3LWFA

Crystal structure of putative transcriptional regulator (np_470886.1) from listeria innocua at 2.06 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
144
structure length
144
Chain Sequence
YFQGMKITTKGRYGLTITLELAKRIGDGPISLRSIAQDKNLSEHYLEQLIGPLRNAGIVKSIRGAHGGYVLNGDPEKITAGDIIRTLEGPIVLVESMEDEEAAQRELWTRMRNAVRDVLDQTTLSDLLKHSTDSELTDGYMFYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Crystal structure of Putative transcriptional regulator (NP_470886.1) from LISTERIA INNOCUA at 2.06 A resolution
rcsb
source organism Listeria innocua
molecule tags Transcription regulator
total genus 38
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lwfA01
1G3TA 2J5PA 4N0BA 1IXRC 3ROUA 1MDMB 1U2WA 3GFMA 3TO7A 1EH8A 2IVMA 2DLLA 3LWFA 2XRNA 1FLIA 4AWXB 2KIUA 2A6HF 1ON2A 1SMTA 1W5TA 4KMUX 5FFZA 1O7FA 1OR7A 2IPQX 1DUXC 5E1ZB 1S6LA 5J6XA 5AIQA 1GHCA 2DPUA 4BYYA 2HTSA 5HLHA 4OMZA 2Z99A 4HZFA 2RNJA 1SFUA 4FX4A 2WC2A 1EV7A 2VT2A 3K1MA 1TLHB 1U6GA 2D1VA 1KGSA 4EJVA 5D5VB 1XDUA 2V9VA 3MCZA 3WTVC 5DYMA 2V6CA 2Y75A 1TNSA 1KQ0A 4I02A 3HTSB 3HIFA 4OIOF 1KU9A 5LLQA 3JSPA 2E1NA 1BJAA 1ZHFA 1STZA 4MNUA 2XAJA 2ISYA 3WU0A 2QQ9A 3PQJA 3K1PA 3VOEA 4ZYEA 1D3YA 3I59B 4HF0A 1CF7A 2FXAA 4L9NA 2DQLA 3BROA 1FSEA 4WF2A 3L7WA 1P4XA 1R1VA 4JQFA 2RDPA 1T6SA 4CDGA 2VE8A 2DI3A 3F8CA 1U3EM 1KU3A 4KIGA 5FD5A 4BH9A 2MLGA 2G7HA 1HKQA 3F3XA 3KLOA 1J9IA 1U5TA 3DV8A 1OYIA 5E1XA 2W24A 3VEPA 3MQ0A 5HDKA 2EA4A 4KIBA 4O5VA 2HYFA 3WTUC 4OIQF 4B09A 3DFGA 3RDIA 5FLXZ 5FLXK 5LRSA 5CVIA 5EEGA 2H6CA 3O6BB 1KU7A 4UV8A 5K1YA 2EV5A 2OU2A 1DPRA 2R7FA 5H6QA 4LLLA 2L01A 2Q2EA 3GLXA 5IT3A 2QBYB 2BEOA 1RUNA 4KNYA 2NYXA 2RN7A 4CICA 3KZYA 3FXRA 3HRTA 3VFZA 3ECOA 3KEOA 2M87A 4BXUA 5BMZA 1X3UA 3HOSA 3L9FA 1HKSA 4A12A 5JFRA 1ONVA 3KLNA 2VOPA 2XGXA 3E5UA 3JSOA 4NHJA 4CGZA 1T98A 2KIFA 2ETHA 3BPVA 3IKTA 3G73A 1R58A 5HOOA 3E6DA 4EM1A 2DO7A 2K86A 4KIFA 5ICFA 2GXBA 3HTUA 4G7ZF 4OOIA 4YFKF 4MTDA 5J8FA 4ZYHA 3C18A 2W57A 2L3DA 3HRSA 4HDVA 3Q5FA 2WV0A 3WTXC 2HOEA 2XVCA 4XSXF 4WXDA 5IT9K 5CVRA 3EETA 4UVCA 4EM0B 2L54A 1F9NA 3SZTA 3KCCA 1FC3A 1Z91A 2XROA 3F22A 2P4WA 3I58A 2W25A 1Y0UA 4DQ2A 4NQWA 3RYRA 3P9CA 4WX9A 2K4JA 4Y13A 2IJLA 3AAFA 3E6BA 3HYIA 1ZN2A 1VTNC 3HUGA 3GZ6A 1AOYA 4WK8F 3JW4A 4OU0A 2P7VB 4KT5C 2JPBA 4KN4X 4RAZA 1H9TA 4OINF 2MH2A 3RJPA 2FRHA 4IRHA 1YS7A 2K4BA 4L9TA 1CF7B 5E18F 3I54A 2ZNYA 1Z6RA 3SFZA 1SD6A 3J80Z 3J80K 3N97A 1T38A 5HLGA 4M9ZA 5TJJA 1SMYF 5CYVA 5E17F 3V4GA 3MWMA 4MHGA 3DPLC 3IC7A 2GQQA 4U88A 3M1EA 1U5TB 3GW2A 5LHIA 1YIOA 2EFNA 4ESJA 2P6TA 4M9XA 4L0YB 4NB5A 1S7OA 4AD9A 5JVTA 2BGCA 3ELKA 1FBUA 1TW3A 1W5SA 1BIBA 4HX8A 3P9KA 1PP8F 1K6OA 3GFJA 2IA1A 1ZREA 5AIPA 1R22A 1JXSA 3CUQA 1GVJA 2PFBA 4GGGA 4LK1F 1YG2A 4PGHA 2M45A 1UHWA 1V3FA 2PN6A 3K0LA 4P9FA 5L3DA 2LF7A 3EDPA 3L2CA 4HQMA 3HRMA 3L00A 2DAOA 1LQ1A 2EB7A 5CJ9A 4U0WA 2X0LA 2A68F 1F5TA 2QZ8A 2QQBA 4EV0A 3ZMDA 5HDGA 1G6NA 2OA4A 3RKYA 1BM9A 1XGMA 1HKTA 4QLCU 2ESNA 5E1WA 2GAUA 3KP5A 2E7WA 3CTAA 2QENA 3I71A 4IPAA 2P8TA 2DW4A 5BPDA 2CYYA 1YS6A 2FA5A 1FYKA 1ZAOA 1ZLJA 3GO5A 1HSJA 3WG9A 3Q9VA 4G7HF 4P9UA 5CVJA 1DP7P 3CO6C 4GYGA 2JSCA 3PQKA 2O8XA 1PP7U 1OMIA 5LEJA 4EVIA 2F2EA 2QLZA 2Y0MA 3F72A 1YO5C 1R36A 1KYWA 2QVOA 3LQQA 4WXHA 3OOPA 1ON1A 1OPCA 3HHGA 2YPRA 4A6EA 2F5DA 3F8MA 3KZZA 1YW9A 2RC4A 3ZMVA 2KKOA 4HYEA 4IVNA 4EJOA 1YQAA 2A61A 4BHPA 1FY7A 3ZN0A 3O3KA 1V4RA 2OZ6A 3W6JB 5E20A 2Z9OA 3V7CA 4S04A 2E1CA 1IXCA 4KFCA 3CUQC 4M74A 1BI0A 4EQQA 3DKWA 2UZKA 3HRUA 2CO5A 3U2RA 4LFUA 2ZXJA 3R4KA 3DQVC 3KEQA 5ICGA 3E6CC 3HOTA 1XN7A 1K78A 1YYVA 1E17A 3WTTC 3OV8A 5D4RA 1MD0A 1J59A 2GWRA 4HX7A 5F1RA 3IHUA 4KICA 5HLIA 1YW8A 4KUMA 3O2PE 2UWMA 1D8JA 2XV4S 1YW7A 2ZKZA 3CDHA 1ZARA 4UUVA 2D45A 3F8FA 2M1BA 2KJCA 3GXOA 1FPQA 1IN5A 1FT9A 5J8CA 1P92A 4KMFA 4U0VA 3HHHA 3FMQA 4WXCA 1XDSA 3CUQB 4GO1A 5D6FA 5BPIA 5F6FA 4S05A 4LB6B 5ERIA 2XAHA 2NS0A 5LGUA 2MA3A 1JHHA 1A04A 2NRAC 2EFOA 2O03A 1H0MA 2RGVA 1LEBA 3IKVA 4CO8A 2GZWA 5ICEA 2Q8KA 2XASA 5DV5A 2OQRA 3F8BA 3TOBA 1F1ZA 1G3WA 3QAHA 4UVBA 4I2OA 1P4WA 2Z3YA 2OBPA 2KIMA 2MBFA 5LHHA 3EQLF 3ZPLA 4A0YA 2HQRA 1Z7UA 3R61A 4FHTA 1BI3A 3GVAA 4RGSA 3V8LA 4R8HA 3TQNA 3N4MA 5HS9A 1W7PA 1ZH5A 1MKMA 4AIKA 3GWZA 4OMYA 2Z5UA 4I7HA 4MEYF 3M9AA 1WRJA 4ZH4F 3V7RA 5L3BA 1B6AA 4OIRF 2BE5F 1XSVA 3H3ZA 3WTZA 3CLOA 3FX3A 4L9JA 2C6YA 2ESHA 2M5WA 1IW7F 2F5EA 2VODA 4ZYDA 2MLKA 4XRFA 3U1DA 5CVUA 4G6DA 1W7PD 3BOQA 2IRFG 4N9HA 1RIOH 3KP4A 5L3CA 4YFNF 4GYIA 2ZO4A 3RI4A 2P5KA 1FZPB 2P6SA 2LSOA 2H94A 5LEKA 1BI1A 5LGTA 5DUKA 4ZZLA 5ED4A 2QQAA 3QRFF 3FM3A 3JAMZ 3JAMK 1IZ1A 3V8JA 3M8FA 4PCQA 2ZJ2A 4R1HA 3I64A 2DQRA 4ZZDA 4FX0A 1ZYRF 2A69F 2A07F 4RB1A 4MEXF 3R0AA 2CW0F 4RAYA 1G4DA 2D1HA 5ILVA 4BHBA 2L02A 1S8NA 4UNOA 3C1DA 3G3ZA 3BP8A 1K78B 4FT8A 4G6QA 4A0ZA 4RGXA 2DU9A 1FWZA 1ZGJA 3I0TA 2PBIA 4KA4A 2ISZA 5AONA 1WKMA 1I1SA 2V1XA 4ASNA 4M71A 1SD5A 4HW0A 1D8KA 5CLSA 5IT9Z 5FGMA 4L9VA 2O0YA 3F6OA 2IT0A 1IUYA 3EUHA 3W6KB 1J0RA 3ISPA 2RQPA 3IWZA 3CUOA 2XKPA 1ZG1A 2H6BA 1RZ4A 4G94A 4MTEA 2ELHA 2KRFA 4YG2F 2QWWA 3V7SA 3E5XA 1P4AA 1U5TC 4U0YA 3QPTA 3NQOA 2LDUA 3RYPA 1XCBA 4EJWA 1K79A 1DPUA 4AIHA 1WQ2A 1HBXG 1ZRCA 1W4MA 3BJAA 4O3MA 5DEQA 3U9GA 1TQMA 1UB9A 4AIJA 3DF8A 2OQGA 2RV8A 3QU3A 4UXNA 4EMSA 2CG4A 2DT5A 2UXNA 3HSFA 1R00A 2XIGA 3LA3A 2EWNA 1R7JA 5DDGA 4I0AA 1FOKA 2QYOA 1QNTA 3I53A 4U7BA 2ZNZA 1SAXA 3GEZA 1W7PB 1J5YA 4JK1X 3SHFA 1XGNA 2R7DA 2HTJA 3VODA 1LEAA 4WCGA 1KQ8A 1USTA 1ZG3A 2JPCA 2MH9A 2ZMEA 1QBJA 5H20A 1PUEE 3IWFA 2A6EF 5HS7A 4P5OA 2IA0A 5L3FA 2DPDA 4A6DA 3DP7A 3FXQA 3BJOA 3TO6A 3KE2A 5D5WB 1IN4A 2HKOA 3COAC 1LNWA 4RB3C 4M72A 3NEUA 5E8GA 2LKPA 4A5MA 5D5XB 5DD4A 2PG4A 3P7NA 3SZPA 1XSXA 4TV7A 2ZFWA 4EM2A 4MGRA 4KN7X 4JBAA 3R6SA 1MJBA 4GCVA 4K2EA 3QU6A 1ZG5A 2EA2A 3GZ5A 4LB5A 5D5UB 1MGTA 2EFPA 3WE3A 4B8XA 3BJ6A 3FMRA 3ZQ7A 4RB0A 3ZMUA 1R5HA 2YSRA 3K69A 1IXSB 2YX7A 3IRRA 1TQPA 5FO5A 2G9WA 2FSWA 3QP6A 1BC8C 1QGPA 4IRIA 3FF5A 2HGCA 3TOAA 1HQCA 4HLXA 5K5QA 4I98B 2CGPA 2XAQA 5ICCA 1B1BA 2FNPA 2JT1A 1XGOA 1O3TA 3TDZC 4H0EA 2LF8A 2AXLA 1MJAA 2EFQA 4OIPF 5BOXA 2YU3A 1BIAA 2FBIA 3QP5A 2GIVA 2W85A 4L5IA 4HBLA 2DTRA 4LK0F 4E70A 2YX4A 1QZZA 3C7JA 1GXQA 2J5OA 5JHUA 2ZBKA 3DXJF 4ENMA 5FB2A 2HWVA 4GXOA 2HQNA 3WTYC 1XD7A 3I5UA 3LSTA 4HA8A 4L18B 3GFLA 4KYWA 1HW2A 1TTYA 1USSA 1J2XA 2BYVE 4LG0A 1R1UA 3KETA 2FMLA 1EH7A 4ENKA 4F7ZA 1I1GA 4AVPA 4D0PA 3P9IA 2XHKA 1NHAA 4CZZA 4EJUA 3LA2A 4A5NA 4ENNA 4IHTA 3K9TA 3FXUA 3MZHA 4RGRA 2R3SA 3I4PA 3FHZA 1S3JA 4BHCA 5FFXA 2H27A 4PZJA 2HYGD 2G7UA 1R23A 3SXYA 1F4KA 5E8IA 2PMHA 3KP2A 3WGGA 1MJ9A 3M8EA 4HLYA 4M9SA 3J81Z 3J81K 3WODF 2P5LC 4G7OF 4QWQA 4HAMA 5EEHA 2K02A 1P2FA 1RUOA 3GYHX 3CO7C 2ZMEB 5D8KB 4BQAA 2COMA 5LHGA 1OYYA 2Y48A 3BZ6A 1SD7A 5ILSA 3MAJA 2FE3A 2QM3A 1S7AA 4KDPA 1KU2A 1UCRA 2FNAA 3TDUC 2VBWA 3ZN1A 1I5ZA 3REOA 1I6XA 3IL2A 2ADUA 1Z9CA 5FD6A 1XGSA 3T0YA 4EGZA 3BPXA 2RKHA 4BAYA 3F8NA 1OYWA 1TW2A 5KK1A 5L3GA 2VONA 4HQEA 4Y15A 3ZMTA 2FMYA 2DK8A 3PFIA 3R0JA 2TDXA 5A2QZ 1BN5A 5DUIA 5A2QK 2STTA 4Q5SF 3T1BA 3ERED 1L3LA 1IN6A 3LAJA 1B4AA 1FP2A 2EFWA 4DNCA 2HEOA 1WWXA 1T2KA 2HDCA 2EJRA 3BDDA 4HV6A 1R5GA 1D5VA 2E7XA 1TQIA 1Q1HA 4Q4ZF 2IP2A 4ZYGA 1SFXA 1XSDA 1ZLKA 4CYDA 3HSEA 3JTGA 1S29A 4Z2YA 2FEZA 3KP7A 3E97A 3H3UA 3TO9A 2UXXA 2GXGA 3MFKA 2HZTA 2OZUA 5KVRA 2VT3A 1OKRA 1FBQA 2BBYA 3E6MA 2BV6A 2XAFA 2ACJA 3GUDA 4EGYA 3QPHA 1IN7A 2V79A 1FNNA 3ML6A 3S2WA 5HS8A 1WI9A 2FF4A 2F5CA 2NAZA 1WSUA 2PJPA 4M6XA 1GXPA 2HFHA 2P5VA 1XMKA 2CWEA 5D6EA 4LG0B 1HSTA 1DDNA 1B9NA 4P55A 2DFIA 2HS5A 3ULQB 3RPUA 1LJ9A 2H09A 1Z6TA 5D4SA 2NNYA 3VB2A 3EYYA 3LA7A 1BC7C 1XMAA 5K5RA 3K1NA 4RGUA 4PGGA 2RVCA 3HSRA 5DD8A 3ABTA 1G3YA 1BBYA 1FYLA 3R60A 4CHUA 3E3VA 2VOOA 3MZYA 1J7KA 3RTRA 2F5FA 2HKXA 3QOPA 3FM5A 2DBBA 4Q47A 4YIIA 2L4AA 2AS5F 2FOKA 5HVQC 1IAWA 1IRGA 5DCFA 2YR2A 1I27A 2A5YB 1EH6A 4I0BA 3K2ZA 4UVAA 2XUBA 2M8EA 1UHMA 1TNTA 2W84A 3J7AO 1IRFA 2GA2A 4I01A 4ESBA 3JTHA 1H9GA 2PMUA 3WGIA 2XAGA 4IJAA 4RS8A 1C0WA 1Z1DA 1JE8A 3ABUA 2CFXA 3FWEA 1QQIA 1ZRFA 3H92A 4L5JA 1UFMA 1B9MA 6PAXA 4P96A 2VXZA 5DCMA 1JGSA 2VBXA 1O57A 4IRGA 1LDDA 1P6RA 2D2WA 1L0OC 4Y17A 2MD5A 2LNBA 3SQNA 4G8XA 4O6JA 3GFIA 3IRQA 2O3FA 1E2XA 2OD5A 2L4MA 3B73A 4IF4A 3T5XA 1ZGAA 2JTVA 2VE9A 4MQ9F 4ETSA 1QZYA 1G3SA 4LLGF 1T0FA 2WTEA 4XBFA 3LFKA 2NNNA 1TBXA 3TGNA 4ENJA 4A0XA 3ZMZA 3ECHA 1SFEA 3WU1B 4EJTA 3Q9SA 3D5LA 1FYMA 5F64A 4HF2A 2Q0OA 2KJBA 4Q48A 2PQ8A 2VC1A 3F21A 2O6GE 4G9YA 5LRRA 4N9IA 1T39A 2CSOA 3B02A 1MDMA 1FP1D 2P7CB 2B0LA 4XSZF 4M73A 1YFHA 4R79A 2EV6A 3WTSC 3ZMSA 3GF2A 4LJZF 1MZBA 1AWCA 4PDKA 1U8RA 3BY6A 4ESFA 5BQTA 2CQKA 1KYZA 3RIRA 3ZP5A 1B59A 5D8LB 5BS6A 3CJNA 3RPQA 4YFXF 2V1DA 3NRVA 3TKYA 1Z05A 2PLYA 1ZRDA 1IN8A 3MEXA 2VC0A 1LDJA 4MQVA 4UV9A 3WE2A 1KQ9A 1SD4A 2GA1A 2VBYA 4YIFA 2MC3A 3L09A 2Z33A 4LMYA 2HR3A 2IA2A 5HDNA 4I09A 1BI2A 1QO0D 2XKOA 3LQRA 2IW5A 5K5OA 2PI0A 3WGHA 1CGPA 5ILUA 3E5QA 3FMSA 4BNCA 5L3EA 2EK5A 1YLFA 4HDUA 3M7GA 1PDNC 4RB2C 2DK5A 3T8RA 1O7LA 1REPC 4CXFA 1J75A 1FSHA 2EV0A 3F6VA 3LAPA 3V8KA 2ZCWA 3I59A 2JZYA 4A2UA 1HXDA 1JHFA 2JRTA 5LGNA 4HV5A 1IF1A 2M30A 4ON0A 2FBHA 4HOBA 3F23A 3DEUA 4WWCA 1FBSA 5TRDA 3BWGA 1O3RA 3C3WA 2V1UA 1KA8A 1R1TA 4LLNA 2VN2A 1ULYA 5H6RA 1ODDA 4LGWA 1QPMA 1O3QA 3GX4X 2WWYA 2X4HA 3RKWA 4UHTA 4U7DA 1RNLA 3RKXA 3EYIA 3KP3A 3FZVA 1LB2A 5DCMB 1FX7A 4IHSA 4XLPF 2QBYA 4LD5A 2OAZA 3KP6A 5CVVA 1XB4A 4L0ZB 2VBZA 2QUFA 1O3SA 5JR3A 4M6YA 3D0SA 5JI6A 5LBQA 3DPTA 1K7AA 2K27A 2FU4A 4XLNF 3WTWC 1HW1A 4HF1A 2STWA 1RI7A 3KFWX 2O61A 2PEXA 4HX4A 2FBKA 2A3SA 2FQ3A 1HW5A 1YTYA 1BOAA 2K7LA 1U78A 1XCVA 1LDKB 1LVAA 3T8TA 4IXAA
chains in the Genus database with same CATH superfamily
1G3TA 4QSHA 1UMQA 1I6HJ 1T08B 2J5PA 1W36C 3F0CA 1PVEA 2EINH 4N0BA 1IXRC 4IQ4A 3BG6A 3LMMA 3ROUA 4AYBN 1MDMB 5EJCA 1U2WA 3GBGA 2JN6A 3GFMA 4OWRB 3TO7A 1EH8A 2IVMA 5B1AH 2DLLA 1SFOJ 5IOZA 3LWFA 1FOXA 2XRNA 1FLIA 4AWXB 2HPMA 2KIUA 3BZKA 2A6HF 3OS2A 4IHXA 1RR8C 1ON2A 1SMTA 3HOXJ 3FBIB 3IH3A 2JA2A 4JP0A 3LNQA 1W5TA 4KMUX 5FFZA 1O7FA 1OR7A 2IPQX 4FISA 1DUXC 1I3AA 2KQRA 4BY1J 2QEXI 5E1ZB 5DM6F 3S15J 5C44J 1S6LA 5J6XA 1IGNA 3SDBA 1VQ7I 5AIQA 1GHCA 2DPUA 2X85A 1TWAJ 4BYYA 1JKPC 2HTSA 3B6CA 3DCFA 1HLVA 1E3PA 1SAUA 5HLHA 1V55H 3K7AJ 1MBKA 4OMZA 2Z99A 3D5SC 4HZFA 2RNJA 1SFUA 3VSLA 3HOVJ 4FX4A 2WC2A 3OOUA 1EV7A 2VT2A 2E71A 2HDDA 3GMEA 3K1MA 2M7BA 1TLHB 1FIAA 3K10A 1JT6A 1U6GA 2D1VA 2DA1A 3FXKA 2OC6A 1KGSA 4EJVA 5D5VB 1XDUA 2V9VA 3MMYB 3MCZA 3WTVC 5DYMA 2V6CA 2Y75A 1TNSA 3M3YJ 1KQ0A 4I02A 4C2MJ 3OYKA 2WAFA 5K7FA 4CCKA 4HG2A 1WJCA 2AQEA 3HIFA 1HDDC 3HTSB 4OIOF 3GTOJ 1KU9A 4M3GA 5LLQA 3JSPA 2E1NA 2LREA 1BJAA 1ZHFA 1STZA 4MNUA 1PUFB 2XAJA 2ISYA 3WU0A 2QQ9A 3PQJA 1G8XA 3K1PA 3VOEA 4ZYEA 4NC6A 2A5WA 1D3YA 3I59B 4HF0A 2XSDC 1CF7A 2FXAA 4L9NA 1H88C 1X2MA 2DQLA 1ITYA 3BROA 1FSEA 4HNTA 2CUZA 4WF2A 3L7WA 3ESWB 1P4XA 5F27A 1R1VA 4JQFA 2F4OB 2RDPA 1T6SA 2NS8A 5FKNA 2CMPA 2LG4A 2MGQA 4CDGA 2VE8A 2IS2A 2DI3A 3F8CA 3K4CA 1U3EM 1KU3A 3FXOA 3ZOBA 4KIGA 5FD5A 4BH9A 2MLGA 2G7HA 1HKQA 3F3XA 3KLOA 1J9IA 1U5TA 2W4SA 3DV8A 1OYIA 5E1XA 1JI8A 1Y6IA 5GTHC 3BR2A 2W24A 2R93J 1XTAA 4RDUA 4XLEA 3GTGJ 2UV1A 3VEPA 4C3IJ 3ZQFA 3MQ0A 5HDKA 2EA4A 4KIBA 4O5VA 2EZKA 2ICWG 1Z3YA 2HYFA 3WTUC 4OIQF 4B09A 2A6TA 3DFGA 3RDIA 5J1YA 4V2FA 5FLXZ 5FLXK 3RSNA 5LRSA 3BG3A 5CVIA 5EEGA 1UG2A 2H6CA 2HDWA 3H36A 2DCEA 2X48A 4XL9A 3O6BB 1KU7A 3W6VA 2WADA 3WHCA 1X1DA 1EA3A 4UV8A 1ZK8A 5K1YA 2EV5A 2FX0A 2OU2A 4J00A 1FEXA 1DPRA 3KIOA 2R7FA 5H6QA 4LLLA 2L01A 2Q2EA 1D0ZA 1SEUA 3GLXA 2R5YB 5IT3A 1YX3A 2QBYB 4C3HJ 2BEOA 1RUNA 2K9NA 2X1DA 2NYXA 4KNYA 2RN7A 4CICA 3KZYA 1T8IA 3FXRA 1FMWA 1V5FA 5E3NA 5M3FJ 4XLCA 2NS7A 3HRTA 3VFZA 4AIDA 5KAFC 2B63J 2XC7A 4GFBA 3ECOA 3KEOA 2M87A 3MVPA 1S7EA 2R5ZB 4BXUA 5BMZA 1X3UA 2KLOA 1Y39A 3PUBA 1Y8QB 4UB6C 3HOSA 3L9FA 2NVUB 1HKSA 4A12A 3ZR8X 3HC7A 5JFRA 1ONVA 3GTKJ 2L0KA 3RZDJ 1LE8B 3KLNA 2VOPA 2XGXA 5B5EC 3E5UA 3IV5A 1B72B 3JSOA 4NHJA 4CGZA 4LITA 3KYCB 1T98A 4MFEA 3HKZA 1MMNA 2HOAA 2ECBA 4QPOA 2KIFA 2R7ZJ 2F5VA 4XK4A 2ETHA 1LUJB 3QODA 3BPVA 3WHBA 3IKTA 3G73A 1R58A 5HOOA 1K61A 4XRSA 3E6DA 3SEZA 4JX6A 2VQGA 4EM1A 2DO7A 2K86A 4KIFA 4J19A 5ICFA 2GXBA 3K4MA 2NVQJ 3HTUA 4G7ZF 5IPAA 4OOIA 1ZTRA 4YFKF 3BQZA 4N4OB 3BR1A 1UJ8A 1N75A 4IHVA 5KNLA 4MTDA 2XF6A 4ZYHA 2HI3A 5J8FA 3Q0UA 4A3KJ 3C18A 2W57A 3VPRA 3HM5A 2L3DA 1DQUA 3HRSA 3M07A 3CCYA 3PNTA 1JUMA 4HDVA 2DMQA 3Q5FA 1YHQI 4RM2A 2WV0A 3OS0A 3WTXC 2HOEA 2XVCA 3S1RJ 4XSXF 4WXDA 5IT9K 2KT0A 4KJZA 4BBRJ 5CVRA 3EETA 4UVCA 4IOCF 4EM0B 3LSJA 3UKGA 2L54A 2Y9YA 1F9NA 4RLQA 4I76A 2R7QA 3QYBA 2WB1A 1CQTA 3S32A 1WJDA 1R71A 2KDOA 2B9SA 2BVMA 1LFPA 3SZTA 3KCCA 1FC3A 3HEFA 1Z91A 2XROA 3F22A 2P4WA 3I58A 4IOAF 3MKYB 3IP4B 2W25A 4U87A 2IGKA 2M4GA 1Y0UA 3RCOA 4DQ2A 1XC5A 4NQWA 5E3LA 4DYQA 3RYRA 3P9CA 4WX9A 2K4JA 5EZHA 4Y13A 2CW8A 2IJLA 3U21A 3E6BA 3AAFA 3HYIA 2QA4I 4PJLA 1T33A 1ZN2A 3CQZJ 1VTNC 3HUGA 4D5FA 3GZ6A 1AOYA 2E2IJ 4WK8F 1MBFA 1FOYA 2HVSA 3JW4A 4OU0A 2ELKA 2P7VB 4KT5C 2JPBA 4KN4X 3J7AY 4RAZA 5FROA 3S14J 3FXJA 1H9TA 3FDYA 1QPIA 3LSKA 3QWLA 4OINF 4CUGA 4ABZA 2OPTA 1VF9A 2MH2A 1Y56A 3RJPA 2FRHA 4IRHA 3Q3SA 1BOBA 2ZJPF 1YS7A 2A05A 2K4BA 2DXIA 4L9TA 1CF7B 4Y4RA 5E18F 2K9SA 5J3LA 3NAUA 2O5RA 4DYRA 3I54A 4UB8C 2ZNYA 1Z6RA 3SFZA 1SD6A 2Y0SA 3J80K 3J80Z 2LVSA 2DMTA 3N97A 1T38A 3WG7H 4Y52J 3PIPF 5HLGA 4M9ZA 2GOXB 5TJJA 3I4MJ 1SMYF 1TT5B 5CYVA 1XMXA 5E17F 3V4GA 4A3JJ 3DTKA 3MWMA 4MHGA 3DPLC 3JR9A 2GOMA 3IC7A 3TBIA 2GQQA 4PSWA 4U88A 3M1EA 1U5TB 2DJNA 1VQPI 1TWCJ 3JRGA 3CJQB 1RC9A 3GW2A 5LHIA 4A3BJ 3BTCA 1XG1A 3G1LA 1YIOA 2EFNA 3JRAA 4ESJA 1I3QJ 2LR8A 2P6TA 4M9XA 4L0YB 2Y31A 1F43A 2KPMA 4NB5A 1S7OA 4AD9A 4DIQA 2BGCA 5JVTA 2V26A 3ELKA 3CCVI 5GPCA 1FBUA 1TW3A 1W5SA 1BIBA 4HX8A 2E1OA 2ZXHA 2BXZA 3P9KA 4XRMA 2DYRH 2E2JJ 1PP8F 1Z77A 1K6YA 2N8GA 2VXDA 3Q0VA 1K6OA 1VI0A 3GFJA 2IA1A 2Q2EB 2WAQA 3O8GA 2TCTA 1QA6A 1ZELA 1IUFA 1ZREA 5AIPA 4ZTFA 3JRFA 4FQGA 2HVRA 3CESA 3OYAA 3OYJA 1R22A 1JXSA 2F6CA 1MH4A 3CUQA 3JRHA 5CQEA 4JX5A 1GVJA 2PFBA 4HSRA 3E1SA 1VQ4I 2Z16A 4GGGA 3RQIA 5CKTA 5EDNA 4LK1F 1YG2A 3CP2A 4PGHA 2M45A 1UHWA 1V3FA 3FIWA 2PN6A 3H5NA 3K0LA 4P9FA 3VYRB 5L3DA 2I8DA 2LF7A 3EDPA 3L2CA 2XGEA 4ZDLA 2W1OA 4HQMA 2KDZA 2JSPA 2QKMB 4A3FJ 4ZTJA 3HRMA 3L00A 2DAOA 3BCBA 1LQ1A 2EB7A 2H8WA 5FKOA 5CJ9A 4U0WA 1FOWA 2F48A 2X0LA 4BGDA 2A68F 3JREA 1F5TA 2K85A 2QZ8A 2QQBA 5GPAA 3FHNA 4EV0A 1MBGA 3QPSA 3QYEA 4XKWA 2TRTA 2JA5J 3ZMDA 2IS4A 5HDGA 1ZR4A 2X6WA 1G6NA 3S8PA 2OA4A 1IV6A 3RKYA 2R92J 1BM9A 1XGMA 4M3BA 1HKTA 4QLCU 2ESNA 5E1WA 2M4KA 2GAUA 3KP5A 4CCLA 2E7WA 3CTAA 1IO2A 4HRIA 1RRJA 2LTPA 2QENA 3I71A 2P8TA 4IPAA 2FUG2 2K3PA 2DW4A 5BPDA 3WU2C 2PJRB 1NG7A 2CYYA 1YS6A 2FA5A 1FYKA 1X3ZB 2W82A 3NARA 1ZAOA 3CMAI 3G1OA 3ERMA 3HKZN 4B3AA 3D1NI 1ZLJA 1MMGA 2BY0A 1BJZA 1T0FC 1HSJA 3GO5A 4L5EA 3WG9A 3Q9VA 4FCYA 2IS6A 5J4YA 4EEFG 4G7HF 4P9UA 4PJMA 3OL4A 5CVJA 2CV1A 4MIMA 3ZQQA 1DP7P 3CO6C 4GYGA 2JSCA 3PQKA 2O8XA 1PP7U 1OMIA 5LEJA 4EVIA 3AL0C 1OLTA 2CU7A 2F2EA 2I10A 2O9LA 4F52A 2DDBA 5K7ZA 3OS1A 2QLZA 2Y0MA 3F72A 1E0EA 1YO5C 5IP9J 1JT0A 2JQ7A 2G0EA 1R36A 1KYWA 2QVOA 2JVHA 3H0GJ 3K4LA 3PSFA 3MKZA 2YS9A 3LQQA 4WXHA 3OOPA 2PMZA 3HBLA 4PK4A 1ON1A 4I6ZA 1OPCA 1IRXA 3HHGA 3HUGB 2VKEA 1V5GA 2YPRA 2M2EA 1MMAA 3H3VK 1BR2A 2ME6A 4YELA 2LK2A 4A6EA 3HOZJ 3FK7A 3HL2A 2F5DA 2YU9J 3F8MA 3KZZA 3CMEI 2BW3A 2V9KA 1YW9A 2FD5A 2RC4A 4CH7A 4PUSA 3ZMVA 4MO7A 2KKOA 3MKWB 1D0YA 1TL8A 4HYEA 4IVNA 2B7EA 4EJOA 1YQAA 2A61A 4BHPA 4NBQA 1FY7A 3ZN0A 3O3KA 1WFXA 2ME0A 2XB0X 1V4RA 4IZZA 1G59A 2OZ6A 2VQCA 2NVXJ 3W6JB 5E20A 2Z9OA 3V7CA 2E5NA 4S04A 2JA8J 2E1CA 2WY7Q 1IXCA 4BXFA 4KFCA 3CUQC 4M74A 4XM3A 2K9MA 1BI0A 4EQQA 3DKWA 3AL0B 2FJ1A 2UZKA 3HRUA 2CO5A 3U2RA 2LRDA 3OYMA 2HZDA 4LFUA 2ZXJA 4RM3A 4CCMA 3R4KA 3S1QJ 4BY7J 3DQVC 3KEQA 3NWTA 5ICGA 3E6CC 3HOTA 1X4OA 2CUFA 1XN7A 1K78A 1YYVA 1E17A 3CC7I 3WTTC 1QHHD 2VQHA 3OV8A 5D4RA 1MD0A 2KISA 2QQ8A 3PNVA 1J59A 1AKHA 2W7NA 2Y2ZA 2EIJH 2M0CA 3B6AA 3BCAA 2GWRA 3PJRA 2BHZA 3OYNA 5M3MJ 1JKOC 4RLFA 2KL4A 4HX7A 2QF7A 3IHUA 5F1RA 4KICA 3TMOA 1GV5A 1WI3A 1YW8A 5HLIA 4A3LJ 2RQQA 4KUMA 4BJ6C 1P7JA 3CJRB 3O2PE 2NOGA 2UWMA 1D8JA 2Y0SN 4AUXA 2EQRA 2OTJI 2XV4S 1YW7A 2LBFA 2ZKZA 3CDHA 1ZARA 4UUVA 2DFFA 2L2OA 1D1AA 2DN0A 2ZJQF 2D45A 1EJ9A 1U0JA 4C2TA 4QTRA 3F8FA 2M1BA 2KJCA 3GXOA 1FPQA 1IN5A 1N77A 1FT9A 3IAS2 1UG0A 5FLMJ 5J8CA 4BDZA 4BEHA 1P92A 4KMFA 3SFIA 2E36A 4U0VA 3HHHA 3L2QA 3ZGKA 3FMQA 3CMMA 3GTMJ 4AVZA 1BR4A 4WXCA 1QVUA 1XDSA 3TP3A 3CUQB 4GO1A 5D6FA 2BHYA 4BL0B 5BPIA 4OAYA 5F6FA 1ETXA 2V9PA 4S05A 1QVTA 4LB6B 1VQMI 2DMPA 5ERIA 4HEA2 4II2A 3ASNH 3OYFA 1TT0A 3U1KA 1ETKA 2XAHA 2NS0A 5LGUA 1JJ6C 4XN0A 2MA3A 2KZVA 1JHHA 4XLAA 1RPWA 1A04A 4M3DA 2NRAC 2EFOA 3S2DJ 2O03A 1MBHA 1H0MA 2RGVA 1LEBA 3IKVA 4CO8A 5KAIC 2RAEA 2GZWA 4UY8I 3HPGA 2Q8KA 5ICEA 2XASA 5DV5A 3K70C 2OQRA 1ZKGA 3F8BA 1SANA 3A0BC 5K7HA 3TOBA 3L2RA 3JCUC 1F1ZA 1G3WA 3QAHA 4UVBA 2OJED 4I2OA 1P4WA 2Z3YA 2OBPA 2KIMA 2MBFA 4A93J 1VQ5I 4NC7A 3A1YA 5LHHA 3E7LA 3EQLF 3ZPLA 4A0YA 5BNGA 2HQRA 4ZDOA 1Z7UA 2V4JC 3R61A 4W97A 4FHTA 3S1NJ 4ANJA 1BI3A 2HOTA 3GVAA 4RGSA 1T56A 3V8LA 2VKHA 2KZGA 2DA3A 4R8HA 3TQNA 4DYCA 3N4MA 3BT9A 1TWHJ 4JX4A 5HS9A 1W7PA 4KITB 1ZH5A 1MKMA 4AIKA 5EZGA 1P7IA 3GWZA 5H2FC 2CJJA 4OMYA 1X4PA 5IP7J 1H8AC 3M8JA 2Z5UA 4I7HA 1BA5A 1JUPA 3OR1C 4QIWN 2JMWA 4MEYF 4E7JA 1YJNI 3M9AA 2NXNB 1WRJA 5F08A 2ZJRF 4ZH4F 1XX5A 1W0UA 2XSJC 3V7RA 5L3BA 2V6EA 1B6AA 1HC8A 2GM4A 4OIRF 2EILH 2BE5F 4YEJA 2XRLA 4NDLA 1XSVA 1OCZH 4CCOA 3H3ZA 3WTZA 4Z6YA 3CLOA 2IBDA 2XPWA 4D1QA 4D7MA 1X58A 3FX3A 1RKTA 2AQFA 2VIXA 4L9JA 2C6YA 5LD2C 1VQ8I 2DMUA 2ESHA 2M5WA 1OJLA 1IW7F 1DU0A 2F5EA 3H0DA 2VODA 1WZ2A 1U9NA 5EEAA 4ZYDA 5E3OA 4BUPA 2R7XA 2MLKA 2DJIA 1E3HA 3S16J 1UHSA 4XRFA 1OCRH 5CVUA 3U1DA 4G6DA 1W7PD 2OV7A 2XPVA 1ZQ3P 3HOYJ 3BOQA 3MZ8A 2CQQA 2IRFG 1GDTA 5GADJ 4N9HA 1RIOH 2Y30A 3FBNB 3H5RA 3KP4A 1GUUA 1SVMA 3D5RC 5L3CA 4YFNF 3DU5A 4GYIA 3OSFA 1MMSA 2ZO4A 3OYDA 2BW3B 3RI4A 3G71I 2E2HJ 2P5KA 1FZPB 2BY3A 3AG1H 2DYSH 2LSOA 2P6SA 2H94A 3CCMI 5LEKA 4YIRX 1BI1A 1OR7C 3H9JA 4DBRA 5LGTA 5DUKA 4ZZLA 5ED4A 2DA7A 2QQAA 3QRFF 3FM3A 1V5EA 3JAMZ 3JAMK 1IZ1A 3V8JA 3M8FA 4PCQA 2ZJ2A 4R1HA 3I64A 4II3A 1NH3A 3HZJA 5M5YJ 5FLVA 2DQRA 4ZZDA 4FX0A 1ZYRF 5F0HA 2E1MB 3DU6A 2A69F 4AU7A 2A07F 4RB1A 3VYSB 2R7WA 3TW7A 4MEXF 2PMZN 3R0AA 2CW0F 4RAYA 3I56I 1Y1VJ 5B1BH 1G4DA 2D1HA 3OYIA 2M0MA 5ILVA 2QSFX 2ZC2A 1Z0XA 4BHBA 2RREA 3CCJI 2L02A 1S8NA 4UNOA 2CQXA 3C1DA 3G3ZA 4V19K 3F9KA 3BG5A 3BP8A 2QSGX 1IG7A 1T95A 2KFDA 3H9QA 1K78B 2K9QA 4FT8A 4G6QA 4ZC3A 2R7OA 4RGXA 4A0ZA 2DU9A 1FWZA 1DGRM 1ZGJA 3I0TA 1AKHB 5JLWA 2PBIA 4KA4A 2ISZA 1U8BA 4FTHA 5AONA 1WKMA 1VQ6I 5IY5H 2V1XA 4ASNA 1A5JA 4XONA 1I1SA 4PSXA 4M71A 1SD5A 4HW0A 5JVGF 3PO3J 1D8KA 1BW6A 5CLSA 1ETOA 5IT9Z 1X1PA 4JOMA 4L9VA 5FGMA 2VJJA 3S2HJ 2VJ4A 3BC8A 2KP6A 3CC2I 2O0YA 4X6AJ 4ZYAA 3S93A 2LBFB 3F6OA 1NTCA 1POGA 4XQFA 3PO2J 3TL4X 2ZXWH 2IT0A 1IUYA 3EUHA 3W6KB 4XNFA 4XOTA 1J0RA 1JTYA 5J1UA 3ISPA 4HPQA 2RQPA 5TISC 3GTQJ 3IWZA 1MIJA 4NC8A 4A3GJ 3CUOA 2XKPA 1ZG1A 2GBYA 2H6BA 1RZ4A 2VPRA 4G94A 4MTEA 1IDZA 2H1LA 1HCRA 2ELHA 1Z7LA 2KRFA 4YG2F 2QWWA 1F36A 3V7SA 3DEWA 2X6YA 3E5XA 1P4AA 1IJWC 3DBRB 1U5TC 2P0WA 4U0YA 3QPTA 2LY9A 3DBHB 3NQOA 2LDUA 3RYPA 2X6XA 1XCBA 4EJWA 3HXLA 5IYBJ 1K79A 1DPUA 4AIHA 1WQ2A 4AM3A 1Z67A 1HBXG 1ZRCA 1W4MA 4RA2A 2KIQA 3BJAA 3FKIJ 4O3MA 1LVKA 2KRCA 5DEQA 1SVOA 3U9GA 1TQMA 1UB9A 4AIJA 3DF8A 5IYDJ 2OQGA 2XGDA 2RV8A 3QU3A 4UXNA 1EF4A 4EMSA 2CG4A 3OIPA 2DT5A 2UXNA 5TGTA 3HSFA 1R00A 1IV8A 2FOWA 2XIGA 3LA3A 2EWNA 2K5CA 1R7JA 4H4KC 1G2HA 5DDGA 4I0AA 1OCOH 1FOKA 2QYOA 1QNTA 3OYLA 3I53A 4U7BA 2ZNZA 1SAXA 3HGYA 2VASA 3GLLA 5JLXA 2WY8Q 3GEZA 1A35A 3LSIA 1W7PB 4IHWA 3H9GA 1H89C 1J5YA 2DA4A 2QGUA 2L7ZA 2VI6A 2AXTC 3G1MA 4JK1X 3SHFA 1XGNA 2R7DA 2K40A 4B48A 5GTIC 1ZR2A 1S72I 2HTJA 4M6VA 3VODA 2M7AA 1LEAA 3E0JB 4WCGA 2VKVA 1KQ8A 3K4KA 1USTA 4X0GA 3FKJA 1ZG3A 1R9TJ 2JUGA 4CZCA 2JPCA 2MH9A 2R7VA 2ZMEA 1QBJA 5H20A 4FASD 1PUEE 5FRMA 3IWFA 4DJAA 2A6EF 5HS7A 2E60A 3J7YJ 2HXOA 2IA0A 4P5OA 4DZPA 5L3FA 2DPDA 1UAAA 3P5JA 4A6DA 3DP7A 3FXQA 3LSHA 3BJOA 2MW8A 3TO6A 3KE2A 2BVLA 5D5WB 1IN4A 2HKOA 3NWSA 3COAC 1AU7A 1LNWA 4RB3C 4M72A 4E7KA 2KHMA 3NEUA 5E8GA 1QHGA 2JWTA 3VSKA 2LKPA 5F1JA 4A5MA 5D5XB 1VQ9I 2HYJA 4DOZA 3BLYA 5DD4A 2Z1DA 2PG4A 4EATA 5EG0A 1HF0A 1FTTA 3OSGA 3S17J 3P7NA 3SZPA 5J1RA 1XSXA 2RNGA 3QPLA 1JUSA 4TV7A 1HDPA 2ZFWA 1R49A 5FKMA 4EM2A 3K4BA 3ABLH 4MGRA 2IXSA 4KN7X 4JBAA 3R6SA 1MJBA 5LFAA 4IX7A 4GCVA 4K2EA 4D5CA 3QU6A 1DU6A 2DOFA 1ETVA 2Y69H 1ZG5A 2DT6A 2EA2A 3G2BA 3GZ5A 4LB5A 5D5UB 3GTLJ 1HA8A 1GLNA 3AG3H 1MGTA 2EFPA 3CD6I 2IGNA 1X19A 3LSMA 3WE3A 2L9VA 4XKVA 4FE7A 3BJ6A 3FMRA 4B8XA 2HOSA 5J47A 2EZIA 3ZQ7A 4DW6A 4RB0A 3ZMUA 2LKXA 4D9JA 3PNYA 3CCQI 5DS9A 1R5HA 1LFBA 2YSRA 3DTIA 3G4SI 3K69A 1IXSB 2YX7A 3DKYA 3IRRA 1TQPA 3BG7A 4XORA 1MSEC 1I39A 3MD2A 2X6OA 5FO5A 2VQLA 3ABMH 3DEEA 2G9WA 2FSWA 3QP6A 1BC8C 1QGPA 5EGOA 4IRIA 3FF5A 4KT6A 2HGCA 2I5UA 4M3EA 3TOAA 1HQCA 3LL7A 4QPQA 1N78A 5FRNA 4HLXA 5K5QA 4I98B 2CGPA 2XAQA 1ZGWA 1X1AA 5ICCA 2CH0A 2LLKA 1B1BA 2FNPA 2JT1A 1XGOA 1OQYA 1LKXA 1O3TA 3TDZC 4H0EA 1WJFA 2LF8A 4IO9F 3PUFA 5C3EJ 1WH5A 2AXLA 1JGGA 1MJAA 2EFQA 2L5QA 4OIPF 2MD0A 3C2BA 3OMYA 3KPHA 5CPRB 5BOXA 2YU3A 1BIAA 4F91B 2FBIA 3QP5A 2GIVA 2W85A 1W36D 5IYCJ 4L5IA 4BS9A 4HBLA 3H35A 2LP0A 2DTRA 3A02A 4IL6C 1VQKI 2JK3A 4LK0F 4NUBA 2V1NA 4E70A 2YX4A 1RETA 1QZZA 2ZSIB 3CC4I 3C7JA 1FJLA 4DZJA 1GXQA 3EUAA 1O4XA 2J5OA 5JHUA 2ZBKA 3DXJF 2OUMA 4ENMA 4NQWB 5FB2A 3ZQIA 2HWVA 2BOLA 1W0TA 3K4JA 4GXOA 2HQNA 3WTYC 3OYGA 1XD7A 3I5UA 4B47A 3LSTA 4HA8A 4L18B 4Y7NJ 3GFLA 1R4NB 4KYWA 1KZHA 1K4SA 2OF7A 1VQOI 1HW2A 1TTYA 4F3QA 1USSA 5EF6A 1ETQA 4BE2A 2HXIA 1ETWA 2LMDA 1J2XA 1FMVA 2BYVE 4LG0A 2XF7A 1EKEA 2R7UA 1K4TA 1U9OA 3IH2A 2VUMJ 1R1UA 2WB1N 2FMLA 3KETA 1YIJI 3V42A 1NK3P 1EH7A 2DT7B 1X1CA 3SYTA 4ENKA 2HU9A 2JJ7A 4F7ZA 1I1GA 4BE0A 3W2AA 4AVPA 4D0PA 3P9IA 3OYHA 2XHKA 1NHAA 4CZZA 4EJUA 2GXAA 4A3CJ 3LA2A 4A5NA 4ENNA 4IHTA 1YJWI 1BW5A 1FIPA 3K9TA 3ZCOA 3FXUA 2R5ZA 3MZHA 4RGRA 2R3SA 3I4PA 3FHZA 1S3JA 4BHCA 2BY2A 4BU2A 5FFXA 3RKQA 2H27A 4AC0A 2VB6A 4PZJA 2HYGD 2G7UA 1R23A 2XAUA 3SXYA 1F4KA 2ZSHB 5E8IA 2PMHA 3CMYA 3KP2A 3WGGA 4XOPA 1Z3XA 2ELJA 1MJ9A 3M8EA 3SDGA 2LC2A 4KISA 3S3MA 1BL0A 2ECCA 4ITVA 4HLYA 1WJ5A 2ID3A 2R4GA 1SFKA 2FQ4A 2ID6A 4M9SA 3J81Z 3J81K 3WODF 2P5LC 2Y9ZA 4G7OF 4QWQA 4BXXJ 4HAMA 5EEHA 3AKZA 3UNGC 2K02A 1P2FA 3GCMA 4IQJA 1RUOA 3ZQHA 5C4JJ 3GYHX 3CO7C 4UUSA 1ETYA 2ZMEB 2MYSA 3HOUJ 5D8KB 3BTLA 4BQAA 4LG3A 4I99C 2COMA 3MKLA 5LHGA 1OYYA 2Y48A 3BZ6A 5HODA 3EUKL 2MFZA 1SD7A 2XGCA 3CZ6A 5ILSA 3MAJA 2FE3A 2IGMA 3EPZA 2QM3A 1S7AA 4CSWA 1NK2P 3FXMA 2VKDA 2OCCH 4KDPA 3QOEA 3TEDA 1D1BA 1KU2A 1UCRA 3CCRI 2FNAA 3TDUC 1LPQA 1Y0NA 2VBWA 3KX2A 2W00A 4F92B 3ZN1A 3G6EI 4PFOA 5EG0B 1OCPA 1I5ZA 3REOA 3AG2H 1I6XA 1OCCH 3IL2A 2CS3A 3J7ZI 1GT0C 3KYLA 2ADUA 1Z9CA 2XF5A 3A4CA 5FD6A 2YUSA 2QSHX 1XGSA 3GZNB 3I4NJ 3OYCA 3T0YA 4EGZA 3BPXA 2RKHA 3JRIA 4IEJA 4BAYA 3F8NA 1OYWA 1TW2A 5KK1A 5L3GA 2VONA 1WJEA 4Y15A 4HQEA 2DTZA 5DTDA 3ZMTA 2FMYA 2COBA 2DK8A 4XRSG 3VYTB 3PFIA 3R0JA 2TDXA 1BR1A 2LD5A 4RMNA 3CF2A 4B1RA 5A2QZ 1BN5A 5DUIA 5A2QK 2STTA 4Q5SF 2IS1A 2WAQN 3CLQA 1GVDA 4GRIA 2LFBA 3T1BA 3ERED 1L3LA 1VFCA 2CQNA 1IN6A 2L7FP 3H1CA 3LAJA 1B4AA 1FP2A 3JRDA 2K3FA 3PL8A 4PJJA 4DNCA 4FETA 2EFWA 2HEOA 4MLOA 2X1EA 2R7RA 1WWXA 3VWBA 3BQYA 4C30A 1M1EB 3W3CA 1T2KA 2HDCA 2LY1A 2EJRA 4XKBA 5IP6A 3LFUA 3BDDA 4HV6A 2VLAA 3SZGA 2H8RA 2XB5A 1R5GA 1YOVB 2UUZA 4XKCA 2DFEA 2L9SA 5EGOB 1D5VA 3SEQA 3H5AA 4F93B 2E7XA 1TQIA 1V54H 1Q1HA 4Q4ZF 2IP2A 4ZYGA 2VL8A 1SFXA 2M9HA 4A69C 4A3EJ 1XSDA 1ZLKA 4CYDA 3PSIA 2GIZA 3HSEA 1RKWA 1ORKA 2HQAA 3JTGA 2ZFUA 2IEKA 3CJTB 1WPKA 2JA7J 1RR7A 1S29A 4Z2YA 2FEZA 3TP0A 3KP7A 4C9YA 3DBLB 3E97A 2HVQA 2M34A 4CCJA 4ZJZA 2BY1A 3H3UA 2EBIA 2R7TA 5FKLA 3TO9A 2UXXA 1YRNA 3BR3A 2GXGA 2E1MC 3MFKA 2HZTA 2OZUA 5KVRA 2VT3A 1OKRA 4XLHA 3IH4A 1FBQA 2BBYA 3E6MA 4E7LA 2BV6A 2L9RA 2XAFA 3HGGA 4XR6A 3CP8A 5J40A 1AHDP 2ACJA 3GUDA 4EGYA 1S5LC 3QPHA 5EYRA 3PIOF 1IN7A 2HPIA 3TW6A 2V79A 1FNNA 3ML6A 3S2WA 3A01A 5HS8A 5F0CA 1WI9A 2FF4A 2F5CA 2OCEA 2NAZA 1LFUP 4RAGA 1WSUA 4C3JJ 2PJPA 1X3WB 4M6XA 3K6GA 3CCLI 1B8IA 1GXPA 2HFHA 2Z2SB 2P5VA 1XMKA 2CWEA 2VJIA 5D6EA 4LG0B 1HSTA 2M8GX 5IOYA 3OIQA 2L7KA 3HJEA 1DDNA 1K83J 1B9NA 2LYCA 4C2UA 3K4NA 1WJBA 2DODA 1IC8A 4CCNA 3QYFA 4P55A 4BQNA 2X9DA 5FKKA 3S3OA 2DFIA 2HS5A 1SVLA 5E79C 3ULQB 3RPUA 1LJ9A 2EIMH 4V2GA 1QRYA 2H09A 3ZQGA 1Z6TA 5D4SA 3ZRGA 2NNYA 3VB2A 1TC3C 2VJ5A 3EYYA 3LA7A 1BC7C 1XMAA 3RQ4A 5K5RA 3AG4H 3VDXA 3K1NA 4RGUA 2NVTJ 2LH9A 4G12A 4DBQA 1R4MB 4PGGA 2RVCA 1N25A 3HSRA 2EZHA 5DD8A 3ABTA 2BZTA 1A31A 1G3YA 2L9NA 3N05A 2LY2A 1BBYA 1TZLA 1FYLA 4LIVA 3R60A 3BG9A 4CHUA 3E3VA 2VOOA 3MZYA 3O8HA 1J7KA 2XPUA 3RTRA 2F5FA 2DMNA 2HKXA 1DP3A 3QOPA 1W1WE 3FM5A 2DBBA 4Q47A 4YIIA 2L4AA 3CF5F 2HNHA 2Q1ZB 2AS5F 4UUSB 1MNMC 2FOKA 5HVQC 3C2GA 2LKSA 4XICA 1IAWA 1MW7A 2WA0A 9ANTA 1IRGA 5DCFA 2YR2A 3BTJA 1I27A 1PJRA 2A5YB 5HNHA 1EH6A 4I0BA 2HQ5A 3K2ZA 4UVAA 3RPUD 2XUBA 2M8EA 3ZQLA 1UHMA 2MG4A 2CUEA 2CQ7A 2PJRA 1TNTA 2W84A 3J7AO 5CQGA 1IRFA 2CUJA 1JTXA 2GA2A 4I01A 3MN2A 4ESBA 3JTHA 3HDDA 4B4CA 4PFPA 4BEHB 1H9GA 3LSGA 2PMUA 1S9HA 5B3SH 4E7ZA 3WGIA 1ENHA 3GTJJ 1P9QC 4GDFA 1OISA 3OYEA 2XAGA 3BR5A 4IJAA 4RS8A 1C0WA 1Z1DA 3OYBA 2ZB9A 5M5XJ 1JE8A 3UR3C 3ABUA 2CFXA 3FWEA 4BQQA 1QQIA 1ZRFA 4X1EA 2GLOA 3H92A 4L5JA 4RBOA 1UFMA 1B9MA 4BQOA 3SJMA 6PAXA 4P96A 4E6KG 2VXZA 2R0QC 1OCTC 3LOCA 5DCMA 4CYCA 3DKXA 1JGSA 2VBXA 1A36A 4UUTA 2X1CA 1O57A 4IRGA 4ZDPA 3OY9A 4PJNA 3FXLA 1LDDA 1P6RA 2D2WA 2MABA 1L0OC 1ERDA 4Y17A 4F55A 3CDLA 3BR0A 2MD5A 4CA0A 1PYVA 2LNBA 3SQNA 4G8XA 4O6JA 3L1PA 3IRQA 2O3FA 1E2XA 1WGXA 3A03A 3GFIA 2OD5A 4IKFA 5F04A 2L4MA 3B73A 2JRMA 4B43A 5GAHJ 2R7SA 1UZCA 4IF4A 3L2WA 3T5XA 2CV0A 1ZGAA 2JTVA 3ONQA 2VE9A 3BZCA 3CCEI 5GAEJ 4HNVA 4AYBA 4MQ9F 2IGOA 3BR6A 1X1BA 4ETSA 1QZYA 1G3SA 2NVYJ 4LLGF 1RESA 1T0FA 2E5ZA 2WTEA 3DLAA 4MFDA 3CCSI 2DA5A 3X2QH 3HOWJ 4XBFA 3DLLF 3LFKA 2NNNA 3A2KA 2EPFA 1TBXA 3TGNA 4ENJA 4A0XA 1YE9A 1MMDA 4P1WA 3ZMZA 3ECHA 1SFEA 2DOEA 3WU1B 4EJTA 3Q9SA 3D5LA 3HPHA 5F64A 1FYMA 3KZIC 2E19A 4HF2A 1SC7A 2Q0OA 2KJBA 4Q48A 2PQ8A 2VC1A 4YRVA 3F21A 4Y33A 4IHYA 4E7SA 2O6GE 3IAM2 4G9YA 1ACIA 4HNUA 5LRRA 5FJ8J 3FK6A 5GP9A 2DDAA 1Q1VA 2JUCA 3VYUB 1YITI 4N9IA 4D7NA 1T39A 1GV2A 1YRNB 2CSOA 3B02A 1MSFC 4J01A 1MDMA 1FP1D 2P7CB 2B0LA 4XSZF 1YI2I 1MBJA 3Q0WA 1R5ID 3LSRA 4E7IA 3L2VA 4M73A 1YFHA 4R79A 2EV6A 3OIOA 2WV1A 5F0FA 3WTSC 3ZMSA 3A0HC 3GF2A 4LJZF 1HOMA 1MZBA 4HSTA 1AWCA 4PDKA 2ZXIA 3BY6A 1U8RA 3CCUI 4ESFA 4A3IJ 1Y8RB 4W1UA 1OFCX 3JRCA 2EIKH 2P81A 4G6TB 2CQKA 5BQTA 3A01B 3HB9A 1KYZA 3RIRA 3ZP5A 1B59A 3DWLE 5D8LB 5BS6A 5GAGJ 5J4VA 3CJNA 3RPQA 5HLTA 5DM7F 1WJAA 4YFXF 2V1DA 2DA6A 1B8IB 3NRVA 3TKYA 4BJTA 2EZLA 1Z05A 3PM1A 2PLYA 1YJ9I 1ZRDA 1IN8A 3MEXA 2VC0A 1LDJA 4BKXA 4MQVA 2CFOA 2F4MB 4UV9A 3WE2A 1KQ9A 3I9V2 1SD4A 2GA1A 1A6IA 4XN3A 3OWTA 1JKQC 2VBYA 4YIFA 1MBEA 2H1KA 2MC3A 3L09A 2Z33A 4LMYA 2HR3A 2KMUA 2V7FA 2IA2A 5HDNA 2DOAA 3CDIA 4I09A 1BI2A 3EUHC 1QO0D 1D1CA 2XKOA 3LQRA 2IW5A 2E35A 3OR2C 5K5OA 2PI0A 3K2AA 3WGHA 1QZEA 2O8KA 1CGPA 4E7HA 5KHDA 5ILUA 3E5QA 3FMSA 1VQLI 4BNCA 5L3EA 3AFHA 4XLFA 2EK5A 1YLFA 4HDUA 3M7GA 1PDNC 4RB2C 3W2WA 2DK5A 1DGWY 4A3DJ 3T8RA 4FE4A 3I3LA 2DA2A 1O7LA 1REPC 3KYDB 4CXFA 1PUFA 1J75A 1WVRA 1FSHA 1JKRC 2EV0A 3F6VA 3JRBA 1XS9A 3LAPA 3LSPA 2W48A 3I55I 3V8KA 2ZCWA 3I59A 2JVGA 2JZYA 3DPUA 4OAZA 3ASOH 4A2UA 4RAFA 1HXDA 1JHFA 1TWFJ 2PX9A 3DTEA 4Y3OA 4A3MJ 1W5CC 4PJ0C 3S1MJ 2JRTA 4XMYA 5M5WJ 5LGNA 4HV5A 5E3MA 1TWGJ 1IF1A 3HG9A 2M30A 4ON0A 2O7OA 5JHFA 2FBHA 4HOBA 3F23A 5B66C 1WHUA 3DEUA 4WWCA 1FBSA 1TP4A 5TRDA 3OL3A 3BWGA 1R6RA 1A6QA 3IUOA 1Y1WJ 2WBMA 1J09A 3ZQCA 2DFHA 1O3RA 2QKLB 3C3WA 2V1UA 3S3NA 1KA8A 1R1TA 2JA6J 3RZOJ 4LLNA 2VN2A 3ABKH 1ULYA 3M4OJ 1Z21A 2NOJB 3QQAA 2XDVA 2CW7A 1VQNI 1ODDA 1MH3A 5H6RA 4XIDA 4LGWA 1KONA 1QPMA 4B44A 1E3OC 1O3QA 3GX4X 2WWYA 2X4HA 3RKWA 1D0XA 4N4NB 4UHTA 1YX5A 2AHQA 4M3FA 4U7DA 1VNDA 2BXYA 1MNDA 1X2NA 3C2HA 1RNLA 3RKXA 3EYIA 3KP3A 2ZMEC 2X51A 3KEYA 3BTIA 4LOCA 2R5YA 2K9LA 3FZVA 1LB2A 2VPLA 1WH7A 3FISA 5DCMB 4CYCB 1FX7A 4IHSA 4XLPF 4JYKA 2QBYA 4LD5A 2OAZA 2KRHA 3KP6A 1D5YA 5CVVA 1XB4A 4L0ZB 2VBZA 2QUFA 1O3SA 3W2VA 5JR3A 2E34A 2CV2A 4M6YA 3D0SA 5JI6A 2LOOA 3ZXSA 5LBQA 2MC4A 4LIUA 1QU3A 2EH3A 3DPTA 1JJ8C 1K7AA 5C4XJ 1FTZA 2QCOA 1VZ0A 1UELB 2M3AA 2MSYA 2WAEA 4NNJA 1WCMJ 1IRZA 2D5VA 2K27A 2FU4A 4XLNF 4E4HA 1HW1A 3WTWC 4HF1A 4BJ5C 2STWA 2OTLI 1RI7A 2CRGA 3KFWX 2O61A 3M1CA 2PEXA 4BACA 5HNFA 4HX4A 4S0HB 2F4IA 1I50J 2FBKA 1XPXA 1NG6A 1AA7A 1MNEA 2A3SA 1IDYA 1LE8A 2FQ3A 2IAIA 4BDYA 1HW5A 1B72A 3K70D 5KCMA 1YTYA 2AO9A 1BOAA 2K7LA 1U78A 1XCVA 3GTPJ 4BE1A 1APLC 4DGWB 2L7MP 3PFYA 1LDKB 1LVAA 4BBSJ 4B3XA 3T8TA 4IXAA 3L2UA
chains in the Genus database with same CATH topology
1G3TA 2J5PA 4N0BA 1IXRC 3ROUA 1MDMB 1U2WA 3GFMA 3TO7A 1EH8A 2IVMA 2DLLA 3LWFA 2XRNA 1FLIA 4AWXB 2KIUA 2A6HF 1ON2A 1SMTA 1W5TA 4KMUX 5FFZA 1O7FA 1OR7A 2IPQX 1DUXC 5E1ZB 1S6LA 5J6XA 5AIQA 1GHCA 2DPUA 4BYYA 2HTSA 5HLHA 4OMZA 2Z99A 4HZFA 2RNJA 1SFUA 4FX4A 2WC2A 1EV7A 2VT2A 3K1MA 1TLHB 1U6GA 2D1VA 1KGSA 4EJVA 5D5VB 1XDUA 2V9VA 3MCZA 3WTVC 5DYMA 2V6CA 2Y75A 1TNSA 1KQ0A 4I02A 3HTSB 3HIFA 4OIOF 1KU9A 5LLQA 3JSPA 2E1NA 1BJAA 1ZHFA 1STZA 4MNUA 2XAJA 2ISYA 3WU0A 2QQ9A 3PQJA 3K1PA 3VOEA 4ZYEA 1D3YA 3I59B 4HF0A 1CF7A 2FXAA 4L9NA 2DQLA 3BROA 1FSEA 4WF2A 3L7WA 1P4XA 1R1VA 4JQFA 2RDPA 1T6SA 4CDGA 2VE8A 2DI3A 3F8CA 1U3EM 1KU3A 4KIGA 5FD5A 4BH9A 2MLGA 2G7HA 1HKQA 3F3XA 3KLOA 1J9IA 1U5TA 3DV8A 1OYIA 5E1XA 2W24A 3VEPA 3MQ0A 5HDKA 2EA4A 4KIBA 4O5VA 2HYFA 3WTUC 4OIQF 4B09A 3DFGA 3RDIA 5FLXZ 5FLXK 5LRSA 5CVIA 5EEGA 2H6CA 3O6BB 1KU7A 4UV8A 5K1YA 2EV5A 2OU2A 1DPRA 2R7FA 5H6QA 4LLLA 2L01A 2Q2EA 3GLXA 5IT3A 2QBYB 2BEOA 1RUNA 4KNYA 2NYXA 2RN7A 4CICA 3KZYA 3FXRA 3HRTA 3VFZA 3ECOA 3KEOA 2M87A 4BXUA 5BMZA 1X3UA 3HOSA 3L9FA 1HKSA 4A12A 5JFRA 1ONVA 3KLNA 2VOPA 2XGXA 3E5UA 3JSOA 4NHJA 4CGZA 1T98A 2KIFA 2ETHA 3BPVA 3IKTA 3G73A 1R58A 5HOOA 3E6DA 4EM1A 2DO7A 2K86A 4KIFA 5ICFA 2GXBA 3HTUA 4G7ZF 4OOIA 4YFKF 4MTDA 5J8FA 4ZYHA 3C18A 2W57A 2L3DA 3HRSA 4HDVA 3Q5FA 2WV0A 3WTXC 2HOEA 2XVCA 4XSXF 4WXDA 5IT9K 5CVRA 3EETA 4UVCA 4EM0B 2L54A 1F9NA 3SZTA 3KCCA 1FC3A 1Z91A 2XROA 3F22A 2P4WA 3I58A 2W25A 1Y0UA 4DQ2A 4NQWA 3RYRA 3P9CA 4WX9A 2K4JA 4Y13A 2IJLA 3AAFA 3E6BA 3HYIA 1ZN2A 1VTNC 3HUGA 3GZ6A 1AOYA 4WK8F 3JW4A 4OU0A 2P7VB 4KT5C 2JPBA 4KN4X 4RAZA 1H9TA 4OINF 2MH2A 3RJPA 2FRHA 4IRHA 1YS7A 2K4BA 4L9TA 1CF7B 5E18F 3I54A 2ZNYA 1Z6RA 3SFZA 1SD6A 3J80Z 3J80K 3N97A 1T38A 5HLGA 4M9ZA 5TJJA 1SMYF 5CYVA 5E17F 3V4GA 3MWMA 4MHGA 3DPLC 3IC7A 2GQQA 4U88A 3M1EA 1U5TB 3GW2A 5LHIA 1YIOA 2EFNA 4ESJA 2P6TA 4M9XA 4L0YB 4NB5A 1S7OA 4AD9A 5JVTA 2BGCA 3ELKA 1FBUA 1TW3A 1W5SA 1BIBA 4HX8A 3P9KA 1PP8F 1K6OA 3GFJA 2IA1A 1ZREA 5AIPA 1R22A 1JXSA 3CUQA 1GVJA 2PFBA 4GGGA 4LK1F 1YG2A 4PGHA 2M45A 1UHWA 1V3FA 2PN6A 3K0LA 4P9FA 5L3DA 2LF7A 3EDPA 3L2CA 4HQMA 3HRMA 3L00A 2DAOA 1LQ1A 2EB7A 5CJ9A 4U0WA 2X0LA 2A68F 1F5TA 2QZ8A 2QQBA 4EV0A 3ZMDA 5HDGA 1G6NA 2OA4A 3RKYA 1BM9A 1XGMA 1HKTA 4QLCU 2ESNA 5E1WA 2GAUA 3KP5A 2E7WA 3CTAA 2QENA 3I71A 4IPAA 2P8TA 2DW4A 5BPDA 2CYYA 1YS6A 2FA5A 1FYKA 1ZAOA 1ZLJA 3GO5A 1HSJA 3WG9A 3Q9VA 4G7HF 4P9UA 5CVJA 1DP7P 3CO6C 4GYGA 2JSCA 3PQKA 2O8XA 1PP7U 1OMIA 5LEJA 4EVIA 2F2EA 2QLZA 2Y0MA 3F72A 1YO5C 1R36A 1KYWA 2QVOA 3LQQA 4WXHA 3OOPA 1ON1A 1OPCA 3HHGA 2YPRA 4A6EA 2F5DA 3F8MA 3KZZA 1YW9A 2RC4A 3ZMVA 2KKOA 4HYEA 4IVNA 4EJOA 1YQAA 2A61A 4BHPA 1FY7A 3ZN0A 3O3KA 1V4RA 2OZ6A 3W6JB 5E20A 2Z9OA 3V7CA 4S04A 2E1CA 1IXCA 4KFCA 3CUQC 4M74A 1BI0A 4EQQA 3DKWA 2UZKA 3HRUA 2CO5A 3U2RA 4LFUA 2ZXJA 3R4KA 3DQVC 3KEQA 5ICGA 3E6CC 3HOTA 1XN7A 1K78A 1YYVA 1E17A 3WTTC 3OV8A 5D4RA 1MD0A 1J59A 2GWRA 4HX7A 5F1RA 3IHUA 4KICA 5HLIA 1YW8A 4KUMA 3O2PE 2UWMA 1D8JA 2XV4S 1YW7A 2ZKZA 3CDHA 1ZARA 4UUVA 2D45A 3F8FA 2M1BA 2KJCA 3GXOA 1FPQA 1IN5A 1FT9A 5J8CA 1P92A 4KMFA 4U0VA 3HHHA 3FMQA 4WXCA 1XDSA 3CUQB 4GO1A 5D6FA 5BPIA 5F6FA 4S05A 4LB6B 5ERIA 2XAHA 2NS0A 5LGUA 2MA3A 1JHHA 1A04A 2NRAC 2EFOA 2O03A 1H0MA 2RGVA 1LEBA 3IKVA 4CO8A 2GZWA 5ICEA 2Q8KA 2XASA 5DV5A 2OQRA 3F8BA 3TOBA 1F1ZA 1G3WA 3QAHA 4UVBA 4I2OA 1P4WA 2Z3YA 2OBPA 2KIMA 2MBFA 5LHHA 3EQLF 3ZPLA 4A0YA 2HQRA 1Z7UA 3R61A 4FHTA 1BI3A 3GVAA 4RGSA 3V8LA 4R8HA 3TQNA 3N4MA 5HS9A 1W7PA 1ZH5A 1MKMA 4AIKA 3GWZA 4OMYA 2Z5UA 4I7HA 4MEYF 3M9AA 1WRJA 4ZH4F 3V7RA 5L3BA 1B6AA 4OIRF 2BE5F 1XSVA 3H3ZA 3WTZA 3CLOA 3FX3A 4L9JA 2C6YA 2ESHA 2M5WA 1IW7F 2F5EA 2VODA 4ZYDA 2MLKA 4XRFA 3U1DA 5CVUA 4G6DA 1W7PD 3BOQA 2IRFG 4N9HA 1RIOH 3KP4A 5L3CA 4YFNF 4GYIA 2ZO4A 3RI4A 2P5KA 1FZPB 2P6SA 2LSOA 2H94A 5LEKA 1BI1A 5LGTA 5DUKA 4ZZLA 5ED4A 2QQAA 3QRFF 3FM3A 3JAMZ 3JAMK 1IZ1A 3V8JA 3M8FA 4PCQA 2ZJ2A 4R1HA 3I64A 2DQRA 4ZZDA 4FX0A 1ZYRF 2A69F 2A07F 4RB1A 4MEXF 3R0AA 2CW0F 4RAYA 1G4DA 2D1HA 5ILVA 4BHBA 2L02A 1S8NA 4UNOA 3C1DA 3G3ZA 3BP8A 1K78B 4FT8A 4G6QA 4A0ZA 4RGXA 2DU9A 1FWZA 1ZGJA 3I0TA 2PBIA 4KA4A 2ISZA 5AONA 1WKMA 1I1SA 2V1XA 4ASNA 4M71A 1SD5A 4HW0A 1D8KA 5CLSA 5IT9Z 5FGMA 4L9VA 2O0YA 3F6OA 2IT0A 1IUYA 3EUHA 3W6KB 1J0RA 3ISPA 2RQPA 3IWZA 3CUOA 2XKPA 1ZG1A 2H6BA 1RZ4A 4G94A 4MTEA 2ELHA 2KRFA 4YG2F 2QWWA 3V7SA 3E5XA 1P4AA 1U5TC 4U0YA 3QPTA 3NQOA 2LDUA 3RYPA 1XCBA 4EJWA 1K79A 1DPUA 4AIHA 1WQ2A 1HBXG 1ZRCA 1W4MA 3BJAA 4O3MA 5DEQA 3U9GA 1TQMA 1UB9A 4AIJA 3DF8A 2OQGA 2RV8A 3QU3A 4UXNA 4EMSA 2CG4A 2DT5A 2UXNA 3HSFA 1R00A 2XIGA 3LA3A 2EWNA 1R7JA 5DDGA 4I0AA 1FOKA 2QYOA 1QNTA 3I53A 4U7BA 2ZNZA 1SAXA 3GEZA 1W7PB 1J5YA 4JK1X 3SHFA 1XGNA 2R7DA 2HTJA 3VODA 1LEAA 4WCGA 1KQ8A 1USTA 1ZG3A 2JPCA 2MH9A 2ZMEA 1QBJA 5H20A 1PUEE 3IWFA 2A6EF 5HS7A 4P5OA 2IA0A 5L3FA 2DPDA 4A6DA 3DP7A 3FXQA 3BJOA 3TO6A 3KE2A 5D5WB 1IN4A 2HKOA 3COAC 1LNWA 4RB3C 4M72A 3NEUA 5E8GA 2LKPA 4A5MA 5D5XB 5DD4A 2PG4A 3P7NA 3SZPA 1XSXA 4TV7A 2ZFWA 4EM2A 4MGRA 4KN7X 4JBAA 3R6SA 1MJBA 4GCVA 4K2EA 3QU6A 1ZG5A 2EA2A 3GZ5A 4LB5A 5D5UB 1MGTA 2EFPA 3WE3A 4B8XA 3BJ6A 3FMRA 3ZQ7A 4RB0A 3ZMUA 1R5HA 2YSRA 3K69A 1IXSB 2YX7A 3IRRA 1TQPA 5FO5A 2G9WA 2FSWA 3QP6A 1BC8C 1QGPA 4IRIA 3FF5A 2HGCA 3TOAA 1HQCA 4HLXA 5K5QA 4I98B 2CGPA 2XAQA 5ICCA 1B1BA 2FNPA 2JT1A 1XGOA 1O3TA 3TDZC 4H0EA 2LF8A 2AXLA 1MJAA 2EFQA 4OIPF 5BOXA 2YU3A 1BIAA 2FBIA 3QP5A 2GIVA 2W85A 4L5IA 4HBLA 2DTRA 4LK0F 4E70A 2YX4A 1QZZA 3C7JA 1GXQA 2J5OA 5JHUA 2ZBKA 3DXJF 4ENMA 5FB2A 2HWVA 4GXOA 2HQNA 3WTYC 1XD7A 3I5UA 3LSTA 4HA8A 4L18B 3GFLA 4KYWA 1HW2A 1TTYA 1USSA 1J2XA 2BYVE 4LG0A 1R1UA 3KETA 2FMLA 1EH7A 4ENKA 4F7ZA 1I1GA 4AVPA 4D0PA 3P9IA 2XHKA 1NHAA 4CZZA 4EJUA 3LA2A 4A5NA 4ENNA 4IHTA 3K9TA 3FXUA 3MZHA 4RGRA 2R3SA 3I4PA 3FHZA 1S3JA 4BHCA 5FFXA 2H27A 4PZJA 2HYGD 2G7UA 1R23A 3SXYA 1F4KA 5E8IA 2PMHA 3KP2A 3WGGA 1MJ9A 3M8EA 4HLYA 4M9SA 3J81Z 3J81K 3WODF 2P5LC 4G7OF 4QWQA 4HAMA 5EEHA 2K02A 1P2FA 1RUOA 3GYHX 3CO7C 2ZMEB 5D8KB 4BQAA 2COMA 5LHGA 1OYYA 2Y48A 3BZ6A 1SD7A 5ILSA 3MAJA 2FE3A 2QM3A 1S7AA 4KDPA 1KU2A 1UCRA 2FNAA 3TDUC 2VBWA 3ZN1A 1I5ZA 3REOA 1I6XA 3IL2A 2ADUA 1Z9CA 5FD6A 1XGSA 3T0YA 4EGZA 3BPXA 2RKHA 4BAYA 3F8NA 1OYWA 1TW2A 5KK1A 5L3GA 2VONA 4HQEA 4Y15A 3ZMTA 2FMYA 2DK8A 3PFIA 3R0JA 2TDXA 5A2QZ 1BN5A 5DUIA 5A2QK 2STTA 4Q5SF 3T1BA 3ERED 1L3LA 1IN6A 3LAJA 1B4AA 1FP2A 2EFWA 4DNCA 2HEOA 1WWXA 1T2KA 2HDCA 2EJRA 3BDDA 4HV6A 1R5GA 1D5VA 2E7XA 1TQIA 1Q1HA 4Q4ZF 2IP2A 4ZYGA 1SFXA 1XSDA 1ZLKA 4CYDA 3HSEA 3JTGA 1S29A 4Z2YA 2FEZA 3KP7A 3E97A 3H3UA 3TO9A 2UXXA 2GXGA 3MFKA 2HZTA 2OZUA 5KVRA 2VT3A 1OKRA 1FBQA 2BBYA 3E6MA 2BV6A 2XAFA 2ACJA 3GUDA 4EGYA 3QPHA 1IN7A 2V79A 1FNNA 3ML6A 3S2WA 5HS8A 1WI9A 2FF4A 2F5CA 2NAZA 1WSUA 2PJPA 4M6XA 1GXPA 2HFHA 2P5VA 1XMKA 2CWEA 5D6EA 4LG0B 1HSTA 1DDNA 1B9NA 4P55A 2DFIA 2HS5A 3ULQB 3RPUA 1LJ9A 2H09A 1Z6TA 5D4SA 2NNYA 3VB2A 3EYYA 3LA7A 1BC7C 1XMAA 5K5RA 3K1NA 4RGUA 4PGGA 2RVCA 3HSRA 5DD8A 3ABTA 1G3YA 1BBYA 1FYLA 3R60A 4CHUA 3E3VA 2VOOA 3MZYA 1J7KA 3RTRA 2F5FA 2HKXA 3QOPA 3FM5A 2DBBA 4Q47A 4YIIA 2L4AA 2AS5F 2FOKA 5HVQC 1IAWA 1IRGA 5DCFA 2YR2A 1I27A 2A5YB 1EH6A 4I0BA 3K2ZA 4UVAA 2XUBA 2M8EA 1UHMA 1TNTA 2W84A 3J7AO 1IRFA 2GA2A 4I01A 4ESBA 3JTHA 1H9GA 2PMUA 3WGIA 2XAGA 4IJAA 4RS8A 1C0WA 1Z1DA 1JE8A 3ABUA 2CFXA 3FWEA 1QQIA 1ZRFA 3H92A 4L5JA 1UFMA 1B9MA 6PAXA 4P96A 2VXZA 5DCMA 1JGSA 2VBXA 1O57A 4IRGA 1LDDA 1P6RA 2D2WA 1L0OC 4Y17A 2MD5A 2LNBA 3SQNA 4G8XA 4O6JA 3GFIA 3IRQA 2O3FA 1E2XA 2OD5A 2L4MA 3B73A 4IF4A 3T5XA 1ZGAA 2JTVA 2VE9A 4MQ9F 4ETSA 1QZYA 1G3SA 4LLGF 1T0FA 2WTEA 4XBFA 3LFKA 2NNNA 1TBXA 3TGNA 4ENJA 4A0XA 3ZMZA 3ECHA 1SFEA 3WU1B 4EJTA 3Q9SA 3D5LA 1FYMA 5F64A 4HF2A 2Q0OA 2KJBA 4Q48A 2PQ8A 2VC1A 3F21A 2O6GE 4G9YA 5LRRA 4N9IA 1T39A 2CSOA 3B02A 1MDMA 1FP1D 2P7CB 2B0LA 4XSZF 4M73A 1YFHA 4R79A 2EV6A 3WTSC 3ZMSA 3GF2A 4LJZF 1MZBA 1AWCA 4PDKA 1U8RA 3BY6A 4ESFA 5BQTA 2CQKA 1KYZA 3RIRA 3ZP5A 1B59A 5D8LB 5BS6A 3CJNA 3RPQA 4YFXF 2V1DA 3NRVA 3TKYA 1Z05A 2PLYA 1ZRDA 1IN8A 3MEXA 2VC0A 1LDJA 4MQVA 4UV9A 3WE2A 1KQ9A 1SD4A 2GA1A 2VBYA 4YIFA 2MC3A 3L09A 2Z33A 4LMYA 2HR3A 2IA2A 5HDNA 4I09A 1BI2A 1QO0D 2XKOA 3LQRA 2IW5A 5K5OA 2PI0A 3WGHA 1CGPA 5ILUA 3E5QA 3FMSA 4BNCA 5L3EA 2EK5A 1YLFA 4HDUA 3M7GA 1PDNC 4RB2C 2DK5A 3T8RA 1O7LA 1REPC 4CXFA 1J75A 1FSHA 2EV0A 3F6VA 3LAPA 3V8KA 2ZCWA 3I59A 2JZYA 4A2UA 1HXDA 1JHFA 2JRTA 5LGNA 4HV5A 1IF1A 2M30A 4ON0A 2FBHA 4HOBA 3F23A 3DEUA 4WWCA 1FBSA 5TRDA 3BWGA 1O3RA 3C3WA 2V1UA 1KA8A 1R1TA 4LLNA 2VN2A 1ULYA 5H6RA 1ODDA 4LGWA 1QPMA 1O3QA 3GX4X 2WWYA 2X4HA 3RKWA 4UHTA 4U7DA 1RNLA 3RKXA 3EYIA 3KP3A 3FZVA 1LB2A 5DCMB 1FX7A 4IHSA 4XLPF 2QBYA 4LD5A 2OAZA 3KP6A 5CVVA 1XB4A 4L0ZB 2VBZA 2QUFA 1O3SA 5JR3A 4M6YA 3D0SA 5JI6A 5LBQA 3DPTA 1K7AA 2K27A 2FU4A 4XLNF 3WTWC 1HW1A 4HF1A 2STWA 1RI7A 3KFWX 2O61A 2PEXA 4HX4A 2FBKA 2A3SA 2FQ3A 1HW5A 1YTYA 1BOAA 2K7LA 1U78A 1XCVA 1LDKB 1LVAA 3T8TA 4IXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3T A;  2J5P A;  4N0B A;  1IXR C;  3ROU A;  1MDM B;  1U2W A;  3GFM A;  3TO7 A;  1EH8 A;  2IVM A;  2DLL A;  3LWF A;  2XRN A;  1FLI A;  4AWX B;  2KIU A;  2A6H F;  1ON2 A;  1SMT A;  1W5T A;  4KMU X;  5FFZ A;  1O7F A;  1OR7 A;  2IPQ X;  1DUX C;  5E1Z B;  1S6L A;  5J6X A;  5AIQ A;  1GHC A;  2DPU A;  4BYY A;  2HTS A;  5HLH A;  4OMZ A;  2Z99 A;  4HZF A;  2RNJ A;  1SFU A;  4FX4 A;  2WC2 A;  1EV7 A;  2VT2 A;  3K1M A;  1TLH B;  1U6G A;  2D1V A;  1KGS A;  4EJV A;  5D5V B;  1XDU A;  2V9V A;  3MCZ A;  3WTV C;  5DYM A;  2V6C A;  2Y75 A;  1TNS A;  1KQ0 A;  4I02 A;  3HTS B;  3HIF A;  4OIO F;  1KU9 A;  5LLQ A;  3JSP A;  2E1N A;  1BJA A;  1ZHF A;  1STZ A;  4MNU A;  2XAJ A;  2ISY A;  3WU0 A;  2QQ9 A;  3PQJ A;  3K1P A;  3VOE A;  4ZYE A;  1D3Y A;  3I59 B;  4HF0 A;  1CF7 A;  2FXA A;  4L9N A;  2DQL A;  3BRO A;  1FSE A;  4WF2 A;  3L7W A;  1P4X A;  1R1V A;  4JQF A;  2RDP A;  1T6S A;  4CDG A;  2VE8 A;  2DI3 A;  3F8C A;  1U3E M;  1KU3 A;  4KIG A;  5FD5 A;  4BH9 A;  2MLG A;  2G7H A;  1HKQ A;  3F3X A;  3KLO A;  1J9I A;  1U5T A;  3DV8 A;  1OYI A;  5E1X A;  2W24 A;  3VEP A;  3MQ0 A;  5HDK A;  2EA4 A;  4KIB A;  4O5V A;  2HYF A;  3WTU C;  4OIQ F;  4B09 A;  3DFG A;  3RDI A;  5FLX Z;  5FLX K;  5LRS A;  5CVI A;  5EEG A;  2H6C A;  3O6B B;  1KU7 A;  4UV8 A;  5K1Y A;  2EV5 A;  2OU2 A;  1DPR A;  2R7F A;  5H6Q A;  4LLL A;  2L01 A;  2Q2E A;  3GLX A;  5IT3 A;  2QBY B;  2BEO A;  1RUN A;  4KNY A;  2NYX A;  2RN7 A;  4CIC A;  3KZY A;  3FXR A;  3HRT A;  3VFZ A;  3ECO A;  3KEO A;  2M87 A;  4BXU A;  5BMZ A;  1X3U A;  3HOS A;  3L9F A;  1HKS A;  4A12 A;  5JFR A;  1ONV A;  3KLN A;  2VOP A;  2XGX A;  3E5U A;  3JSO A;  4NHJ A;  4CGZ A;  1T98 A;  2KIF A;  2ETH A;  3BPV A;  3IKT A;  3G73 A;  1R58 A;  5HOO A;  3E6D A;  4EM1 A;  2DO7 A;  2K86 A;  4KIF A;  5ICF A;  2GXB A;  3HTU A;  4G7Z F;  4OOI A;  4YFK F;  4MTD A;  5J8F A;  4ZYH A;  3C18 A;  2W57 A;  2L3D A;  3HRS A;  4HDV A;  3Q5F A;  2WV0 A;  3WTX C;  2HOE A;  2XVC A;  4XSX F;  4WXD A;  5IT9 K;  5CVR A;  3EET A;  4UVC A;  4EM0 B;  2L54 A;  1F9N A;  3SZT A;  3KCC A;  1FC3 A;  1Z91 A;  2XRO A;  3F22 A;  2P4W A;  3I58 A;  2W25 A;  1Y0U A;  4DQ2 A;  4NQW A;  3RYR A;  3P9C A;  4WX9 A;  2K4J A;  4Y13 A;  2IJL A;  3AAF A;  3E6B A;  3HYI A;  1ZN2 A;  1VTN C;  3HUG A;  3GZ6 A;  1AOY A;  4WK8 F;  3JW4 A;  4OU0 A;  2P7V B;  4KT5 C;  2JPB A;  4KN4 X;  4RAZ A;  1H9T A;  4OIN F;  2MH2 A;  3RJP A;  2FRH A;  4IRH A;  1YS7 A;  2K4B A;  4L9T A;  1CF7 B;  5E18 F;  3I54 A;  2ZNY A;  1Z6R A;  3SFZ A;  1SD6 A;  3J80 Z;  3J80 K;  3N97 A;  1T38 A;  5HLG A;  4M9Z A;  5TJJ A;  1SMY F;  5CYV A;  5E17 F;  3V4G A;  3MWM A;  4MHG A;  3DPL C;  3IC7 A;  2GQQ A;  4U88 A;  3M1E A;  1U5T B;  3GW2 A;  5LHI A;  1YIO A;  2EFN A;  4ESJ A;  2P6T A;  4M9X A;  4L0Y B;  4NB5 A;  1S7O A;  4AD9 A;  5JVT A;  2BGC A;  3ELK A;  1FBU A;  1TW3 A;  1W5S A;  1BIB A;  4HX8 A;  3P9K A;  1PP8 F;  1K6O A;  3GFJ A;  2IA1 A;  1ZRE A;  5AIP A;  1R22 A;  1JXS A;  3CUQ A;  1GVJ A;  2PFB A;  4GGG A;  4LK1 F;  1YG2 A;  4PGH A;  2M45 A;  1UHW A;  1V3F A;  2PN6 A;  3K0L A;  4P9F A;  5L3D A;  2LF7 A;  3EDP A;  3L2C A;  4HQM A;  3HRM A;  3L00 A;  2DAO A;  1LQ1 A;  2EB7 A;  5CJ9 A;  4U0W A;  2X0L A;  2A68 F;  1F5T A;  2QZ8 A;  2QQB A;  4EV0 A;  3ZMD A;  5HDG A;  1G6N A;  2OA4 A;  3RKY A;  1BM9 A;  1XGM A;  1HKT A;  4QLC U;  2ESN A;  5E1W A;  2GAU A;  3KP5 A;  2E7W A;  3CTA A;  2QEN A;  3I71 A;  4IPA A;  2P8T A;  2DW4 A;  5BPD A;  2CYY A;  1YS6 A;  2FA5 A;  1FYK A;  1ZAO A;  1ZLJ A;  3GO5 A;  1HSJ A;  3WG9 A;  3Q9V A;  4G7H F;  4P9U A;  5CVJ A;  1DP7 P;  3CO6 C;  4GYG A;  2JSC A;  3PQK A;  2O8X A;  1PP7 U;  1OMI A;  5LEJ A;  4EVI A;  2F2E A;  2QLZ A;  2Y0M A;  3F72 A;  1YO5 C;  1R36 A;  1KYW A;  2QVO A;  3LQQ A;  4WXH A;  3OOP A;  1ON1 A;  1OPC A;  3HHG A;  2YPR A;  4A6E A;  2F5D A;  3F8M A;  3KZZ A;  1YW9 A;  2RC4 A;  3ZMV A;  2KKO A;  4HYE A;  4IVN A;  4EJO A;  1YQA A;  2A61 A;  4BHP A;  1FY7 A;  3ZN0 A;  3O3K A;  1V4R A;  2OZ6 A;  3W6J B;  5E20 A;  2Z9O A;  3V7C A;  4S04 A;  2E1C A;  1IXC A;  4KFC A;  3CUQ C;  4M74 A;  1BI0 A;  4EQQ A;  3DKW A;  2UZK A;  3HRU A;  2CO5 A;  3U2R A;  4LFU A;  2ZXJ A;  3R4K A;  3DQV C;  3KEQ A;  5ICG A;  3E6C C;  3HOT A;  1XN7 A;  1K78 A;  1YYV A;  1E17 A;  3WTT C;  3OV8 A;  5D4R A;  1MD0 A;  1J59 A;  2GWR A;  4HX7 A;  5F1R A;  3IHU A;  4KIC A;  5HLI A;  1YW8 A;  4KUM A;  3O2P E;  2UWM A;  1D8J A;  2XV4 S;  1YW7 A;  2ZKZ A;  3CDH A;  1ZAR A;  4UUV A;  2D45 A;  3F8F A;  2M1B A;  2KJC A;  3GXO A;  1FPQ A;  1IN5 A;  1FT9 A;  5J8C A;  1P92 A;  4KMF A;  4U0V A;  3HHH A;  3FMQ A;  4WXC A;  1XDS A;  3CUQ B;  4GO1 A;  5D6F A;  5BPI A;  5F6F A;  4S05 A;  4LB6 B;  5ERI A;  2XAH A;  2NS0 A;  5LGU A;  2MA3 A;  1JHH A;  1A04 A;  2NRA C;  2EFO A;  2O03 A;  1H0M A;  2RGV A;  1LEB A;  3IKV A;  4CO8 A;  2GZW A;  5ICE A;  2Q8K A;  2XAS A;  5DV5 A;  2OQR A;  3F8B A;  3TOB A;  1F1Z A;  1G3W A;  3QAH A;  4UVB A;  4I2O A;  1P4W A;  2Z3Y A;  2OBP A;  2KIM A;  2MBF A;  5LHH A;  3EQL F;  3ZPL A;  4A0Y A;  2HQR A;  1Z7U A;  3R61 A;  4FHT A;  1BI3 A;  3GVA A;  4RGS A;  3V8L A;  4R8H A;  3TQN A;  3N4M A;  5HS9 A;  1W7P A;  1ZH5 A;  1MKM A;  4AIK A;  3GWZ A;  4OMY A;  2Z5U A;  4I7H A;  4MEY F;  3M9A A;  1WRJ A;  4ZH4 F;  3V7R A;  5L3B A;  1B6A A;  4OIR F;  2BE5 F;  1XSV A;  3H3Z A;  3WTZ A;  3CLO A;  3FX3 A;  4L9J A;  2C6Y A;  2ESH A;  2M5W A;  1IW7 F;  2F5E A;  2VOD A;  4ZYD A;  2MLK A;  4XRF A;  3U1D A;  5CVU A;  4G6D A;  1W7P D;  3BOQ A;  2IRF G;  4N9H A;  1RIO H;  3KP4 A;  5L3C A;  4YFN F;  4GYI A;  2ZO4 A;  3RI4 A;  2P5K A;  1FZP B;  2P6S A;  2LSO A;  2H94 A;  5LEK A;  1BI1 A;  5LGT A;  5DUK A;  4ZZL A;  5ED4 A;  2QQA A;  3QRF F;  3FM3 A;  3JAM Z;  3JAM K;  1IZ1 A;  3V8J A;  3M8F A;  4PCQ A;  2ZJ2 A;  4R1H A;  3I64 A;  2DQR A;  4ZZD A;  4FX0 A;  1ZYR F;  2A69 F;  2A07 F;  4RB1 A;  4MEX F;  3R0A A;  2CW0 F;  4RAY A;  1G4D A;  2D1H A;  5ILV A;  4BHB A;  2L02 A;  1S8N A;  4UNO A;  3C1D A;  3G3Z A;  3BP8 A;  1K78 B;  4FT8 A;  4G6Q A;  4A0Z A;  4RGX A;  2DU9 A;  1FWZ A;  1ZGJ A;  3I0T A;  2PBI A;  4KA4 A;  2ISZ A;  5AON A;  1WKM A;  1I1S A;  2V1X A;  4ASN A;  4M71 A;  1SD5 A;  4HW0 A;  1D8K A;  5CLS A;  5IT9 Z;  5FGM A;  4L9V A;  2O0Y A;  3F6O A;  2IT0 A;  1IUY A;  3EUH A;  3W6K B;  1J0R A;  3ISP A;  2RQP A;  3IWZ A;  3CUO A;  2XKP A;  1ZG1 A;  2H6B A;  1RZ4 A;  4G94 A;  4MTE A;  2ELH A;  2KRF A;  4YG2 F;  2QWW A;  3V7S A;  3E5X A;  1P4A A;  1U5T C;  4U0Y A;  3QPT A;  3NQO A;  2LDU A;  3RYP A;  1XCB A;  4EJW A;  1K79 A;  1DPU A;  4AIH A;  1WQ2 A;  1HBX G;  1ZRC A;  1W4M A;  3BJA A;  4O3M A;  5DEQ A;  3U9G A;  1TQM A;  1UB9 A;  4AIJ A;  3DF8 A;  2OQG A;  2RV8 A;  3QU3 A;  4UXN A;  4EMS A;  2CG4 A;  2DT5 A;  2UXN A;  3HSF A;  1R00 A;  2XIG A;  3LA3 A;  2EWN A;  1R7J A;  5DDG A;  4I0A A;  1FOK A;  2QYO A;  1QNT A;  3I53 A;  4U7B A;  2ZNZ A;  1SAX A;  3GEZ A;  1W7P B;  1J5Y A;  4JK1 X;  3SHF A;  1XGN A;  2R7D A;  2HTJ A;  3VOD A;  1LEA A;  4WCG A;  1KQ8 A;  1UST A;  1ZG3 A;  2JPC A;  2MH9 A;  2ZME A;  1QBJ A;  5H20 A;  1PUE E;  3IWF A;  2A6E F;  5HS7 A;  4P5O A;  2IA0 A;  5L3F A;  2DPD A;  4A6D A;  3DP7 A;  3FXQ A;  3BJO A;  3TO6 A;  3KE2 A;  5D5W B;  1IN4 A;  2HKO A;  3COA C;  1LNW A;  4RB3 C;  4M72 A;  3NEU A;  5E8G A;  2LKP A;  4A5M A;  5D5X B;  5DD4 A;  2PG4 A;  3P7N A;  3SZP A;  1XSX A;  4TV7 A;  2ZFW A;  4EM2 A;  4MGR A;  4KN7 X;  4JBA A;  3R6S A;  1MJB A;  4GCV A;  4K2E A;  3QU6 A;  1ZG5 A;  2EA2 A;  3GZ5 A;  4LB5 A;  5D5U B;  1MGT A;  2EFP A;  3WE3 A;  4B8X A;  3BJ6 A;  3FMR A;  3ZQ7 A;  4RB0 A;  3ZMU A;  1R5H A;  2YSR A;  3K69 A;  1IXS B;  2YX7 A;  3IRR A;  1TQP A;  5FO5 A;  2G9W A;  2FSW A;  3QP6 A;  1BC8 C;  1QGP A;  4IRI A;  3FF5 A;  2HGC A;  3TOA A;  1HQC A;  4HLX A;  5K5Q A;  4I98 B;  2CGP A;  2XAQ A;  5ICC A;  1B1B A;  2FNP A;  2JT1 A;  1XGO A;  1O3T A;  3TDZ C;  4H0E A;  2LF8 A;  2AXL A;  1MJA A;  2EFQ A;  4OIP F;  5BOX A;  2YU3 A;  1BIA A;  2FBI A;  3QP5 A;  2GIV A;  2W85 A;  4L5I A;  4HBL A;  2DTR A;  4LK0 F;  4E70 A;  2YX4 A;  1QZZ A;  3C7J A;  1GXQ A;  2J5O A;  5JHU A;  2ZBK A;  3DXJ F;  4ENM A;  5FB2 A;  2HWV A;  4GXO A;  2HQN A;  3WTY C;  1XD7 A;  3I5U A;  3LST A;  4HA8 A;  4L18 B;  3GFL A;  4KYW A;  1HW2 A;  1TTY A;  1USS A;  1J2X A;  2BYV E;  4LG0 A;  1R1U A;  3KET A;  2FML A;  1EH7 A;  4ENK A;  4F7Z A;  1I1G A;  4AVP A;  4D0P A;  3P9I A;  2XHK A;  1NHA A;  4CZZ A;  4EJU A;  3LA2 A;  4A5N A;  4ENN A;  4IHT A;  3K9T A;  3FXU A;  3MZH A;  4RGR A;  2R3S A;  3I4P A;  3FHZ A;  1S3J A;  4BHC A;  5FFX A;  2H27 A;  4PZJ A;  2HYG D;  2G7U A;  1R23 A;  3SXY A;  1F4K A;  5E8I A;  2PMH A;  3KP2 A;  3WGG A;  1MJ9 A;  3M8E A;  4HLY A;  4M9S A;  3J81 Z;  3J81 K;  3WOD F;  2P5L C;  4G7O F;  4QWQ A;  4HAM A;  5EEH A;  2K02 A;  1P2F A;  1RUO A;  3GYH X;  3CO7 C;  2ZME B;  5D8K B;  4BQA A;  2COM A;  5LHG A;  1OYY A;  2Y48 A;  3BZ6 A;  1SD7 A;  5ILS A;  3MAJ A;  2FE3 A;  2QM3 A;  1S7A A;  4KDP A;  1KU2 A;  1UCR A;  2FNA A;  3TDU C;  2VBW A;  3ZN1 A;  1I5Z A;  3REO A;  1I6X A;  3IL2 A;  2ADU A;  1Z9C A;  5FD6 A;  1XGS A;  3T0Y A;  4EGZ A;  3BPX A;  2RKH A;  4BAY A;  3F8N A;  1OYW A;  1TW2 A;  5KK1 A;  5L3G A;  2VON A;  4HQE A;  4Y15 A;  3ZMT A;  2FMY A;  2DK8 A;  3PFI A;  3R0J A;  2TDX A;  5A2Q Z;  1BN5 A;  5DUI A;  5A2Q K;  2STT A;  4Q5S F;  3T1B A;  3ERE D;  1L3L A;  1IN6 A;  3LAJ A;  1B4A A;  1FP2 A;  2EFW A;  4DNC A;  2HEO A;  1WWX A;  1T2K A;  2HDC A;  2EJR A;  3BDD A;  4HV6 A;  1R5G A;  1D5V A;  2E7X A;  1TQI A;  1Q1H A;  4Q4Z F;  2IP2 A;  4ZYG A;  1SFX A;  1XSD A;  1ZLK A;  4CYD A;  3HSE A;  3JTG A;  1S29 A;  4Z2Y A;  2FEZ A;  3KP7 A;  3E97 A;  3H3U A;  3TO9 A;  2UXX A;  2GXG A;  3MFK A;  2HZT A;  2OZU A;  5KVR A;  2VT3 A;  1OKR A;  1FBQ A;  2BBY A;  3E6M A;  2BV6 A;  2XAF A;  2ACJ A;  3GUD A;  4EGY A;  3QPH A;  1IN7 A;  2V79 A;  1FNN A;  3ML6 A;  3S2W A;  5HS8 A;  1WI9 A;  2FF4 A;  2F5C A;  2NAZ A;  1WSU A;  2PJP A;  4M6X A;  1GXP A;  2HFH A;  2P5V A;  1XMK A;  2CWE A;  5D6E A;  4LG0 B;  1HST A;  1DDN A;  1B9N A;  4P55 A;  2DFI A;  2HS5 A;  3ULQ B;  3RPU A;  1LJ9 A;  2H09 A;  1Z6T A;  5D4S A;  2NNY A;  3VB2 A;  3EYY A;  3LA7 A;  1BC7 C;  1XMA A;  5K5R A;  3K1N A;  4RGU A;  4PGG A;  2RVC A;  3HSR A;  5DD8 A;  3ABT A;  1G3Y A;  1BBY A;  1FYL A;  3R60 A;  4CHU A;  3E3V A;  2VOO A;  3MZY A;  1J7K A;  3RTR A;  2F5F A;  2HKX A;  3QOP A;  3FM5 A;  2DBB A;  4Q47 A;  4YII A;  2L4A A;  2AS5 F;  2FOK A;  5HVQ C;  1IAW A;  1IRG A;  5DCF A;  2YR2 A;  1I27 A;  2A5Y B;  1EH6 A;  4I0B A;  3K2Z A;  4UVA A;  2XUB A;  2M8E A;  1UHM A;  1TNT A;  2W84 A;  3J7A O;  1IRF A;  2GA2 A;  4I01 A;  4ESB A;  3JTH A;  1H9G A;  2PMU A;  3WGI A;  2XAG A;  4IJA A;  4RS8 A;  1C0W A;  1Z1D A;  1JE8 A;  3ABU A;  2CFX A;  3FWE A;  1QQI A;  1ZRF A;  3H92 A;  4L5J A;  1UFM A;  1B9M A;  6PAX A;  4P96 A;  2VXZ A;  5DCM A;  1JGS A;  2VBX A;  1O57 A;  4IRG A;  1LDD A;  1P6R A;  2D2W A;  1L0O C;  4Y17 A;  2MD5 A;  2LNB A;  3SQN A;  4G8X A;  4O6J A;  3GFI A;  3IRQ A;  2O3F A;  1E2X A;  2OD5 A;  2L4M A;  3B73 A;  4IF4 A;  3T5X A;  1ZGA A;  2JTV A;  2VE9 A;  4MQ9 F;  4ETS A;  1QZY A;  1G3S A;  4LLG F;  1T0F A;  2WTE A;  4XBF A;  3LFK A;  2NNN A;  1TBX A;  3TGN A;  4ENJ A;  4A0X A;  3ZMZ A;  3ECH A;  1SFE A;  3WU1 B;  4EJT A;  3Q9S A;  3D5L A;  1FYM A;  5F64 A;  4HF2 A;  2Q0O A;  2KJB A;  4Q48 A;  2PQ8 A;  2VC1 A;  3F21 A;  2O6G E;  4G9Y A;  5LRR A;  4N9I A;  1T39 A;  2CSO A;  3B02 A;  1MDM A;  1FP1 D;  2P7C B;  2B0L A;  4XSZ F;  4M73 A;  1YFH A;  4R79 A;  2EV6 A;  3WTS C;  3ZMS A;  3GF2 A;  4LJZ F;  1MZB A;  1AWC A;  4PDK A;  1U8R A;  3BY6 A;  4ESF A;  5BQT A;  2CQK A;  1KYZ A;  3RIR A;  3ZP5 A;  1B59 A;  5D8L B;  5BS6 A;  3CJN A;  3RPQ A;  4YFX F;  2V1D A;  3NRV A;  3TKY A;  1Z05 A;  2PLY A;  1ZRD A;  1IN8 A;  3MEX A;  2VC0 A;  1LDJ A;  4MQV A;  4UV9 A;  3WE2 A;  1KQ9 A;  1SD4 A;  2GA1 A;  2VBY A;  4YIF A;  2MC3 A;  3L09 A;  2Z33 A;  4LMY A;  2HR3 A;  2IA2 A;  5HDN A;  4I09 A;  1BI2 A;  1QO0 D;  2XKO A;  3LQR A;  2IW5 A;  5K5O A;  2PI0 A;  3WGH A;  1CGP A;  5ILU A;  3E5Q A;  3FMS A;  4BNC A;  5L3E A;  2EK5 A;  1YLF A;  4HDU A;  3M7G A;  1PDN C;  4RB2 C;  2DK5 A;  3T8R A;  1O7L A;  1REP C;  4CXF A;  1J75 A;  1FSH A;  2EV0 A;  3F6V A;  3LAP A;  3V8K A;  2ZCW A;  3I59 A;  2JZY A;  4A2U A;  1HXD A;  1JHF A;  2JRT A;  5LGN A;  4HV5 A;  1IF1 A;  2M30 A;  4ON0 A;  2FBH A;  4HOB A;  3F23 A;  3DEU A;  4WWC A;  1FBS A;  5TRD A;  3BWG A;  1O3R A;  3C3W A;  2V1U A;  1KA8 A;  1R1T A;  4LLN A;  2VN2 A;  1ULY A;  5H6R A;  1ODD A;  4LGW A;  1QPM A;  1O3Q A;  3GX4 X;  2WWY A;  2X4H A;  3RKW A;  4UHT A;  4U7D A;  1RNL A;  3RKX A;  3EYI A;  3KP3 A;  3FZV A;  1LB2 A;  5DCM B;  1FX7 A;  4IHS A;  4XLP F;  2QBY A;  4LD5 A;  2OAZ A;  3KP6 A;  5CVV A;  1XB4 A;  4L0Z B;  2VBZ A;  2QUF A;  1O3S A;  5JR3 A;  4M6Y A;  3D0S A;  5JI6 A;  5LBQ A;  3DPT A;  1K7A A;  2K27 A;  2FU4 A;  4XLN F;  3WTW C;  1HW1 A;  4HF1 A;  2STW A;  1RI7 A;  3KFW X;  2O61 A;  2PEX A;  4HX4 A;  2FBK A;  2A3S A;  2FQ3 A;  1HW5 A;  1YTY A;  1BOA A;  2K7L A;  1U78 A;  1XCV A;  1LDK B;  1LVA A;  3T8T A;  4IXA A; 
#chains in the Genus database with same CATH topology
 1G3T A;  4QSH A;  1UMQ A;  1I6H J;  1T08 B;  2J5P A;  1W36 C;  3F0C A;  1PVE A;  2EIN H;  4N0B A;  1IXR C;  4IQ4 A;  3BG6 A;  3LMM A;  3ROU A;  4AYB N;  1MDM B;  5EJC A;  1U2W A;  3GBG A;  2JN6 A;  3GFM A;  4OWR B;  3TO7 A;  1EH8 A;  2IVM A;  5B1A H;  2DLL A;  1SFO J;  5IOZ A;  3LWF A;  1FOX A;  2XRN A;  1FLI A;  4AWX B;  2HPM A;  2KIU A;  3BZK A;  2A6H F;  3OS2 A;  4IHX A;  1RR8 C;  1ON2 A;  1SMT A;  3HOX J;  3FBI B;  3IH3 A;  2JA2 A;  4JP0 A;  3LNQ A;  1W5T A;  4KMU X;  5FFZ A;  1O7F A;  1OR7 A;  2IPQ X;  4FIS A;  1DUX C;  1I3A A;  2KQR A;  4BY1 J;  2QEX I;  5E1Z B;  5DM6 F;  3S15 J;  5C44 J;  1S6L A;  5J6X A;  1IGN A;  3SDB A;  1VQ7 I;  5AIQ A;  1GHC A;  2DPU A;  2X85 A;  1TWA J;  4BYY A;  1JKP C;  2HTS A;  3B6C A;  3DCF A;  1HLV A;  1E3P A;  1SAU A;  5HLH A;  1V55 H;  3K7A J;  1MBK A;  4OMZ A;  2Z99 A;  3D5S C;  4HZF A;  2RNJ A;  1SFU A;  3VSL A;  3HOV J;  4FX4 A;  2WC2 A;  3OOU A;  1EV7 A;  2VT2 A;  2E71 A;  2HDD A;  3GME A;  3K1M A;  2M7B A;  1TLH B;  1FIA A;  3K10 A;  1JT6 A;  1U6G A;  2D1V A;  2DA1 A;  3FXK A;  2OC6 A;  1KGS A;  4EJV A;  5D5V B;  1XDU A;  2V9V A;  3MMY B;  3MCZ A;  3WTV C;  5DYM A;  2V6C A;  2Y75 A;  1TNS A;  3M3Y J;  1KQ0 A;  4I02 A;  4C2M J;  3OYK A;  2WAF A;  5K7F A;  4CCK A;  4HG2 A;  1WJC A;  2AQE A;  3HIF A;  1HDD C;  3HTS B;  4OIO F;  3GTO J;  1KU9 A;  4M3G A;  5LLQ A;  3JSP A;  2E1N A;  2LRE A;  1BJA A;  1ZHF A;  1STZ A;  4MNU A;  1PUF B;  2XAJ A;  2ISY A;  3WU0 A;  2QQ9 A;  3PQJ A;  1G8X A;  3K1P A;  3VOE A;  4ZYE A;  4NC6 A;  2A5W A;  1D3Y A;  3I59 B;  4HF0 A;  2XSD C;  1CF7 A;  2FXA A;  4L9N A;  1H88 C;  1X2M A;  2DQL A;  1ITY A;  3BRO A;  1FSE A;  4HNT A;  2CUZ A;  4WF2 A;  3L7W A;  3ESW B;  1P4X A;  5F27 A;  1R1V A;  4JQF A;  2F4O B;  2RDP A;  1T6S A;  2NS8 A;  5FKN A;  2CMP A;  2LG4 A;  2MGQ A;  4CDG A;  2VE8 A;  2IS2 A;  2DI3 A;  3F8C A;  3K4C A;  1U3E M;  1KU3 A;  3FXO A;  3ZOB A;  4KIG A;  5FD5 A;  4BH9 A;  2MLG A;  2G7H A;  1HKQ A;  3F3X A;  3KLO A;  1J9I A;  1U5T A;  2W4S A;  3DV8 A;  1OYI A;  5E1X A;  1JI8 A;  1Y6I A;  5GTH C;  3BR2 A;  2W24 A;  2R93 J;  1XTA A;  4RDU A;  4XLE A;  3GTG J;  2UV1 A;  3VEP A;  4C3I J;  3ZQF A;  3MQ0 A;  5HDK A;  2EA4 A;  4KIB A;  4O5V A;  2EZK A;  2ICW G;  1Z3Y A;  2HYF A;  3WTU C;  4OIQ F;  4B09 A;  2A6T A;  3DFG A;  3RDI A;  5J1Y A;  4V2F A;  5FLX Z;  5FLX K;  3RSN A;  5LRS A;  3BG3 A;  5CVI A;  5EEG A;  1UG2 A;  2H6C A;  2HDW A;  3H36 A;  2DCE A;  2X48 A;  4XL9 A;  3O6B B;  1KU7 A;  3W6V A;  2WAD A;  3WHC A;  1X1D A;  1EA3 A;  4UV8 A;  1ZK8 A;  5K1Y A;  2EV5 A;  2FX0 A;  2OU2 A;  4J00 A;  1FEX A;  1DPR A;  3KIO A;  2R7F A;  5H6Q A;  4LLL A;  2L01 A;  2Q2E A;  1D0Z A;  1SEU A;  3GLX A;  2R5Y B;  5IT3 A;  1YX3 A;  2QBY B;  4C3H J;  2BEO A;  1RUN A;  2K9N A;  2X1D A;  2NYX A;  4KNY A;  2RN7 A;  4CIC A;  3KZY A;  1T8I A;  3FXR A;  1FMW A;  1V5F A;  5E3N A;  5M3F J;  4XLC A;  2NS7 A;  3HRT A;  3VFZ A;  4AID A;  5KAF C;  2B63 J;  2XC7 A;  4GFB A;  3ECO A;  3KEO A;  2M87 A;  3MVP A;  1S7E A;  2R5Z B;  4BXU A;  5BMZ A;  1X3U A;  2KLO A;  1Y39 A;  3PUB A;  1Y8Q B;  4UB6 C;  3HOS A;  3L9F A;  2NVU B;  1HKS A;  4A12 A;  3ZR8 X;  3HC7 A;  5JFR A;  1ONV A;  3GTK J;  2L0K A;  3RZD J;  1LE8 B;  3KLN A;  2VOP A;  2XGX A;  5B5E C;  3E5U A;  3IV5 A;  1B72 B;  3JSO A;  4NHJ A;  4CGZ A;  4LIT A;  3KYC B;  1T98 A;  4MFE A;  3HKZ A;  1MMN A;  2HOA A;  2ECB A;  4QPO A;  2KIF A;  2R7Z J;  2F5V A;  4XK4 A;  2ETH A;  1LUJ B;  3QOD A;  3BPV A;  3WHB A;  3IKT A;  3G73 A;  1R58 A;  5HOO A;  1K61 A;  4XRS A;  3E6D A;  3SEZ A;  4JX6 A;  2VQG A;  4EM1 A;  2DO7 A;  2K86 A;  4KIF A;  4J19 A;  5ICF A;  2GXB A;  3K4M A;  2NVQ J;  3HTU A;  4G7Z F;  5IPA A;  4OOI A;  1ZTR A;  4YFK F;  3BQZ A;  4N4O B;  3BR1 A;  1UJ8 A;  1N75 A;  4IHV A;  5KNL A;  4MTD A;  2XF6 A;  4ZYH A;  2HI3 A;  5J8F A;  3Q0U A;  4A3K J;  3C18 A;  2W57 A;  3VPR A;  3HM5 A;  2L3D A;  1DQU A;  3HRS A;  3M07 A;  3CCY A;  3PNT A;  1JUM A;  4HDV A;  2DMQ A;  3Q5F A;  1YHQ I;  4RM2 A;  2WV0 A;  3OS0 A;  3WTX C;  2HOE A;  2XVC A;  3S1R J;  4XSX F;  4WXD A;  5IT9 K;  2KT0 A;  4KJZ A;  4BBR J;  5CVR A;  3EET A;  4UVC A;  4IOC F;  4EM0 B;  3LSJ A;  3UKG A;  2L54 A;  2Y9Y A;  1F9N A;  4RLQ A;  4I76 A;  2R7Q A;  3QYB A;  2WB1 A;  1CQT A;  3S32 A;  1WJD A;  1R71 A;  2KDO A;  2B9S A;  2BVM A;  1LFP A;  3SZT A;  3KCC A;  1FC3 A;  3HEF A;  1Z91 A;  2XRO A;  3F22 A;  2P4W A;  3I58 A;  4IOA F;  3MKY B;  3IP4 B;  2W25 A;  4U87 A;  2IGK A;  2M4G A;  1Y0U A;  3RCO A;  4DQ2 A;  1XC5 A;  4NQW A;  5E3L A;  4DYQ A;  3RYR A;  3P9C A;  4WX9 A;  2K4J A;  5EZH A;  4Y13 A;  2CW8 A;  2IJL A;  3U21 A;  3E6B A;  3AAF A;  3HYI A;  2QA4 I;  4PJL A;  1T33 A;  1ZN2 A;  3CQZ J;  1VTN C;  3HUG A;  4D5F A;  3GZ6 A;  1AOY A;  2E2I J;  4WK8 F;  1MBF A;  1FOY A;  2HVS A;  3JW4 A;  4OU0 A;  2ELK A;  2P7V B;  4KT5 C;  2JPB A;  4KN4 X;  3J7A Y;  4RAZ A;  5FRO A;  3S14 J;  3FXJ A;  1H9T A;  3FDY A;  1QPI A;  3LSK A;  3QWL A;  4OIN F;  4CUG A;  4ABZ A;  2OPT A;  1VF9 A;  2MH2 A;  1Y56 A;  3RJP A;  2FRH A;  4IRH A;  3Q3S A;  1BOB A;  2ZJP F;  1YS7 A;  2A05 A;  2K4B A;  2DXI A;  4L9T A;  1CF7 B;  4Y4R A;  5E18 F;  2K9S A;  5J3L A;  3NAU A;  2O5R A;  4DYR A;  3I54 A;  4UB8 C;  2ZNY A;  1Z6R A;  3SFZ A;  1SD6 A;  2Y0S A;  3J80 K;  3J80 Z;  2LVS A;  2DMT A;  3N97 A;  1T38 A;  3WG7 H;  4Y52 J;  3PIP F;  5HLG A;  4M9Z A;  2GOX B;  5TJJ A;  3I4M J;  1SMY F;  1TT5 B;  5CYV A;  1XMX A;  5E17 F;  3V4G A;  4A3J J;  3DTK A;  3MWM A;  4MHG A;  3DPL C;  3JR9 A;  2GOM A;  3IC7 A;  3TBI A;  2GQQ A;  4PSW A;  4U88 A;  3M1E A;  1U5T B;  2DJN A;  1VQP I;  1TWC J;  3JRG A;  3CJQ B;  1RC9 A;  3GW2 A;  5LHI A;  4A3B J;  3BTC A;  1XG1 A;  3G1L A;  1YIO A;  2EFN A;  3JRA A;  4ESJ A;  1I3Q J;  2LR8 A;  2P6T A;  4M9X A;  4L0Y B;  2Y31 A;  1F43 A;  2KPM A;  4NB5 A;  1S7O A;  4AD9 A;  4DIQ A;  2BGC A;  5JVT A;  2V26 A;  3ELK A;  3CCV I;  5GPC A;  1FBU A;  1TW3 A;  1W5S A;  1BIB A;  4HX8 A;  2E1O A;  2ZXH A;  2BXZ A;  3P9K A;  4XRM A;  2DYR H;  2E2J J;  1PP8 F;  1Z77 A;  1K6Y A;  2N8G A;  2VXD A;  3Q0V A;  1K6O A;  1VI0 A;  3GFJ A;  2IA1 A;  2Q2E B;  2WAQ A;  3O8G A;  2TCT A;  1QA6 A;  1ZEL A;  1IUF A;  1ZRE A;  5AIP A;  4ZTF A;  3JRF A;  4FQG A;  2HVR A;  3CES A;  3OYA A;  3OYJ A;  1R22 A;  1JXS A;  2F6C A;  1MH4 A;  3CUQ A;  3JRH A;  5CQE A;  4JX5 A;  1GVJ A;  2PFB A;  4HSR A;  3E1S A;  1VQ4 I;  2Z16 A;  4GGG A;  3RQI A;  5CKT A;  5EDN A;  4LK1 F;  1YG2 A;  3CP2 A;  4PGH A;  2M45 A;  1UHW A;  1V3F A;  3FIW A;  2PN6 A;  3H5N A;  3K0L A;  4P9F A;  3VYR B;  5L3D A;  2I8D A;  2LF7 A;  3EDP A;  3L2C A;  2XGE A;  4ZDL A;  2W1O A;  4HQM A;  2KDZ A;  2JSP A;  2QKM B;  4A3F J;  4ZTJ A;  3HRM A;  3L00 A;  2DAO A;  3BCB A;  1LQ1 A;  2EB7 A;  2H8W A;  5FKO A;  5CJ9 A;  4U0W A;  1FOW A;  2F48 A;  2X0L A;  4BGD A;  2A68 F;  3JRE A;  1F5T A;  2K85 A;  2QZ8 A;  2QQB A;  5GPA A;  3FHN A;  4EV0 A;  1MBG A;  3QPS A;  3QYE A;  4XKW A;  2TRT A;  2JA5 J;  3ZMD A;  2IS4 A;  5HDG A;  1ZR4 A;  2X6W A;  1G6N A;  3S8P A;  2OA4 A;  1IV6 A;  3RKY A;  2R92 J;  1BM9 A;  1XGM A;  4M3B A;  1HKT A;  4QLC U;  2ESN A;  5E1W A;  2M4K A;  2GAU A;  3KP5 A;  4CCL A;  2E7W A;  3CTA A;  1IO2 A;  4HRI A;  1RRJ A;  2LTP A;  2QEN A;  3I71 A;  2P8T A;  4IPA A;  2FUG 2;  2K3P A;  2DW4 A;  5BPD A;  3WU2 C;  2PJR B;  1NG7 A;  2CYY A;  1YS6 A;  2FA5 A;  1FYK A;  1X3Z B;  2W82 A;  3NAR A;  1ZAO A;  3CMA I;  3G1O A;  3ERM A;  3HKZ N;  4B3A A;  3D1N I;  1ZLJ A;  1MMG A;  2BY0 A;  1BJZ A;  1T0F C;  1HSJ A;  3GO5 A;  4L5E A;  3WG9 A;  3Q9V A;  4FCY A;  2IS6 A;  5J4Y A;  4EEF G;  4G7H F;  4P9U A;  4PJM A;  3OL4 A;  5CVJ A;  2CV1 A;  4MIM A;  3ZQQ A;  1DP7 P;  3CO6 C;  4GYG A;  2JSC A;  3PQK A;  2O8X A;  1PP7 U;  1OMI A;  5LEJ A;  4EVI A;  3AL0 C;  1OLT A;  2CU7 A;  2F2E A;  2I10 A;  2O9L A;  4F52 A;  2DDB A;  5K7Z A;  3OS1 A;  2QLZ A;  2Y0M A;  3F72 A;  1E0E A;  1YO5 C;  5IP9 J;  1JT0 A;  2JQ7 A;  2G0E A;  1R36 A;  1KYW A;  2QVO A;  2JVH A;  3H0G J;  3K4L A;  3PSF A;  3MKZ A;  2YS9 A;  3LQQ A;  4WXH A;  3OOP A;  2PMZ A;  3HBL A;  4PK4 A;  1ON1 A;  4I6Z A;  1OPC A;  1IRX A;  3HHG A;  3HUG B;  2VKE A;  1V5G A;  2YPR A;  2M2E A;  1MMA A;  3H3V K;  1BR2 A;  2ME6 A;  4YEL A;  2LK2 A;  4A6E A;  3HOZ J;  3FK7 A;  3HL2 A;  2F5D A;  2YU9 J;  3F8M A;  3KZZ A;  3CME I;  2BW3 A;  2V9K A;  1YW9 A;  2FD5 A;  2RC4 A;  4CH7 A;  4PUS A;  3ZMV A;  4MO7 A;  2KKO A;  3MKW B;  1D0Y A;  1TL8 A;  4HYE A;  4IVN A;  2B7E A;  4EJO A;  1YQA A;  2A61 A;  4BHP A;  4NBQ A;  1FY7 A;  3ZN0 A;  3O3K A;  1WFX A;  2ME0 A;  2XB0 X;  1V4R A;  4IZZ A;  1G59 A;  2OZ6 A;  2VQC A;  2NVX J;  3W6J B;  5E20 A;  2Z9O A;  3V7C A;  2E5N A;  4S04 A;  2JA8 J;  2E1C A;  2WY7 Q;  1IXC A;  4BXF A;  4KFC A;  3CUQ C;  4M74 A;  4XM3 A;  2K9M A;  1BI0 A;  4EQQ A;  3DKW A;  3AL0 B;  2FJ1 A;  2UZK A;  3HRU A;  2CO5 A;  3U2R A;  2LRD A;  3OYM A;  2HZD A;  4LFU A;  2ZXJ A;  4RM3 A;  4CCM A;  3R4K A;  3S1Q J;  4BY7 J;  3DQV C;  3KEQ A;  3NWT A;  5ICG A;  3E6C C;  3HOT A;  1X4O A;  2CUF A;  1XN7 A;  1K78 A;  1YYV A;  1E17 A;  3CC7 I;  3WTT C;  1QHH D;  2VQH A;  3OV8 A;  5D4R A;  1MD0 A;  2KIS A;  2QQ8 A;  3PNV A;  1J59 A;  1AKH A;  2W7N A;  2Y2Z A;  2EIJ H;  2M0C A;  3B6A A;  3BCA A;  2GWR A;  3PJR A;  2BHZ A;  3OYN A;  5M3M J;  1JKO C;  4RLF A;  2KL4 A;  4HX7 A;  2QF7 A;  3IHU A;  5F1R A;  4KIC A;  3TMO A;  1GV5 A;  1WI3 A;  1YW8 A;  5HLI A;  4A3L J;  2RQQ A;  4KUM A;  4BJ6 C;  1P7J A;  3CJR B;  3O2P E;  2NOG A;  2UWM A;  1D8J A;  2Y0S N;  4AUX A;  2EQR A;  2OTJ I;  2XV4 S;  1YW7 A;  2LBF A;  2ZKZ A;  3CDH A;  1ZAR A;  4UUV A;  2DFF A;  2L2O A;  1D1A A;  2DN0 A;  2ZJQ F;  2D45 A;  1EJ9 A;  1U0J A;  4C2T A;  4QTR A;  3F8F A;  2M1B A;  2KJC A;  3GXO A;  1FPQ A;  1IN5 A;  1N77 A;  1FT9 A;  3IAS 2;  1UG0 A;  5FLM J;  5J8C A;  4BDZ A;  4BEH A;  1P92 A;  4KMF A;  3SFI A;  2E36 A;  4U0V A;  3HHH A;  3L2Q A;  3ZGK A;  3FMQ A;  3CMM A;  3GTM J;  4AVZ A;  1BR4 A;  4WXC A;  1QVU A;  1XDS A;  3TP3 A;  3CUQ B;  4GO1 A;  5D6F A;  2BHY A;  4BL0 B;  5BPI A;  4OAY A;  5F6F A;  1ETX A;  2V9P A;  4S05 A;  1QVT A;  4LB6 B;  1VQM I;  2DMP A;  5ERI A;  4HEA 2;  4II2 A;  3ASN H;  3OYF A;  1TT0 A;  3U1K A;  1ETK A;  2XAH A;  2NS0 A;  5LGU A;  1JJ6 C;  4XN0 A;  2MA3 A;  2KZV A;  1JHH A;  4XLA A;  1RPW A;  1A04 A;  4M3D A;  2NRA C;  2EFO A;  3S2D J;  2O03 A;  1MBH A;  1H0M A;  2RGV A;  1LEB A;  3IKV A;  4CO8 A;  5KAI C;  2RAE A;  2GZW A;  4UY8 I;  3HPG A;  2Q8K A;  5ICE A;  2XAS A;  5DV5 A;  3K70 C;  2OQR A;  1ZKG A;  3F8B A;  1SAN A;  3A0B C;  5K7H A;  3TOB A;  3L2R A;  3JCU C;  1F1Z A;  1G3W A;  3QAH A;  4UVB A;  2OJE D;  4I2O A;  1P4W A;  2Z3Y A;  2OBP A;  2KIM A;  2MBF A;  4A93 J;  1VQ5 I;  4NC7 A;  3A1Y A;  5LHH A;  3E7L A;  3EQL F;  3ZPL A;  4A0Y A;  5BNG A;  2HQR A;  4ZDO A;  1Z7U A;  2V4J C;  3R61 A;  4W97 A;  4FHT A;  3S1N J;  4ANJ A;  1BI3 A;  2HOT A;  3GVA A;  4RGS A;  1T56 A;  3V8L A;  2VKH A;  2KZG A;  2DA3 A;  4R8H A;  3TQN A;  4DYC A;  3N4M A;  3BT9 A;  1TWH J;  4JX4 A;  5HS9 A;  1W7P A;  4KIT B;  1ZH5 A;  1MKM A;  4AIK A;  5EZG A;  1P7I A;  3GWZ A;  5H2F C;  2CJJ A;  4OMY A;  1X4P A;  5IP7 J;  1H8A C;  3M8J A;  2Z5U A;  4I7H A;  1BA5 A;  1JUP A;  3OR1 C;  4QIW N;  2JMW A;  4MEY F;  4E7J A;  1YJN I;  3M9A A;  2NXN B;  1WRJ A;  5F08 A;  2ZJR F;  4ZH4 F;  1XX5 A;  1W0U A;  2XSJ C;  3V7R A;  5L3B A;  2V6E A;  1B6A A;  1HC8 A;  2GM4 A;  4OIR F;  2EIL H;  2BE5 F;  4YEJ A;  2XRL A;  4NDL A;  1XSV A;  1OCZ H;  4CCO A;  3H3Z A;  3WTZ A;  4Z6Y A;  3CLO A;  2IBD A;  2XPW A;  4D1Q A;  4D7M A;  1X58 A;  3FX3 A;  1RKT A;  2AQF A;  2VIX A;  4L9J A;  2C6Y A;  5LD2 C;  1VQ8 I;  2DMU A;  2ESH A;  2M5W A;  1OJL A;  1IW7 F;  1DU0 A;  2F5E A;  3H0D A;  2VOD A;  1WZ2 A;  1U9N A;  5EEA A;  4ZYD A;  5E3O A;  4BUP A;  2R7X A;  2MLK A;  2DJI A;  1E3H A;  3S16 J;  1UHS A;  4XRF A;  1OCR H;  5CVU A;  3U1D A;  4G6D A;  1W7P D;  2OV7 A;  2XPV A;  1ZQ3 P;  3HOY J;  3BOQ A;  3MZ8 A;  2CQQ A;  2IRF G;  1GDT A;  5GAD J;  4N9H A;  1RIO H;  2Y30 A;  3FBN B;  3H5R A;  3KP4 A;  1GUU A;  1SVM A;  3D5R C;  5L3C A;  4YFN F;  3DU5 A;  4GYI A;  3OSF A;  1MMS A;  2ZO4 A;  3OYD A;  2BW3 B;  3RI4 A;  3G71 I;  2E2H J;  2P5K A;  1FZP B;  2BY3 A;  3AG1 H;  2DYS H;  2LSO A;  2P6S A;  2H94 A;  3CCM I;  5LEK A;  4YIR X;  1BI1 A;  1OR7 C;  3H9J A;  4DBR A;  5LGT A;  5DUK A;  4ZZL A;  5ED4 A;  2DA7 A;  2QQA A;  3QRF F;  3FM3 A;  1V5E A;  3JAM Z;  3JAM K;  1IZ1 A;  3V8J A;  3M8F A;  4PCQ A;  2ZJ2 A;  4R1H A;  3I64 A;  4II3 A;  1NH3 A;  3HZJ A;  5M5Y J;  5FLV A;  2DQR A;  4ZZD A;  4FX0 A;  1ZYR F;  5F0H A;  2E1M B;  3DU6 A;  2A69 F;  4AU7 A;  2A07 F;  4RB1 A;  3VYS B;  2R7W A;  3TW7 A;  4MEX F;  2PMZ N;  3R0A A;  2CW0 F;  4RAY A;  3I56 I;  1Y1V J;  5B1B H;  1G4D A;  2D1H A;  3OYI A;  2M0M A;  5ILV A;  2QSF X;  2ZC2 A;  1Z0X A;  4BHB A;  2RRE A;  3CCJ I;  2L02 A;  1S8N A;  4UNO A;  2CQX A;  3C1D A;  3G3Z A;  4V19 K;  3F9K A;  3BG5 A;  3BP8 A;  2QSG X;  1IG7 A;  1T95 A;  2KFD A;  3H9Q A;  1K78 B;  2K9Q A;  4FT8 A;  4G6Q A;  4ZC3 A;  2R7O A;  4RGX A;  4A0Z A;  2DU9 A;  1FWZ A;  1DGR M;  1ZGJ A;  3I0T A;  1AKH B;  5JLW A;  2PBI A;  4KA4 A;  2ISZ A;  1U8B A;  4FTH A;  5AON A;  1WKM A;  1VQ6 I;  5IY5 H;  2V1X A;  4ASN A;  1A5J A;  4XON A;  1I1S A;  4PSX A;  4M71 A;  1SD5 A;  4HW0 A;  5JVG F;  3PO3 J;  1D8K A;  1BW6 A;  5CLS A;  1ETO A;  5IT9 Z;  1X1P A;  4JOM A;  4L9V A;  5FGM A;  2VJJ A;  3S2H J;  2VJ4 A;  3BC8 A;  2KP6 A;  3CC2 I;  2O0Y A;  4X6A J;  4ZYA A;  3S93 A;  2LBF B;  3F6O A;  1NTC A;  1POG A;  4XQF A;  3PO2 J;  3TL4 X;  2ZXW H;  2IT0 A;  1IUY A;  3EUH A;  3W6K B;  4XNF A;  4XOT A;  1J0R A;  1JTY A;  5J1U A;  3ISP A;  4HPQ A;  2RQP A;  5TIS C;  3GTQ J;  3IWZ A;  1MIJ A;  4NC8 A;  4A3G J;  3CUO A;  2XKP A;  1ZG1 A;  2GBY A;  2H6B A;  1RZ4 A;  2VPR A;  4G94 A;  4MTE A;  1IDZ A;  2H1L A;  1HCR A;  2ELH A;  1Z7L A;  2KRF A;  4YG2 F;  2QWW A;  1F36 A;  3V7S A;  3DEW A;  2X6Y A;  3E5X A;  1P4A A;  1IJW C;  3DBR B;  1U5T C;  2P0W A;  4U0Y A;  3QPT A;  2LY9 A;  3DBH B;  3NQO A;  2LDU A;  3RYP A;  2X6X A;  1XCB A;  4EJW A;  3HXL A;  5IYB J;  1K79 A;  1DPU A;  4AIH A;  1WQ2 A;  4AM3 A;  1Z67 A;  1HBX G;  1ZRC A;  1W4M A;  4RA2 A;  2KIQ A;  3BJA A;  3FKI J;  4O3M A;  1LVK A;  2KRC A;  5DEQ A;  1SVO A;  3U9G A;  1TQM A;  1UB9 A;  4AIJ A;  3DF8 A;  5IYD J;  2OQG A;  2XGD A;  2RV8 A;  3QU3 A;  4UXN A;  1EF4 A;  4EMS A;  2CG4 A;  3OIP A;  2DT5 A;  2UXN A;  5TGT A;  3HSF A;  1R00 A;  1IV8 A;  2FOW A;  2XIG A;  3LA3 A;  2EWN A;  2K5C A;  1R7J A;  4H4K C;  1G2H A;  5DDG A;  4I0A A;  1OCO H;  1FOK A;  2QYO A;  1QNT A;  3OYL A;  3I53 A;  4U7B A;  2ZNZ A;  1SAX A;  3HGY A;  2VAS A;  3GLL A;  5JLX A;  2WY8 Q;  3GEZ A;  1A35 A;  3LSI A;  1W7P B;  4IHW A;  3H9G A;  1H89 C;  1J5Y A;  2DA4 A;  2QGU A;  2L7Z A;  2VI6 A;  2AXT C;  3G1M A;  4JK1 X;  3SHF A;  1XGN A;  2R7D A;  2K40 A;  4B48 A;  5GTI C;  1ZR2 A;  1S72 I;  2HTJ A;  4M6V A;  3VOD A;  2M7A A;  1LEA A;  3E0J B;  4WCG A;  2VKV A;  1KQ8 A;  3K4K A;  1UST A;  4X0G A;  3FKJ A;  1ZG3 A;  1R9T J;  2JUG A;  4CZC A;  2JPC A;  2MH9 A;  2R7V A;  2ZME A;  1QBJ A;  5H20 A;  4FAS D;  1PUE E;  5FRM A;  3IWF A;  4DJA A;  2A6E F;  5HS7 A;  2E60 A;  3J7Y J;  2HXO A;  2IA0 A;  4P5O A;  4DZP A;  5L3F A;  2DPD A;  1UAA A;  3P5J A;  4A6D A;  3DP7 A;  3FXQ A;  3LSH A;  3BJO A;  2MW8 A;  3TO6 A;  3KE2 A;  2BVL A;  5D5W B;  1IN4 A;  2HKO A;  3NWS A;  3COA C;  1AU7 A;  1LNW A;  4RB3 C;  4M72 A;  4E7K A;  2KHM A;  3NEU A;  5E8G A;  1QHG A;  2JWT A;  3VSK A;  2LKP A;  5F1J A;  4A5M A;  5D5X B;  1VQ9 I;  2HYJ A;  4DOZ A;  3BLY A;  5DD4 A;  2Z1D A;  2PG4 A;  4EAT A;  5EG0 A;  1HF0 A;  1FTT A;  3OSG A;  3S17 J;  3P7N A;  3SZP A;  5J1R A;  1XSX A;  2RNG A;  3QPL A;  1JUS A;  4TV7 A;  1HDP A;  2ZFW A;  1R49 A;  5FKM A;  4EM2 A;  3K4B A;  3ABL H;  4MGR A;  2IXS A;  4KN7 X;  4JBA A;  3R6S A;  1MJB A;  5LFA A;  4IX7 A;  4GCV A;  4K2E A;  4D5C A;  3QU6 A;  1DU6 A;  2DOF A;  1ETV A;  2Y69 H;  1ZG5 A;  2DT6 A;  2EA2 A;  3G2B A;  3GZ5 A;  4LB5 A;  5D5U B;  3GTL J;  1HA8 A;  1GLN A;  3AG3 H;  1MGT A;  2EFP A;  3CD6 I;  2IGN A;  1X19 A;  3LSM A;  3WE3 A;  2L9V A;  4XKV A;  4FE7 A;  3BJ6 A;  3FMR A;  4B8X A;  2HOS A;  5J47 A;  2EZI A;  3ZQ7 A;  4DW6 A;  4RB0 A;  3ZMU A;  2LKX A;  4D9J A;  3PNY A;  3CCQ I;  5DS9 A;  1R5H A;  1LFB A;  2YSR A;  3DTI A;  3G4S I;  3K69 A;  1IXS B;  2YX7 A;  3DKY A;  3IRR A;  1TQP A;  3BG7 A;  4XOR A;  1MSE C;  1I39 A;  3MD2 A;  2X6O A;  5FO5 A;  2VQL A;  3ABM H;  3DEE A;  2G9W A;  2FSW A;  3QP6 A;  1BC8 C;  1QGP A;  5EGO A;  4IRI A;  3FF5 A;  4KT6 A;  2HGC A;  2I5U A;  4M3E A;  3TOA A;  1HQC A;  3LL7 A;  4QPQ A;  1N78 A;  5FRN A;  4HLX A;  5K5Q A;  4I98 B;  2CGP A;  2XAQ A;  1ZGW A;  1X1A A;  5ICC A;  2CH0 A;  2LLK A;  1B1B A;  2FNP A;  2JT1 A;  1XGO A;  1OQY A;  1LKX A;  1O3T A;  3TDZ C;  4H0E A;  1WJF A;  2LF8 A;  4IO9 F;  3PUF A;  5C3E J;  1WH5 A;  2AXL A;  1JGG A;  1MJA A;  2EFQ A;  2L5Q A;  4OIP F;  2MD0 A;  3C2B A;  3OMY A;  3KPH A;  5CPR B;  5BOX A;  2YU3 A;  1BIA A;  4F91 B;  2FBI A;  3QP5 A;  2GIV A;  2W85 A;  1W36 D;  5IYC J;  4L5I A;  4BS9 A;  4HBL A;  3H35 A;  2LP0 A;  2DTR A;  3A02 A;  4IL6 C;  1VQK I;  2JK3 A;  4LK0 F;  4NUB A;  2V1N A;  4E70 A;  2YX4 A;  1RET A;  1QZZ A;  2ZSI B;  3CC4 I;  3C7J A;  1FJL A;  4DZJ A;  1GXQ A;  3EUA A;  1O4X A;  2J5O A;  5JHU A;  2ZBK A;  3DXJ F;  2OUM A;  4ENM A;  4NQW B;  5FB2 A;  3ZQI A;  2HWV A;  2BOL A;  1W0T A;  3K4J A;  4GXO A;  2HQN A;  3WTY C;  3OYG A;  1XD7 A;  3I5U A;  4B47 A;  3LST A;  4HA8 A;  4L18 B;  4Y7N J;  3GFL A;  1R4N B;  4KYW A;  1KZH A;  1K4S A;  2OF7 A;  1VQO I;  1HW2 A;  1TTY A;  4F3Q A;  1USS A;  5EF6 A;  1ETQ A;  4BE2 A;  2HXI A;  1ETW A;  2LMD A;  1J2X A;  1FMV A;  2BYV E;  4LG0 A;  2XF7 A;  1EKE A;  2R7U A;  1K4T A;  1U9O A;  3IH2 A;  2VUM J;  1R1U A;  2WB1 N;  2FML A;  3KET A;  1YIJ I;  3V42 A;  1NK3 P;  1EH7 A;  2DT7 B;  1X1C A;  3SYT A;  4ENK A;  2HU9 A;  2JJ7 A;  4F7Z A;  1I1G A;  4BE0 A;  3W2A A;  4AVP A;  4D0P A;  3P9I A;  3OYH A;  2XHK A;  1NHA A;  4CZZ A;  4EJU A;  2GXA A;  4A3C J;  3LA2 A;  4A5N A;  4ENN A;  4IHT A;  1YJW I;  1BW5 A;  1FIP A;  3K9T A;  3ZCO A;  3FXU A;  2R5Z A;  3MZH A;  4RGR A;  2R3S A;  3I4P A;  3FHZ A;  1S3J A;  4BHC A;  2BY2 A;  4BU2 A;  5FFX A;  3RKQ A;  2H27 A;  4AC0 A;  2VB6 A;  4PZJ A;  2HYG D;  2G7U A;  1R23 A;  2XAU A;  3SXY A;  1F4K A;  2ZSH B;  5E8I A;  2PMH A;  3CMY A;  3KP2 A;  3WGG A;  4XOP A;  1Z3X A;  2ELJ A;  1MJ9 A;  3M8E A;  3SDG A;  2LC2 A;  4KIS A;  3S3M A;  1BL0 A;  2ECC A;  4ITV A;  4HLY A;  1WJ5 A;  2ID3 A;  2R4G A;  1SFK A;  2FQ4 A;  2ID6 A;  4M9S A;  3J81 Z;  3J81 K;  3WOD F;  2P5L C;  2Y9Z A;  4G7O F;  4QWQ A;  4BXX J;  4HAM A;  5EEH A;  3AKZ A;  3UNG C;  2K02 A;  1P2F A;  3GCM A;  4IQJ A;  1RUO A;  3ZQH A;  5C4J J;  3GYH X;  3CO7 C;  4UUS A;  1ETY A;  2ZME B;  2MYS A;  3HOU J;  5D8K B;  3BTL A;  4BQA A;  4LG3 A;  4I99 C;  2COM A;  3MKL A;  5LHG A;  1OYY A;  2Y48 A;  3BZ6 A;  5HOD A;  3EUK L;  2MFZ A;  1SD7 A;  2XGC A;  3CZ6 A;  5ILS A;  3MAJ A;  2FE3 A;  2IGM A;  3EPZ A;  2QM3 A;  1S7A A;  4CSW A;  1NK2 P;  3FXM A;  2VKD A;  2OCC H;  4KDP A;  3QOE A;  3TED A;  1D1B A;  1KU2 A;  1UCR A;  3CCR I;  2FNA A;  3TDU C;  1LPQ A;  1Y0N A;  2VBW A;  3KX2 A;  2W00 A;  4F92 B;  3ZN1 A;  3G6E I;  4PFO A;  5EG0 B;  1OCP A;  1I5Z A;  3REO A;  3AG2 H;  1I6X A;  1OCC H;  3IL2 A;  2CS3 A;  3J7Z I;  1GT0 C;  3KYL A;  2ADU A;  1Z9C A;  2XF5 A;  3A4C A;  5FD6 A;  2YUS A;  2QSH X;  1XGS A;  3GZN B;  3I4N J;  3OYC A;  3T0Y A;  4EGZ A;  3BPX A;  2RKH A;  3JRI A;  4IEJ A;  4BAY A;  3F8N A;  1OYW A;  1TW2 A;  5KK1 A;  5L3G A;  2VON A;  1WJE A;  4Y15 A;  4HQE A;  2DTZ A;  5DTD A;  3ZMT A;  2FMY A;  2COB A;  2DK8 A;  4XRS G;  3VYT B;  3PFI A;  3R0J A;  2TDX A;  1BR1 A;  2LD5 A;  4RMN A;  3CF2 A;  4B1R A;  5A2Q Z;  1BN5 A;  5DUI A;  5A2Q K;  2STT A;  4Q5S F;  2IS1 A;  2WAQ N;  3CLQ A;  1GVD A;  4GRI A;  2LFB A;  3T1B A;  3ERE D;  1L3L A;  1VFC A;  2CQN A;  1IN6 A;  2L7F P;  3H1C A;  3LAJ A;  1B4A A;  1FP2 A;  3JRD A;  2K3F A;  3PL8 A;  4PJJ A;  4DNC A;  4FET A;  2EFW A;  2HEO A;  4MLO A;  2X1E A;  2R7R A;  1WWX A;  3VWB A;  3BQY A;  4C30 A;  1M1E B;  3W3C A;  1T2K A;  2HDC A;  2LY1 A;  2EJR A;  4XKB A;  5IP6 A;  3LFU A;  3BDD A;  4HV6 A;  2VLA A;  3SZG A;  2H8R A;  2XB5 A;  1R5G A;  1YOV B;  2UUZ A;  4XKC A;  2DFE A;  2L9S A;  5EGO B;  1D5V A;  3SEQ A;  3H5A A;  4F93 B;  2E7X A;  1TQI A;  1V54 H;  1Q1H A;  4Q4Z F;  2IP2 A;  4ZYG A;  2VL8 A;  1SFX A;  2M9H A;  4A69 C;  4A3E J;  1XSD A;  1ZLK A;  4CYD A;  3PSI A;  2GIZ A;  3HSE A;  1RKW A;  1ORK A;  2HQA A;  3JTG A;  2ZFU A;  2IEK A;  3CJT B;  1WPK A;  2JA7 J;  1RR7 A;  1S29 A;  4Z2Y A;  2FEZ A;  3TP0 A;  3KP7 A;  4C9Y A;  3DBL B;  3E97 A;  2HVQ A;  2M34 A;  4CCJ A;  4ZJZ A;  2BY1 A;  3H3U A;  2EBI A;  2R7T A;  5FKL A;  3TO9 A;  2UXX A;  1YRN A;  3BR3 A;  2GXG A;  2E1M C;  3MFK A;  2HZT A;  2OZU A;  5KVR A;  2VT3 A;  1OKR A;  4XLH A;  3IH4 A;  1FBQ A;  2BBY A;  3E6M A;  4E7L A;  2BV6 A;  2L9R A;  2XAF A;  3HGG A;  4XR6 A;  3CP8 A;  5J40 A;  1AHD P;  2ACJ A;  3GUD A;  4EGY A;  1S5L C;  3QPH A;  5EYR A;  3PIO F;  1IN7 A;  2HPI A;  3TW6 A;  2V79 A;  1FNN A;  3ML6 A;  3S2W A;  3A01 A;  5HS8 A;  5F0C A;  1WI9 A;  2FF4 A;  2F5C A;  2OCE A;  2NAZ A;  1LFU P;  4RAG A;  1WSU A;  4C3J J;  2PJP A;  1X3W B;  4M6X A;  3K6G A;  3CCL I;  1B8I A;  1GXP A;  2HFH A;  2Z2S B;  2P5V A;  1XMK A;  2CWE A;  2VJI A;  5D6E A;  4LG0 B;  1HST A;  2M8G X;  5IOY A;  3OIQ A;  2L7K A;  3HJE A;  1DDN A;  1K83 J;  1B9N A;  2LYC A;  4C2U A;  3K4N A;  1WJB A;  2DOD A;  1IC8 A;  4CCN A;  3QYF A;  4P55 A;  4BQN A;  2X9D A;  5FKK A;  3S3O A;  2DFI A;  2HS5 A;  1SVL A;  5E79 C;  3ULQ B;  3RPU A;  1LJ9 A;  2EIM H;  4V2G A;  1QRY A;  2H09 A;  3ZQG A;  1Z6T A;  5D4S A;  3ZRG A;  2NNY A;  3VB2 A;  1TC3 C;  2VJ5 A;  3EYY A;  3LA7 A;  1BC7 C;  1XMA A;  3RQ4 A;  5K5R A;  3AG4 H;  3VDX A;  3K1N A;  4RGU A;  2NVT J;  2LH9 A;  4G12 A;  4DBQ A;  1R4M B;  4PGG A;  2RVC A;  1N25 A;  3HSR A;  2EZH A;  5DD8 A;  3ABT A;  2BZT A;  1A31 A;  1G3Y A;  2L9N A;  3N05 A;  2LY2 A;  1BBY A;  1TZL A;  1FYL A;  4LIV A;  3R60 A;  3BG9 A;  4CHU A;  3E3V A;  2VOO A;  3MZY A;  3O8H A;  1J7K A;  2XPU A;  3RTR A;  2F5F A;  2DMN A;  2HKX A;  1DP3 A;  3QOP A;  1W1W E;  3FM5 A;  2DBB A;  4Q47 A;  4YII A;  2L4A A;  3CF5 F;  2HNH A;  2Q1Z B;  2AS5 F;  4UUS B;  1MNM C;  2FOK A;  5HVQ C;  3C2G A;  2LKS A;  4XIC A;  1IAW A;  1MW7 A;  2WA0 A;  9ANT A;  1IRG A;  5DCF A;  2YR2 A;  3BTJ A;  1I27 A;  1PJR A;  2A5Y B;  5HNH A;  1EH6 A;  4I0B A;  2HQ5 A;  3K2Z A;  4UVA A;  3RPU D;  2XUB A;  2M8E A;  3ZQL A;  1UHM A;  2MG4 A;  2CUE A;  2CQ7 A;  2PJR A;  1TNT A;  2W84 A;  3J7A O;  5CQG A;  1IRF A;  2CUJ A;  1JTX A;  2GA2 A;  4I01 A;  3MN2 A;  4ESB A;  3JTH A;  3HDD A;  4B4C A;  4PFP A;  4BEH B;  1H9G A;  3LSG A;  2PMU A;  1S9H A;  5B3S H;  4E7Z A;  3WGI A;  1ENH A;  3GTJ J;  1P9Q C;  4GDF A;  1OIS A;  3OYE A;  2XAG A;  3BR5 A;  4IJA A;  4RS8 A;  1C0W A;  1Z1D A;  3OYB A;  2ZB9 A;  5M5X J;  1JE8 A;  3UR3 C;  3ABU A;  2CFX A;  3FWE A;  4BQQ A;  1QQI A;  1ZRF A;  4X1E A;  2GLO A;  3H92 A;  4L5J A;  4RBO A;  1UFM A;  1B9M A;  4BQO A;  3SJM A;  6PAX A;  4P96 A;  4E6K G;  2VXZ A;  2R0Q C;  1OCT C;  3LOC A;  5DCM A;  4CYC A;  3DKX A;  1JGS A;  2VBX A;  1A36 A;  4UUT A;  2X1C A;  1O57 A;  4IRG A;  4ZDP A;  3OY9 A;  4PJN A;  3FXL A;  1LDD A;  1P6R A;  2D2W A;  2MAB A;  1L0O C;  1ERD A;  4Y17 A;  4F55 A;  3CDL A;  3BR0 A;  2MD5 A;  4CA0 A;  1PYV A;  2LNB A;  3SQN A;  4G8X A;  4O6J A;  3L1P A;  3IRQ A;  2O3F A;  1E2X A;  1WGX A;  3A03 A;  3GFI A;  2OD5 A;  4IKF A;  5F04 A;  2L4M A;  3B73 A;  2JRM A;  4B43 A;  5GAH J;  2R7S A;  1UZC A;  4IF4 A;  3L2W A;  3T5X A;  2CV0 A;  1ZGA A;  2JTV A;  3ONQ A;  2VE9 A;  3BZC A;  3CCE I;  5GAE J;  4HNV A;  4AYB A;  4MQ9 F;  2IGO A;  3BR6 A;  1X1B A;  4ETS A;  1QZY A;  1G3S A;  2NVY J;  4LLG F;  1RES A;  1T0F A;  2E5Z A;  2WTE A;  3DLA A;  4MFD A;  3CCS I;  2DA5 A;  3X2Q H;  3HOW J;  4XBF A;  3DLL F;  3LFK A;  2NNN A;  3A2K A;  2EPF A;  1TBX A;  3TGN A;  4ENJ A;  4A0X A;  1YE9 A;  1MMD A;  4P1W A;  3ZMZ A;  3ECH A;  1SFE A;  2DOE A;  3WU1 B;  4EJT A;  3Q9S A;  3D5L A;  3HPH A;  5F64 A;  1FYM A;  3KZI C;  2E19 A;  4HF2 A;  1SC7 A;  2Q0O A;  2KJB A;  4Q48 A;  2PQ8 A;  2VC1 A;  4YRV A;  3F21 A;  4Y33 A;  4IHY A;  4E7S A;  2O6G E;  3IAM 2;  4G9Y A;  1ACI A;  4HNU A;  5LRR A;  5FJ8 J;  3FK6 A;  5GP9 A;  2DDA A;  1Q1V A;  2JUC A;  3VYU B;  1YIT I;  4N9I A;  4D7N A;  1T39 A;  1GV2 A;  1YRN B;  2CSO A;  3B02 A;  1MSF C;  4J01 A;  1MDM A;  1FP1 D;  2P7C B;  2B0L A;  4XSZ F;  1YI2 I;  1MBJ A;  3Q0W A;  1R5I D;  3LSR A;  4E7I A;  3L2V A;  4M73 A;  1YFH A;  4R79 A;  2EV6 A;  3OIO A;  2WV1 A;  5F0F A;  3WTS C;  3ZMS A;  3A0H C;  3GF2 A;  4LJZ F;  1HOM A;  1MZB A;  4HST A;  1AWC A;  4PDK A;  2ZXI A;  3BY6 A;  1U8R A;  3CCU I;  4ESF A;  4A3I J;  1Y8R B;  4W1U A;  1OFC X;  3JRC A;  2EIK H;  2P81 A;  4G6T B;  2CQK A;  5BQT A;  3A01 B;  3HB9 A;  1KYZ A;  3RIR A;  3ZP5 A;  1B59 A;  3DWL E;  5D8L B;  5BS6 A;  5GAG J;  5J4V A;  3CJN A;  3RPQ A;  5HLT A;  5DM7 F;  1WJA A;  4YFX F;  2V1D A;  2DA6 A;  1B8I B;  3NRV A;  3TKY A;  4BJT A;  2EZL A;  1Z05 A;  3PM1 A;  2PLY A;  1YJ9 I;  1ZRD A;  1IN8 A;  3MEX A;  2VC0 A;  1LDJ A;  4BKX A;  4MQV A;  2CFO A;  2F4M B;  4UV9 A;  3WE2 A;  1KQ9 A;  3I9V 2;  1SD4 A;  2GA1 A;  1A6I A;  4XN3 A;  3OWT A;  1JKQ C;  2VBY A;  4YIF A;  1MBE A;  2H1K A;  2MC3 A;  3L09 A;  2Z33 A;  4LMY A;  2HR3 A;  2KMU A;  2V7F A;  2IA2 A;  5HDN A;  2DOA A;  3CDI A;  4I09 A;  1BI2 A;  3EUH C;  1QO0 D;  1D1C A;  2XKO A;  3LQR A;  2IW5 A;  2E35 A;  3OR2 C;  5K5O A;  2PI0 A;  3K2A A;  3WGH A;  1QZE A;  2O8K A;  1CGP A;  4E7H A;  5KHD A;  5ILU A;  3E5Q A;  3FMS A;  1VQL I;  4BNC A;  5L3E A;  3AFH A;  4XLF A;  2EK5 A;  1YLF A;  4HDU A;  3M7G A;  1PDN C;  4RB2 C;  3W2W A;  2DK5 A;  1DGW Y;  4A3D J;  3T8R A;  4FE4 A;  3I3L A;  2DA2 A;  1O7L A;  1REP C;  3KYD B;  4CXF A;  1PUF A;  1J75 A;  1WVR A;  1FSH A;  1JKR C;  2EV0 A;  3F6V A;  3JRB A;  1XS9 A;  3LAP A;  3LSP A;  2W48 A;  3I55 I;  3V8K A;  2ZCW A;  3I59 A;  2JVG A;  2JZY A;  3DPU A;  4OAZ A;  3ASO H;  4A2U A;  4RAF A;  1HXD A;  1JHF A;  1TWF J;  2PX9 A;  3DTE A;  4Y3O A;  4A3M J;  1W5C C;  4PJ0 C;  3S1M J;  2JRT A;  4XMY A;  5M5W J;  5LGN A;  4HV5 A;  5E3M A;  1TWG J;  1IF1 A;  3HG9 A;  2M30 A;  4ON0 A;  2O7O A;  5JHF A;  2FBH A;  4HOB A;  3F23 A;  5B66 C;  1WHU A;  3DEU A;  4WWC A;  1FBS A;  1TP4 A;  5TRD A;  3OL3 A;  3BWG A;  1R6R A;  1A6Q A;  3IUO A;  1Y1W J;  2WBM A;  1J09 A;  3ZQC A;  2DFH A;  1O3R A;  2QKL B;  3C3W A;  2V1U A;  3S3N A;  1KA8 A;  1R1T A;  2JA6 J;  3RZO J;  4LLN A;  2VN2 A;  3ABK H;  1ULY A;  3M4O J;  1Z21 A;  2NOJ B;  3QQA A;  2XDV A;  2CW7 A;  1VQN I;  1ODD A;  1MH3 A;  5H6R A;  4XID A;  4LGW A;  1KON A;  1QPM A;  4B44 A;  1E3O C;  1O3Q A;  3GX4 X;  2WWY A;  2X4H A;  3RKW A;  1D0X A;  4N4N B;  4UHT A;  1YX5 A;  2AHQ A;  4M3F A;  4U7D A;  1VND A;  2BXY A;  1MND A;  1X2N A;  3C2H A;  1RNL A;  3RKX A;  3EYI A;  3KP3 A;  2ZME C;  2X51 A;  3KEY A;  3BTI A;  4LOC A;  2R5Y A;  2K9L A;  3FZV A;  1LB2 A;  2VPL A;  1WH7 A;  3FIS A;  5DCM B;  4CYC B;  1FX7 A;  4IHS A;  4XLP F;  4JYK A;  2QBY A;  4LD5 A;  2OAZ A;  2KRH A;  3KP6 A;  1D5Y A;  5CVV A;  1XB4 A;  4L0Z B;  2VBZ A;  2QUF A;  1O3S A;  3W2V A;  5JR3 A;  2E34 A;  2CV2 A;  4M6Y A;  3D0S A;  5JI6 A;  2LOO A;  3ZXS A;  5LBQ A;  2MC4 A;  4LIU A;  1QU3 A;  2EH3 A;  3DPT A;  1JJ8 C;  1K7A A;  5C4X J;  1FTZ A;  2QCO A;  1VZ0 A;  1UEL B;  2M3A A;  2MSY A;  2WAE A;  4NNJ A;  1WCM J;  1IRZ A;  2D5V A;  2K27 A;  2FU4 A;  4XLN F;  4E4H A;  1HW1 A;  3WTW C;  4HF1 A;  4BJ5 C;  2STW A;  2OTL I;  1RI7 A;  2CRG A;  3KFW X;  2O61 A;  3M1C A;  2PEX A;  4BAC A;  5HNF A;  4HX4 A;  4S0H B;  2F4I A;  1I50 J;  2FBK A;  1XPX A;  1NG6 A;  1AA7 A;  1MNE A;  2A3S A;  1IDY A;  1LE8 A;  2FQ3 A;  2IAI A;  4BDY A;  1HW5 A;  1B72 A;  3K70 D;  5KCM A;  1YTY A;  2AO9 A;  1BOA A;  2K7L A;  1U78 A;  1XCV A;  3GTP J;  4BE1 A;  1APL C;  4DGW B;  2L7M P;  3PFY A;  1LDK B;  1LVA A;  4BBS J;  4B3X A;  3T8T A;  4IXA A;  3L2U A; 
#chains in the Genus database with same CATH homology
 1G3T A;  2J5P A;  4N0B A;  1IXR C;  3ROU A;  1MDM B;  1U2W A;  3GFM A;  3TO7 A;  1EH8 A;  2IVM A;  2DLL A;  3LWF A;  2XRN A;  1FLI A;  4AWX B;  2KIU A;  2A6H F;  1ON2 A;  1SMT A;  1W5T A;  4KMU X;  5FFZ A;  1O7F A;  1OR7 A;  2IPQ X;  1DUX C;  5E1Z B;  1S6L A;  5J6X A;  5AIQ A;  1GHC A;  2DPU A;  4BYY A;  2HTS A;  5HLH A;  4OMZ A;  2Z99 A;  4HZF A;  2RNJ A;  1SFU A;  4FX4 A;  2WC2 A;  1EV7 A;  2VT2 A;  3K1M A;  1TLH B;  1U6G A;  2D1V A;  1KGS A;  4EJV A;  5D5V B;  1XDU A;  2V9V A;  3MCZ A;  3WTV C;  5DYM A;  2V6C A;  2Y75 A;  1TNS A;  1KQ0 A;  4I02 A;  3HTS B;  3HIF A;  4OIO F;  1KU9 A;  5LLQ A;  3JSP A;  2E1N A;  1BJA A;  1ZHF A;  1STZ A;  4MNU A;  2XAJ A;  2ISY A;  3WU0 A;  2QQ9 A;  3PQJ A;  3K1P A;  3VOE A;  4ZYE A;  1D3Y A;  3I59 B;  4HF0 A;  1CF7 A;  2FXA A;  4L9N A;  2DQL A;  3BRO A;  1FSE A;  4WF2 A;  3L7W A;  1P4X A;  1R1V A;  4JQF A;  2RDP A;  1T6S A;  4CDG A;  2VE8 A;  2DI3 A;  3F8C A;  1U3E M;  1KU3 A;  4KIG A;  5FD5 A;  4BH9 A;  2MLG A;  2G7H A;  1HKQ A;  3F3X A;  3KLO A;  1J9I A;  1U5T A;  3DV8 A;  1OYI A;  5E1X A;  2W24 A;  3VEP A;  3MQ0 A;  5HDK A;  2EA4 A;  4KIB A;  4O5V A;  2HYF A;  3WTU C;  4OIQ F;  4B09 A;  3DFG A;  3RDI A;  5FLX Z;  5FLX K;  5LRS A;  5CVI A;  5EEG A;  2H6C A;  3O6B B;  1KU7 A;  4UV8 A;  5K1Y A;  2EV5 A;  2OU2 A;  1DPR A;  2R7F A;  5H6Q A;  4LLL A;  2L01 A;  2Q2E A;  3GLX A;  5IT3 A;  2QBY B;  2BEO A;  1RUN A;  4KNY A;  2NYX A;  2RN7 A;  4CIC A;  3KZY A;  3FXR A;  3HRT A;  3VFZ A;  3ECO A;  3KEO A;  2M87 A;  4BXU A;  5BMZ A;  1X3U A;  3HOS A;  3L9F A;  1HKS A;  4A12 A;  5JFR A;  1ONV A;  3KLN A;  2VOP A;  2XGX A;  3E5U A;  3JSO A;  4NHJ A;  4CGZ A;  1T98 A;  2KIF A;  2ETH A;  3BPV A;  3IKT A;  3G73 A;  1R58 A;  5HOO A;  3E6D A;  4EM1 A;  2DO7 A;  2K86 A;  4KIF A;  5ICF A;  2GXB A;  3HTU A;  4G7Z F;  4OOI A;  4YFK F;  4MTD A;  5J8F A;  4ZYH A;  3C18 A;  2W57 A;  2L3D A;  3HRS A;  4HDV A;  3Q5F A;  2WV0 A;  3WTX C;  2HOE A;  2XVC A;  4XSX F;  4WXD A;  5IT9 K;  5CVR A;  3EET A;  4UVC A;  4EM0 B;  2L54 A;  1F9N A;  3SZT A;  3KCC A;  1FC3 A;  1Z91 A;  2XRO A;  3F22 A;  2P4W A;  3I58 A;  2W25 A;  1Y0U A;  4DQ2 A;  4NQW A;  3RYR A;  3P9C A;  4WX9 A;  2K4J A;  4Y13 A;  2IJL A;  3AAF A;  3E6B A;  3HYI A;  1ZN2 A;  1VTN C;  3HUG A;  3GZ6 A;  1AOY A;  4WK8 F;  3JW4 A;  4OU0 A;  2P7V B;  4KT5 C;  2JPB A;  4KN4 X;  4RAZ A;  1H9T A;  4OIN F;  2MH2 A;  3RJP A;  2FRH A;  4IRH A;  1YS7 A;  2K4B A;  4L9T A;  1CF7 B;  5E18 F;  3I54 A;  2ZNY A;  1Z6R A;  3SFZ A;  1SD6 A;  3J80 Z;  3J80 K;  3N97 A;  1T38 A;  5HLG A;  4M9Z A;  5TJJ A;  1SMY F;  5CYV A;  5E17 F;  3V4G A;  3MWM A;  4MHG A;  3DPL C;  3IC7 A;  2GQQ A;  4U88 A;  3M1E A;  1U5T B;  3GW2 A;  5LHI A;  1YIO A;  2EFN A;  4ESJ A;  2P6T A;  4M9X A;  4L0Y B;  4NB5 A;  1S7O A;  4AD9 A;  5JVT A;  2BGC A;  3ELK A;  1FBU A;  1TW3 A;  1W5S A;  1BIB A;  4HX8 A;  3P9K A;  1PP8 F;  1K6O A;  3GFJ A;  2IA1 A;  1ZRE A;  5AIP A;  1R22 A;  1JXS A;  3CUQ A;  1GVJ A;  2PFB A;  4GGG A;  4LK1 F;  1YG2 A;  4PGH A;  2M45 A;  1UHW A;  1V3F A;  2PN6 A;  3K0L A;  4P9F A;  5L3D A;  2LF7 A;  3EDP A;  3L2C A;  4HQM A;  3HRM A;  3L00 A;  2DAO A;  1LQ1 A;  2EB7 A;  5CJ9 A;  4U0W A;  2X0L A;  2A68 F;  1F5T A;  2QZ8 A;  2QQB A;  4EV0 A;  3ZMD A;  5HDG A;  1G6N A;  2OA4 A;  3RKY A;  1BM9 A;  1XGM A;  1HKT A;  4QLC U;  2ESN A;  5E1W A;  2GAU A;  3KP5 A;  2E7W A;  3CTA A;  2QEN A;  3I71 A;  4IPA A;  2P8T A;  2DW4 A;  5BPD A;  2CYY A;  1YS6 A;  2FA5 A;  1FYK A;  1ZAO A;  1ZLJ A;  3GO5 A;  1HSJ A;  3WG9 A;  3Q9V A;  4G7H F;  4P9U A;  5CVJ A;  1DP7 P;  3CO6 C;  4GYG A;  2JSC A;  3PQK A;  2O8X A;  1PP7 U;  1OMI A;  5LEJ A;  4EVI A;  2F2E A;  2QLZ A;  2Y0M A;  3F72 A;  1YO5 C;  1R36 A;  1KYW A;  2QVO A;  3LQQ A;  4WXH A;  3OOP A;  1ON1 A;  1OPC A;  3HHG A;  2YPR A;  4A6E A;  2F5D A;  3F8M A;  3KZZ A;  1YW9 A;  2RC4 A;  3ZMV A;  2KKO A;  4HYE A;  4IVN A;  4EJO A;  1YQA A;  2A61 A;  4BHP A;  1FY7 A;  3ZN0 A;  3O3K A;  1V4R A;  2OZ6 A;  3W6J B;  5E20 A;  2Z9O A;  3V7C A;  4S04 A;  2E1C A;  1IXC A;  4KFC A;  3CUQ C;  4M74 A;  1BI0 A;  4EQQ A;  3DKW A;  2UZK A;  3HRU A;  2CO5 A;  3U2R A;  4LFU A;  2ZXJ A;  3R4K A;  3DQV C;  3KEQ A;  5ICG A;  3E6C C;  3HOT A;  1XN7 A;  1K78 A;  1YYV A;  1E17 A;  3WTT C;  3OV8 A;  5D4R A;  1MD0 A;  1J59 A;  2GWR A;  4HX7 A;  5F1R A;  3IHU A;  4KIC A;  5HLI A;  1YW8 A;  4KUM A;  3O2P E;  2UWM A;  1D8J A;  2XV4 S;  1YW7 A;  2ZKZ A;  3CDH A;  1ZAR A;  4UUV A;  2D45 A;  3F8F A;  2M1B A;  2KJC A;  3GXO A;  1FPQ A;  1IN5 A;  1FT9 A;  5J8C A;  1P92 A;  4KMF A;  4U0V A;  3HHH A;  3FMQ A;  4WXC A;  1XDS A;  3CUQ B;  4GO1 A;  5D6F A;  5BPI A;  5F6F A;  4S05 A;  4LB6 B;  5ERI A;  2XAH A;  2NS0 A;  5LGU A;  2MA3 A;  1JHH A;  1A04 A;  2NRA C;  2EFO A;  2O03 A;  1H0M A;  2RGV A;  1LEB A;  3IKV A;  4CO8 A;  2GZW A;  5ICE A;  2Q8K A;  2XAS A;  5DV5 A;  2OQR A;  3F8B A;  3TOB A;  1F1Z A;  1G3W A;  3QAH A;  4UVB A;  4I2O A;  1P4W A;  2Z3Y A;  2OBP A;  2KIM A;  2MBF A;  5LHH A;  3EQL F;  3ZPL A;  4A0Y A;  2HQR A;  1Z7U A;  3R61 A;  4FHT A;  1BI3 A;  3GVA A;  4RGS A;  3V8L A;  4R8H A;  3TQN A;  3N4M A;  5HS9 A;  1W7P A;  1ZH5 A;  1MKM A;  4AIK A;  3GWZ A;  4OMY A;  2Z5U A;  4I7H A;  4MEY F;  3M9A A;  1WRJ A;  4ZH4 F;  3V7R A;  5L3B A;  1B6A A;  4OIR F;  2BE5 F;  1XSV A;  3H3Z A;  3WTZ A;  3CLO A;  3FX3 A;  4L9J A;  2C6Y A;  2ESH A;  2M5W A;  1IW7 F;  2F5E A;  2VOD A;  4ZYD A;  2MLK A;  4XRF A;  3U1D A;  5CVU A;  4G6D A;  1W7P D;  3BOQ A;  2IRF G;  4N9H A;  1RIO H;  3KP4 A;  5L3C A;  4YFN F;  4GYI A;  2ZO4 A;  3RI4 A;  2P5K A;  1FZP B;  2P6S A;  2LSO A;  2H94 A;  5LEK A;  1BI1 A;  5LGT A;  5DUK A;  4ZZL A;  5ED4 A;  2QQA A;  3QRF F;  3FM3 A;  3JAM Z;  3JAM K;  1IZ1 A;  3V8J A;  3M8F A;  4PCQ A;  2ZJ2 A;  4R1H A;  3I64 A;  2DQR A;  4ZZD A;  4FX0 A;  1ZYR F;  2A69 F;  2A07 F;  4RB1 A;  4MEX F;  3R0A A;  2CW0 F;  4RAY A;  1G4D A;  2D1H A;  5ILV A;  4BHB A;  2L02 A;  1S8N A;  4UNO A;  3C1D A;  3G3Z A;  3BP8 A;  1K78 B;  4FT8 A;  4G6Q A;  4A0Z A;  4RGX A;  2DU9 A;  1FWZ A;  1ZGJ A;  3I0T A;  2PBI A;  4KA4 A;  2ISZ A;  5AON A;  1WKM A;  1I1S A;  2V1X A;  4ASN A;  4M71 A;  1SD5 A;  4HW0 A;  1D8K A;  5CLS A;  5IT9 Z;  5FGM A;  4L9V A;  2O0Y A;  3F6O A;  2IT0 A;  1IUY A;  3EUH A;  3W6K B;  1J0R A;  3ISP A;  2RQP A;  3IWZ A;  3CUO A;  2XKP A;  1ZG1 A;  2H6B A;  1RZ4 A;  4G94 A;  4MTE A;  2ELH A;  2KRF A;  4YG2 F;  2QWW A;  3V7S A;  3E5X A;  1P4A A;  1U5T C;  4U0Y A;  3QPT A;  3NQO A;  2LDU A;  3RYP A;  1XCB A;  4EJW A;  1K79 A;  1DPU A;  4AIH A;  1WQ2 A;  1HBX G;  1ZRC A;  1W4M A;  3BJA A;  4O3M A;  5DEQ A;  3U9G A;  1TQM A;  1UB9 A;  4AIJ A;  3DF8 A;  2OQG A;  2RV8 A;  3QU3 A;  4UXN A;  4EMS A;  2CG4 A;  2DT5 A;  2UXN A;  3HSF A;  1R00 A;  2XIG A;  3LA3 A;  2EWN A;  1R7J A;  5DDG A;  4I0A A;  1FOK A;  2QYO A;  1QNT A;  3I53 A;  4U7B A;  2ZNZ A;  1SAX A;  3GEZ A;  1W7P B;  1J5Y A;  4JK1 X;  3SHF A;  1XGN A;  2R7D A;  2HTJ A;  3VOD A;  1LEA A;  4WCG A;  1KQ8 A;  1UST A;  1ZG3 A;  2JPC A;  2MH9 A;  2ZME A;  1QBJ A;  5H20 A;  1PUE E;  3IWF A;  2A6E F;  5HS7 A;  4P5O A;  2IA0 A;  5L3F A;  2DPD A;  4A6D A;  3DP7 A;  3FXQ A;  3BJO A;  3TO6 A;  3KE2 A;  5D5W B;  1IN4 A;  2HKO A;  3COA C;  1LNW A;  4RB3 C;  4M72 A;  3NEU A;  5E8G A;  2LKP A;  4A5M A;  5D5X B;  5DD4 A;  2PG4 A;  3P7N A;  3SZP A;  1XSX A;  4TV7 A;  2ZFW A;  4EM2 A;  4MGR A;  4KN7 X;  4JBA A;  3R6S A;  1MJB A;  4GCV A;  4K2E A;  3QU6 A;  1ZG5 A;  2EA2 A;  3GZ5 A;  4LB5 A;  5D5U B;  1MGT A;  2EFP A;  3WE3 A;  4B8X A;  3BJ6 A;  3FMR A;  3ZQ7 A;  4RB0 A;  3ZMU A;  1R5H A;  2YSR A;  3K69 A;  1IXS B;  2YX7 A;  3IRR A;  1TQP A;  5FO5 A;  2G9W A;  2FSW A;  3QP6 A;  1BC8 C;  1QGP A;  4IRI A;  3FF5 A;  2HGC A;  3TOA A;  1HQC A;  4HLX A;  5K5Q A;  4I98 B;  2CGP A;  2XAQ A;  5ICC A;  1B1B A;  2FNP A;  2JT1 A;  1XGO A;  1O3T A;  3TDZ C;  4H0E A;  2LF8 A;  2AXL A;  1MJA A;  2EFQ A;  4OIP F;  5BOX A;  2YU3 A;  1BIA A;  2FBI A;  3QP5 A;  2GIV A;  2W85 A;  4L5I A;  4HBL A;  2DTR A;  4LK0 F;  4E70 A;  2YX4 A;  1QZZ A;  3C7J A;  1GXQ A;  2J5O A;  5JHU A;  2ZBK A;  3DXJ F;  4ENM A;  5FB2 A;  2HWV A;  4GXO A;  2HQN A;  3WTY C;  1XD7 A;  3I5U A;  3LST A;  4HA8 A;  4L18 B;  3GFL A;  4KYW A;  1HW2 A;  1TTY A;  1USS A;  1J2X A;  2BYV E;  4LG0 A;  1R1U A;  3KET A;  2FML A;  1EH7 A;  4ENK A;  4F7Z A;  1I1G A;  4AVP A;  4D0P A;  3P9I A;  2XHK A;  1NHA A;  4CZZ A;  4EJU A;  3LA2 A;  4A5N A;  4ENN A;  4IHT A;  3K9T A;  3FXU A;  3MZH A;  4RGR A;  2R3S A;  3I4P A;  3FHZ A;  1S3J A;  4BHC A;  5FFX A;  2H27 A;  4PZJ A;  2HYG D;  2G7U A;  1R23 A;  3SXY A;  1F4K A;  5E8I A;  2PMH A;  3KP2 A;  3WGG A;  1MJ9 A;  3M8E A;  4HLY A;  4M9S A;  3J81 Z;  3J81 K;  3WOD F;  2P5L C;  4G7O F;  4QWQ A;  4HAM A;  5EEH A;  2K02 A;  1P2F A;  1RUO A;  3GYH X;  3CO7 C;  2ZME B;  5D8K B;  4BQA A;  2COM A;  5LHG A;  1OYY A;  2Y48 A;  3BZ6 A;  1SD7 A;  5ILS A;  3MAJ A;  2FE3 A;  2QM3 A;  1S7A A;  4KDP A;  1KU2 A;  1UCR A;  2FNA A;  3TDU C;  2VBW A;  3ZN1 A;  1I5Z A;  3REO A;  1I6X A;  3IL2 A;  2ADU A;  1Z9C A;  5FD6 A;  1XGS A;  3T0Y A;  4EGZ A;  3BPX A;  2RKH A;  4BAY A;  3F8N A;  1OYW A;  1TW2 A;  5KK1 A;  5L3G A;  2VON A;  4HQE A;  4Y15 A;  3ZMT A;  2FMY A;  2DK8 A;  3PFI A;  3R0J A;  2TDX A;  5A2Q Z;  1BN5 A;  5DUI A;  5A2Q K;  2STT A;  4Q5S F;  3T1B A;  3ERE D;  1L3L A;  1IN6 A;  3LAJ A;  1B4A A;  1FP2 A;  2EFW A;  4DNC A;  2HEO A;  1WWX A;  1T2K A;  2HDC A;  2EJR A;  3BDD A;  4HV6 A;  1R5G A;  1D5V A;  2E7X A;  1TQI A;  1Q1H A;  4Q4Z F;  2IP2 A;  4ZYG A;  1SFX A;  1XSD A;  1ZLK A;  4CYD A;  3HSE A;  3JTG A;  1S29 A;  4Z2Y A;  2FEZ A;  3KP7 A;  3E97 A;  3H3U A;  3TO9 A;  2UXX A;  2GXG A;  3MFK A;  2HZT A;  2OZU A;  5KVR A;  2VT3 A;  1OKR A;  1FBQ A;  2BBY A;  3E6M A;  2BV6 A;  2XAF A;  2ACJ A;  3GUD A;  4EGY A;  3QPH A;  1IN7 A;  2V79 A;  1FNN A;  3ML6 A;  3S2W A;  5HS8 A;  1WI9 A;  2FF4 A;  2F5C A;  2NAZ A;  1WSU A;  2PJP A;  4M6X A;  1GXP A;  2HFH A;  2P5V A;  1XMK A;  2CWE A;  5D6E A;  4LG0 B;  1HST A;  1DDN A;  1B9N A;  4P55 A;  2DFI A;  2HS5 A;  3ULQ B;  3RPU A;  1LJ9 A;  2H09 A;  1Z6T A;  5D4S A;  2NNY A;  3VB2 A;  3EYY A;  3LA7 A;  1BC7 C;  1XMA A;  5K5R A;  3K1N A;  4RGU A;  4PGG A;  2RVC A;  3HSR A;  5DD8 A;  3ABT A;  1G3Y A;  1BBY A;  1FYL A;  3R60 A;  4CHU A;  3E3V A;  2VOO A;  3MZY A;  1J7K A;  3RTR A;  2F5F A;  2HKX A;  3QOP A;  3FM5 A;  2DBB A;  4Q47 A;  4YII A;  2L4A A;  2AS5 F;  2FOK A;  5HVQ C;  1IAW A;  1IRG A;  5DCF A;  2YR2 A;  1I27 A;  2A5Y B;  1EH6 A;  4I0B A;  3K2Z A;  4UVA A;  2XUB A;  2M8E A;  1UHM A;  1TNT A;  2W84 A;  3J7A O;  1IRF A;  2GA2 A;  4I01 A;  4ESB A;  3JTH A;  1H9G A;  2PMU A;  3WGI A;  2XAG A;  4IJA A;  4RS8 A;  1C0W A;  1Z1D A;  1JE8 A;  3ABU A;  2CFX A;  3FWE A;  1QQI A;  1ZRF A;  3H92 A;  4L5J A;  1UFM A;  1B9M A;  6PAX A;  4P96 A;  2VXZ A;  5DCM A;  1JGS A;  2VBX A;  1O57 A;  4IRG A;  1LDD A;  1P6R A;  2D2W A;  1L0O C;  4Y17 A;  2MD5 A;  2LNB A;  3SQN A;  4G8X A;  4O6J A;  3GFI A;  3IRQ A;  2O3F A;  1E2X A;  2OD5 A;  2L4M A;  3B73 A;  4IF4 A;  3T5X A;  1ZGA A;  2JTV A;  2VE9 A;  4MQ9 F;  4ETS A;  1QZY A;  1G3S A;  4LLG F;  1T0F A;  2WTE A;  4XBF A;  3LFK A;  2NNN A;  1TBX A;  3TGN A;  4ENJ A;  4A0X A;  3ZMZ A;  3ECH A;  1SFE A;  3WU1 B;  4EJT A;  3Q9S A;  3D5L A;  1FYM A;  5F64 A;  4HF2 A;  2Q0O A;  2KJB A;  4Q48 A;  2PQ8 A;  2VC1 A;  3F21 A;  2O6G E;  4G9Y A;  5LRR A;  4N9I A;  1T39 A;  2CSO A;  3B02 A;  1MDM A;  1FP1 D;  2P7C B;  2B0L A;  4XSZ F;  4M73 A;  1YFH A;  4R79 A;  2EV6 A;  3WTS C;  3ZMS A;  3GF2 A;  4LJZ F;  1MZB A;  1AWC A;  4PDK A;  1U8R A;  3BY6 A;  4ESF A;  5BQT A;  2CQK A;  1KYZ A;  3RIR A;  3ZP5 A;  1B59 A;  5D8L B;  5BS6 A;  3CJN A;  3RPQ A;  4YFX F;  2V1D A;  3NRV A;  3TKY A;  1Z05 A;  2PLY A;  1ZRD A;  1IN8 A;  3MEX A;  2VC0 A;  1LDJ A;  4MQV A;  4UV9 A;  3WE2 A;  1KQ9 A;  1SD4 A;  2GA1 A;  2VBY A;  4YIF A;  2MC3 A;  3L09 A;  2Z33 A;  4LMY A;  2HR3 A;  2IA2 A;  5HDN A;  4I09 A;  1BI2 A;  1QO0 D;  2XKO A;  3LQR A;  2IW5 A;  5K5O A;  2PI0 A;  3WGH A;  1CGP A;  5ILU A;  3E5Q A;  3FMS A;  4BNC A;  5L3E A;  2EK5 A;  1YLF A;  4HDU A;  3M7G A;  1PDN C;  4RB2 C;  2DK5 A;  3T8R A;  1O7L A;  1REP C;  4CXF A;  1J75 A;  1FSH A;  2EV0 A;  3F6V A;  3LAP A;  3V8K A;  2ZCW A;  3I59 A;  2JZY A;  4A2U A;  1HXD A;  1JHF A;  2JRT A;  5LGN A;  4HV5 A;  1IF1 A;  2M30 A;  4ON0 A;  2FBH A;  4HOB A;  3F23 A;  3DEU A;  4WWC A;  1FBS A;  5TRD A;  3BWG A;  1O3R A;  3C3W A;  2V1U A;  1KA8 A;  1R1T A;  4LLN A;  2VN2 A;  1ULY A;  5H6R A;  1ODD A;  4LGW A;  1QPM A;  1O3Q A;  3GX4 X;  2WWY A;  2X4H A;  3RKW A;  4UHT A;  4U7D A;  1RNL A;  3RKX A;  3EYI A;  3KP3 A;  3FZV A;  1LB2 A;  5DCM B;  1FX7 A;  4IHS A;  4XLP F;  2QBY A;  4LD5 A;  2OAZ A;  3KP6 A;  5CVV A;  1XB4 A;  4L0Z B;  2VBZ A;  2QUF A;  1O3S A;  5JR3 A;  4M6Y A;  3D0S A;  5JI6 A;  5LBQ A;  3DPT A;  1K7A A;  2K27 A;  2FU4 A;  4XLN F;  3WTW C;  1HW1 A;  4HF1 A;  2STW A;  1RI7 A;  3KFW X;  2O61 A;  2PEX A;  4HX4 A;  2FBK A;  2A3S A;  2FQ3 A;  1HW5 A;  1YTY A;  1BOA A;  2K7L A;  1U78 A;  1XCV A;  1LDK B;  1LVA A;  3T8T A;  4IXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...