3LWFA

Crystal structure of putative transcriptional regulator (np_470886.1) from listeria innocua at 2.06 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
144
structure length
144
Chain Sequence
YFQGMKITTKGRYGLTITLELAKRIGDGPISLRSIAQDKNLSEHYLEQLIGPLRNAGIVKSIRGAHGGYVLNGDPEKITAGDIIRTLEGPIVLVESMEDEEAAQRELWTRMRNAVRDVLDQTTLSDLLKHSTDSELTDGYMFYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative transcriptional regulator (NP_470886.1) from LISTERIA INNOCUA at 2.06 A resolution
rcsb
source organism Listeria innocua
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator
total genus 38
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lwfA01
4KMUX 2HTJA 1WI9A 4H0EA 4I01A 2Y0MA 3SXYA 2PLYA 1FSHA 5CJ9A 3GXOA 4TV7A 2ELHA 1BI0A 1ZGAA 3FHZA 1XGNA 4WXDA 4HV6A 4ENNA 1XCBA 1EH8A 4MHGA 3WGHA 5K5RA 2O0YA 1XMKA 2A6HF 3SZPA 3EYYA 1ZRFA 3FF5A 3KP5A 3MFKA 2GZWA 1J59A 2IPQX 1TBXA 1FSEA 1MJBA 1QGPA 2Z5UA 1BOAA 1IXSB 2QYOA 4O3MA 4GYGA 3FX3A 1XSXA 1XGOA 1ZG5A 4LGWA 2F5FA 3JSPA 1ZREA 3WTSC 5DEQA 1O3SA 2X4HA 2GA1A 5E1XA 1QBJA 4KA4A 2H94A 2STTA 5E18F 3ZPLA 3ECHA 5CVRA 1G3YA 5F64A 3T0YA 1UHWA 2MA3A 2QBYB 2FNPA 1SD5A 4AD9A 4A0XA 4OINF 2M30A 5EEGA 4BH9A 2DPDA 5HLGA 4MGRA 1BIBA 2EV5A 2FBKA 4RGXA 1HW2A 1RNLA 1U5TA 3HHHA 1ZH5A 2H09A 1R22A 3IRRA 3CUQB 2NS0A 3HOTA 4HAMA 2CWEA 2DBBA 1YW9A 3ZP5A 2QENA 4N0BA 2RKHA 4HLYA 1BI1A 1OYIA 5DUIA 1NHAA 3BPVA 4P96A 4KIFA 4PGHA 1ON2A 4L9NA 2BBYA 4UHTA 4IXAA 2CQKA 4IRIA 3WTUC 1YIOA 5BMZA 1MKMA 4Q4ZF 2NRAC 2PG4A 4U7DA 1SD4A 3JSOA 2R7FA 4IJAA 2YPRA 3PQKA 3TOBA 5HDNA 3FMRA 1AWCA 1GHCA 1UCRA 5E20A 4MNUA 4ZH4F 3GWZA 3ZMDA 4EJOA 3RKYA 4E70A 1SMYF 2IP2A 3MCZA 3KCCA 1XDSA 3GO5A 1XCVA 2UZKA 1D8JA 4GGGA 1FYMA 4I2OA 1DUXC 1AOYA 3KP4A 2Z3YA 1FWZA 4KNYA 3I64A 4UUVA 1F4KA 1HSTA 2A07F 5CVJA 2Q0OA 4ENJA 2P8TA 3NQOA 2EV6A 2QWWA 5ILSA 4EM2A 2WWYA 2HWVA 1YYVA 3F3XA 1R5HA 5JR3A 3U2RA 5H20A 1F5TA 4IRHA 1R1TA 3Q9SA 3ABTA 4MEYF 3DPTA 1LDJA 4A12A 2NNNA 4I98B 3QAHA 1MDMA 5ICEA 3KFWX 1ZAOA 4G9YA 4EJTA 2HQNA 3ABUA 5DV5A 1XB4A 4CICA 4M74A 2EFOA 3ZMVA 1SFEA 1T0FA 1T39A 1WRJA 5DCMA 2Q2EA 5HLIA 3IL2A 1TQPA 2M8EA 2K02A 5FGMA 3IKTA 2STWA 2VOOA 2M1BA 4RS8A 5FD5A 3R0AA 3VEPA 5D5VB 2A5YB 5ERIA 4WXCA 3CUOA 1KA8A 3VODA 5CVUA 4HF1A 2QQ9A 3KZZA 2HKXA 3K69A 3COAC 2W85A 1LDKB 3C3WA 3C1DA 3F8NA 1LEBA 1UB9A 1XGSA 1TTYA 4A5NA 1G6NA 5BPIA 3C18A 4LG0B 5DCFA 1IRFA 3TKYA 2JPCA 3GUDA 2GWRA 1T6SA 2RQPA 2K86A 2Y48A 5DD4A 4HX4A 2COMA 3C7JA 3FMQA 5D5XB 1J2XA 4GYIA 4N9HA 3WTXC 1F1ZA 5F1RA 3OV8A 1D5VA 4KFCA 2HR3A 1O57A 3LA7A 3EETA 3WTZA 1UFMA 2L02A 1PP8F 5D6EA 5DYMA 4AWXB 2ESHA 3ZMSA 4RGRA 2EFPA 3BWGA 2K27A 3S2WA 1D8KA 2JZYA 2DQLA 1K79A 3F6VA 3SFZA 3GVAA 2B0LA 1FOKA 3T8TA 1FY7A 3O6BB 4IHSA 2VBZA 5LBQA 3GFMA 1FT9A 5BPDA 1JXSA 1O7LA 1TLHB 4R1HA 1OR7A 2ISYA 2VOPA 2K4BA 1MZBA 1T98A 3HRTA 1YS7A 1XSDA 4CDGA 1FYKA 2GXBA 2OZ6A 1DPRA 1RI7A 5DD8A 3WU1B 1HSJA 4PZJA 1IW7F 5LRRA 2YX7A 5D8LB 1YO5C 2PJPA 4ENKA 1BIAA 1K78A 2CSOA 2MH9A 2V1UA 2WV0A 4FX0A 4MQ9F 5AIQA 2E1NA 3ECOA 5IT9K 2Q8KA 1MDMB 4G7ZF 2O03A 3DV8A 3RPUA 4HF2A 1QZZA 2RVCA 4YIIA 3RYRA 4XRFA 4HQEA 1TNTA 2XAFA 4XBFA 4A2UA 2IRFG 2QVOA 3LA2A 5LEKA 3P7NA 3KP7A 5CVVA 1IN8A 4ESFA 3BROA 3HUGA 2IA0A 4HBLA 2BV6A 4YIFA 1KQ8A 2ZCWA 3ISPA 3N4MA 4WCGA 4A0ZA 3F8CA 3GFJA 1IZ1A 1P4AA 4R8HA 3ZMTA 1I1GA 3I4PA 4XLNF 4HA8A 4OIQF 2HGCA 1CGPA 4U0WA 1PUEE 2RC4A 1KU3A 1KU2A 3LSTA 2CYYA 1LNWA 1T2KA 2D1HA 2XASA 3E5QA 2ZNYA 1V4RA 2XUBA 1YW8A 4WX9A 1ULYA 2ESNA 3WTTC 2JPBA 2RN7A 1I5ZA 4M9ZA 1P2FA 5J8CA 3N97A 1B9MA 1MJAA 3U1DA 4HX7A 3I0TA 4HOBA 4ZYEA 4NHJA 2W24A 4UV9A 1J5YA 3GF2A 4B8XA 4MTEA 4OIPF 1MGTA 3KLOA 1OPCA 4EJVA 3ZN0A 2LDUA 2HFHA 2EB7A 4Q48A 1IF1A 3F8MA 3BOQA 3HHGA 5ICFA 2C6YA 2XAGA 4PCQA 3U9GA 1H0MA 2NAZA 4MTDA 3E6DA 5E8IA 4OU0A 1WWXA 2PFBA 4ZZDA 3R6SA 3RTRA 4M9SA 3B73A 1BBYA 2X0LA 1LVAA 3K1PA 2W84A 3IRQA 2XKPA 1R23A 2LF7A 3BP8A 1U5TC 5D6FA 2V1DA 3GX4X 3PQJA 2P5VA 2FA5A 4GO1A 1DP7P 2UXNA 2EWNA 3L7WA 2P7VB 1FP2A 5ICGA 3WE2A 4RB3C 2YU3A 2MD5A 1FBQA 3F22A 3REOA 1BJAA 4RB2C 1JHHA 2H6CA 4HX8A 1XMAA 4EJWA 2TDXA 3GW2A 5FD6A 3GEZA 4EGZA 1T38A 4D0PA 1EV7A 1O7FA 2H27A 1TNSA 2ISZA 4EGYA 2XAJA 5EEHA 1A04A 4MEXF 3WGGA 3M8FA 5JFRA 4KN4X 1P4WA 2MC3A 3F72A 4RGSA 4U0VA 2OZUA 4UVBA 1X3UA 3JTGA 2O3FA 4LK0F 4YFXF 3R4KA 1U3EM 2FE3A 3MWMA 5AIPA 2PI0A 2YSRA 3HOSA 5E17F 2K7LA 2EK5A 1GXPA 2A68F 4LLLA 3T1BA 1FBUA 5H6RA 2VE9A 4HDUA 1KU7A 3VOEA 1U5TB 1ZLKA 1UHMA 1J0RA 3RKWA 3R0JA 2ZKZA 2G7UA 4KT5C 3QU6A 3CO7C 2WC2A 3F8BA 1I27A 2DPUA 4I0BA 2FQ3A 2FOKA 5DUKA 1ODDA 2V79A 5DDGA 5JI6A 1CF7A 3FZVA 3V7CA 1DPUA 5L3BA 4KIGA 5L3FA 4RAYA 2O61A 3MAJA 5L3DA 2DW4A 1ON1A 2DK8A 2AS5F 1FX7A 1YS6A 1OYWA 1XDUA 5J8FA 3WTWC 3HSRA 3SHFA 3HTSB 4B09A 2IVMA 3IC7A 3LWFA 4G6DA 4FT8A 3LAJA 4ASNA 3J81Z 3V7RA 4LLNA 3FXUA 2W57A 5D4RA 1SMTA 4L5JA 2EA2A 2ZMEA 4ON0A 3MEXA 2LNBA 1YTYA 4EV0A 1FLIA 1ZRDA 2IA1A 4FX4A 5ILUA 2KIUA 1TQIA 2QUFA 4HW0A 3WG9A 4O6JA 1FC3A 1S29A 4LD5A 1TW2A 3V8JA 3E6BA 3T8RA 3VB2A 2RV8A 1L3LA 1TQMA 1XN7A 2P6SA 1LDDA 2XV4S 4OIOF 1RUNA 3I59A 5L3EA 1JHFA 3GZ6A 3LFKA 4KIBA 3G3ZA 4G8XA 2DQRA 4JQFA 2E1CA 2JSCA 3KP3A 5FFZA 3KP2A 1B6AA 3CLOA 4LJZF 4HDVA 2UWMA 3ELKA 5FO5A 1EH7A 4WXHA 1WKMA 5CYVA 4I02A 3EUHA 2O8XA 3BDDA 1PDNC 4L9JA 1U2WA 2VT2A 5LHGA 1ZG3A 5J6XA 3B02A 3K1MA 3FXQA 2Z99A 5KVRA 3BPXA 3M8EA 4G7OF 3E97A 1FNNA 3P9CA 4ZYGA 1BC8C 2R7DA 1Q1HA 3FXRA 3ULQB 2MH2A 4U0YA 3ML6A 1HXDA 4EMSA 3GZ5A 1IAWA 2DO7A 1R1VA 3R61A 2VBYA 4NQWA 2F5DA 1F9NA 2J5OA 3KP6A 3WTYC 1J9IA 3OOPA 1Z1DA 1O3RA 2IT0A 3CJNA 5CVIA 5LGUA 2ZBKA 3HRSA 1ZYRF 4OMZA 2L01A 2KRFA 1Z7UA 4A6DA 2P7CB 1S3JA 1HKQA 3K9TA 2KIFA 3WE3A 1LB2A 3VFZA 3V4GA 2BGCA 3DQVC 4M6YA 1YFHA 2F2EA 2GIVA 4UVAA 1HW5A 1U6GA 2EA4A 1IRGA 4HLXA 1TW3A 4ETSA 4BXUA 5HLHA 2QZ8A 3G73A 3MZYA 2PQ8A 5D5WB 2HYGD 3RDIA 2VXZA 3Q9VA 4WWCA 2AXLA 3PFIA 2EV0A 5LRSA 2ZNZA 1E17A 3JTHA 3RYPA 3DFGA 4XSZF 3HIFA 5A2QZ 4N9IA 1JGSA 2O6GE 3WU0A 4G6QA 4ENMA 2Z33A 4O5VA 3QPHA 4YFKF 3I58A 2RNJA 4XSXF 1S7AA 4EM0B 4AIHA 5K1YA 4OOIA 3J80Z 2M5WA 2M45A 1IUYA 1YLFA 5CLSA 3LQRA 1G3SA 4ESJA 2A61A 5LHIA 3I5UA 2CO5A 2XRNA 4OIRF 1HKSA 1QO0D 4HZFA 2PMHA 2HS5A 2A69F 3F21A 1W4MA 4GCVA 2XVCA 2E7XA 1W7PD 5LGNA 4LMYA 1W7PB 4NB5A 3FWEA 2XHKA 6PAXA 4YFNF 2FRHA 3TDZC 1IN4A 2GXGA 5LEJA 3WTVC 1ZARA 1IXRC 4OMYA 4L18B 2CW0F 3I71A 2CGPA 3E3VA 1GXQA 1O3QA 2D1VA 2MLGA 1R1UA 2LF8A 3DEUA 3P9IA 3J81K 4P9FA 4LB6B 1B4AA 5IT3A 1B59A 4BHPA 1W5SA 2LKPA 1W5TA 1U8RA 3KEOA 2PMUA 5HOOA 4DQ2A 4U7BA 2D2WA 2PN6A 5K5OA 2VBXA 3CUQA 4KMFA 5BQTA 3E5UA 4KYWA 5F6FA 2P5KA 4AIKA 2BEOA 1QQIA 1Z05A 5DCMB 4EJUA 1XGMA 2Y75A 1USSA 1K6OA 3KE2A 2OU2A 1QNTA 3GFLA 3R60A 4WF2A 2QM3A 1R58A 1BC7C 2VN2A 3RPQA 2HOEA 2QLZA 2IW5A 5HDGA 2DTRA 1QZYA 4BNCA 3RKXA 4AVPA 3HSEA 4FHTA 2VBWA 5TRDA 2XAQA 3K2ZA 4M72A 2XROA 2V6CA 2EJRA 3IKVA 2BE5F 1P4XA 2MLKA 1DDNA 1YG2A 1KYWA 3P9KA 4AIJA 4G94A 1Z9CA 1S8NA 2HYFA 2JT1A 4IPAA 4GXOA 2PBIA 3HSFA 3AAFA 4UXNA 5BOXA 5HS7A 3DPLC 2V1XA 2HKOA 3V7SA 5E8GA 3ZQ7A 4EVIA 1KQ9A 2DAOA 4LK1F 2P6TA 4A6EA 4JK1X 4LB5A 5E1ZB 1IN6A 1REPC 5D4SA 1KQ0A 4M6XA 1MJ9A 3V8LA 5FB2A 5LLQA 2GA2A 4BHCA 2F5EA 3RI4A 4S04A 5HDKA 3L2CA 1O3TA 3IHUA 1Z6RA 2FMLA 4CO8A 4BAYA 2ZMEB 1S7OA 4Q47A 3HRMA 4I7HA 1FYLA 1K7AA 2NNYA 1J7KA 1W7PA 1B9NA 2VE8A 1H9GA 2FSWA 1BN5A 2EFQA 4RB0A 2EFNA 2G9WA 1BI3A 2WTEA 2MBFA 1C0WA 4RAZA 3L00A 2NYXA 5ICCA 4ZZLA 3TOAA 2VODA 2L4MA 1P92A 1E2XA 2L54A 4HQMA 3EDPA 2ZFWA 4PGGA 3ERED 2YR2A 1LEAA 3CUQC 5HS9A 4BHBA 4IHTA 1P6RA 3KZYA 3KEQA 1ZG1A 3TO9A 1SFXA 4RB1A 1YW7A 1RZ4A 1ZGJA 1WSUA 2CFXA 2F5CA 4ZYDA 1HW1A 3H92A 2HTSA 1FBSA 5L3CA 1G3TA 1PP7U 4Q5SF 3T5XA 3KLNA 2D45A 4A5MA 1FPQA 1ZHFA 1J75A 2QBYA 2CG4A 2RDPA 2QQAA 2L3DA 2V9VA 1JE8A 2H6BA 3MZHA 4Y13A 2HZTA 4IRGA 3IWFA 5FFXA 1XSVA 1Y0UA 1ONVA 4IF4A 2FEZA 1HBXG 1SFUA 5ED4A 3QP6A 2ADUA 4KDPA 4R79A 2K4JA 5ILVA 3RIRA 3TDUC 1SD7A 4EM1A 1R7JA 4I09A 3L09A 1XD7A 1GVJA 3ZN1A 5LGTA 4ZYHA 2PEXA 4Z2YA 3DP7A 1KYZA 2G7HA 2LSOA 3EYIA 2ZXJA 3E6MA 2P4WA 3WODF 1FP1D 4L5IA 3QU3A 3W6KB 2KJBA 3EQLF 2J5PA 4CZZA 5E1WA 1I6XA 3CTAA 5FLXZ 1R5GA 1G4DA 3SZTA 4L0ZB 4M71A 4BYYA 3O3KA 3FM3A 1YQAA 4KICA 3LAPA 4Y15A 1OYYA 3GLXA 3MQ0A 5TJJA 1I1SA 2KKOA 3DF8A 1HQCA 3TO7A 2DFIA 4Y17A 3ZMUA 4K2EA 2VONA 4BQAA 3SQNA 3DXJF 3BJAA 3E5XA 2HDCA 2HQRA 2XGXA 3D5LA 4LG0A 2KIMA 3HYIA 1ZRCA 4DNCA 2BYVE 1L0OC 5KK1A 2FMYA 1OMIA 4F7ZA 3TQNA 3KETA 3E6CC 3BJ6A 2JRTA 4HF0A 1RIOH 2OQGA 4S05A 1Z6TA 4HV5A 2VC0A 5JVTA 2Z9OA 3I53A 2E7WA 4LFUA 4ESBA 4KUMA 4UVCA 4IVNA 3L9FA 3F8FA 3QRFF 3HTUA 3NRVA 2ETHA 2FNAA 3J7AO 1R36A 1KGSA 1ZN2A 4P55A 3WGIA 3O2PE 4CGZA 1G3WA 2DU9A 2OQRA 3TO6A 2KJCA 1STZA 2JTVA 2A3SA 3BZ6A 2OBPA 5A2QK 4PDKA 2DLLA 2ZO4A 1LJ9A 3H3UA 3M1EA 1HKTA 4CYDA 5BS6A 5H6QA 4YG2F 4HYEA 2FBHA 3D0SA 2FBIA 3F6OA 4L9VA 1IN7A 2ACJA 5L3GA 1IN5A 5D5UB 3FMSA 3J80K 3NEUA 1QPMA 4EQQA 2FU4A 2FF4A 2XAHA 1USTA 2RGVA 1B1BA 2GQQA 1FZPB 1IXCA 3BY6A 4G7HF 3QP5A 3JW4A 4LLGF 3CO6C 2L4AA 3IWZA 2IA2A 1KU9A 1V3FA 2OA4A 1BM9A 3ZMZA 1R00A 3M9AA 1S6LA 4M9XA 2OD5A 1RUOA 4CHUA 4KN7X 2VC1A 3DKWA 4WK8F 3QOPA 1OKRA 1BI2A 1CF7B 4P5OA 4UNOA 5JHUA 4P9UA 2W25A 4A0YA 2DK5A 2A6EF 3Q5FA 2R3SA 2EFWA 2OAZA 4M73A 4MQVA 4XLPF 1MD0A 1LQ1A 5D8KB 5IT9Z 4CXFA 3FM5A 2VT3A 2XKOA 2XIGA 5AONA 3F23A 1VTNC 3HRUA 2FXAA 4UV8A 2M87A 3ROUA 1EH6A 5FLXK 2DT5A 2IJLA 4L9TA 2QQBA 4U88A 1SAXA 4RGUA 2GAUA 4QLCU 1D3YA 2YX4A 1ZLJA 1Z91A 2HEOA 3K1NA 2UXXA 5LHHA 3RJPA 3W6JB 3V8KA 3GYHX 3QPTA 3BJOA 3H3ZA 5HS8A 1H9TA 3JAMZ 3M7GA 3LA3A 3LQQA 4L0YB 1U78A 5K5QA 3I59B 1K78B 1WQ2A 2P5LC 3I54A 3JAMK 2DI3A 4I0AA 3CDHA 3K0LA 5HVQC 2ZJ2A 3GFIA 3TGNA 1SD6A 4JBAA 4QWQA
chains in the Genus database with same CATH superfamily
4KMUX 5B3SH 1G8XA 2HTJA 5B5EC 2EZHA 4PSXA 1VQMI 1WI9A 4F91B 4H0EA 4M3EA 3M4OJ 4I01A 2Y0MA 3SXYA 2PLYA 1FSHA 5CJ9A 1H88C 3GXOA 1X2MA 4DGWB 1HF0A 2R7QA 1V55H 4TV7A 1XMXA 2ELHA 4BEHA 1BI0A 2KZVA 1ZGAA 4XKVA 3FHZA 1XGNA 5J1UA 3H35A 4WXDA 5FLVA 4HV6A 5GPCA 4ENNA 5C4JJ 1XCBA 2JWTA 1EH8A 4MHGA 1HA8A 2HYJA 1EJ9A 2LBFB 3WGHA 5K5RA 2O0YA 1XMKA 4IZZA 2A6HF 2MGQA 3BR1A 4IHXA 3QODA 3SZPA 3EYYA 3JRAA 1T0FC 2JA2A 1LUJB 1ZRFA 3FF5A 4XKWA 2KDOA 1LKXA 3KP5A 3MFKA 3S15J 2GZWA 4F93B 1J59A 2IPQX 1TBXA 4UB6C 5KNLA 3OYJA 1FSEA 1V54H 3FK7A 4AUXA 3HOXJ 3G1MA 1MJBA 1QGPA 2Z5UA 1BOAA 1IXSB 3FBNB 2QYOA 4O3MA 3OSFA 4GYGA 4RLFA 3FX3A 3GLLA 1XSXA 1OLTA 1XGOA 5EG0A 1ZG5A 1SFKA 2KMUA 1Y39A 2ZJRF 3CCMI 1E3PA 2MYSA 4LGWA 3FHNA 2OPTA 5DM6F 2HPMA 3OYBA 2QF7A 2M7BA 2OJED 1I50J 2F5FA 3JSPA 1ZREA 4XM3A 5FROA 4CUGA 5CQEA 5DEQA 3WTSC 1O3SA 1XS9A 3HC7A 5J47A 2DOFA 5CPRB 4PJ0C 2X4HA 2BXYA 2GA1A 5E1XA 4XKBA 4BACA 4KA4A 1QBJA 1Y1WJ 2H1KA 4S0HB 4DW6A 2H94A 1VQKI 2STTA 5E18F 3FXMA 3ZPLA 3ECHA 5CVRA 2KQRA 1G3YA 1PUFA 5F64A 3CESA 3T0YA 1UHWA 2MA3A 1T08B 3Q0UA 3ZCOA 3MKLA 4N4OB 3OYLA 3K7AJ 4B43A 1YE9A 3GCMA 2QBYB 3LSGA 5M5XJ 3WHBA 1D0XA 2FNPA 2CRGA 3LSPA 2LBFA 1SD5A 1LPQA 4AD9A 4A0XA 2E71A 4OINF 4P1WA 1X4OA 3DKXA 2M30A 5EEGA 4BH9A 5EGOB 2DPDA 3CLQA 5HLGA 4MGRA 2LOOA 1ACIA 1BIBA 4IOAF 2EV5A 2IEKA 2FBKA 3HJEA 4MLOA 4DZPA 3K10A 4RGXA 1HW2A 1RNLA 1WJFA 1U5TA 3F9KA 3HHHA 2OCCH 4XOTA 5DTDA 1ZH5A 2H09A 4DZJA 1R22A 1QVTA 3IRRA 3CUQB 3CD6I 3SEZA 2NS0A 2KISA 3CZ6A 3HOTA 4IHVA 4HAMA 2DN0A 2CWEA 1RKWA 2DBBA 1YW9A 4QIWN 3ZP5A 3RZOJ 2QENA 4N0BA 2RKHA 3CCLI 2BXZA 4X0GA 3HPGA 2LR8A 5GTHC 4HLYA 1BI1A 1OYIA 2BVMA 5DUIA 4FCYA 3SDGA 1NHAA 5FJ8J 3BPVA 4IEJA 3S93A 4P96A 4A3DJ 3K4BA 4KIFA 4PGHA 1ON2A 4L9NA 1R9TJ 2BBYA 4UHTA 4IXAA 2CQKA 4IRIA 1XG1A 3WTUC 1YIOA 5BMZA 3VWBA 1MKMA 4AM3A 1WCMJ 3H9GA 4Q4ZF 4DBRA 2NRAC 1FIPA 2PG4A 1VQ5I 1XPXA 4U7DA 1SD4A 3CCVI 1B8IA 3HOZJ 3A01B 4AVZA 3JSOA 2R7FA 4FTHA 4IJAA 2X48A 2YPRA 3BG3A 3PQKA 3KYLA 3TOBA 3M07A 5HDNA 2O5RA 1FIAA 2V9PA 3FMRA 1AWCA 1GHCA 2X6XA 1UCRA 5E20A 5BNGA 4MNUA 4G12A 4ZH4F 3GWZA 3ZMDA 4EJOA 3RKYA 1OCZH 2EIJH 3RQIA 4E70A 2F4IA 2Y31A 4BJ5C 4B44A 2YUSA 1U9NA 2DA4A 3FISA 1SMYF 2IP2A 3MCZA 3OYDA 1D5YA 3KCCA 2EZIA 4B3AA 3LMMA 3OYIA 1XDSA 3GTJJ 1SEUA 3GO5A 3I4NJ 1XCVA 2UZKA 2RAEA 1D8JA 4GGGA 4I99C 3OR1C 4YEJA 1YHQI 1FYMA 4I2OA 2E35A 1DUXC 1AOYA 3KP4A 2Z3YA 1FWZA 1ZTRA 4KNYA 4J19A 3FKIJ 3I64A 4B47A 2AQEA 1F4KA 4UUVA 3MKWB 4XLHA 2IGKA 1HSTA 2A07F 5CVJA 2EQRA 1W0UA 2Q0OA 2QCOA 4ENJA 4J00A 3N05A 5EJCA 2P8TA 4C2TA 2O7OA 3GBGA 1WJEA 2DA6A 3NQOA 2EV6A 4IOCF 2QWWA 5ILSA 3Q0VA 1IG7A 1NK3P 2XF7A 5JLXA 2R93J 4EM2A 2WWYA 2HWVA 1YYVA 3F3XA 1ETKA 2BY0A 1R5HA 5JR3A 1HDDC 2EBIA 5H20A 3U2RA 4IRHA 1F5TA 4C2MJ 5J3LA 3HOUJ 4H4KC 1R1TA 3ONQA 3Q9SA 2R7ZJ 1W0TA 3ABTA 3QWLA 4MEYF 4ZC3A 3DPTA 3PNVA 2H8RA 4LIVA 3FIWA 2VPLA 1LDJA 1B72B 4J01A 4A12A 2NNNA 4I98B 3QAHA 1MDMA 5ICEA 3KFWX 1ZAOA 1RESA 4G9YA 1IRZA 4LITA 4DYQA 2KDZA 4EJTA 1MNEA 2HQNA 4LIUA 3ABUA 5DV5A 1XB4A 4CICA 4M74A 2EFOA 3ZMVA 1SFEA 1T0FA 1T39A 1T95A 1WRJA 2DCEA 1MSEC 5DCMA 2Q2EA 5HLIA 1WI3A 3IL2A 2HNHA 1O4XA 3GTLJ 1TQPA 2CUJA 1OR7C 2M8EA 2WA0A 2K02A 3JRIA 5FGMA 5K7FA 4GFBA 3AL0B 3OIQA 3VPRA 4W97A 3IKTA 2STWA 2VOOA 2M1BA 1G59A 4RS8A 1Z0XA 3L1PA 2VKDA 5FD5A 2MSYA 3R0AA 3TMOA 1WVRA 3VEPA 2JSPA 5D5VB 4A3KJ 2A5YB 5ERIA 4WXCA 3I56I 5FLMJ 3CUOA 3GZNB 4Y52J 3OIOA 1KA8A 3VODA 1IV6A 4N4NB 5CVUA 3ZGKA 2CQQA 1Y8QB 4HF1A 2QQ9A 3KZZA 3SZGA 3CC4I 3K4JA 2B7EA 2HKXA 3K69A 3S2DJ 4BE2A 3COAC 2W85A 2KRHA 2I10A 1LDKB 1FJLA 4XL9A 4E7ZA 3C3WA 3C1DA 3F8NA 1LEBA 2DFFA 1UB9A 1XGSA 1TTYA 4A5NA 1G6NA 1QU3A 2Y0SA 5DS9A 5BPIA 1U0JA 3C18A 1R71A 4Y4RA 4LG0B 5DCFA 4BBSJ 1IRFA 3TKYA 4BJTA 1Y1VJ 2JPCA 3S1RJ 2FJ1A 3GUDA 2GWRA 1ZKGA 2R7TA 3OS0A 1YJ9I 1T6SA 3JRBA 4NDLA 2E36A 2RQPA 3B6CA 3OYKA 3GMEA 2K86A 1Y56A 2Y48A 3VYSB 3L2WA 5DD4A 4HX4A 2JN6A 2COMA 3C7JA 2QSHX 2MD0A 3FMQA 5D5XB 1VQ7I 3CP2A 3MN2A 2OV7A 1YIJI 1J2XA 3HB9A 1MMSA 4CCJA 1VQLI 4GYIA 5FKOA 3S1MJ 1MBFA 4N9HA 3WTXC 3I3LA 2X6YA 1F1ZA 2MABA 5F1RA 5B66C 3OV8A 3BZKA 1D5VA 4KFCA 3G1LA 4QSHA 2HR3A 3I4MJ 1O57A 2XPVA 3LA7A 3EETA 3WTZA 3KX2A 1UFMA 3KZIC 2CQNA 2L02A 4AYBA 4F3QA 5K7HA 1PP8F 4B1RA 4RM3A 5D6EA 5DYMA 2WAFA 4AWXB 3CCEI 1H8AC 4C30A 3QQAA 2ESHA 3ZMSA 4RGRA 2EFPA 3CCYA 3BWGA 2K27A 3S2WA 2DMPA 1D8KA 2JZYA 3BR0A 2DQLA 4IKFA 1Y8RB 1G2HA 1K79A 1H89C 1P7IA 1Y0NA 3F6VA 3SFZA 3GVAA 2GIZA 2B0LA 4NUBA 1FOKA 3OMYA 2EILH 1TZLA 2BW3A 3K4KA 3T8TA 1FY7A 4YRVA 1R6RA 3OYEA 1MSFC 3PM1A 3O6BB 2JA6J 4IHSA 2VBZA 5LBQA 3GFMA 3BT9A 4XLCA 1FT9A 2DOAA 1OCRH 3HGYA 3C2GA 1X1BA 5BPDA 1JXSA 1O7LA 1TLHB 4R1HA 4NC7A 1OR7A 3CP8A 2ISYA 4F52A 2HU9A 2VOPA 2K4BA 4KISA 1YX3A 2E34A 1MZBA 1IGNA 3ABLH 2HXOA 2IS4A 1T98A 3NAUA 4CCMA 4BGDA 2XB5A 1X19A 3HRTA 2L7MP 5K7ZA 1YS7A 1XSDA 2A05A 2JA7J 4CDGA 1FYKA 2GXBA 3OL4A 2DOEA 2DJIA 3JCUC 5J4YA 2OZ6A 1DPRA 3MVPA 1RI7A 5DD8A 3WU1B 1VQNI 1HSJA 3PIPF 4PZJA 4YELA 1IW7F 2E2JJ 5LRRA 2W48A 2V4JC 2NOJB 2YX7A 5D8LB 1YO5C 3CCUI 1UELB 2TCTA 4ENKA 1BIAA 2PJPA 2JJ7A 1K78A 5HLTA 2CSOA 2MH9A 1POGA 2V1UA 2R5YA 2DT6A 2WV0A 4FX0A 4MQ9F 5AIQA 5FRNA 4BKXA 3CDIA 3S32A 3BTIA 2E1NA 1GUUA 3ECOA 4DYRA 5IT9K 2Q8KA 1MBHA 1MDMB 4G7ZF 2O03A 3DV8A 1D0YA 4DYCA 1K61A 1AA7A 1AKHA 1NK2P 1VI0A 2K9QA 3LSJA 4XRSA 2Y0SN 3RKQA 3RPUA 4XK4A 4HF2A 1TT5B 1QZZA 2RVCA 2WB1N 3MMYB 4YIIA 3O8HA 4XRFA 3RYRA 4HQEA 1TNTA 2I8DA 2XAFA 2H1LA 4PUSA 4XBFA 2ECCA 4A2UA 2IRFG 2QVOA 3LA2A 2QGUA 2EZLA 5LEKA 3P7NA 1N78A 3KP7A 5CVVA 1IN8A 4ESFA 3IH3A 3HOYJ 3BROA 3HUGA 2KFDA 2IA0A 2E19A 4HBLA 2BV6A 1QZEA 2VASA 5GAGJ 3CCSI 4YIFA 1KQ8A 3QYFA 3S8PA 2VUMJ 2ZCWA 3ISPA 4M3FA 5KAFC 3N4MA 3DTKA 4WCGA 4MIMA 4A0ZA 3F8CA 2Y9YA 3GFJA 1IZ1A 1P4AA 3GTKJ 1I3AA 3TEDA 1LFUP 5HNHA 1DQUA 4R8HA 3CCQI 3ZMTA 2OTLI 1I1GA 3L2UA 3I4PA 4XLNF 1SC7A 3K6GA 2F4MB 4HA8A 2HGCA 4OIQF 1CGPA 4IQ4A 4U0WA 1PUEE 2PJRB 2EIMH 2RC4A 3BR3A 2ZB9A 1KU3A 5C4XJ 1KU2A 3LSTA 1MBJA 2CYYA 1LNWA 2V9KA 1W36C 2Y2ZA 3VYTB 1WFXA 1NG6A 2VQLA 3M8JA 2D1HA 1T2KA 3W3CA 3K70D 2XASA 2ZMEC 3E5QA 2ZNYA 1V4RA 2XUBA 1YW8A 4WX9A 1ULYA 2ESNA 2ME6A 4BY7J 3WTTC 1MH4A 4NNJA 2JPBA 2RN7A 2UV1A 3TP0A 3LL7A 1I5ZA 3I55I 4M9ZA 2LY9A 9ANTA 1P2FA 5J8CA 5IP9J 1OCCH 4A3IJ 4HPQA 2D5VA 3TBIA 2JMWA 3N97A 2PMZA 1FTTA 4I76A 3BTCA 1GDTA 1B9MA 1MJAA 3U1DA 4HX7A 4A3CJ 3FBIB 3I0TA 4HOBA 4ZYEA 4NHJA 1JUPA 2W24A 4CYCB 4UV9A 3W2VA 1J5YA 2E60A 3GF2A 1OFCX 4B8XA 4BL0B 2LMDA 4MTEA 5B1AH 1QA6A 2B9SA 4E7SA 3H5NA 1PUFB 2ELKA 1MGTA 4OIPF 3KLOA 2ELJA 1OPCA 2NXNB 5FKMA 4EJVA 1RC9A 4F55A 2K40A 3ZN0A 2LDUA 4A3FJ 1EKEA 2HFHA 1T33A 2EB7A 4Q48A 1IF1A 1ENHA 3F8MA 3BOQA 3HHGA 5ICFA 2C6YA 2XAGA 2KPMA 3CQZJ 5EGOA 4PCQA 2BZTA 3U9GA 1H0MA 2ZXHA 1WJ5A 2NAZA 4MTDA 1NH3A 2I5UA 3K4MA 3E6DA 3PNTA 3PO2J 3E7LA 5E8IA 4OU0A 1WWXA 3PSIA 2PFBA 5B1BH 3HEFA 3G4SI 4ZZDA 3R6SA 3RTRA 3S3NA 4M9SA 3B73A 1BBYA 2L7ZA 5LD2C 1U9OA 2X0LA 1LVAA 1W5CC 1HLVA 3K1PA 2B63J 4HRIA 1GLNA 2W84A 4XLAA 4XKCA 3IRQA 4UUSA 2CV1A 3AG2H 2XKPA 1R23A 2LF7A 1WJCA 3BP8A 3S1NJ 1U5TC 2W82A 5D6FA 2V1DA 3IH4A 3GX4X 5EF6A 1BOBA 3PQJA 4HEA2 2P5VA 5IYCJ 2FA5A 3CMMA 3KYCB 4L5EA 5FKKA 4GO1A 1DP7P 2UXNA 5J4VA 4ZTFA 2EWNA 3L7WA 2P7VB 1FP2A 5ICGA 3WE2A 2IAIA 2M4GA 4RB3C 2YU3A 4I6ZA 2MD5A 2LK2A 4NBQA 1FBQA 3F22A 2OUMA 2XRLA 3QYBA 2LKSA 1R5ID 2IS2A 2DDBA 3REOA 1J09A 1BJAA 4RB2C 4CCOA 1MBKA 2KL4A 1UMQA 1JHHA 2E5ZA 1GV5A 2H6CA 4Z6YA 4HX8A 1XMAA 1S7EA 4EJWA 4PJNA 2TDXA 2HOAA 3GW2A 3I9V2 1E0EA 4RBOA 4LOCA 4M3BA 2DA3A 2LD5A 5FD6A 3GEZA 4EGZA 3JREA 1T38A 4D0PA 4PFPA 1EV7A 1O7FA 2H27A 1TNSA 5M3MJ 2NOGA 2ISZA 2XPWA 3RCOA 1K4TA 5F0FA 5EZHA 4EGYA 2XAJA 3K4NA 4E7KA 5EEHA 1A04A 4MEXF 2ZJPF 2KP6A 3WGGA 2E2IJ 3M8FA 5JFRA 4KN4X 2BOLA 1P4WA 2BY3A 2LH9A 2MC3A 3F72A 1UG2A 2M8GX 4RGSA 4U0VA 3J7ZI 2R5ZB 3JRFA 4OAZA 5M5WJ 2OZUA 2WV1A 1X3UA 3FXOA 4FE7A 4UVBA 1APLC 1VQ9I 5KAIC 3JRDA 3JTGA 2O3FA 4LK0F 4XRSG 1SAUA 3S17J 4YFXF 1BL0A 2LY2A 3R4KA 1U3EM 4BUPA 2FE3A 3PUBA 1D0ZA 3IAM2 3MWMA 5AIPA 2PI0A 1ORKA 3D5SC 1UHSA 2YSRA 3OYHA 3HOSA 3W2WA 5E17F 2RQQA 2K7LA 2RNGA 2XC7A 3DWLE 2EK5A 1GXPA 1TWHJ 2A68F 4LLLA 2EZKA 3T1BA 3BTLA 1FBUA 2X9DA 3HKZN 4BY1J 5H6RA 3OS1A 2VE9A 3B6AA 2PMZN 4HDUA 2XB0X 1KU7A 3PUFA 5E3LA 3VOEA 3E0JB 1Z67A 1U5TB 1ZLKA 1UHMA 2M0CA 1J0RA 3RKWA 3R0JA 2ZKZA 2NS8A 2G7UA 1IC8A 4KT5C 1UG0A 3BC8A 3QU6A 2R0QC 3CO7C 2WC2A 5F08A 2LC2A 4RM2A 2RREA 1UZCA 3L2VA 3F8BA 4JP0A 1I27A 1Y6IA 2DPUA 4I0BA 2FQ3A 4XNFA 2FOKA 5DUKA 2LLKA 1ODDA 2V79A 5DDGA 5JI6A 1CF7A 1ITYA 4M6VA 2CU7A 3VYRB 3FZVA 3V7CA 4BQOA 1MMGA 2XF6A 1DPUA 2IBDA 5L3BA 4KIGA 2XF5A 2K9SA 2O8KA 5L3FA 4RAYA 2O61A 3MAJA 5L3DA 2E1OA 2DW4A 2GXAA 1ON1A 1D1BA 1ZR2A 2BY2A 2WAQA 2M34A 3DBLB 2DK8A 2AS5F 1FX7A 4DIQA 3LOCA 1YS6A 1OYWA 1XDUA 5J8FA 5CKTA 1QPIA 1FMWA 1A35A 3WTWC 1JI8A 1DGWY 3IH2A 4U87A 4LG3A 3VDXA 1PYVA 4IL6C 4BE0A 3HSRA 3SHFA 3HTSB 5GAEJ 4B09A 2IVMA 1VQ6I 3IC7A 2QSFX 3LWFA 4G6DA 1X4PA 3FXKA 1BJZA 1LE8A 4FT8A 3LAJA 4ASNA 3PJRA 3J81Z 4XONA 1IUFA 3V7RA 1DU0A 4LLNA 4M3DA 3FXUA 3GTQJ 2W57A 5D4RA 1SMTA 2LG4A 1E3OC 2DA2A 1FOWA 2FUG2 4GRIA 2BHYA 2EA2A 4L5JA 4RDUA 2ZMEA 4ON0A 4XIDA 3MEXA 2LNBA 1YTYA 4EV0A 3H9JA 2HDWA 4D1QA 2VXDA 4UY8I 1FLIA 1ZRDA 2IA1A 3Q0WA 2GM4A 4FX4A 5ILUA 2DXIA 2KLOA 2KIUA 1TQIA 2QUFA 3HL2A 2FQ4A 4HW0A 3WG9A 5H2FC 5IPAA 3ESWB 2X1CA 1W36D 4O6JA 1FC3A 1S29A 4LD5A 1TW2A 3LFUA 2ID3A 3V8JA 3E6BA 2CUFA 1EF4A 3T8RA 1VQ8I 3MKYB 3VB2A 2WB1A 2RV8A 1L3LA 1TL8A 1TQMA 4BXXJ 2QA4I 3G71I 1XN7A 2P6SA 1LDDA 1ZQ3P 1A5JA 3SDBA 2XV4S 1MMAA 4OIOF 2K3FA 4ZDLA 1RUNA 3TW7A 3I59A 5L3EA 1JKPC 3ZRGA 1JHFA 3GZ6A 4EEFG 4AYBN 1ZELA 3H0GJ 4Y33A 1ETYA 3LFKA 3CC2I 4KIBA 3G3ZA 1BR1A 4G8XA 2DQRA 4JQFA 2E1CA 1T56A 2JSCA 5J1RA 1B72A 1BR4A 2COBA 3KP3A 4JX5A 5FFZA 3KP2A 1B6AA 3CLOA 4LJZF 4HDVA 2UWMA 3AKZA 3H36A 3ELKA 1WPKA 4HSRA 1YRNA 5J40A 3BCBA 3ASNH 5FO5A 1EH7A 4A3EJ 4WXHA 3S14J 3ZQFA 1NTCA 1RPWA 1WKMA 2Z16A 5CYVA 4I02A 4E6KG 4DOZA 3EUHA 2O8XA 1JT6A 2HVQA 2M3AA 3BDDA 1PDNC 1ETWA 1D1CA 4L9JA 3S2HJ 1U2WA 1F43A 2CW8A 2VT2A 5LHGA 2EINH 1ZG3A 1MBGA 5J6XA 3A2KA 1SANA 1JKQC 2E2HJ 3B02A 2R7VA 3K1MA 4XOPA 3G2BA 2R5ZA 3FXQA 3KYDB 2Z99A 5KVRA 3ZXSA 2LREA 3U1KA 3BPXA 3M8EA 4G7OF 2X6OA 3E97A 1FNNA 3P9CA 4ZYGA 1BC8C 2DMQA 2DT7B 2R7DA 3UNGC 1Q1HA 3FXRA 1MIJA 5JVGF 3ULQB 2PX9A 2DODA 2K85A 2MH2A 5JHFA 4U0YA 3H5RA 3ML6A 1HXDA 4JX4A 1IDYA 4EMSA 4E7IA 3GZ5A 4JX6A 5EG0B 1JUMA 4QPOA 1IAWA 2OF7A 2DO7A 1R1VA 3A1YA 4RAFA 3S1QJ 3R61A 3IUOA 2VBYA 1RETA 4NQWA 1ETVA 2F5DA 2OCEA 1F9NA 2J5OA 3KIOA 4Y3OA 2DFEA 3KP6A 3WTYC 1J9IA 3OOPA 4BQNA 1Z1DA 4E4HA 1O3RA 1TWGJ 3CJNA 5LFAA 3FKJA 5CVIA 2IT0A 5LGUA 2ZBKA 3HRSA 3CMEI 2CQ7A 1ZYRF 4XQFA 1AHDP 1QHGA 4OMZA 2Y30A 2L01A 2XSJC 5IP7J 2MC4A 2KRFA 1ETQA 1Z7UA 2V26A 4A6DA 2P7CB 3WHCA 3OYNA 1S3JA 2E1MC 1HKQA 3K9TA 2KIFA 3WE3A 2XDVA 3VFZA 3V4GA 1LB2A 2BGCA 3DQVC 4A3GJ 3SJMA 1SVMA 4M6YA 1YFHA 2F2EA 2GIVA 1BW6A 4UVAA 2NVQJ 1HW5A 1U6GA 2EA4A 1ETXA 2VI6A 1IRGA 4HLXA 2XGCA 1TW3A 1YITI 4ETSA 4BXUA 1SFOJ 2R7RA 2ZC2A 1X58A 3PSFA 5HLHA 4FISA 2QZ8A 3G73A 3MZYA 2ME0A 2PQ8A 3K4LA 5D5WB 1LFBA 2IGNA 4A3MJ 1I39A 2M9HA 2Z2SB 3OYMA 2HYGD 3RDIA 2VXZA 1N75A 3GTOJ 2ZFUA 3Q9VA 4WWCA 4BBRJ 4PFOA 4UUTA 2AXLA 1EA3A 2XSDC 3PFIA 2CUZA 3EPZA 2EV0A 5LRSA 1Z3YA 2ZNZA 1E17A 3JTHA 2ZXIA 2JVHA 4XLFA 3RYPA 3DFGA 4XSZF 2L2OA 2QKLB 3HIFA 5A2QZ 4N9IA 2MG4A 2EPFA 1JGSA 4NC8A 2JRMA 5EDNA 1A36A 2DA7A 3EUAA 3ZOBA 2O6GE 3WU0A 3OYFA 1XC5A 2EH3A 4G6QA 4XRMA 4ENMA 2Z33A 2VB6A 4O5VA 1WGXA 1SVOA 4FE4A 3EUKL 3QPHA 3X2QH 2XAUA 4CYCA 2DA5A 4QTRA 2VJ4A 2JK3A 1X3WB 4YFKF 4RMNA 3I58A 1R49A 2RNJA 4XSXF 1GT0C 1S7AA 4EM0B 1RRJA 4AIHA 3CF5F 5K1YA 4OOIA 3J80Z 2M5WA 3LNQA 1FTZA 2M45A 1IUYA 1YLFA 5CLSA 3KEYA 1BR2A 5DM7F 3LQRA 1G3SA 4ESJA 3E1SA 2A61A 5LHIA 1LFPA 3I5UA 2ZSHB 2L9SA 2CO5A 4A3JJ 3PO3J 1UJ8A 2DMTA 1JT0A 2HQAA 2XRNA 4G6TB 3DEEA 4OIRF 1W1WE 1HKSA 5IY5H 1QO0D 1ZK8A 2PMHA 4HZFA 3SFIA 4X6AJ 2Y69H 2HS5A 2WADA 2A69F 3F21A 1W4MA 4GCVA 1A6IA 2XVCA 4MFDA 2E7XA 1W7PD 3A02A 5E79C 4ZDOA 5LGNA 1WJAA 4LMYA 3WG7H 1W7PB 4NB5A 3FWEA 4C3IJ 2XHKA 6PAXA 4YFNF 2FRHA 3P5JA 3W2AA 4V2GA 4IQJA 3TDZC 1IN4A 3GTPJ 2GXGA 2DTZA 3FDYA 4BXFA 5LEJA 3WTVC 1ZARA 4UUSB 2CW7A 1OCTC 1IXRC 4OMYA 4L18B 2CW0F 3I71A 2X1DA 2CGPA 3E3VA 4B4CA 1GXQA 1O3QA 1JTYA 3V42A 1K6YA 2D1VA 1RKTA 2MLGA 1R1UA 2LF8A 3DEUA 3PFYA 4A69C 3H1CA 3P9IA 3J81K 4P9FA 3ZQHA 2JUCA 4D7NA 4LB6B 1MNMC 1B4AA 5FKNA 1QHHD 5IT3A 1B59A 4BHPA 2WBMA 1W5SA 1X2NA 2LKPA 3SYTA 1W5TA 1U8RA 1TWFJ 3KEOA 4W1UA 2PMUA 5HOOA 2CJJA 3FXJA 3L2QA 2HDDA 2NS7A 4DQ2A 4U7BA 2D2WA 5EEAA 2IS1A 2PN6A 5K5OA 2PJRA 1V5GA 4CCLA 2VBXA 2WY7Q 3OY9A 3CUQA 4KMFA 4PJLA 2Q1ZB 4C3HJ 5BQTA 3E5UA 4CCNA 4DJAA 4PSWA 4C2UA 4KYWA 5F6FA 2P5KA 2R4GA 4AIKA 2BEOA 1QQIA 1Z05A 4D5FA 4ABZA 5DCMB 1U8BA 1WH5A 2BW3B 4EJUA 2P0WA 1VZ0A 5EZGA 1XGMA 2Y75A 3OSGA 4HNUA 1USSA 3BCAA 4NQWB 2LFBA 1K6OA 2UUZA 3KE2A 2NVUB 2OU2A 1QNTA 3GFLA 3R60A 4WF2A 2QM3A 5FRMA 2F6CA 2V1NA 1VFCA 1R58A 1BC7C 1K83J 2VN2A 3RPQA 3CCRI 2HOEA 2QLZA 2IW5A 5HDGA 2DTRA 2DMUA 5C44J 1KONA 1QZYA 4ANJA 4BNCA 3RKXA 2QEXI 4AVPA 5F04A 3H0DA 2R92J 4XR6A 3HSEA 3VSLA 4B48A 5E3MA 4FHTA 1JKRC 2VBWA 3ZQIA 2DDAA 3C2BA 5TRDA 2XAQA 2HPIA 1Z3XA 3K2ZA 4BS9A 4M72A 4OWRB 2XROA 2V6CA 1MW7A 3K2AA 2R7XA 2EJRA 5E3NA 3IKVA 2BE5F 2TRTA 1P4XA 4M3GA 2MLKA 5IOZA 4IHWA 3CCJI 1DDNA 1YG2A 5GP9A 2A6TA 1KYWA 3P9KA 3OYGA 4AIJA 4G94A 1Z9CA 3DLAA 1VNDA 1S8NA 4KJZA 3BR5A 2LP0A 4RAGA 2IGOA 2KRCA 2LVSA 2X51A 2CQXA 3DU6A 1OCPA 2HYFA 2JT1A 4IPAA 4GXOA 2PBIA 5F0HA 3HSFA 3AAFA 4UXNA 2ID6A 5BOXA 1K4SA 5HS7A 3DPLC 1A6QA 2V1XA 2ICWG 2L5QA 1Z7LA 4MO7A 3UR3C 2HKOA 3J7AY 3V7SA 5F0CA 4ITVA 4JOMA 5E8GA 3ZQ7A 4EVIA 1KQ9A 2DAOA 2K3PA 3A0BC 2LKXA 4LK1F 1TC3C 1MMDA 2CS3A 3ZQCA 1N25A 2P6TA 3ZQQA 4A6EA 4JK1X 1S5LC 2LY1A 5EYRA 4LB5A 3OR2C 5E1ZB 1IN6A 3CJTB 3G6EI 1REPC 5D4SA 2JUGA 4D9JA 2VKHA 1MBEA 1KQ0A 2DMNA 4BEHB 4YIRX 1LE8B 4M6XA 1MJ9A 3V8LA 5FB2A 5LLQA 3DLLF 2GA2A 4FQGA 2CH0A 2F5EA 4BHCA 3BR6A 2AHQA 1HCRA 3RI4A 1WZ2A 3CJRB 2AXTC 2E1MB 4S04A 3HZJA 5HDKA 4D7MA 3L2CA 1O3TA 3PL8A 4C3JJ 3IHUA 4EATA 1Z6RA 5TGTA 5IP6A 2FOWA 2VJJA 2BVLA 3IAS2 2FMLA 3C2HA 2NVXJ 4CO8A 1M1EB 2HOTA 4BAYA 3AFHA 3JRCA 2ZMEB 1S7OA 4Q47A 3HRMA 2X85A 2VLAA 4I7HA 2LRDA 5FKLA 1FYLA 1K7AA 3CC7I 1J7KA 2NNYA 1W7PA 1B9NA 2VE8A 1H9GA 2FSWA 1BN5A 2EFQA 4RB0A 2EFNA 2G9WA 3A03A 1BI3A 2WTEA 2G0EA 1I3QJ 2MBFA 2KT0A 2L9RA 2N8GA 4RAZA 1C0WA 3L00A 4XLEA 1R4MB 1D1AA 1LVKA 2NYXA 1MH3A 4ZTJA 5ICCA 2DJNA 3TOAA 4ZZLA 5J1YA 2VODA 3JRGA 2L4MA 1P92A 1E2XA 2L54A 4HQMA 3EDPA 2ZFWA 1JJ6C 1BW5A 3BG6A 3OOUA 3S3MA 4PGGA 3ERED 1DP3A 2YR2A 1LEAA 3CUQC 5HS9A 4BHBA 4IHTA 5M5YJ 1IJWC 1P6RA 2WAEA 3HOWJ 2JQ7A 4C9YA 3KZYA 3KEQA 3LSKA 1ZG1A 1JGGA 4XN0A 4IHYA 2L0KA 2DFHA 3TO9A 3DU5A 4ZDPA 1SFXA 2GOXB 3D1NI 4RB1A 1N77A 2W7NA 1YW7A 1RZ4A 1ZGJA 1AU7A 2VPRA 2R5YB 2F5VA 1X1CA 1WSUA 2CFXA 5HODA 2F5CA 4ZYAA 4ZYDA 1HW1A 3H92A 2HTSA 1FBSA 2VQHA 5L3CA 2W00A 1G3TA 1YRNB 1PP7U 2X6WA 3HKZA 3CMYA 3HPHA 3TW6A 3T5XA 4Q5SF 1AKHB 3KLNA 3ABKH 2D45A 4A3LJ 1OJLA 3NWTA 1A31A 2DYRH 3PNYA 4A5MA 1PJRA 2BHZA 1FPQA 1ZHFA 1VQPI 3ABMH 1ZR4A 1J75A 2QBYA 1X1PA 2CG4A 2RDPA 2QQAA 3BTJA 3HOVJ 2L3DA 2V9VA 2XPUA 1JE8A 1YJWI 2H6BA 3MZHA 3BG9A 4BJ6C 4Y13A 2FX0A 2HZTA 4IRGA 3LSHA 3IWFA 2FD5A 5FFXA 1I6HJ 1XSVA 1Y0UA 1ONVA 4IF4A 4E7JA 3QOEA 2FEZA 2IGMA 3IP4B 4BE1A 5TISC 1SFUA 5ED4A 2L7FP 1HBXG 3QP6A 2ADUA 4KDPA 4XORA 4PJMA 4R79A 1S9HA 2K4JA 5ILVA 5E3OA 2V7FA 3RIRA 3TDUC 3ZQGA 1SD7A 4EM1A 1R7JA 4I09A 2HVRA 4A93J 3L09A 1UAAA 2A5WA 1XD7A 1GVJA 2IS6A 3ZN1A 1PVEA 5LGTA 4ZYHA 3VSKA 2F4OB 2PEXA 4Z2YA 3DP7A 4JBAA 2GOMA 2R7UA 3BQYA 1YX5A 2G7HA 2LSOA 3QPSA 4Y7NJ 3DPUA 1OISA 3EYIA 2ZXJA 3E6MA 2P4WA 3WODF 3BG5A 1FP1D 4L5IA 3Q3SA 3QU3A 3W6KB 1V5EA 5F1JA 2QQ8A 2KJBA 3EQLF 2R7WA 4V19K 2J5PA 2Q2EB 1FMVA 2KIQA 4CZZA 3BG7A 5E1WA 2M7AA 1RR7A 1I6XA 3CTAA 4V2FA 5FLXZ 2OTJI 1XX5A 2O9LA 1R5GA 2K9NA 1G4DA 3SZTA 4L0ZB 4M71A 4B3XA 4HSTA 3HXLA 4BYYA 4PK4A 1B8IB 4AIDA 3A01A 2W4SA 5CQGA 3O3KA 4GDFA 2CFOA 3LSRA 3FM3A 1YQAA 2LTPA 4KICA 3LAPA 2H8WA 4Y15A 3TL4X 2W1OA 2K5CA 2CV0A 3KPHA 5IYDJ 1OYYA 2YS9A 3GLXA 3MQ0A 5TJJA 3SEQA 1I1SA 4IO9F 3OS2A 2KKOA 1CQTA 3DF8A 1HQCA 3TO7A 1YOVB 1X3ZB 2DFIA 4Y17A 3ZMUA 2CV2A 3F0CA 4K2EA 2VONA 4BQAA 1Z21A 5GPAA 3OYCA 2X1EA 3SQNA 3DXJF 3BJAA 3E5XA 3CMAI 2HDCA 2HQRA 3WU2C 1HDPA 4XN3A 2XGXA 2ZXWH 5KCMA 1IDZA 3D5LA 3AG3H 2KIMA 3HYIA 4LG0A 1ZRCA 2EIKH 4DNCA 2BYVE 3BR2A 1FEXA 3BZCA 1L0OC 3HG9A 1R4NB 5KK1A 2FMYA 1OMIA 4F7ZA 3TQNA 3BLYA 3KETA 3E6CC 2HZDA 3BJ6A 2JRTA 4HF0A 1RIOH 5JLWA 2OQGA 2CUEA 4S05A 1Z6TA 5IOYA 4HV5A 3GTGJ 2VC0A 5JVTA 2IXSA 3QPLA 2Z9OA 3I53A 3ERMA 2E7WA 4LFUA 4ESBA 3S3OA 2YU9J 4KUMA 4CZCA 4UVCA 4IVNA 3HUGB 3F8FA 2AQFA 3L9FA 3QRFF 3HTUA 3D5RC 3NRVA 2F48A 1P7JA 2ETHA 4OAYA 1V5FA 2HXIA 1F36A 3RZDJ 2FNAA 2HVSA 1Z77A 3J7AO 1R36A 4XMYA 2WAQN 4IX7A 3H9QA 3FK6A 2ECBA 3ASOH 1KGSA 3J7YJ 1ZN2A 4P55A 3WGIA 3O2PE 5M3FJ 1DU6A 3DEWA 1IO2A 4CGZA 3HGGA 4UB8C 1G3WA 2DU9A 3DKYA 1TP4A 4RA2A 2OQRA 3TO6A 4A3BJ 2KJCA 1STZA 2JTVA 2DYSH 3DTEA 4CSWA 2A3SA 3BZ6A 4AC0A 2NVTJ 2MW8A 2JVGA 2LYCA 2OBPA 1ERDA 5A2QK 4PDKA 2DLLA 1BA5A 3TP3A 2ZJQF 2ZO4A 1LJ9A 3H3UA 4BDZA 1GVDA 2KHMA 2VQGA 3M1EA 1HKTA 1T8IA 2WY8Q 4CYDA 2L9VA 1OCOH 3MKZA 3ZR8X 1P9QC 5BS6A 5H6QA 2V6EA 5C3EJ 3GTMJ 1IV8A 3AG4H 4YG2F 4HYEA 2FBHA 3G1OA 3LSMA 1HC8A 3D0SA 1X1DA 2FBIA 3F6OA 2Y9ZA 4L9VA 3HDDA 1IN7A 2M0MA 2ACJA 5L3GA 1IN5A 5D5UB 2QKMB 1XTAA 1NG7A 5HNFA 3FMSA 3J80K 1IRXA 4CA0A 3NEUA 1TWCJ 2XGDA 1QPMA 1OQYA 4EQQA 2FU4A 2R7OA 2FF4A 2XAHA 2GLOA 1USTA 2VJ5A 3CF2A 2RGVA 1ZGWA 3UKGA 1B1BA 2GQQA 1FZPB 2QSGX 1IXCA 3L2RA 3BY6A 5F27A 3HBLA 2VKVA 4CCKA 1YI2I 1YJNI 1RR8C 4D5CA 4G7HF 3QP5A 3JW4A 4LLGF 3CO6C 2L4AA 3IWZA 5GAHJ 2IA2A 1KU9A 3RPUD 1JJ8C 1V3FA 3HM5A 2KZGA 1ETOA 2OA4A 1BM9A 3PIOF 1WJDA 3ZMZA 4AU7A 4CH7A 1R00A 3MD2A 3FXLA 3M9AA 1S6LA 4M9XA 2OD5A 1RUOA 4CHUA 4KN7X 3NWSA 1GV2A 2Z1DA 2VC1A 3DKWA 3RQ4A 1WH7A 4WK8F 3MZ8A 4ZJZA 3QOPA 1S72I 1OKRA 1BI2A 1CF7B 4P5OA 4UNOA 4NC6A 5JHUA 1KZHA 2HI3A 2OC6A 4P9UA 2W25A 2M2EA 4A0YA 4E7HA 2VIXA 2ZSIB 1SVLA 2DK5A 3O8GA 4PJJA 2A6EF 3Q5FA 4BU2A 2VQCA 2R3SA 2EFWA 4X1EA 2OAZA 3OL3A 4II2A 3S16J 4M73A 3LSIA 4MQVA 4XLPF 1MD0A 1LQ1A 5D8KB 3JR9A 1VF9A 1HOMA 1JTXA 3K4CA 4HNTA 3QYEA 4CXFA 5IT9Z 4KITB 3FM5A 1MMNA 4E7LA 4DBQA 2VT3A 2XKOA 2MFZA 2XIGA 5AONA 3F23A 2VL8A 3DBHB 2AO9A 1VTNC 3HRUA 5IYBJ 2FXAA 2JA5J 1QVUA 4RLQA 1JUSA 1TT0A 2M87A 4UV8A 2NVYJ 2HQ5A 3ROUA 2CMPA 2VKEA 5GTIC 1EH6A 5FLXK 3OWTA 2DT5A 2M4KA 2IJLA 1VQOI 1QRYA 3H3VK 1FOXA 4L9TA 1WJBA 4HG2A 3H5AA 1DGRM 2QQBA 3NARA 4MFEA 3BQZA 4FETA 4U88A 3M1CA 4BQQA 4RGUA 1SAXA 3DBRB 2GAUA 3A4CA 3W6VA 4QLCU 1D3YA 3OIPA 2YX4A 3DCFA 2R7SA 1ZLJA 2XGEA 2JA8J 1Z91A 2HEOA 3K1NA 1X1AA 1E3HA 4KT6A 1JKOC 2VJIA 3M3YJ 3ZQLA 2UXXA 4BDYA 5LHHA 2K9MA 1MNDA 3RJPA 3W6JB 3V8KA 3VYUB 3CDLA 4F92B 5GADJ 3JRHA 3GYHX 4II3A 2P81A 1VQ4I 3CJQB 2E5NA 3K70C 4HNVA 2GBYA 2K9LA 3QPTA 3EUHC 3U21A 3BJOA 3H3ZA 5HS8A 1H9TA 2HOSA 3A0HC 3JAMZ 4QPQA 1FOYA 1TWAJ 3M7GA 3LA3A 5KHDA 3LQQA 4L0YB 1U78A 5K5QA 3I59B 1K78B 3AL0C 3DTIA 3OYAA 4JYKA 2L7KA 1WQ2A 2P5LC 2DA1A 3IV5A 3I54A 4FASD 3JAMK 2BY1A 2DI3A 4I0AA 3RSNA 3CDHA 3K0LA 2L9NA 4XICA 1Q1VA 3AG1H 2ZJ2A 5HVQC 3GFIA 3TGNA 1SD6A 1KYZA 4QWQA 1WHUA
chains in the Genus database with same CATH topology
4KMUX 2HTJA 1WI9A 4H0EA 4I01A 2Y0MA 3SXYA 2PLYA 1FSHA 5CJ9A 3GXOA 4TV7A 2ELHA 1BI0A 1ZGAA 3FHZA 1XGNA 4WXDA 4HV6A 4ENNA 1XCBA 1EH8A 4MHGA 3WGHA 5K5RA 2O0YA 1XMKA 2A6HF 3SZPA 3EYYA 1ZRFA 3FF5A 3KP5A 3MFKA 2GZWA 1J59A 2IPQX 1TBXA 1FSEA 1MJBA 1QGPA 2Z5UA 1BOAA 1IXSB 2QYOA 4O3MA 4GYGA 3FX3A 1XSXA 1XGOA 1ZG5A 4LGWA 2F5FA 3JSPA 1ZREA 3WTSC 5DEQA 1O3SA 2X4HA 2GA1A 5E1XA 1QBJA 4KA4A 2H94A 2STTA 5E18F 3ZPLA 3ECHA 5CVRA 1G3YA 5F64A 3T0YA 1UHWA 2MA3A 2QBYB 2FNPA 1SD5A 4AD9A 4A0XA 4OINF 2M30A 5EEGA 4BH9A 2DPDA 5HLGA 4MGRA 1BIBA 2EV5A 2FBKA 4RGXA 1HW2A 1RNLA 1U5TA 3HHHA 1ZH5A 2H09A 1R22A 3IRRA 3CUQB 2NS0A 3HOTA 4HAMA 2CWEA 2DBBA 1YW9A 3ZP5A 2QENA 4N0BA 2RKHA 4HLYA 1BI1A 1OYIA 5DUIA 1NHAA 3BPVA 4P96A 4KIFA 4PGHA 1ON2A 4L9NA 2BBYA 4UHTA 4IXAA 2CQKA 4IRIA 3WTUC 1YIOA 5BMZA 1MKMA 4Q4ZF 2NRAC 2PG4A 4U7DA 1SD4A 3JSOA 2R7FA 4IJAA 2YPRA 3PQKA 3TOBA 5HDNA 3FMRA 1AWCA 1GHCA 1UCRA 5E20A 4MNUA 4ZH4F 3GWZA 3ZMDA 4EJOA 3RKYA 4E70A 1SMYF 2IP2A 3MCZA 3KCCA 1XDSA 3GO5A 1XCVA 2UZKA 1D8JA 4GGGA 1FYMA 4I2OA 1DUXC 1AOYA 3KP4A 2Z3YA 1FWZA 4KNYA 3I64A 4UUVA 1F4KA 1HSTA 2A07F 5CVJA 2Q0OA 4ENJA 2P8TA 3NQOA 2EV6A 2QWWA 5ILSA 4EM2A 2WWYA 2HWVA 1YYVA 3F3XA 1R5HA 5JR3A 3U2RA 5H20A 1F5TA 4IRHA 1R1TA 3Q9SA 3ABTA 4MEYF 3DPTA 1LDJA 4A12A 2NNNA 4I98B 3QAHA 1MDMA 5ICEA 3KFWX 1ZAOA 4G9YA 4EJTA 2HQNA 3ABUA 5DV5A 1XB4A 4CICA 4M74A 2EFOA 3ZMVA 1SFEA 1T0FA 1T39A 1WRJA 5DCMA 2Q2EA 5HLIA 3IL2A 1TQPA 2M8EA 2K02A 5FGMA 3IKTA 2STWA 2VOOA 2M1BA 4RS8A 5FD5A 3R0AA 3VEPA 5D5VB 2A5YB 5ERIA 4WXCA 3CUOA 1KA8A 3VODA 5CVUA 4HF1A 2QQ9A 3KZZA 2HKXA 3K69A 3COAC 2W85A 1LDKB 3C3WA 3C1DA 3F8NA 1LEBA 1UB9A 1XGSA 1TTYA 4A5NA 1G6NA 5BPIA 3C18A 4LG0B 5DCFA 1IRFA 3TKYA 2JPCA 3GUDA 2GWRA 1T6SA 2RQPA 2K86A 2Y48A 5DD4A 4HX4A 2COMA 3C7JA 3FMQA 5D5XB 1J2XA 4GYIA 4N9HA 3WTXC 1F1ZA 5F1RA 3OV8A 1D5VA 4KFCA 2HR3A 1O57A 3LA7A 3EETA 3WTZA 1UFMA 2L02A 1PP8F 5D6EA 5DYMA 4AWXB 2ESHA 3ZMSA 4RGRA 2EFPA 3BWGA 2K27A 3S2WA 1D8KA 2JZYA 2DQLA 1K79A 3F6VA 3SFZA 3GVAA 2B0LA 1FOKA 3T8TA 1FY7A 3O6BB 4IHSA 2VBZA 5LBQA 3GFMA 1FT9A 5BPDA 1JXSA 1O7LA 1TLHB 4R1HA 1OR7A 2ISYA 2VOPA 2K4BA 1MZBA 1T98A 3HRTA 1YS7A 1XSDA 4CDGA 1FYKA 2GXBA 2OZ6A 1DPRA 1RI7A 5DD8A 3WU1B 1HSJA 4PZJA 1IW7F 5LRRA 2YX7A 5D8LB 1YO5C 2PJPA 4ENKA 1BIAA 1K78A 2CSOA 2MH9A 2V1UA 2WV0A 4FX0A 4MQ9F 5AIQA 2E1NA 3ECOA 5IT9K 2Q8KA 1MDMB 4G7ZF 2O03A 3DV8A 3RPUA 4HF2A 1QZZA 2RVCA 4YIIA 3RYRA 4XRFA 4HQEA 1TNTA 2XAFA 4XBFA 4A2UA 2IRFG 2QVOA 3LA2A 5LEKA 3P7NA 3KP7A 5CVVA 1IN8A 4ESFA 3BROA 3HUGA 2IA0A 4HBLA 2BV6A 4YIFA 1KQ8A 2ZCWA 3ISPA 3N4MA 4WCGA 4A0ZA 3F8CA 3GFJA 1IZ1A 1P4AA 4R8HA 3ZMTA 1I1GA 3I4PA 4XLNF 4HA8A 4OIQF 2HGCA 1CGPA 4U0WA 1PUEE 2RC4A 1KU3A 1KU2A 3LSTA 2CYYA 1LNWA 1T2KA 2D1HA 2XASA 3E5QA 2ZNYA 1V4RA 2XUBA 1YW8A 4WX9A 1ULYA 2ESNA 3WTTC 2JPBA 2RN7A 1I5ZA 4M9ZA 1P2FA 5J8CA 3N97A 1B9MA 1MJAA 3U1DA 4HX7A 3I0TA 4HOBA 4ZYEA 4NHJA 2W24A 4UV9A 1J5YA 3GF2A 4B8XA 4MTEA 4OIPF 1MGTA 3KLOA 1OPCA 4EJVA 3ZN0A 2LDUA 2HFHA 2EB7A 4Q48A 1IF1A 3F8MA 3BOQA 3HHGA 5ICFA 2C6YA 2XAGA 4PCQA 3U9GA 1H0MA 2NAZA 4MTDA 3E6DA 5E8IA 4OU0A 1WWXA 2PFBA 4ZZDA 3R6SA 3RTRA 4M9SA 3B73A 1BBYA 2X0LA 1LVAA 3K1PA 2W84A 3IRQA 2XKPA 1R23A 2LF7A 3BP8A 1U5TC 5D6FA 2V1DA 3GX4X 3PQJA 2P5VA 2FA5A 4GO1A 1DP7P 2UXNA 2EWNA 3L7WA 2P7VB 1FP2A 5ICGA 3WE2A 4RB3C 2YU3A 2MD5A 1FBQA 3F22A 3REOA 1BJAA 4RB2C 1JHHA 2H6CA 4HX8A 1XMAA 4EJWA 2TDXA 3GW2A 5FD6A 3GEZA 4EGZA 1T38A 4D0PA 1EV7A 1O7FA 2H27A 1TNSA 2ISZA 4EGYA 2XAJA 5EEHA 1A04A 4MEXF 3WGGA 3M8FA 5JFRA 4KN4X 1P4WA 2MC3A 3F72A 4RGSA 4U0VA 2OZUA 4UVBA 1X3UA 3JTGA 2O3FA 4LK0F 4YFXF 3R4KA 1U3EM 2FE3A 3MWMA 5AIPA 2PI0A 2YSRA 3HOSA 5E17F 2K7LA 2EK5A 1GXPA 2A68F 4LLLA 3T1BA 1FBUA 5H6RA 2VE9A 4HDUA 1KU7A 3VOEA 1U5TB 1ZLKA 1UHMA 1J0RA 3RKWA 3R0JA 2ZKZA 2G7UA 4KT5C 3QU6A 3CO7C 2WC2A 3F8BA 1I27A 2DPUA 4I0BA 2FQ3A 2FOKA 5DUKA 1ODDA 2V79A 5DDGA 5JI6A 1CF7A 3FZVA 3V7CA 1DPUA 5L3BA 4KIGA 5L3FA 4RAYA 2O61A 3MAJA 5L3DA 2DW4A 1ON1A 2DK8A 2AS5F 1FX7A 1YS6A 1OYWA 1XDUA 5J8FA 3WTWC 3HSRA 3SHFA 3HTSB 4B09A 2IVMA 3IC7A 3LWFA 4G6DA 4FT8A 3LAJA 4ASNA 3J81Z 3V7RA 4LLNA 3FXUA 2W57A 5D4RA 1SMTA 4L5JA 2EA2A 2ZMEA 4ON0A 3MEXA 2LNBA 1YTYA 4EV0A 1FLIA 1ZRDA 2IA1A 4FX4A 5ILUA 2KIUA 1TQIA 2QUFA 4HW0A 3WG9A 4O6JA 1FC3A 1S29A 4LD5A 1TW2A 3V8JA 3E6BA 3T8RA 3VB2A 2RV8A 1L3LA 1TQMA 1XN7A 2P6SA 1LDDA 2XV4S 4OIOF 1RUNA 3I59A 5L3EA 1JHFA 3GZ6A 3LFKA 4KIBA 3G3ZA 4G8XA 2DQRA 4JQFA 2E1CA 2JSCA 3KP3A 5FFZA 3KP2A 1B6AA 3CLOA 4LJZF 4HDVA 2UWMA 3ELKA 5FO5A 1EH7A 4WXHA 1WKMA 5CYVA 4I02A 3EUHA 2O8XA 3BDDA 1PDNC 4L9JA 1U2WA 2VT2A 5LHGA 1ZG3A 5J6XA 3B02A 3K1MA 3FXQA 2Z99A 5KVRA 3BPXA 3M8EA 4G7OF 3E97A 1FNNA 3P9CA 4ZYGA 1BC8C 2R7DA 1Q1HA 3FXRA 3ULQB 2MH2A 4U0YA 3ML6A 1HXDA 4EMSA 3GZ5A 1IAWA 2DO7A 1R1VA 3R61A 2VBYA 4NQWA 2F5DA 1F9NA 2J5OA 3KP6A 3WTYC 1J9IA 3OOPA 1Z1DA 1O3RA 2IT0A 3CJNA 5CVIA 5LGUA 2ZBKA 3HRSA 1ZYRF 4OMZA 2L01A 2KRFA 1Z7UA 4A6DA 2P7CB 1S3JA 1HKQA 3K9TA 2KIFA 3WE3A 1LB2A 3VFZA 3V4GA 2BGCA 3DQVC 4M6YA 1YFHA 2F2EA 2GIVA 4UVAA 1HW5A 1U6GA 2EA4A 1IRGA 4HLXA 1TW3A 4ETSA 4BXUA 5HLHA 2QZ8A 3G73A 3MZYA 2PQ8A 5D5WB 2HYGD 3RDIA 2VXZA 3Q9VA 4WWCA 2AXLA 3PFIA 2EV0A 5LRSA 2ZNZA 1E17A 3JTHA 3RYPA 3DFGA 4XSZF 3HIFA 5A2QZ 4N9IA 1JGSA 2O6GE 3WU0A 4G6QA 4ENMA 2Z33A 4O5VA 3QPHA 4YFKF 3I58A 2RNJA 4XSXF 1S7AA 4EM0B 4AIHA 5K1YA 4OOIA 3J80Z 2M5WA 2M45A 1IUYA 1YLFA 5CLSA 3LQRA 1G3SA 4ESJA 2A61A 5LHIA 3I5UA 2CO5A 2XRNA 4OIRF 1HKSA 1QO0D 4HZFA 2PMHA 2HS5A 2A69F 3F21A 1W4MA 4GCVA 2XVCA 2E7XA 1W7PD 5LGNA 4LMYA 1W7PB 4NB5A 3FWEA 2XHKA 6PAXA 4YFNF 2FRHA 3TDZC 1IN4A 2GXGA 5LEJA 3WTVC 1ZARA 1IXRC 4OMYA 4L18B 2CW0F 3I71A 2CGPA 3E3VA 1GXQA 1O3QA 2D1VA 2MLGA 1R1UA 2LF8A 3DEUA 3P9IA 3J81K 4P9FA 4LB6B 1B4AA 5IT3A 1B59A 4BHPA 1W5SA 2LKPA 1W5TA 1U8RA 3KEOA 2PMUA 5HOOA 4DQ2A 4U7BA 2D2WA 2PN6A 5K5OA 2VBXA 3CUQA 4KMFA 5BQTA 3E5UA 4KYWA 5F6FA 2P5KA 4AIKA 2BEOA 1QQIA 1Z05A 5DCMB 4EJUA 1XGMA 2Y75A 1USSA 1K6OA 3KE2A 2OU2A 1QNTA 3GFLA 3R60A 4WF2A 2QM3A 1R58A 1BC7C 2VN2A 3RPQA 2HOEA 2QLZA 2IW5A 5HDGA 2DTRA 1QZYA 4BNCA 3RKXA 4AVPA 3HSEA 4FHTA 2VBWA 5TRDA 2XAQA 3K2ZA 4M72A 2XROA 2V6CA 2EJRA 3IKVA 2BE5F 1P4XA 2MLKA 1DDNA 1YG2A 1KYWA 3P9KA 4AIJA 4G94A 1Z9CA 1S8NA 2HYFA 2JT1A 4IPAA 4GXOA 2PBIA 3HSFA 3AAFA 4UXNA 5BOXA 5HS7A 3DPLC 2V1XA 2HKOA 3V7SA 5E8GA 3ZQ7A 4EVIA 1KQ9A 2DAOA 4LK1F 2P6TA 4A6EA 4JK1X 4LB5A 5E1ZB 1IN6A 1REPC 5D4SA 1KQ0A 4M6XA 1MJ9A 3V8LA 5FB2A 5LLQA 2GA2A 4BHCA 2F5EA 3RI4A 4S04A 5HDKA 3L2CA 1O3TA 3IHUA 1Z6RA 2FMLA 4CO8A 4BAYA 2ZMEB 1S7OA 4Q47A 3HRMA 4I7HA 1FYLA 1K7AA 2NNYA 1J7KA 1W7PA 1B9NA 2VE8A 1H9GA 2FSWA 1BN5A 2EFQA 4RB0A 2EFNA 2G9WA 1BI3A 2WTEA 2MBFA 1C0WA 4RAZA 3L00A 2NYXA 5ICCA 4ZZLA 3TOAA 2VODA 2L4MA 1P92A 1E2XA 2L54A 4HQMA 3EDPA 2ZFWA 4PGGA 3ERED 2YR2A 1LEAA 3CUQC 5HS9A 4BHBA 4IHTA 1P6RA 3KZYA 3KEQA 1ZG1A 3TO9A 1SFXA 4RB1A 1YW7A 1RZ4A 1ZGJA 1WSUA 2CFXA 2F5CA 4ZYDA 1HW1A 3H92A 2HTSA 1FBSA 5L3CA 1G3TA 1PP7U 4Q5SF 3T5XA 3KLNA 2D45A 4A5MA 1FPQA 1ZHFA 1J75A 2QBYA 2CG4A 2RDPA 2QQAA 2L3DA 2V9VA 1JE8A 2H6BA 3MZHA 4Y13A 2HZTA 4IRGA 3IWFA 5FFXA 1XSVA 1Y0UA 1ONVA 4IF4A 2FEZA 1HBXG 1SFUA 5ED4A 3QP6A 2ADUA 4KDPA 4R79A 2K4JA 5ILVA 3RIRA 3TDUC 1SD7A 4EM1A 1R7JA 4I09A 3L09A 1XD7A 1GVJA 3ZN1A 5LGTA 4ZYHA 2PEXA 4Z2YA 3DP7A 1KYZA 2G7HA 2LSOA 3EYIA 2ZXJA 3E6MA 2P4WA 3WODF 1FP1D 4L5IA 3QU3A 3W6KB 2KJBA 3EQLF 2J5PA 4CZZA 5E1WA 1I6XA 3CTAA 5FLXZ 1R5GA 1G4DA 3SZTA 4L0ZB 4M71A 4BYYA 3O3KA 3FM3A 1YQAA 4KICA 3LAPA 4Y15A 1OYYA 3GLXA 3MQ0A 5TJJA 1I1SA 2KKOA 3DF8A 1HQCA 3TO7A 2DFIA 4Y17A 3ZMUA 4K2EA 2VONA 4BQAA 3SQNA 3DXJF 3BJAA 3E5XA 2HDCA 2HQRA 2XGXA 3D5LA 4LG0A 2KIMA 3HYIA 1ZRCA 4DNCA 2BYVE 1L0OC 5KK1A 2FMYA 1OMIA 4F7ZA 3TQNA 3KETA 3E6CC 3BJ6A 2JRTA 4HF0A 1RIOH 2OQGA 4S05A 1Z6TA 4HV5A 2VC0A 5JVTA 2Z9OA 3I53A 2E7WA 4LFUA 4ESBA 4KUMA 4UVCA 4IVNA 3L9FA 3F8FA 3QRFF 3HTUA 3NRVA 2ETHA 2FNAA 3J7AO 1R36A 1KGSA 1ZN2A 4P55A 3WGIA 3O2PE 4CGZA 1G3WA 2DU9A 2OQRA 3TO6A 2KJCA 1STZA 2JTVA 2A3SA 3BZ6A 2OBPA 5A2QK 4PDKA 2DLLA 2ZO4A 1LJ9A 3H3UA 3M1EA 1HKTA 4CYDA 5BS6A 5H6QA 4YG2F 4HYEA 2FBHA 3D0SA 2FBIA 3F6OA 4L9VA 1IN7A 2ACJA 5L3GA 1IN5A 5D5UB 3FMSA 3J80K 3NEUA 1QPMA 4EQQA 2FU4A 2FF4A 2XAHA 1USTA 2RGVA 1B1BA 2GQQA 1FZPB 1IXCA 3BY6A 4G7HF 3QP5A 3JW4A 4LLGF 3CO6C 2L4AA 3IWZA 2IA2A 1KU9A 1V3FA 2OA4A 1BM9A 3ZMZA 1R00A 3M9AA 1S6LA 4M9XA 2OD5A 1RUOA 4CHUA 4KN7X 2VC1A 3DKWA 4WK8F 3QOPA 1OKRA 1BI2A 1CF7B 4P5OA 4UNOA 5JHUA 4P9UA 2W25A 4A0YA 2DK5A 2A6EF 3Q5FA 2R3SA 2EFWA 2OAZA 4M73A 4MQVA 4XLPF 1MD0A 1LQ1A 5D8KB 5IT9Z 4CXFA 3FM5A 2VT3A 2XKOA 2XIGA 5AONA 3F23A 1VTNC 3HRUA 2FXAA 4UV8A 2M87A 3ROUA 1EH6A 5FLXK 2DT5A 2IJLA 4L9TA 2QQBA 4U88A 1SAXA 4RGUA 2GAUA 4QLCU 1D3YA 2YX4A 1ZLJA 1Z91A 2HEOA 3K1NA 2UXXA 5LHHA 3RJPA 3W6JB 3V8KA 3GYHX 3QPTA 3BJOA 3H3ZA 5HS8A 1H9TA 3JAMZ 3M7GA 3LA3A 3LQQA 4L0YB 1U78A 5K5QA 3I59B 1K78B 1WQ2A 2P5LC 3I54A 3JAMK 2DI3A 4I0AA 3CDHA 3K0LA 5HVQC 2ZJ2A 3GFIA 3TGNA 1SD6A 4JBAA 4QWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMU X;  2HTJ A;  1WI9 A;  4H0E A;  4I01 A;  2Y0M A;  3SXY A;  2PLY A;  1FSH A;  5CJ9 A;  3GXO A;  4TV7 A;  2ELH A;  1BI0 A;  1ZGA A;  3FHZ A;  1XGN A;  4WXD A;  4HV6 A;  4ENN A;  1XCB A;  1EH8 A;  4MHG A;  3WGH A;  5K5R A;  2O0Y A;  1XMK A;  2A6H F;  3SZP A;  3EYY A;  1ZRF A;  3FF5 A;  3KP5 A;  3MFK A;  2GZW A;  1J59 A;  2IPQ X;  1TBX A;  1FSE A;  1MJB A;  1QGP A;  2Z5U A;  1BOA A;  1IXS B;  2QYO A;  4O3M A;  4GYG A;  3FX3 A;  1XSX A;  1XGO A;  1ZG5 A;  4LGW A;  2F5F A;  3JSP A;  1ZRE A;  3WTS C;  5DEQ A;  1O3S A;  2X4H A;  2GA1 A;  5E1X A;  1QBJ A;  4KA4 A;  2H94 A;  2STT A;  5E18 F;  3ZPL A;  3ECH A;  5CVR A;  1G3Y A;  5F64 A;  3T0Y A;  1UHW A;  2MA3 A;  2QBY B;  2FNP A;  1SD5 A;  4AD9 A;  4A0X A;  4OIN F;  2M30 A;  5EEG A;  4BH9 A;  2DPD A;  5HLG A;  4MGR A;  1BIB A;  2EV5 A;  2FBK A;  4RGX A;  1HW2 A;  1RNL A;  1U5T A;  3HHH A;  1ZH5 A;  2H09 A;  1R22 A;  3IRR A;  3CUQ B;  2NS0 A;  3HOT A;  4HAM A;  2CWE A;  2DBB A;  1YW9 A;  3ZP5 A;  2QEN A;  4N0B A;  2RKH A;  4HLY A;  1BI1 A;  1OYI A;  5DUI A;  1NHA A;  3BPV A;  4P96 A;  4KIF A;  4PGH A;  1ON2 A;  4L9N A;  2BBY A;  4UHT A;  4IXA A;  2CQK A;  4IRI A;  3WTU C;  1YIO A;  5BMZ A;  1MKM A;  4Q4Z F;  2NRA C;  2PG4 A;  4U7D A;  1SD4 A;  3JSO A;  2R7F A;  4IJA A;  2YPR A;  3PQK A;  3TOB A;  5HDN A;  3FMR A;  1AWC A;  1GHC A;  1UCR A;  5E20 A;  4MNU A;  4ZH4 F;  3GWZ A;  3ZMD A;  4EJO A;  3RKY A;  4E70 A;  1SMY F;  2IP2 A;  3MCZ A;  3KCC A;  1XDS A;  3GO5 A;  1XCV A;  2UZK A;  1D8J A;  4GGG A;  1FYM A;  4I2O A;  1DUX C;  1AOY A;  3KP4 A;  2Z3Y A;  1FWZ A;  4KNY A;  3I64 A;  4UUV A;  1F4K A;  1HST A;  2A07 F;  5CVJ A;  2Q0O A;  4ENJ A;  2P8T A;  3NQO A;  2EV6 A;  2QWW A;  5ILS A;  4EM2 A;  2WWY A;  2HWV A;  1YYV A;  3F3X A;  1R5H A;  5JR3 A;  3U2R A;  5H20 A;  1F5T A;  4IRH A;  1R1T A;  3Q9S A;  3ABT A;  4MEY F;  3DPT A;  1LDJ A;  4A12 A;  2NNN A;  4I98 B;  3QAH A;  1MDM A;  5ICE A;  3KFW X;  1ZAO A;  4G9Y A;  4EJT A;  2HQN A;  3ABU A;  5DV5 A;  1XB4 A;  4CIC A;  4M74 A;  2EFO A;  3ZMV A;  1SFE A;  1T0F A;  1T39 A;  1WRJ A;  5DCM A;  2Q2E A;  5HLI A;  3IL2 A;  1TQP A;  2M8E A;  2K02 A;  5FGM A;  3IKT A;  2STW A;  2VOO A;  2M1B A;  4RS8 A;  5FD5 A;  3R0A A;  3VEP A;  5D5V B;  2A5Y B;  5ERI A;  4WXC A;  3CUO A;  1KA8 A;  3VOD A;  5CVU A;  4HF1 A;  2QQ9 A;  3KZZ A;  2HKX A;  3K69 A;  3COA C;  2W85 A;  1LDK B;  3C3W A;  3C1D A;  3F8N A;  1LEB A;  1UB9 A;  1XGS A;  1TTY A;  4A5N A;  1G6N A;  5BPI A;  3C18 A;  4LG0 B;  5DCF A;  1IRF A;  3TKY A;  2JPC A;  3GUD A;  2GWR A;  1T6S A;  2RQP A;  2K86 A;  2Y48 A;  5DD4 A;  4HX4 A;  2COM A;  3C7J A;  3FMQ A;  5D5X B;  1J2X A;  4GYI A;  4N9H A;  3WTX C;  1F1Z A;  5F1R A;  3OV8 A;  1D5V A;  4KFC A;  2HR3 A;  1O57 A;  3LA7 A;  3EET A;  3WTZ A;  1UFM A;  2L02 A;  1PP8 F;  5D6E A;  5DYM A;  4AWX B;  2ESH A;  3ZMS A;  4RGR A;  2EFP A;  3BWG A;  2K27 A;  3S2W A;  1D8K A;  2JZY A;  2DQL A;  1K79 A;  3F6V A;  3SFZ A;  3GVA A;  2B0L A;  1FOK A;  3T8T A;  1FY7 A;  3O6B B;  4IHS A;  2VBZ A;  5LBQ A;  3GFM A;  1FT9 A;  5BPD A;  1JXS A;  1O7L A;  1TLH B;  4R1H A;  1OR7 A;  2ISY A;  2VOP A;  2K4B A;  1MZB A;  1T98 A;  3HRT A;  1YS7 A;  1XSD A;  4CDG A;  1FYK A;  2GXB A;  2OZ6 A;  1DPR A;  1RI7 A;  5DD8 A;  3WU1 B;  1HSJ A;  4PZJ A;  1IW7 F;  5LRR A;  2YX7 A;  5D8L B;  1YO5 C;  2PJP A;  4ENK A;  1BIA A;  1K78 A;  2CSO A;  2MH9 A;  2V1U A;  2WV0 A;  4FX0 A;  4MQ9 F;  5AIQ A;  2E1N A;  3ECO A;  5IT9 K;  2Q8K A;  1MDM B;  4G7Z F;  2O03 A;  3DV8 A;  3RPU A;  4HF2 A;  1QZZ A;  2RVC A;  4YII A;  3RYR A;  4XRF A;  4HQE A;  1TNT A;  2XAF A;  4XBF A;  4A2U A;  2IRF G;  2QVO A;  3LA2 A;  5LEK A;  3P7N A;  3KP7 A;  5CVV A;  1IN8 A;  4ESF A;  3BRO A;  3HUG A;  2IA0 A;  4HBL A;  2BV6 A;  4YIF A;  1KQ8 A;  2ZCW A;  3ISP A;  3N4M A;  4WCG A;  4A0Z A;  3F8C A;  3GFJ A;  1IZ1 A;  1P4A A;  4R8H A;  3ZMT A;  1I1G A;  3I4P A;  4XLN F;  4HA8 A;  4OIQ F;  2HGC A;  1CGP A;  4U0W A;  1PUE E;  2RC4 A;  1KU3 A;  1KU2 A;  3LST A;  2CYY A;  1LNW A;  1T2K A;  2D1H A;  2XAS A;  3E5Q A;  2ZNY A;  1V4R A;  2XUB A;  1YW8 A;  4WX9 A;  1ULY A;  2ESN A;  3WTT C;  2JPB A;  2RN7 A;  1I5Z A;  4M9Z A;  1P2F A;  5J8C A;  3N97 A;  1B9M A;  1MJA A;  3U1D A;  4HX7 A;  3I0T A;  4HOB A;  4ZYE A;  4NHJ A;  2W24 A;  4UV9 A;  1J5Y A;  3GF2 A;  4B8X A;  4MTE A;  4OIP F;  1MGT A;  3KLO A;  1OPC A;  4EJV A;  3ZN0 A;  2LDU A;  2HFH A;  2EB7 A;  4Q48 A;  1IF1 A;  3F8M A;  3BOQ A;  3HHG A;  5ICF A;  2C6Y A;  2XAG A;  4PCQ A;  3U9G A;  1H0M A;  2NAZ A;  4MTD A;  3E6D A;  5E8I A;  4OU0 A;  1WWX A;  2PFB A;  4ZZD A;  3R6S A;  3RTR A;  4M9S A;  3B73 A;  1BBY A;  2X0L A;  1LVA A;  3K1P A;  2W84 A;  3IRQ A;  2XKP A;  1R23 A;  2LF7 A;  3BP8 A;  1U5T C;  5D6F A;  2V1D A;  3GX4 X;  3PQJ A;  2P5V A;  2FA5 A;  4GO1 A;  1DP7 P;  2UXN A;  2EWN A;  3L7W A;  2P7V B;  1FP2 A;  5ICG A;  3WE2 A;  4RB3 C;  2YU3 A;  2MD5 A;  1FBQ A;  3F22 A;  3REO A;  1BJA A;  4RB2 C;  1JHH A;  2H6C A;  4HX8 A;  1XMA A;  4EJW A;  2TDX A;  3GW2 A;  5FD6 A;  3GEZ A;  4EGZ A;  1T38 A;  4D0P A;  1EV7 A;  1O7F A;  2H27 A;  1TNS A;  2ISZ A;  4EGY A;  2XAJ A;  5EEH A;  1A04 A;  4MEX F;  3WGG A;  3M8F A;  5JFR A;  4KN4 X;  1P4W A;  2MC3 A;  3F72 A;  4RGS A;  4U0V A;  2OZU A;  4UVB A;  1X3U A;  3JTG A;  2O3F A;  4LK0 F;  4YFX F;  3R4K A;  1U3E M;  2FE3 A;  3MWM A;  5AIP A;  2PI0 A;  2YSR A;  3HOS A;  5E17 F;  2K7L A;  2EK5 A;  1GXP A;  2A68 F;  4LLL A;  3T1B A;  1FBU A;  5H6R A;  2VE9 A;  4HDU A;  1KU7 A;  3VOE A;  1U5T B;  1ZLK A;  1UHM A;  1J0R A;  3RKW A;  3R0J A;  2ZKZ A;  2G7U A;  4KT5 C;  3QU6 A;  3CO7 C;  2WC2 A;  3F8B A;  1I27 A;  2DPU A;  4I0B A;  2FQ3 A;  2FOK A;  5DUK A;  1ODD A;  2V79 A;  5DDG A;  5JI6 A;  1CF7 A;  3FZV A;  3V7C A;  1DPU A;  5L3B A;  4KIG A;  5L3F A;  4RAY A;  2O61 A;  3MAJ A;  5L3D A;  2DW4 A;  1ON1 A;  2DK8 A;  2AS5 F;  1FX7 A;  1YS6 A;  1OYW A;  1XDU A;  5J8F A;  3WTW C;  3HSR A;  3SHF A;  3HTS B;  4B09 A;  2IVM A;  3IC7 A;  3LWF A;  4G6D A;  4FT8 A;  3LAJ A;  4ASN A;  3J81 Z;  3V7R A;  4LLN A;  3FXU A;  2W57 A;  5D4R A;  1SMT A;  4L5J A;  2EA2 A;  2ZME A;  4ON0 A;  3MEX A;  2LNB A;  1YTY A;  4EV0 A;  1FLI A;  1ZRD A;  2IA1 A;  4FX4 A;  5ILU A;  2KIU A;  1TQI A;  2QUF A;  4HW0 A;  3WG9 A;  4O6J A;  1FC3 A;  1S29 A;  4LD5 A;  1TW2 A;  3V8J A;  3E6B A;  3T8R A;  3VB2 A;  2RV8 A;  1L3L A;  1TQM A;  1XN7 A;  2P6S A;  1LDD A;  2XV4 S;  4OIO F;  1RUN A;  3I59 A;  5L3E A;  1JHF A;  3GZ6 A;  3LFK A;  4KIB A;  3G3Z A;  4G8X A;  2DQR A;  4JQF A;  2E1C A;  2JSC A;  3KP3 A;  5FFZ A;  3KP2 A;  1B6A A;  3CLO A;  4LJZ F;  4HDV A;  2UWM A;  3ELK A;  5FO5 A;  1EH7 A;  4WXH A;  1WKM A;  5CYV A;  4I02 A;  3EUH A;  2O8X A;  3BDD A;  1PDN C;  4L9J A;  1U2W A;  2VT2 A;  5LHG A;  1ZG3 A;  5J6X A;  3B02 A;  3K1M A;  3FXQ A;  2Z99 A;  5KVR A;  3BPX A;  3M8E A;  4G7O F;  3E97 A;  1FNN A;  3P9C A;  4ZYG A;  1BC8 C;  2R7D A;  1Q1H A;  3FXR A;  3ULQ B;  2MH2 A;  4U0Y A;  3ML6 A;  1HXD A;  4EMS A;  3GZ5 A;  1IAW A;  2DO7 A;  1R1V A;  3R61 A;  2VBY A;  4NQW A;  2F5D A;  1F9N A;  2J5O A;  3KP6 A;  3WTY C;  1J9I A;  3OOP A;  1Z1D A;  1O3R A;  2IT0 A;  3CJN A;  5CVI A;  5LGU A;  2ZBK A;  3HRS A;  1ZYR F;  4OMZ A;  2L01 A;  2KRF A;  1Z7U A;  4A6D A;  2P7C B;  1S3J A;  1HKQ A;  3K9T A;  2KIF A;  3WE3 A;  1LB2 A;  3VFZ A;  3V4G A;  2BGC A;  3DQV C;  4M6Y A;  1YFH A;  2F2E A;  2GIV A;  4UVA A;  1HW5 A;  1U6G A;  2EA4 A;  1IRG A;  4HLX A;  1TW3 A;  4ETS A;  4BXU A;  5HLH A;  2QZ8 A;  3G73 A;  3MZY A;  2PQ8 A;  5D5W B;  2HYG D;  3RDI A;  2VXZ A;  3Q9V A;  4WWC A;  2AXL A;  3PFI A;  2EV0 A;  5LRS A;  2ZNZ A;  1E17 A;  3JTH A;  3RYP A;  3DFG A;  4XSZ F;  3HIF A;  5A2Q Z;  4N9I A;  1JGS A;  2O6G E;  3WU0 A;  4G6Q A;  4ENM A;  2Z33 A;  4O5V A;  3QPH A;  4YFK F;  3I58 A;  2RNJ A;  4XSX F;  1S7A A;  4EM0 B;  4AIH A;  5K1Y A;  4OOI A;  3J80 Z;  2M5W A;  2M45 A;  1IUY A;  1YLF A;  5CLS A;  3LQR A;  1G3S A;  4ESJ A;  2A61 A;  5LHI A;  3I5U A;  2CO5 A;  2XRN A;  4OIR F;  1HKS A;  1QO0 D;  4HZF A;  2PMH A;  2HS5 A;  2A69 F;  3F21 A;  1W4M A;  4GCV A;  2XVC A;  2E7X A;  1W7P D;  5LGN A;  4LMY A;  1W7P B;  4NB5 A;  3FWE A;  2XHK A;  6PAX A;  4YFN F;  2FRH A;  3TDZ C;  1IN4 A;  2GXG A;  5LEJ A;  3WTV C;  1ZAR A;  1IXR C;  4OMY A;  4L18 B;  2CW0 F;  3I71 A;  2CGP A;  3E3V A;  1GXQ A;  1O3Q A;  2D1V A;  2MLG A;  1R1U A;  2LF8 A;  3DEU A;  3P9I A;  3J81 K;  4P9F A;  4LB6 B;  1B4A A;  5IT3 A;  1B59 A;  4BHP A;  1W5S A;  2LKP A;  1W5T A;  1U8R A;  3KEO A;  2PMU A;  5HOO A;  4DQ2 A;  4U7B A;  2D2W A;  2PN6 A;  5K5O A;  2VBX A;  3CUQ A;  4KMF A;  5BQT A;  3E5U A;  4KYW A;  5F6F A;  2P5K A;  4AIK A;  2BEO A;  1QQI A;  1Z05 A;  5DCM B;  4EJU A;  1XGM A;  2Y75 A;  1USS A;  1K6O A;  3KE2 A;  2OU2 A;  1QNT A;  3GFL A;  3R60 A;  4WF2 A;  2QM3 A;  1R58 A;  1BC7 C;  2VN2 A;  3RPQ A;  2HOE A;  2QLZ A;  2IW5 A;  5HDG A;  2DTR A;  1QZY A;  4BNC A;  3RKX A;  4AVP A;  3HSE A;  4FHT A;  2VBW A;  5TRD A;  2XAQ A;  3K2Z A;  4M72 A;  2XRO A;  2V6C A;  2EJR A;  3IKV A;  2BE5 F;  1P4X A;  2MLK A;  1DDN A;  1YG2 A;  1KYW A;  3P9K A;  4AIJ A;  4G94 A;  1Z9C A;  1S8N A;  2HYF A;  2JT1 A;  4IPA A;  4GXO A;  2PBI A;  3HSF A;  3AAF A;  4UXN A;  5BOX A;  5HS7 A;  3DPL C;  2V1X A;  2HKO A;  3V7S A;  5E8G A;  3ZQ7 A;  4EVI A;  1KQ9 A;  2DAO A;  4LK1 F;  2P6T A;  4A6E A;  4JK1 X;  4LB5 A;  5E1Z B;  1IN6 A;  1REP C;  5D4S A;  1KQ0 A;  4M6X A;  1MJ9 A;  3V8L A;  5FB2 A;  5LLQ A;  2GA2 A;  4BHC A;  2F5E A;  3RI4 A;  4S04 A;  5HDK A;  3L2C A;  1O3T A;  3IHU A;  1Z6R A;  2FML A;  4CO8 A;  4BAY A;  2ZME B;  1S7O A;  4Q47 A;  3HRM A;  4I7H A;  1FYL A;  1K7A A;  2NNY A;  1J7K A;  1W7P A;  1B9N A;  2VE8 A;  1H9G A;  2FSW A;  1BN5 A;  2EFQ A;  4RB0 A;  2EFN A;  2G9W A;  1BI3 A;  2WTE A;  2MBF A;  1C0W A;  4RAZ A;  3L00 A;  2NYX A;  5ICC A;  4ZZL A;  3TOA A;  2VOD A;  2L4M A;  1P92 A;  1E2X A;  2L54 A;  4HQM A;  3EDP A;  2ZFW A;  4PGG A;  3ERE D;  2YR2 A;  1LEA A;  3CUQ C;  5HS9 A;  4BHB A;  4IHT A;  1P6R A;  3KZY A;  3KEQ A;  1ZG1 A;  3TO9 A;  1SFX A;  4RB1 A;  1YW7 A;  1RZ4 A;  1ZGJ A;  1WSU A;  2CFX A;  2F5C A;  4ZYD A;  1HW1 A;  3H92 A;  2HTS A;  1FBS A;  5L3C A;  1G3T A;  1PP7 U;  4Q5S F;  3T5X A;  3KLN A;  2D45 A;  4A5M A;  1FPQ A;  1ZHF A;  1J75 A;  2QBY A;  2CG4 A;  2RDP A;  2QQA A;  2L3D A;  2V9V A;  1JE8 A;  2H6B A;  3MZH A;  4Y13 A;  2HZT A;  4IRG A;  3IWF A;  5FFX A;  1XSV A;  1Y0U A;  1ONV A;  4IF4 A;  2FEZ A;  1HBX G;  1SFU A;  5ED4 A;  3QP6 A;  2ADU A;  4KDP A;  4R79 A;  2K4J A;  5ILV A;  3RIR A;  3TDU C;  1SD7 A;  4EM1 A;  1R7J A;  4I09 A;  3L09 A;  1XD7 A;  1GVJ A;  3ZN1 A;  5LGT A;  4ZYH A;  2PEX A;  4Z2Y A;  3DP7 A;  1KYZ A;  2G7H A;  2LSO A;  3EYI A;  2ZXJ A;  3E6M A;  2P4W A;  3WOD F;  1FP1 D;  4L5I A;  3QU3 A;  3W6K B;  2KJB A;  3EQL F;  2J5P A;  4CZZ A;  5E1W A;  1I6X A;  3CTA A;  5FLX Z;  1R5G A;  1G4D A;  3SZT A;  4L0Z B;  4M71 A;  4BYY A;  3O3K A;  3FM3 A;  1YQA A;  4KIC A;  3LAP A;  4Y15 A;  1OYY A;  3GLX A;  3MQ0 A;  5TJJ A;  1I1S A;  2KKO A;  3DF8 A;  1HQC A;  3TO7 A;  2DFI A;  4Y17 A;  3ZMU A;  4K2E A;  2VON A;  4BQA A;  3SQN A;  3DXJ F;  3BJA A;  3E5X A;  2HDC A;  2HQR A;  2XGX A;  3D5L A;  4LG0 A;  2KIM A;  3HYI A;  1ZRC A;  4DNC A;  2BYV E;  1L0O C;  5KK1 A;  2FMY A;  1OMI A;  4F7Z A;  3TQN A;  3KET A;  3E6C C;  3BJ6 A;  2JRT A;  4HF0 A;  1RIO H;  2OQG A;  4S05 A;  1Z6T A;  4HV5 A;  2VC0 A;  5JVT A;  2Z9O A;  3I53 A;  2E7W A;  4LFU A;  4ESB A;  4KUM A;  4UVC A;  4IVN A;  3L9F A;  3F8F A;  3QRF F;  3HTU A;  3NRV A;  2ETH A;  2FNA A;  3J7A O;  1R36 A;  1KGS A;  1ZN2 A;  4P55 A;  3WGI A;  3O2P E;  4CGZ A;  1G3W A;  2DU9 A;  2OQR A;  3TO6 A;  2KJC A;  1STZ A;  2JTV A;  2A3S A;  3BZ6 A;  2OBP A;  5A2Q K;  4PDK A;  2DLL A;  2ZO4 A;  1LJ9 A;  3H3U A;  3M1E A;  1HKT A;  4CYD A;  5BS6 A;  5H6Q A;  4YG2 F;  4HYE A;  2FBH A;  3D0S A;  2FBI A;  3F6O A;  4L9V A;  1IN7 A;  2ACJ A;  5L3G A;  1IN5 A;  5D5U B;  3FMS A;  3J80 K;  3NEU A;  1QPM A;  4EQQ A;  2FU4 A;  2FF4 A;  2XAH A;  1UST A;  2RGV A;  1B1B A;  2GQQ A;  1FZP B;  1IXC A;  3BY6 A;  4G7H F;  3QP5 A;  3JW4 A;  4LLG F;  3CO6 C;  2L4A A;  3IWZ A;  2IA2 A;  1KU9 A;  1V3F A;  2OA4 A;  1BM9 A;  3ZMZ A;  1R00 A;  3M9A A;  1S6L A;  4M9X A;  2OD5 A;  1RUO A;  4CHU A;  4KN7 X;  2VC1 A;  3DKW A;  4WK8 F;  3QOP A;  1OKR A;  1BI2 A;  1CF7 B;  4P5O A;  4UNO A;  5JHU A;  4P9U A;  2W25 A;  4A0Y A;  2DK5 A;  2A6E F;  3Q5F A;  2R3S A;  2EFW A;  2OAZ A;  4M73 A;  4MQV A;  4XLP F;  1MD0 A;  1LQ1 A;  5D8K B;  5IT9 Z;  4CXF A;  3FM5 A;  2VT3 A;  2XKO A;  2XIG A;  5AON A;  3F23 A;  1VTN C;  3HRU A;  2FXA A;  4UV8 A;  2M87 A;  3ROU A;  1EH6 A;  5FLX K;  2DT5 A;  2IJL A;  4L9T A;  2QQB A;  4U88 A;  1SAX A;  4RGU A;  2GAU A;  4QLC U;  1D3Y A;  2YX4 A;  1ZLJ A;  1Z91 A;  2HEO A;  3K1N A;  2UXX A;  5LHH A;  3RJP A;  3W6J B;  3V8K A;  3GYH X;  3QPT A;  3BJO A;  3H3Z A;  5HS8 A;  1H9T A;  3JAM Z;  3M7G A;  3LA3 A;  3LQQ A;  4L0Y B;  1U78 A;  5K5Q A;  3I59 B;  1K78 B;  1WQ2 A;  2P5L C;  3I54 A;  3JAM K;  2DI3 A;  4I0A A;  3CDH A;  3K0L A;  5HVQ C;  2ZJ2 A;  3GFI A;  3TGN A;  1SD6 A;  4JBA A;  4QWQ A; 
#chains in the Genus database with same CATH topology
 4KMU X;  5B3S H;  1G8X A;  2HTJ A;  5B5E C;  2EZH A;  4PSX A;  1VQM I;  1WI9 A;  4F91 B;  4H0E A;  4M3E A;  3M4O J;  4I01 A;  2Y0M A;  3SXY A;  2PLY A;  1FSH A;  5CJ9 A;  1H88 C;  3GXO A;  1X2M A;  4DGW B;  1HF0 A;  2R7Q A;  1V55 H;  4TV7 A;  1XMX A;  2ELH A;  4BEH A;  1BI0 A;  2KZV A;  1ZGA A;  4XKV A;  3FHZ A;  1XGN A;  5J1U A;  3H35 A;  4WXD A;  5FLV A;  4HV6 A;  5GPC A;  4ENN A;  5C4J J;  1XCB A;  2JWT A;  1EH8 A;  4MHG A;  1HA8 A;  2HYJ A;  1EJ9 A;  2LBF B;  3WGH A;  5K5R A;  2O0Y A;  1XMK A;  4IZZ A;  2A6H F;  2MGQ A;  3BR1 A;  4IHX A;  3QOD A;  3SZP A;  3EYY A;  3JRA A;  1T0F C;  2JA2 A;  1LUJ B;  1ZRF A;  3FF5 A;  4XKW A;  2KDO A;  1LKX A;  3KP5 A;  3MFK A;  3S15 J;  2GZW A;  4F93 B;  1J59 A;  2IPQ X;  1TBX A;  4UB6 C;  5KNL A;  3OYJ A;  1FSE A;  1V54 H;  3FK7 A;  4AUX A;  3HOX J;  3G1M A;  1MJB A;  1QGP A;  2Z5U A;  1BOA A;  1IXS B;  3FBN B;  2QYO A;  4O3M A;  3OSF A;  4GYG A;  4RLF A;  3FX3 A;  3GLL A;  1XSX A;  1OLT A;  1XGO A;  5EG0 A;  1ZG5 A;  1SFK A;  2KMU A;  1Y39 A;  2ZJR F;  3CCM I;  1E3P A;  2MYS A;  4LGW A;  3FHN A;  2OPT A;  5DM6 F;  2HPM A;  3OYB A;  2QF7 A;  2M7B A;  2OJE D;  1I50 J;  2F5F A;  3JSP A;  1ZRE A;  4XM3 A;  5FRO A;  4CUG A;  5CQE A;  5DEQ A;  3WTS C;  1O3S A;  1XS9 A;  3HC7 A;  5J47 A;  2DOF A;  5CPR B;  4PJ0 C;  2X4H A;  2BXY A;  2GA1 A;  5E1X A;  4XKB A;  4BAC A;  4KA4 A;  1QBJ A;  1Y1W J;  2H1K A;  4S0H B;  4DW6 A;  2H94 A;  1VQK I;  2STT A;  5E18 F;  3FXM A;  3ZPL A;  3ECH A;  5CVR A;  2KQR A;  1G3Y A;  1PUF A;  5F64 A;  3CES A;  3T0Y A;  1UHW A;  2MA3 A;  1T08 B;  3Q0U A;  3ZCO A;  3MKL A;  4N4O B;  3OYL A;  3K7A J;  4B43 A;  1YE9 A;  3GCM A;  2QBY B;  3LSG A;  5M5X J;  3WHB A;  1D0X A;  2FNP A;  2CRG A;  3LSP A;  2LBF A;  1SD5 A;  1LPQ A;  4AD9 A;  4A0X A;  2E71 A;  4OIN F;  4P1W A;  1X4O A;  3DKX A;  2M30 A;  5EEG A;  4BH9 A;  5EGO B;  2DPD A;  3CLQ A;  5HLG A;  4MGR A;  2LOO A;  1ACI A;  1BIB A;  4IOA F;  2EV5 A;  2IEK A;  2FBK A;  3HJE A;  4MLO A;  4DZP A;  3K10 A;  4RGX A;  1HW2 A;  1RNL A;  1WJF A;  1U5T A;  3F9K A;  3HHH A;  2OCC H;  4XOT A;  5DTD A;  1ZH5 A;  2H09 A;  4DZJ A;  1R22 A;  1QVT A;  3IRR A;  3CUQ B;  3CD6 I;  3SEZ A;  2NS0 A;  2KIS A;  3CZ6 A;  3HOT A;  4IHV A;  4HAM A;  2DN0 A;  2CWE A;  1RKW A;  2DBB A;  1YW9 A;  4QIW N;  3ZP5 A;  3RZO J;  2QEN A;  4N0B A;  2RKH A;  3CCL I;  2BXZ A;  4X0G A;  3HPG A;  2LR8 A;  5GTH C;  4HLY A;  1BI1 A;  1OYI A;  2BVM A;  5DUI A;  4FCY A;  3SDG A;  1NHA A;  5FJ8 J;  3BPV A;  4IEJ A;  3S93 A;  4P96 A;  4A3D J;  3K4B A;  4KIF A;  4PGH A;  1ON2 A;  4L9N A;  1R9T J;  2BBY A;  4UHT A;  4IXA A;  2CQK A;  4IRI A;  1XG1 A;  3WTU C;  1YIO A;  5BMZ A;  3VWB A;  1MKM A;  4AM3 A;  1WCM J;  3H9G A;  4Q4Z F;  4DBR A;  2NRA C;  1FIP A;  2PG4 A;  1VQ5 I;  1XPX A;  4U7D A;  1SD4 A;  3CCV I;  1B8I A;  3HOZ J;  3A01 B;  4AVZ A;  3JSO A;  2R7F A;  4FTH A;  4IJA A;  2X48 A;  2YPR A;  3BG3 A;  3PQK A;  3KYL A;  3TOB A;  3M07 A;  5HDN A;  2O5R A;  1FIA A;  2V9P A;  3FMR A;  1AWC A;  1GHC A;  2X6X A;  1UCR A;  5E20 A;  5BNG A;  4MNU A;  4G12 A;  4ZH4 F;  3GWZ A;  3ZMD A;  4EJO A;  3RKY A;  1OCZ H;  2EIJ H;  3RQI A;  4E70 A;  2F4I A;  2Y31 A;  4BJ5 C;  4B44 A;  2YUS A;  1U9N A;  2DA4 A;  3FIS A;  1SMY F;  2IP2 A;  3MCZ A;  3OYD A;  1D5Y A;  3KCC A;  2EZI A;  4B3A A;  3LMM A;  3OYI A;  1XDS A;  3GTJ J;  1SEU A;  3GO5 A;  3I4N J;  1XCV A;  2UZK A;  2RAE A;  1D8J A;  4GGG A;  4I99 C;  3OR1 C;  4YEJ A;  1YHQ I;  1FYM A;  4I2O A;  2E35 A;  1DUX C;  1AOY A;  3KP4 A;  2Z3Y A;  1FWZ A;  1ZTR A;  4KNY A;  4J19 A;  3FKI J;  3I64 A;  4B47 A;  2AQE A;  1F4K A;  4UUV A;  3MKW B;  4XLH A;  2IGK A;  1HST A;  2A07 F;  5CVJ A;  2EQR A;  1W0U A;  2Q0O A;  2QCO A;  4ENJ A;  4J00 A;  3N05 A;  5EJC A;  2P8T A;  4C2T A;  2O7O A;  3GBG A;  1WJE A;  2DA6 A;  3NQO A;  2EV6 A;  4IOC F;  2QWW A;  5ILS A;  3Q0V A;  1IG7 A;  1NK3 P;  2XF7 A;  5JLX A;  2R93 J;  4EM2 A;  2WWY A;  2HWV A;  1YYV A;  3F3X A;  1ETK A;  2BY0 A;  1R5H A;  5JR3 A;  1HDD C;  2EBI A;  5H20 A;  3U2R A;  4IRH A;  1F5T A;  4C2M J;  5J3L A;  3HOU J;  4H4K C;  1R1T A;  3ONQ A;  3Q9S A;  2R7Z J;  1W0T A;  3ABT A;  3QWL A;  4MEY F;  4ZC3 A;  3DPT A;  3PNV A;  2H8R A;  4LIV A;  3FIW A;  2VPL A;  1LDJ A;  1B72 B;  4J01 A;  4A12 A;  2NNN A;  4I98 B;  3QAH A;  1MDM A;  5ICE A;  3KFW X;  1ZAO A;  1RES A;  4G9Y A;  1IRZ A;  4LIT A;  4DYQ A;  2KDZ A;  4EJT A;  1MNE A;  2HQN A;  4LIU A;  3ABU A;  5DV5 A;  1XB4 A;  4CIC A;  4M74 A;  2EFO A;  3ZMV A;  1SFE A;  1T0F A;  1T39 A;  1T95 A;  1WRJ A;  2DCE A;  1MSE C;  5DCM A;  2Q2E A;  5HLI A;  1WI3 A;  3IL2 A;  2HNH A;  1O4X A;  3GTL J;  1TQP A;  2CUJ A;  1OR7 C;  2M8E A;  2WA0 A;  2K02 A;  3JRI A;  5FGM A;  5K7F A;  4GFB A;  3AL0 B;  3OIQ A;  3VPR A;  4W97 A;  3IKT A;  2STW A;  2VOO A;  2M1B A;  1G59 A;  4RS8 A;  1Z0X A;  3L1P A;  2VKD A;  5FD5 A;  2MSY A;  3R0A A;  3TMO A;  1WVR A;  3VEP A;  2JSP A;  5D5V B;  4A3K J;  2A5Y B;  5ERI A;  4WXC A;  3I56 I;  5FLM J;  3CUO A;  3GZN B;  4Y52 J;  3OIO A;  1KA8 A;  3VOD A;  1IV6 A;  4N4N B;  5CVU A;  3ZGK A;  2CQQ A;  1Y8Q B;  4HF1 A;  2QQ9 A;  3KZZ A;  3SZG A;  3CC4 I;  3K4J A;  2B7E A;  2HKX A;  3K69 A;  3S2D J;  4BE2 A;  3COA C;  2W85 A;  2KRH A;  2I10 A;  1LDK B;  1FJL A;  4XL9 A;  4E7Z A;  3C3W A;  3C1D A;  3F8N A;  1LEB A;  2DFF A;  1UB9 A;  1XGS A;  1TTY A;  4A5N A;  1G6N A;  1QU3 A;  2Y0S A;  5DS9 A;  5BPI A;  1U0J A;  3C18 A;  1R71 A;  4Y4R A;  4LG0 B;  5DCF A;  4BBS J;  1IRF A;  3TKY A;  4BJT A;  1Y1V J;  2JPC A;  3S1R J;  2FJ1 A;  3GUD A;  2GWR A;  1ZKG A;  2R7T A;  3OS0 A;  1YJ9 I;  1T6S A;  3JRB A;  4NDL A;  2E36 A;  2RQP A;  3B6C A;  3OYK A;  3GME A;  2K86 A;  1Y56 A;  2Y48 A;  3VYS B;  3L2W A;  5DD4 A;  4HX4 A;  2JN6 A;  2COM A;  3C7J A;  2QSH X;  2MD0 A;  3FMQ A;  5D5X B;  1VQ7 I;  3CP2 A;  3MN2 A;  2OV7 A;  1YIJ I;  1J2X A;  3HB9 A;  1MMS A;  4CCJ A;  1VQL I;  4GYI A;  5FKO A;  3S1M J;  1MBF A;  4N9H A;  3WTX C;  3I3L A;  2X6Y A;  1F1Z A;  2MAB A;  5F1R A;  5B66 C;  3OV8 A;  3BZK A;  1D5V A;  4KFC A;  3G1L A;  4QSH A;  2HR3 A;  3I4M J;  1O57 A;  2XPV A;  3LA7 A;  3EET A;  3WTZ A;  3KX2 A;  1UFM A;  3KZI C;  2CQN A;  2L02 A;  4AYB A;  4F3Q A;  5K7H A;  1PP8 F;  4B1R A;  4RM3 A;  5D6E A;  5DYM A;  2WAF A;  4AWX B;  3CCE I;  1H8A C;  4C30 A;  3QQA A;  2ESH A;  3ZMS A;  4RGR A;  2EFP A;  3CCY A;  3BWG A;  2K27 A;  3S2W A;  2DMP A;  1D8K A;  2JZY A;  3BR0 A;  2DQL A;  4IKF A;  1Y8R B;  1G2H A;  1K79 A;  1H89 C;  1P7I A;  1Y0N A;  3F6V A;  3SFZ A;  3GVA A;  2GIZ A;  2B0L A;  4NUB A;  1FOK A;  3OMY A;  2EIL H;  1TZL A;  2BW3 A;  3K4K A;  3T8T A;  1FY7 A;  4YRV A;  1R6R A;  3OYE A;  1MSF C;  3PM1 A;  3O6B B;  2JA6 J;  4IHS A;  2VBZ A;  5LBQ A;  3GFM A;  3BT9 A;  4XLC A;  1FT9 A;  2DOA A;  1OCR H;  3HGY A;  3C2G A;  1X1B A;  5BPD A;  1JXS A;  1O7L A;  1TLH B;  4R1H A;  4NC7 A;  1OR7 A;  3CP8 A;  2ISY A;  4F52 A;  2HU9 A;  2VOP A;  2K4B A;  4KIS A;  1YX3 A;  2E34 A;  1MZB A;  1IGN A;  3ABL H;  2HXO A;  2IS4 A;  1T98 A;  3NAU A;  4CCM A;  4BGD A;  2XB5 A;  1X19 A;  3HRT A;  2L7M P;  5K7Z A;  1YS7 A;  1XSD A;  2A05 A;  2JA7 J;  4CDG A;  1FYK A;  2GXB A;  3OL4 A;  2DOE A;  2DJI A;  3JCU C;  5J4Y A;  2OZ6 A;  1DPR A;  3MVP A;  1RI7 A;  5DD8 A;  3WU1 B;  1VQN I;  1HSJ A;  3PIP F;  4PZJ A;  4YEL A;  1IW7 F;  2E2J J;  5LRR A;  2W48 A;  2V4J C;  2NOJ B;  2YX7 A;  5D8L B;  1YO5 C;  3CCU I;  1UEL B;  2TCT A;  4ENK A;  1BIA A;  2PJP A;  2JJ7 A;  1K78 A;  5HLT A;  2CSO A;  2MH9 A;  1POG A;  2V1U A;  2R5Y A;  2DT6 A;  2WV0 A;  4FX0 A;  4MQ9 F;  5AIQ A;  5FRN A;  4BKX A;  3CDI A;  3S32 A;  3BTI A;  2E1N A;  1GUU A;  3ECO A;  4DYR A;  5IT9 K;  2Q8K A;  1MBH A;  1MDM B;  4G7Z F;  2O03 A;  3DV8 A;  1D0Y A;  4DYC A;  1K61 A;  1AA7 A;  1AKH A;  1NK2 P;  1VI0 A;  2K9Q A;  3LSJ A;  4XRS A;  2Y0S N;  3RKQ A;  3RPU A;  4XK4 A;  4HF2 A;  1TT5 B;  1QZZ A;  2RVC A;  2WB1 N;  3MMY B;  4YII A;  3O8H A;  4XRF A;  3RYR A;  4HQE A;  1TNT A;  2I8D A;  2XAF A;  2H1L A;  4PUS A;  4XBF A;  2ECC A;  4A2U A;  2IRF G;  2QVO A;  3LA2 A;  2QGU A;  2EZL A;  5LEK A;  3P7N A;  1N78 A;  3KP7 A;  5CVV A;  1IN8 A;  4ESF A;  3IH3 A;  3HOY J;  3BRO A;  3HUG A;  2KFD A;  2IA0 A;  2E19 A;  4HBL A;  2BV6 A;  1QZE A;  2VAS A;  5GAG J;  3CCS I;  4YIF A;  1KQ8 A;  3QYF A;  3S8P A;  2VUM J;  2ZCW A;  3ISP A;  4M3F A;  5KAF C;  3N4M A;  3DTK A;  4WCG A;  4MIM A;  4A0Z A;  3F8C A;  2Y9Y A;  3GFJ A;  1IZ1 A;  1P4A A;  3GTK J;  1I3A A;  3TED A;  1LFU P;  5HNH A;  1DQU A;  4R8H A;  3CCQ I;  3ZMT A;  2OTL I;  1I1G A;  3L2U A;  3I4P A;  4XLN F;  1SC7 A;  3K6G A;  2F4M B;  4HA8 A;  2HGC A;  4OIQ F;  1CGP A;  4IQ4 A;  4U0W A;  1PUE E;  2PJR B;  2EIM H;  2RC4 A;  3BR3 A;  2ZB9 A;  1KU3 A;  5C4X J;  1KU2 A;  3LST A;  1MBJ A;  2CYY A;  1LNW A;  2V9K A;  1W36 C;  2Y2Z A;  3VYT B;  1WFX A;  1NG6 A;  2VQL A;  3M8J A;  2D1H A;  1T2K A;  3W3C A;  3K70 D;  2XAS A;  2ZME C;  3E5Q A;  2ZNY A;  1V4R A;  2XUB A;  1YW8 A;  4WX9 A;  1ULY A;  2ESN A;  2ME6 A;  4BY7 J;  3WTT C;  1MH4 A;  4NNJ A;  2JPB A;  2RN7 A;  2UV1 A;  3TP0 A;  3LL7 A;  1I5Z A;  3I55 I;  4M9Z A;  2LY9 A;  9ANT A;  1P2F A;  5J8C A;  5IP9 J;  1OCC H;  4A3I J;  4HPQ A;  2D5V A;  3TBI A;  2JMW A;  3N97 A;  2PMZ A;  1FTT A;  4I76 A;  3BTC A;  1GDT A;  1B9M A;  1MJA A;  3U1D A;  4HX7 A;  4A3C J;  3FBI B;  3I0T A;  4HOB A;  4ZYE A;  4NHJ A;  1JUP A;  2W24 A;  4CYC B;  4UV9 A;  3W2V A;  1J5Y A;  2E60 A;  3GF2 A;  1OFC X;  4B8X A;  4BL0 B;  2LMD A;  4MTE A;  5B1A H;  1QA6 A;  2B9S A;  4E7S A;  3H5N A;  1PUF B;  2ELK A;  1MGT A;  4OIP F;  3KLO A;  2ELJ A;  1OPC A;  2NXN B;  5FKM A;  4EJV A;  1RC9 A;  4F55 A;  2K40 A;  3ZN0 A;  2LDU A;  4A3F J;  1EKE A;  2HFH A;  1T33 A;  2EB7 A;  4Q48 A;  1IF1 A;  1ENH A;  3F8M A;  3BOQ A;  3HHG A;  5ICF A;  2C6Y A;  2XAG A;  2KPM A;  3CQZ J;  5EGO A;  4PCQ A;  2BZT A;  3U9G A;  1H0M A;  2ZXH A;  1WJ5 A;  2NAZ A;  4MTD A;  1NH3 A;  2I5U A;  3K4M A;  3E6D A;  3PNT A;  3PO2 J;  3E7L A;  5E8I A;  4OU0 A;  1WWX A;  3PSI A;  2PFB A;  5B1B H;  3HEF A;  3G4S I;  4ZZD A;  3R6S A;  3RTR A;  3S3N A;  4M9S A;  3B73 A;  1BBY A;  2L7Z A;  5LD2 C;  1U9O A;  2X0L A;  1LVA A;  1W5C C;  1HLV A;  3K1P A;  2B63 J;  4HRI A;  1GLN A;  2W84 A;  4XLA A;  4XKC A;  3IRQ A;  4UUS A;  2CV1 A;  3AG2 H;  2XKP A;  1R23 A;  2LF7 A;  1WJC A;  3BP8 A;  3S1N J;  1U5T C;  2W82 A;  5D6F A;  2V1D A;  3IH4 A;  3GX4 X;  5EF6 A;  1BOB A;  3PQJ A;  4HEA 2;  2P5V A;  5IYC J;  2FA5 A;  3CMM A;  3KYC B;  4L5E A;  5FKK A;  4GO1 A;  1DP7 P;  2UXN A;  5J4V A;  4ZTF A;  2EWN A;  3L7W A;  2P7V B;  1FP2 A;  5ICG A;  3WE2 A;  2IAI A;  2M4G A;  4RB3 C;  2YU3 A;  4I6Z A;  2MD5 A;  2LK2 A;  4NBQ A;  1FBQ A;  3F22 A;  2OUM A;  2XRL A;  3QYB A;  2LKS A;  1R5I D;  2IS2 A;  2DDB A;  3REO A;  1J09 A;  1BJA A;  4RB2 C;  4CCO A;  1MBK A;  2KL4 A;  1UMQ A;  1JHH A;  2E5Z A;  1GV5 A;  2H6C A;  4Z6Y A;  4HX8 A;  1XMA A;  1S7E A;  4EJW A;  4PJN A;  2TDX A;  2HOA A;  3GW2 A;  3I9V 2;  1E0E A;  4RBO A;  4LOC A;  4M3B A;  2DA3 A;  2LD5 A;  5FD6 A;  3GEZ A;  4EGZ A;  3JRE A;  1T38 A;  4D0P A;  4PFP A;  1EV7 A;  1O7F A;  2H27 A;  1TNS A;  5M3M J;  2NOG A;  2ISZ A;  2XPW A;  3RCO A;  1K4T A;  5F0F A;  5EZH A;  4EGY A;  2XAJ A;  3K4N A;  4E7K A;  5EEH A;  1A04 A;  4MEX F;  2ZJP F;  2KP6 A;  3WGG A;  2E2I J;  3M8F A;  5JFR A;  4KN4 X;  2BOL A;  1P4W A;  2BY3 A;  2LH9 A;  2MC3 A;  3F72 A;  1UG2 A;  2M8G X;  4RGS A;  4U0V A;  3J7Z I;  2R5Z B;  3JRF A;  4OAZ A;  5M5W J;  2OZU A;  2WV1 A;  1X3U A;  3FXO A;  4FE7 A;  4UVB A;  1APL C;  1VQ9 I;  5KAI C;  3JRD A;  3JTG A;  2O3F A;  4LK0 F;  4XRS G;  1SAU A;  3S17 J;  4YFX F;  1BL0 A;  2LY2 A;  3R4K A;  1U3E M;  4BUP A;  2FE3 A;  3PUB A;  1D0Z A;  3IAM 2;  3MWM A;  5AIP A;  2PI0 A;  1ORK A;  3D5S C;  1UHS A;  2YSR A;  3OYH A;  3HOS A;  3W2W A;  5E17 F;  2RQQ A;  2K7L A;  2RNG A;  2XC7 A;  3DWL E;  2EK5 A;  1GXP A;  1TWH J;  2A68 F;  4LLL A;  2EZK A;  3T1B A;  3BTL A;  1FBU A;  2X9D A;  3HKZ N;  4BY1 J;  5H6R A;  3OS1 A;  2VE9 A;  3B6A A;  2PMZ N;  4HDU A;  2XB0 X;  1KU7 A;  3PUF A;  5E3L A;  3VOE A;  3E0J B;  1Z67 A;  1U5T B;  1ZLK A;  1UHM A;  2M0C A;  1J0R A;  3RKW A;  3R0J A;  2ZKZ A;  2NS8 A;  2G7U A;  1IC8 A;  4KT5 C;  1UG0 A;  3BC8 A;  3QU6 A;  2R0Q C;  3CO7 C;  2WC2 A;  5F08 A;  2LC2 A;  4RM2 A;  2RRE A;  1UZC A;  3L2V A;  3F8B A;  4JP0 A;  1I27 A;  1Y6I A;  2DPU A;  4I0B A;  2FQ3 A;  4XNF A;  2FOK A;  5DUK A;  2LLK A;  1ODD A;  2V79 A;  5DDG A;  5JI6 A;  1CF7 A;  1ITY A;  4M6V A;  2CU7 A;  3VYR B;  3FZV A;  3V7C A;  4BQO A;  1MMG A;  2XF6 A;  1DPU A;  2IBD A;  5L3B A;  4KIG A;  2XF5 A;  2K9S A;  2O8K A;  5L3F A;  4RAY A;  2O61 A;  3MAJ A;  5L3D A;  2E1O A;  2DW4 A;  2GXA A;  1ON1 A;  1D1B A;  1ZR2 A;  2BY2 A;  2WAQ A;  2M34 A;  3DBL B;  2DK8 A;  2AS5 F;  1FX7 A;  4DIQ A;  3LOC A;  1YS6 A;  1OYW A;  1XDU A;  5J8F A;  5CKT A;  1QPI A;  1FMW A;  1A35 A;  3WTW C;  1JI8 A;  1DGW Y;  3IH2 A;  4U87 A;  4LG3 A;  3VDX A;  1PYV A;  4IL6 C;  4BE0 A;  3HSR A;  3SHF A;  3HTS B;  5GAE J;  4B09 A;  2IVM A;  1VQ6 I;  3IC7 A;  2QSF X;  3LWF A;  4G6D A;  1X4P A;  3FXK A;  1BJZ A;  1LE8 A;  4FT8 A;  3LAJ A;  4ASN A;  3PJR A;  3J81 Z;  4XON A;  1IUF A;  3V7R A;  1DU0 A;  4LLN A;  4M3D A;  3FXU A;  3GTQ J;  2W57 A;  5D4R A;  1SMT A;  2LG4 A;  1E3O C;  2DA2 A;  1FOW A;  2FUG 2;  4GRI A;  2BHY A;  2EA2 A;  4L5J A;  4RDU A;  2ZME A;  4ON0 A;  4XID A;  3MEX A;  2LNB A;  1YTY A;  4EV0 A;  3H9J A;  2HDW A;  4D1Q A;  2VXD A;  4UY8 I;  1FLI A;  1ZRD A;  2IA1 A;  3Q0W A;  2GM4 A;  4FX4 A;  5ILU A;  2DXI A;  2KLO A;  2KIU A;  1TQI A;  2QUF A;  3HL2 A;  2FQ4 A;  4HW0 A;  3WG9 A;  5H2F C;  5IPA A;  3ESW B;  2X1C A;  1W36 D;  4O6J A;  1FC3 A;  1S29 A;  4LD5 A;  1TW2 A;  3LFU A;  2ID3 A;  3V8J A;  3E6B A;  2CUF A;  1EF4 A;  3T8R A;  1VQ8 I;  3MKY B;  3VB2 A;  2WB1 A;  2RV8 A;  1L3L A;  1TL8 A;  1TQM A;  4BXX J;  2QA4 I;  3G71 I;  1XN7 A;  2P6S A;  1LDD A;  1ZQ3 P;  1A5J A;  3SDB A;  2XV4 S;  1MMA A;  4OIO F;  2K3F A;  4ZDL A;  1RUN A;  3TW7 A;  3I59 A;  5L3E A;  1JKP C;  3ZRG A;  1JHF A;  3GZ6 A;  4EEF G;  4AYB N;  1ZEL A;  3H0G J;  4Y33 A;  1ETY A;  3LFK A;  3CC2 I;  4KIB A;  3G3Z A;  1BR1 A;  4G8X A;  2DQR A;  4JQF A;  2E1C A;  1T56 A;  2JSC A;  5J1R A;  1B72 A;  1BR4 A;  2COB A;  3KP3 A;  4JX5 A;  5FFZ A;  3KP2 A;  1B6A A;  3CLO A;  4LJZ F;  4HDV A;  2UWM A;  3AKZ A;  3H36 A;  3ELK A;  1WPK A;  4HSR A;  1YRN A;  5J40 A;  3BCB A;  3ASN H;  5FO5 A;  1EH7 A;  4A3E J;  4WXH A;  3S14 J;  3ZQF A;  1NTC A;  1RPW A;  1WKM A;  2Z16 A;  5CYV A;  4I02 A;  4E6K G;  4DOZ A;  3EUH A;  2O8X A;  1JT6 A;  2HVQ A;  2M3A A;  3BDD A;  1PDN C;  1ETW A;  1D1C A;  4L9J A;  3S2H J;  1U2W A;  1F43 A;  2CW8 A;  2VT2 A;  5LHG A;  2EIN H;  1ZG3 A;  1MBG A;  5J6X A;  3A2K A;  1SAN A;  1JKQ C;  2E2H J;  3B02 A;  2R7V A;  3K1M A;  4XOP A;  3G2B A;  2R5Z A;  3FXQ A;  3KYD B;  2Z99 A;  5KVR A;  3ZXS A;  2LRE A;  3U1K A;  3BPX A;  3M8E A;  4G7O F;  2X6O A;  3E97 A;  1FNN A;  3P9C A;  4ZYG A;  1BC8 C;  2DMQ A;  2DT7 B;  2R7D A;  3UNG C;  1Q1H A;  3FXR A;  1MIJ A;  5JVG F;  3ULQ B;  2PX9 A;  2DOD A;  2K85 A;  2MH2 A;  5JHF A;  4U0Y A;  3H5R A;  3ML6 A;  1HXD A;  4JX4 A;  1IDY A;  4EMS A;  4E7I A;  3GZ5 A;  4JX6 A;  5EG0 B;  1JUM A;  4QPO A;  1IAW A;  2OF7 A;  2DO7 A;  1R1V A;  3A1Y A;  4RAF A;  3S1Q J;  3R61 A;  3IUO A;  2VBY A;  1RET A;  4NQW A;  1ETV A;  2F5D A;  2OCE A;  1F9N A;  2J5O A;  3KIO A;  4Y3O A;  2DFE A;  3KP6 A;  3WTY C;  1J9I A;  3OOP A;  4BQN A;  1Z1D A;  4E4H A;  1O3R A;  1TWG J;  3CJN A;  5LFA A;  3FKJ A;  5CVI A;  2IT0 A;  5LGU A;  2ZBK A;  3HRS A;  3CME I;  2CQ7 A;  1ZYR F;  4XQF A;  1AHD P;  1QHG A;  4OMZ A;  2Y30 A;  2L01 A;  2XSJ C;  5IP7 J;  2MC4 A;  2KRF A;  1ETQ A;  1Z7U A;  2V26 A;  4A6D A;  2P7C B;  3WHC A;  3OYN A;  1S3J A;  2E1M C;  1HKQ A;  3K9T A;  2KIF A;  3WE3 A;  2XDV A;  3VFZ A;  3V4G A;  1LB2 A;  2BGC A;  3DQV C;  4A3G J;  3SJM A;  1SVM A;  4M6Y A;  1YFH A;  2F2E A;  2GIV A;  1BW6 A;  4UVA A;  2NVQ J;  1HW5 A;  1U6G A;  2EA4 A;  1ETX A;  2VI6 A;  1IRG A;  4HLX A;  2XGC A;  1TW3 A;  1YIT I;  4ETS A;  4BXU A;  1SFO J;  2R7R A;  2ZC2 A;  1X58 A;  3PSF A;  5HLH A;  4FIS A;  2QZ8 A;  3G73 A;  3MZY A;  2ME0 A;  2PQ8 A;  3K4L A;  5D5W B;  1LFB A;  2IGN A;  4A3M J;  1I39 A;  2M9H A;  2Z2S B;  3OYM A;  2HYG D;  3RDI A;  2VXZ A;  1N75 A;  3GTO J;  2ZFU A;  3Q9V A;  4WWC A;  4BBR J;  4PFO A;  4UUT A;  2AXL A;  1EA3 A;  2XSD C;  3PFI A;  2CUZ A;  3EPZ A;  2EV0 A;  5LRS A;  1Z3Y A;  2ZNZ A;  1E17 A;  3JTH A;  2ZXI A;  2JVH A;  4XLF A;  3RYP A;  3DFG A;  4XSZ F;  2L2O A;  2QKL B;  3HIF A;  5A2Q Z;  4N9I A;  2MG4 A;  2EPF A;  1JGS A;  4NC8 A;  2JRM A;  5EDN A;  1A36 A;  2DA7 A;  3EUA A;  3ZOB A;  2O6G E;  3WU0 A;  3OYF A;  1XC5 A;  2EH3 A;  4G6Q A;  4XRM A;  4ENM A;  2Z33 A;  2VB6 A;  4O5V A;  1WGX A;  1SVO A;  4FE4 A;  3EUK L;  3QPH A;  3X2Q H;  2XAU A;  4CYC A;  2DA5 A;  4QTR A;  2VJ4 A;  2JK3 A;  1X3W B;  4YFK F;  4RMN A;  3I58 A;  1R49 A;  2RNJ A;  4XSX F;  1GT0 C;  1S7A A;  4EM0 B;  1RRJ A;  4AIH A;  3CF5 F;  5K1Y A;  4OOI A;  3J80 Z;  2M5W A;  3LNQ A;  1FTZ A;  2M45 A;  1IUY A;  1YLF A;  5CLS A;  3KEY A;  1BR2 A;  5DM7 F;  3LQR A;  1G3S A;  4ESJ A;  3E1S A;  2A61 A;  5LHI A;  1LFP A;  3I5U A;  2ZSH B;  2L9S A;  2CO5 A;  4A3J J;  3PO3 J;  1UJ8 A;  2DMT A;  1JT0 A;  2HQA A;  2XRN A;  4G6T B;  3DEE A;  4OIR F;  1W1W E;  1HKS A;  5IY5 H;  1QO0 D;  1ZK8 A;  2PMH A;  4HZF A;  3SFI A;  4X6A J;  2Y69 H;  2HS5 A;  2WAD A;  2A69 F;  3F21 A;  1W4M A;  4GCV A;  1A6I A;  2XVC A;  4MFD A;  2E7X A;  1W7P D;  3A02 A;  5E79 C;  4ZDO A;  5LGN A;  1WJA A;  4LMY A;  3WG7 H;  1W7P B;  4NB5 A;  3FWE A;  4C3I J;  2XHK A;  6PAX A;  4YFN F;  2FRH A;  3P5J A;  3W2A A;  4V2G A;  4IQJ A;  3TDZ C;  1IN4 A;  3GTP J;  2GXG A;  2DTZ A;  3FDY A;  4BXF A;  5LEJ A;  3WTV C;  1ZAR A;  4UUS B;  2CW7 A;  1OCT C;  1IXR C;  4OMY A;  4L18 B;  2CW0 F;  3I71 A;  2X1D A;  2CGP A;  3E3V A;  4B4C A;  1GXQ A;  1O3Q A;  1JTY A;  3V42 A;  1K6Y A;  2D1V A;  1RKT A;  2MLG A;  1R1U A;  2LF8 A;  3DEU A;  3PFY A;  4A69 C;  3H1C A;  3P9I A;  3J81 K;  4P9F A;  3ZQH A;  2JUC A;  4D7N A;  4LB6 B;  1MNM C;  1B4A A;  5FKN A;  1QHH D;  5IT3 A;  1B59 A;  4BHP A;  2WBM A;  1W5S A;  1X2N A;  2LKP A;  3SYT A;  1W5T A;  1U8R A;  1TWF J;  3KEO A;  4W1U A;  2PMU A;  5HOO A;  2CJJ A;  3FXJ A;  3L2Q A;  2HDD A;  2NS7 A;  4DQ2 A;  4U7B A;  2D2W A;  5EEA A;  2IS1 A;  2PN6 A;  5K5O A;  2PJR A;  1V5G A;  4CCL A;  2VBX A;  2WY7 Q;  3OY9 A;  3CUQ A;  4KMF A;  4PJL A;  2Q1Z B;  4C3H J;  5BQT A;  3E5U A;  4CCN A;  4DJA A;  4PSW A;  4C2U A;  4KYW A;  5F6F A;  2P5K A;  2R4G A;  4AIK A;  2BEO A;  1QQI A;  1Z05 A;  4D5F A;  4ABZ A;  5DCM B;  1U8B A;  1WH5 A;  2BW3 B;  4EJU A;  2P0W A;  1VZ0 A;  5EZG A;  1XGM A;  2Y75 A;  3OSG A;  4HNU A;  1USS A;  3BCA A;  4NQW B;  2LFB A;  1K6O A;  2UUZ A;  3KE2 A;  2NVU B;  2OU2 A;  1QNT A;  3GFL A;  3R60 A;  4WF2 A;  2QM3 A;  5FRM A;  2F6C A;  2V1N A;  1VFC A;  1R58 A;  1BC7 C;  1K83 J;  2VN2 A;  3RPQ A;  3CCR I;  2HOE A;  2QLZ A;  2IW5 A;  5HDG A;  2DTR A;  2DMU A;  5C44 J;  1KON A;  1QZY A;  4ANJ A;  4BNC A;  3RKX A;  2QEX I;  4AVP A;  5F04 A;  3H0D A;  2R92 J;  4XR6 A;  3HSE A;  3VSL A;  4B48 A;  5E3M A;  4FHT A;  1JKR C;  2VBW A;  3ZQI A;  2DDA A;  3C2B A;  5TRD A;  2XAQ A;  2HPI A;  1Z3X A;  3K2Z A;  4BS9 A;  4M72 A;  4OWR B;  2XRO A;  2V6C A;  1MW7 A;  3K2A A;  2R7X A;  2EJR A;  5E3N A;  3IKV A;  2BE5 F;  2TRT A;  1P4X A;  4M3G A;  2MLK A;  5IOZ A;  4IHW A;  3CCJ I;  1DDN A;  1YG2 A;  5GP9 A;  2A6T A;  1KYW A;  3P9K A;  3OYG A;  4AIJ A;  4G94 A;  1Z9C A;  3DLA A;  1VND A;  1S8N A;  4KJZ A;  3BR5 A;  2LP0 A;  4RAG A;  2IGO A;  2KRC A;  2LVS A;  2X51 A;  2CQX A;  3DU6 A;  1OCP A;  2HYF A;  2JT1 A;  4IPA A;  4GXO A;  2PBI A;  5F0H A;  3HSF A;  3AAF A;  4UXN A;  2ID6 A;  5BOX A;  1K4S A;  5HS7 A;  3DPL C;  1A6Q A;  2V1X A;  2ICW G;  2L5Q A;  1Z7L A;  4MO7 A;  3UR3 C;  2HKO A;  3J7A Y;  3V7S A;  5F0C A;  4ITV A;  4JOM A;  5E8G A;  3ZQ7 A;  4EVI A;  1KQ9 A;  2DAO A;  2K3P A;  3A0B C;  2LKX A;  4LK1 F;  1TC3 C;  1MMD A;  2CS3 A;  3ZQC A;  1N25 A;  2P6T A;  3ZQQ A;  4A6E A;  4JK1 X;  1S5L C;  2LY1 A;  5EYR A;  4LB5 A;  3OR2 C;  5E1Z B;  1IN6 A;  3CJT B;  3G6E I;  1REP C;  5D4S A;  2JUG A;  4D9J A;  2VKH A;  1MBE A;  1KQ0 A;  2DMN A;  4BEH B;  4YIR X;  1LE8 B;  4M6X A;  1MJ9 A;  3V8L A;  5FB2 A;  5LLQ A;  3DLL F;  2GA2 A;  4FQG A;  2CH0 A;  2F5E A;  4BHC A;  3BR6 A;  2AHQ A;  1HCR A;  3RI4 A;  1WZ2 A;  3CJR B;  2AXT C;  2E1M B;  4S04 A;  3HZJ A;  5HDK A;  4D7M A;  3L2C A;  1O3T A;  3PL8 A;  4C3J J;  3IHU A;  4EAT A;  1Z6R A;  5TGT A;  5IP6 A;  2FOW A;  2VJJ A;  2BVL A;  3IAS 2;  2FML A;  3C2H A;  2NVX J;  4CO8 A;  1M1E B;  2HOT A;  4BAY A;  3AFH A;  3JRC A;  2ZME B;  1S7O A;  4Q47 A;  3HRM A;  2X85 A;  2VLA A;  4I7H A;  2LRD A;  5FKL A;  1FYL A;  1K7A A;  3CC7 I;  1J7K A;  2NNY A;  1W7P A;  1B9N A;  2VE8 A;  1H9G A;  2FSW A;  1BN5 A;  2EFQ A;  4RB0 A;  2EFN A;  2G9W A;  3A03 A;  1BI3 A;  2WTE A;  2G0E A;  1I3Q J;  2MBF A;  2KT0 A;  2L9R A;  2N8G A;  4RAZ A;  1C0W A;  3L00 A;  4XLE A;  1R4M B;  1D1A A;  1LVK A;  2NYX A;  1MH3 A;  4ZTJ A;  5ICC A;  2DJN A;  3TOA A;  4ZZL A;  5J1Y A;  2VOD A;  3JRG A;  2L4M A;  1P92 A;  1E2X A;  2L54 A;  4HQM A;  3EDP A;  2ZFW A;  1JJ6 C;  1BW5 A;  3BG6 A;  3OOU A;  3S3M A;  4PGG A;  3ERE D;  1DP3 A;  2YR2 A;  1LEA A;  3CUQ C;  5HS9 A;  4BHB A;  4IHT A;  5M5Y J;  1IJW C;  1P6R A;  2WAE A;  3HOW J;  2JQ7 A;  4C9Y A;  3KZY A;  3KEQ A;  3LSK A;  1ZG1 A;  1JGG A;  4XN0 A;  4IHY A;  2L0K A;  2DFH A;  3TO9 A;  3DU5 A;  4ZDP A;  1SFX A;  2GOX B;  3D1N I;  4RB1 A;  1N77 A;  2W7N A;  1YW7 A;  1RZ4 A;  1ZGJ A;  1AU7 A;  2VPR A;  2R5Y B;  2F5V A;  1X1C A;  1WSU A;  2CFX A;  5HOD A;  2F5C A;  4ZYA A;  4ZYD A;  1HW1 A;  3H92 A;  2HTS A;  1FBS A;  2VQH A;  5L3C A;  2W00 A;  1G3T A;  1YRN B;  1PP7 U;  2X6W A;  3HKZ A;  3CMY A;  3HPH A;  3TW6 A;  3T5X A;  4Q5S F;  1AKH B;  3KLN A;  3ABK H;  2D45 A;  4A3L J;  1OJL A;  3NWT A;  1A31 A;  2DYR H;  3PNY A;  4A5M A;  1PJR A;  2BHZ A;  1FPQ A;  1ZHF A;  1VQP I;  3ABM H;  1ZR4 A;  1J75 A;  2QBY A;  1X1P A;  2CG4 A;  2RDP A;  2QQA A;  3BTJ A;  3HOV J;  2L3D A;  2V9V A;  2XPU A;  1JE8 A;  1YJW I;  2H6B A;  3MZH A;  3BG9 A;  4BJ6 C;  4Y13 A;  2FX0 A;  2HZT A;  4IRG A;  3LSH A;  3IWF A;  2FD5 A;  5FFX A;  1I6H J;  1XSV A;  1Y0U A;  1ONV A;  4IF4 A;  4E7J A;  3QOE A;  2FEZ A;  2IGM A;  3IP4 B;  4BE1 A;  5TIS C;  1SFU A;  5ED4 A;  2L7F P;  1HBX G;  3QP6 A;  2ADU A;  4KDP A;  4XOR A;  4PJM A;  4R79 A;  1S9H A;  2K4J A;  5ILV A;  5E3O A;  2V7F A;  3RIR A;  3TDU C;  3ZQG A;  1SD7 A;  4EM1 A;  1R7J A;  4I09 A;  2HVR A;  4A93 J;  3L09 A;  1UAA A;  2A5W A;  1XD7 A;  1GVJ A;  2IS6 A;  3ZN1 A;  1PVE A;  5LGT A;  4ZYH A;  3VSK A;  2F4O B;  2PEX A;  4Z2Y A;  3DP7 A;  4JBA A;  2GOM A;  2R7U A;  3BQY A;  1YX5 A;  2G7H A;  2LSO A;  3QPS A;  4Y7N J;  3DPU A;  1OIS A;  3EYI A;  2ZXJ A;  3E6M A;  2P4W A;  3WOD F;  3BG5 A;  1FP1 D;  4L5I A;  3Q3S A;  3QU3 A;  3W6K B;  1V5E A;  5F1J A;  2QQ8 A;  2KJB A;  3EQL F;  2R7W A;  4V19 K;  2J5P A;  2Q2E B;  1FMV A;  2KIQ A;  4CZZ A;  3BG7 A;  5E1W A;  2M7A A;  1RR7 A;  1I6X A;  3CTA A;  4V2F A;  5FLX Z;  2OTJ I;  1XX5 A;  2O9L A;  1R5G A;  2K9N A;  1G4D A;  3SZT A;  4L0Z B;  4M71 A;  4B3X A;  4HST A;  3HXL A;  4BYY A;  4PK4 A;  1B8I B;  4AID A;  3A01 A;  2W4S A;  5CQG A;  3O3K A;  4GDF A;  2CFO A;  3LSR A;  3FM3 A;  1YQA A;  2LTP A;  4KIC A;  3LAP A;  2H8W A;  4Y15 A;  3TL4 X;  2W1O A;  2K5C A;  2CV0 A;  3KPH A;  5IYD J;  1OYY A;  2YS9 A;  3GLX A;  3MQ0 A;  5TJJ A;  3SEQ A;  1I1S A;  4IO9 F;  3OS2 A;  2KKO A;  1CQT A;  3DF8 A;  1HQC A;  3TO7 A;  1YOV B;  1X3Z B;  2DFI A;  4Y17 A;  3ZMU A;  2CV2 A;  3F0C A;  4K2E A;  2VON A;  4BQA A;  1Z21 A;  5GPA A;  3OYC A;  2X1E A;  3SQN A;  3DXJ F;  3BJA A;  3E5X A;  3CMA I;  2HDC A;  2HQR A;  3WU2 C;  1HDP A;  4XN3 A;  2XGX A;  2ZXW H;  5KCM A;  1IDZ A;  3D5L A;  3AG3 H;  2KIM A;  3HYI A;  4LG0 A;  1ZRC A;  2EIK H;  4DNC A;  2BYV E;  3BR2 A;  1FEX A;  3BZC A;  1L0O C;  3HG9 A;  1R4N B;  5KK1 A;  2FMY A;  1OMI A;  4F7Z A;  3TQN A;  3BLY A;  3KET A;  3E6C C;  2HZD A;  3BJ6 A;  2JRT A;  4HF0 A;  1RIO H;  5JLW A;  2OQG A;  2CUE A;  4S05 A;  1Z6T A;  5IOY A;  4HV5 A;  3GTG J;  2VC0 A;  5JVT A;  2IXS A;  3QPL A;  2Z9O A;  3I53 A;  3ERM A;  2E7W A;  4LFU A;  4ESB A;  3S3O A;  2YU9 J;  4KUM A;  4CZC A;  4UVC A;  4IVN A;  3HUG B;  3F8F A;  2AQF A;  3L9F A;  3QRF F;  3HTU A;  3D5R C;  3NRV A;  2F48 A;  1P7J A;  2ETH A;  4OAY A;  1V5F A;  2HXI A;  1F36 A;  3RZD J;  2FNA A;  2HVS A;  1Z77 A;  3J7A O;  1R36 A;  4XMY A;  2WAQ N;  4IX7 A;  3H9Q A;  3FK6 A;  2ECB A;  3ASO H;  1KGS A;  3J7Y J;  1ZN2 A;  4P55 A;  3WGI A;  3O2P E;  5M3F J;  1DU6 A;  3DEW A;  1IO2 A;  4CGZ A;  3HGG A;  4UB8 C;  1G3W A;  2DU9 A;  3DKY A;  1TP4 A;  4RA2 A;  2OQR A;  3TO6 A;  4A3B J;  2KJC A;  1STZ A;  2JTV A;  2DYS H;  3DTE A;  4CSW A;  2A3S A;  3BZ6 A;  4AC0 A;  2NVT J;  2MW8 A;  2JVG A;  2LYC A;  2OBP A;  1ERD A;  5A2Q K;  4PDK A;  2DLL A;  1BA5 A;  3TP3 A;  2ZJQ F;  2ZO4 A;  1LJ9 A;  3H3U A;  4BDZ A;  1GVD A;  2KHM A;  2VQG A;  3M1E A;  1HKT A;  1T8I A;  2WY8 Q;  4CYD A;  2L9V A;  1OCO H;  3MKZ A;  3ZR8 X;  1P9Q C;  5BS6 A;  5H6Q A;  2V6E A;  5C3E J;  3GTM J;  1IV8 A;  3AG4 H;  4YG2 F;  4HYE A;  2FBH A;  3G1O A;  3LSM A;  1HC8 A;  3D0S A;  1X1D A;  2FBI A;  3F6O A;  2Y9Z A;  4L9V A;  3HDD A;  1IN7 A;  2M0M A;  2ACJ A;  5L3G A;  1IN5 A;  5D5U B;  2QKM B;  1XTA A;  1NG7 A;  5HNF A;  3FMS A;  3J80 K;  1IRX A;  4CA0 A;  3NEU A;  1TWC J;  2XGD A;  1QPM A;  1OQY A;  4EQQ A;  2FU4 A;  2R7O A;  2FF4 A;  2XAH A;  2GLO A;  1UST A;  2VJ5 A;  3CF2 A;  2RGV A;  1ZGW A;  3UKG A;  1B1B A;  2GQQ A;  1FZP B;  2QSG X;  1IXC A;  3L2R A;  3BY6 A;  5F27 A;  3HBL A;  2VKV A;  4CCK A;  1YI2 I;  1YJN I;  1RR8 C;  4D5C A;  4G7H F;  3QP5 A;  3JW4 A;  4LLG F;  3CO6 C;  2L4A A;  3IWZ A;  5GAH J;  2IA2 A;  1KU9 A;  3RPU D;  1JJ8 C;  1V3F A;  3HM5 A;  2KZG A;  1ETO A;  2OA4 A;  1BM9 A;  3PIO F;  1WJD A;  3ZMZ A;  4AU7 A;  4CH7 A;  1R00 A;  3MD2 A;  3FXL A;  3M9A A;  1S6L A;  4M9X A;  2OD5 A;  1RUO A;  4CHU A;  4KN7 X;  3NWS A;  1GV2 A;  2Z1D A;  2VC1 A;  3DKW A;  3RQ4 A;  1WH7 A;  4WK8 F;  3MZ8 A;  4ZJZ A;  3QOP A;  1S72 I;  1OKR A;  1BI2 A;  1CF7 B;  4P5O A;  4UNO A;  4NC6 A;  5JHU A;  1KZH A;  2HI3 A;  2OC6 A;  4P9U A;  2W25 A;  2M2E A;  4A0Y A;  4E7H A;  2VIX A;  2ZSI B;  1SVL A;  2DK5 A;  3O8G A;  4PJJ A;  2A6E F;  3Q5F A;  4BU2 A;  2VQC A;  2R3S A;  2EFW A;  4X1E A;  2OAZ A;  3OL3 A;  4II2 A;  3S16 J;  4M73 A;  3LSI A;  4MQV A;  4XLP F;  1MD0 A;  1LQ1 A;  5D8K B;  3JR9 A;  1VF9 A;  1HOM A;  1JTX A;  3K4C A;  4HNT A;  3QYE A;  4CXF A;  5IT9 Z;  4KIT B;  3FM5 A;  1MMN A;  4E7L A;  4DBQ A;  2VT3 A;  2XKO A;  2MFZ A;  2XIG A;  5AON A;  3F23 A;  2VL8 A;  3DBH B;  2AO9 A;  1VTN C;  3HRU A;  5IYB J;  2FXA A;  2JA5 J;  1QVU A;  4RLQ A;  1JUS A;  1TT0 A;  2M87 A;  4UV8 A;  2NVY J;  2HQ5 A;  3ROU A;  2CMP A;  2VKE A;  5GTI C;  1EH6 A;  5FLX K;  3OWT A;  2DT5 A;  2M4K A;  2IJL A;  1VQO I;  1QRY A;  3H3V K;  1FOX A;  4L9T A;  1WJB A;  4HG2 A;  3H5A A;  1DGR M;  2QQB A;  3NAR A;  4MFE A;  3BQZ A;  4FET A;  4U88 A;  3M1C A;  4BQQ A;  4RGU A;  1SAX A;  3DBR B;  2GAU A;  3A4C A;  3W6V A;  4QLC U;  1D3Y A;  3OIP A;  2YX4 A;  3DCF A;  2R7S A;  1ZLJ A;  2XGE A;  2JA8 J;  1Z91 A;  2HEO A;  3K1N A;  1X1A A;  1E3H A;  4KT6 A;  1JKO C;  2VJI A;  3M3Y J;  3ZQL A;  2UXX A;  4BDY A;  5LHH A;  2K9M A;  1MND A;  3RJP A;  3W6J B;  3V8K A;  3VYU B;  3CDL A;  4F92 B;  5GAD J;  3JRH A;  3GYH X;  4II3 A;  2P81 A;  1VQ4 I;  3CJQ B;  2E5N A;  3K70 C;  4HNV A;  2GBY A;  2K9L A;  3QPT A;  3EUH C;  3U21 A;  3BJO A;  3H3Z A;  5HS8 A;  1H9T A;  2HOS A;  3A0H C;  3JAM Z;  4QPQ A;  1FOY A;  1TWA J;  3M7G A;  3LA3 A;  5KHD A;  3LQQ A;  4L0Y B;  1U78 A;  5K5Q A;  3I59 B;  1K78 B;  3AL0 C;  3DTI A;  3OYA A;  4JYK A;  2L7K A;  1WQ2 A;  2P5L C;  2DA1 A;  3IV5 A;  3I54 A;  4FAS D;  3JAM K;  2BY1 A;  2DI3 A;  4I0A A;  3RSN A;  3CDH A;  3K0L A;  2L9N A;  4XIC A;  1Q1V A;  3AG1 H;  2ZJ2 A;  5HVQ C;  3GFI A;  3TGN A;  1SD6 A;  1KYZ A;  4QWQ A;  1WHU A; 
#chains in the Genus database with same CATH homology
 4KMU X;  2HTJ A;  1WI9 A;  4H0E A;  4I01 A;  2Y0M A;  3SXY A;  2PLY A;  1FSH A;  5CJ9 A;  3GXO A;  4TV7 A;  2ELH A;  1BI0 A;  1ZGA A;  3FHZ A;  1XGN A;  4WXD A;  4HV6 A;  4ENN A;  1XCB A;  1EH8 A;  4MHG A;  3WGH A;  5K5R A;  2O0Y A;  1XMK A;  2A6H F;  3SZP A;  3EYY A;  1ZRF A;  3FF5 A;  3KP5 A;  3MFK A;  2GZW A;  1J59 A;  2IPQ X;  1TBX A;  1FSE A;  1MJB A;  1QGP A;  2Z5U A;  1BOA A;  1IXS B;  2QYO A;  4O3M A;  4GYG A;  3FX3 A;  1XSX A;  1XGO A;  1ZG5 A;  4LGW A;  2F5F A;  3JSP A;  1ZRE A;  3WTS C;  5DEQ A;  1O3S A;  2X4H A;  2GA1 A;  5E1X A;  1QBJ A;  4KA4 A;  2H94 A;  2STT A;  5E18 F;  3ZPL A;  3ECH A;  5CVR A;  1G3Y A;  5F64 A;  3T0Y A;  1UHW A;  2MA3 A;  2QBY B;  2FNP A;  1SD5 A;  4AD9 A;  4A0X A;  4OIN F;  2M30 A;  5EEG A;  4BH9 A;  2DPD A;  5HLG A;  4MGR A;  1BIB A;  2EV5 A;  2FBK A;  4RGX A;  1HW2 A;  1RNL A;  1U5T A;  3HHH A;  1ZH5 A;  2H09 A;  1R22 A;  3IRR A;  3CUQ B;  2NS0 A;  3HOT A;  4HAM A;  2CWE A;  2DBB A;  1YW9 A;  3ZP5 A;  2QEN A;  4N0B A;  2RKH A;  4HLY A;  1BI1 A;  1OYI A;  5DUI A;  1NHA A;  3BPV A;  4P96 A;  4KIF A;  4PGH A;  1ON2 A;  4L9N A;  2BBY A;  4UHT A;  4IXA A;  2CQK A;  4IRI A;  3WTU C;  1YIO A;  5BMZ A;  1MKM A;  4Q4Z F;  2NRA C;  2PG4 A;  4U7D A;  1SD4 A;  3JSO A;  2R7F A;  4IJA A;  2YPR A;  3PQK A;  3TOB A;  5HDN A;  3FMR A;  1AWC A;  1GHC A;  1UCR A;  5E20 A;  4MNU A;  4ZH4 F;  3GWZ A;  3ZMD A;  4EJO A;  3RKY A;  4E70 A;  1SMY F;  2IP2 A;  3MCZ A;  3KCC A;  1XDS A;  3GO5 A;  1XCV A;  2UZK A;  1D8J A;  4GGG A;  1FYM A;  4I2O A;  1DUX C;  1AOY A;  3KP4 A;  2Z3Y A;  1FWZ A;  4KNY A;  3I64 A;  4UUV A;  1F4K A;  1HST A;  2A07 F;  5CVJ A;  2Q0O A;  4ENJ A;  2P8T A;  3NQO A;  2EV6 A;  2QWW A;  5ILS A;  4EM2 A;  2WWY A;  2HWV A;  1YYV A;  3F3X A;  1R5H A;  5JR3 A;  3U2R A;  5H20 A;  1F5T A;  4IRH A;  1R1T A;  3Q9S A;  3ABT A;  4MEY F;  3DPT A;  1LDJ A;  4A12 A;  2NNN A;  4I98 B;  3QAH A;  1MDM A;  5ICE A;  3KFW X;  1ZAO A;  4G9Y A;  4EJT A;  2HQN A;  3ABU A;  5DV5 A;  1XB4 A;  4CIC A;  4M74 A;  2EFO A;  3ZMV A;  1SFE A;  1T0F A;  1T39 A;  1WRJ A;  5DCM A;  2Q2E A;  5HLI A;  3IL2 A;  1TQP A;  2M8E A;  2K02 A;  5FGM A;  3IKT A;  2STW A;  2VOO A;  2M1B A;  4RS8 A;  5FD5 A;  3R0A A;  3VEP A;  5D5V B;  2A5Y B;  5ERI A;  4WXC A;  3CUO A;  1KA8 A;  3VOD A;  5CVU A;  4HF1 A;  2QQ9 A;  3KZZ A;  2HKX A;  3K69 A;  3COA C;  2W85 A;  1LDK B;  3C3W A;  3C1D A;  3F8N A;  1LEB A;  1UB9 A;  1XGS A;  1TTY A;  4A5N A;  1G6N A;  5BPI A;  3C18 A;  4LG0 B;  5DCF A;  1IRF A;  3TKY A;  2JPC A;  3GUD A;  2GWR A;  1T6S A;  2RQP A;  2K86 A;  2Y48 A;  5DD4 A;  4HX4 A;  2COM A;  3C7J A;  3FMQ A;  5D5X B;  1J2X A;  4GYI A;  4N9H A;  3WTX C;  1F1Z A;  5F1R A;  3OV8 A;  1D5V A;  4KFC A;  2HR3 A;  1O57 A;  3LA7 A;  3EET A;  3WTZ A;  1UFM A;  2L02 A;  1PP8 F;  5D6E A;  5DYM A;  4AWX B;  2ESH A;  3ZMS A;  4RGR A;  2EFP A;  3BWG A;  2K27 A;  3S2W A;  1D8K A;  2JZY A;  2DQL A;  1K79 A;  3F6V A;  3SFZ A;  3GVA A;  2B0L A;  1FOK A;  3T8T A;  1FY7 A;  3O6B B;  4IHS A;  2VBZ A;  5LBQ A;  3GFM A;  1FT9 A;  5BPD A;  1JXS A;  1O7L A;  1TLH B;  4R1H A;  1OR7 A;  2ISY A;  2VOP A;  2K4B A;  1MZB A;  1T98 A;  3HRT A;  1YS7 A;  1XSD A;  4CDG A;  1FYK A;  2GXB A;  2OZ6 A;  1DPR A;  1RI7 A;  5DD8 A;  3WU1 B;  1HSJ A;  4PZJ A;  1IW7 F;  5LRR A;  2YX7 A;  5D8L B;  1YO5 C;  2PJP A;  4ENK A;  1BIA A;  1K78 A;  2CSO A;  2MH9 A;  2V1U A;  2WV0 A;  4FX0 A;  4MQ9 F;  5AIQ A;  2E1N A;  3ECO A;  5IT9 K;  2Q8K A;  1MDM B;  4G7Z F;  2O03 A;  3DV8 A;  3RPU A;  4HF2 A;  1QZZ A;  2RVC A;  4YII A;  3RYR A;  4XRF A;  4HQE A;  1TNT A;  2XAF A;  4XBF A;  4A2U A;  2IRF G;  2QVO A;  3LA2 A;  5LEK A;  3P7N A;  3KP7 A;  5CVV A;  1IN8 A;  4ESF A;  3BRO A;  3HUG A;  2IA0 A;  4HBL A;  2BV6 A;  4YIF A;  1KQ8 A;  2ZCW A;  3ISP A;  3N4M A;  4WCG A;  4A0Z A;  3F8C A;  3GFJ A;  1IZ1 A;  1P4A A;  4R8H A;  3ZMT A;  1I1G A;  3I4P A;  4XLN F;  4HA8 A;  4OIQ F;  2HGC A;  1CGP A;  4U0W A;  1PUE E;  2RC4 A;  1KU3 A;  1KU2 A;  3LST A;  2CYY A;  1LNW A;  1T2K A;  2D1H A;  2XAS A;  3E5Q A;  2ZNY A;  1V4R A;  2XUB A;  1YW8 A;  4WX9 A;  1ULY A;  2ESN A;  3WTT C;  2JPB A;  2RN7 A;  1I5Z A;  4M9Z A;  1P2F A;  5J8C A;  3N97 A;  1B9M A;  1MJA A;  3U1D A;  4HX7 A;  3I0T A;  4HOB A;  4ZYE A;  4NHJ A;  2W24 A;  4UV9 A;  1J5Y A;  3GF2 A;  4B8X A;  4MTE A;  4OIP F;  1MGT A;  3KLO A;  1OPC A;  4EJV A;  3ZN0 A;  2LDU A;  2HFH A;  2EB7 A;  4Q48 A;  1IF1 A;  3F8M A;  3BOQ A;  3HHG A;  5ICF A;  2C6Y A;  2XAG A;  4PCQ A;  3U9G A;  1H0M A;  2NAZ A;  4MTD A;  3E6D A;  5E8I A;  4OU0 A;  1WWX A;  2PFB A;  4ZZD A;  3R6S A;  3RTR A;  4M9S A;  3B73 A;  1BBY A;  2X0L A;  1LVA A;  3K1P A;  2W84 A;  3IRQ A;  2XKP A;  1R23 A;  2LF7 A;  3BP8 A;  1U5T C;  5D6F A;  2V1D A;  3GX4 X;  3PQJ A;  2P5V A;  2FA5 A;  4GO1 A;  1DP7 P;  2UXN A;  2EWN A;  3L7W A;  2P7V B;  1FP2 A;  5ICG A;  3WE2 A;  4RB3 C;  2YU3 A;  2MD5 A;  1FBQ A;  3F22 A;  3REO A;  1BJA A;  4RB2 C;  1JHH A;  2H6C A;  4HX8 A;  1XMA A;  4EJW A;  2TDX A;  3GW2 A;  5FD6 A;  3GEZ A;  4EGZ A;  1T38 A;  4D0P A;  1EV7 A;  1O7F A;  2H27 A;  1TNS A;  2ISZ A;  4EGY A;  2XAJ A;  5EEH A;  1A04 A;  4MEX F;  3WGG A;  3M8F A;  5JFR A;  4KN4 X;  1P4W A;  2MC3 A;  3F72 A;  4RGS A;  4U0V A;  2OZU A;  4UVB A;  1X3U A;  3JTG A;  2O3F A;  4LK0 F;  4YFX F;  3R4K A;  1U3E M;  2FE3 A;  3MWM A;  5AIP A;  2PI0 A;  2YSR A;  3HOS A;  5E17 F;  2K7L A;  2EK5 A;  1GXP A;  2A68 F;  4LLL A;  3T1B A;  1FBU A;  5H6R A;  2VE9 A;  4HDU A;  1KU7 A;  3VOE A;  1U5T B;  1ZLK A;  1UHM A;  1J0R A;  3RKW A;  3R0J A;  2ZKZ A;  2G7U A;  4KT5 C;  3QU6 A;  3CO7 C;  2WC2 A;  3F8B A;  1I27 A;  2DPU A;  4I0B A;  2FQ3 A;  2FOK A;  5DUK A;  1ODD A;  2V79 A;  5DDG A;  5JI6 A;  1CF7 A;  3FZV A;  3V7C A;  1DPU A;  5L3B A;  4KIG A;  5L3F A;  4RAY A;  2O61 A;  3MAJ A;  5L3D A;  2DW4 A;  1ON1 A;  2DK8 A;  2AS5 F;  1FX7 A;  1YS6 A;  1OYW A;  1XDU A;  5J8F A;  3WTW C;  3HSR A;  3SHF A;  3HTS B;  4B09 A;  2IVM A;  3IC7 A;  3LWF A;  4G6D A;  4FT8 A;  3LAJ A;  4ASN A;  3J81 Z;  3V7R A;  4LLN A;  3FXU A;  2W57 A;  5D4R A;  1SMT A;  4L5J A;  2EA2 A;  2ZME A;  4ON0 A;  3MEX A;  2LNB A;  1YTY A;  4EV0 A;  1FLI A;  1ZRD A;  2IA1 A;  4FX4 A;  5ILU A;  2KIU A;  1TQI A;  2QUF A;  4HW0 A;  3WG9 A;  4O6J A;  1FC3 A;  1S29 A;  4LD5 A;  1TW2 A;  3V8J A;  3E6B A;  3T8R A;  3VB2 A;  2RV8 A;  1L3L A;  1TQM A;  1XN7 A;  2P6S A;  1LDD A;  2XV4 S;  4OIO F;  1RUN A;  3I59 A;  5L3E A;  1JHF A;  3GZ6 A;  3LFK A;  4KIB A;  3G3Z A;  4G8X A;  2DQR A;  4JQF A;  2E1C A;  2JSC A;  3KP3 A;  5FFZ A;  3KP2 A;  1B6A A;  3CLO A;  4LJZ F;  4HDV A;  2UWM A;  3ELK A;  5FO5 A;  1EH7 A;  4WXH A;  1WKM A;  5CYV A;  4I02 A;  3EUH A;  2O8X A;  3BDD A;  1PDN C;  4L9J A;  1U2W A;  2VT2 A;  5LHG A;  1ZG3 A;  5J6X A;  3B02 A;  3K1M A;  3FXQ A;  2Z99 A;  5KVR A;  3BPX A;  3M8E A;  4G7O F;  3E97 A;  1FNN A;  3P9C A;  4ZYG A;  1BC8 C;  2R7D A;  1Q1H A;  3FXR A;  3ULQ B;  2MH2 A;  4U0Y A;  3ML6 A;  1HXD A;  4EMS A;  3GZ5 A;  1IAW A;  2DO7 A;  1R1V A;  3R61 A;  2VBY A;  4NQW A;  2F5D A;  1F9N A;  2J5O A;  3KP6 A;  3WTY C;  1J9I A;  3OOP A;  1Z1D A;  1O3R A;  2IT0 A;  3CJN A;  5CVI A;  5LGU A;  2ZBK A;  3HRS A;  1ZYR F;  4OMZ A;  2L01 A;  2KRF A;  1Z7U A;  4A6D A;  2P7C B;  1S3J A;  1HKQ A;  3K9T A;  2KIF A;  3WE3 A;  1LB2 A;  3VFZ A;  3V4G A;  2BGC A;  3DQV C;  4M6Y A;  1YFH A;  2F2E A;  2GIV A;  4UVA A;  1HW5 A;  1U6G A;  2EA4 A;  1IRG A;  4HLX A;  1TW3 A;  4ETS A;  4BXU A;  5HLH A;  2QZ8 A;  3G73 A;  3MZY A;  2PQ8 A;  5D5W B;  2HYG D;  3RDI A;  2VXZ A;  3Q9V A;  4WWC A;  2AXL A;  3PFI A;  2EV0 A;  5LRS A;  2ZNZ A;  1E17 A;  3JTH A;  3RYP A;  3DFG A;  4XSZ F;  3HIF A;  5A2Q Z;  4N9I A;  1JGS A;  2O6G E;  3WU0 A;  4G6Q A;  4ENM A;  2Z33 A;  4O5V A;  3QPH A;  4YFK F;  3I58 A;  2RNJ A;  4XSX F;  1S7A A;  4EM0 B;  4AIH A;  5K1Y A;  4OOI A;  3J80 Z;  2M5W A;  2M45 A;  1IUY A;  1YLF A;  5CLS A;  3LQR A;  1G3S A;  4ESJ A;  2A61 A;  5LHI A;  3I5U A;  2CO5 A;  2XRN A;  4OIR F;  1HKS A;  1QO0 D;  4HZF A;  2PMH A;  2HS5 A;  2A69 F;  3F21 A;  1W4M A;  4GCV A;  2XVC A;  2E7X A;  1W7P D;  5LGN A;  4LMY A;  1W7P B;  4NB5 A;  3FWE A;  2XHK A;  6PAX A;  4YFN F;  2FRH A;  3TDZ C;  1IN4 A;  2GXG A;  5LEJ A;  3WTV C;  1ZAR A;  1IXR C;  4OMY A;  4L18 B;  2CW0 F;  3I71 A;  2CGP A;  3E3V A;  1GXQ A;  1O3Q A;  2D1V A;  2MLG A;  1R1U A;  2LF8 A;  3DEU A;  3P9I A;  3J81 K;  4P9F A;  4LB6 B;  1B4A A;  5IT3 A;  1B59 A;  4BHP A;  1W5S A;  2LKP A;  1W5T A;  1U8R A;  3KEO A;  2PMU A;  5HOO A;  4DQ2 A;  4U7B A;  2D2W A;  2PN6 A;  5K5O A;  2VBX A;  3CUQ A;  4KMF A;  5BQT A;  3E5U A;  4KYW A;  5F6F A;  2P5K A;  4AIK A;  2BEO A;  1QQI A;  1Z05 A;  5DCM B;  4EJU A;  1XGM A;  2Y75 A;  1USS A;  1K6O A;  3KE2 A;  2OU2 A;  1QNT A;  3GFL A;  3R60 A;  4WF2 A;  2QM3 A;  1R58 A;  1BC7 C;  2VN2 A;  3RPQ A;  2HOE A;  2QLZ A;  2IW5 A;  5HDG A;  2DTR A;  1QZY A;  4BNC A;  3RKX A;  4AVP A;  3HSE A;  4FHT A;  2VBW A;  5TRD A;  2XAQ A;  3K2Z A;  4M72 A;  2XRO A;  2V6C A;  2EJR A;  3IKV A;  2BE5 F;  1P4X A;  2MLK A;  1DDN A;  1YG2 A;  1KYW A;  3P9K A;  4AIJ A;  4G94 A;  1Z9C A;  1S8N A;  2HYF A;  2JT1 A;  4IPA A;  4GXO A;  2PBI A;  3HSF A;  3AAF A;  4UXN A;  5BOX A;  5HS7 A;  3DPL C;  2V1X A;  2HKO A;  3V7S A;  5E8G A;  3ZQ7 A;  4EVI A;  1KQ9 A;  2DAO A;  4LK1 F;  2P6T A;  4A6E A;  4JK1 X;  4LB5 A;  5E1Z B;  1IN6 A;  1REP C;  5D4S A;  1KQ0 A;  4M6X A;  1MJ9 A;  3V8L A;  5FB2 A;  5LLQ A;  2GA2 A;  4BHC A;  2F5E A;  3RI4 A;  4S04 A;  5HDK A;  3L2C A;  1O3T A;  3IHU A;  1Z6R A;  2FML A;  4CO8 A;  4BAY A;  2ZME B;  1S7O A;  4Q47 A;  3HRM A;  4I7H A;  1FYL A;  1K7A A;  2NNY A;  1J7K A;  1W7P A;  1B9N A;  2VE8 A;  1H9G A;  2FSW A;  1BN5 A;  2EFQ A;  4RB0 A;  2EFN A;  2G9W A;  1BI3 A;  2WTE A;  2MBF A;  1C0W A;  4RAZ A;  3L00 A;  2NYX A;  5ICC A;  4ZZL A;  3TOA A;  2VOD A;  2L4M A;  1P92 A;  1E2X A;  2L54 A;  4HQM A;  3EDP A;  2ZFW A;  4PGG A;  3ERE D;  2YR2 A;  1LEA A;  3CUQ C;  5HS9 A;  4BHB A;  4IHT A;  1P6R A;  3KZY A;  3KEQ A;  1ZG1 A;  3TO9 A;  1SFX A;  4RB1 A;  1YW7 A;  1RZ4 A;  1ZGJ A;  1WSU A;  2CFX A;  2F5C A;  4ZYD A;  1HW1 A;  3H92 A;  2HTS A;  1FBS A;  5L3C A;  1G3T A;  1PP7 U;  4Q5S F;  3T5X A;  3KLN A;  2D45 A;  4A5M A;  1FPQ A;  1ZHF A;  1J75 A;  2QBY A;  2CG4 A;  2RDP A;  2QQA A;  2L3D A;  2V9V A;  1JE8 A;  2H6B A;  3MZH A;  4Y13 A;  2HZT A;  4IRG A;  3IWF A;  5FFX A;  1XSV A;  1Y0U A;  1ONV A;  4IF4 A;  2FEZ A;  1HBX G;  1SFU A;  5ED4 A;  3QP6 A;  2ADU A;  4KDP A;  4R79 A;  2K4J A;  5ILV A;  3RIR A;  3TDU C;  1SD7 A;  4EM1 A;  1R7J A;  4I09 A;  3L09 A;  1XD7 A;  1GVJ A;  3ZN1 A;  5LGT A;  4ZYH A;  2PEX A;  4Z2Y A;  3DP7 A;  1KYZ A;  2G7H A;  2LSO A;  3EYI A;  2ZXJ A;  3E6M A;  2P4W A;  3WOD F;  1FP1 D;  4L5I A;  3QU3 A;  3W6K B;  2KJB A;  3EQL F;  2J5P A;  4CZZ A;  5E1W A;  1I6X A;  3CTA A;  5FLX Z;  1R5G A;  1G4D A;  3SZT A;  4L0Z B;  4M71 A;  4BYY A;  3O3K A;  3FM3 A;  1YQA A;  4KIC A;  3LAP A;  4Y15 A;  1OYY A;  3GLX A;  3MQ0 A;  5TJJ A;  1I1S A;  2KKO A;  3DF8 A;  1HQC A;  3TO7 A;  2DFI A;  4Y17 A;  3ZMU A;  4K2E A;  2VON A;  4BQA A;  3SQN A;  3DXJ F;  3BJA A;  3E5X A;  2HDC A;  2HQR A;  2XGX A;  3D5L A;  4LG0 A;  2KIM A;  3HYI A;  1ZRC A;  4DNC A;  2BYV E;  1L0O C;  5KK1 A;  2FMY A;  1OMI A;  4F7Z A;  3TQN A;  3KET A;  3E6C C;  3BJ6 A;  2JRT A;  4HF0 A;  1RIO H;  2OQG A;  4S05 A;  1Z6T A;  4HV5 A;  2VC0 A;  5JVT A;  2Z9O A;  3I53 A;  2E7W A;  4LFU A;  4ESB A;  4KUM A;  4UVC A;  4IVN A;  3L9F A;  3F8F A;  3QRF F;  3HTU A;  3NRV A;  2ETH A;  2FNA A;  3J7A O;  1R36 A;  1KGS A;  1ZN2 A;  4P55 A;  3WGI A;  3O2P E;  4CGZ A;  1G3W A;  2DU9 A;  2OQR A;  3TO6 A;  2KJC A;  1STZ A;  2JTV A;  2A3S A;  3BZ6 A;  2OBP A;  5A2Q K;  4PDK A;  2DLL A;  2ZO4 A;  1LJ9 A;  3H3U A;  3M1E A;  1HKT A;  4CYD A;  5BS6 A;  5H6Q A;  4YG2 F;  4HYE A;  2FBH A;  3D0S A;  2FBI A;  3F6O A;  4L9V A;  1IN7 A;  2ACJ A;  5L3G A;  1IN5 A;  5D5U B;  3FMS A;  3J80 K;  3NEU A;  1QPM A;  4EQQ A;  2FU4 A;  2FF4 A;  2XAH A;  1UST A;  2RGV A;  1B1B A;  2GQQ A;  1FZP B;  1IXC A;  3BY6 A;  4G7H F;  3QP5 A;  3JW4 A;  4LLG F;  3CO6 C;  2L4A A;  3IWZ A;  2IA2 A;  1KU9 A;  1V3F A;  2OA4 A;  1BM9 A;  3ZMZ A;  1R00 A;  3M9A A;  1S6L A;  4M9X A;  2OD5 A;  1RUO A;  4CHU A;  4KN7 X;  2VC1 A;  3DKW A;  4WK8 F;  3QOP A;  1OKR A;  1BI2 A;  1CF7 B;  4P5O A;  4UNO A;  5JHU A;  4P9U A;  2W25 A;  4A0Y A;  2DK5 A;  2A6E F;  3Q5F A;  2R3S A;  2EFW A;  2OAZ A;  4M73 A;  4MQV A;  4XLP F;  1MD0 A;  1LQ1 A;  5D8K B;  5IT9 Z;  4CXF A;  3FM5 A;  2VT3 A;  2XKO A;  2XIG A;  5AON A;  3F23 A;  1VTN C;  3HRU A;  2FXA A;  4UV8 A;  2M87 A;  3ROU A;  1EH6 A;  5FLX K;  2DT5 A;  2IJL A;  4L9T A;  2QQB A;  4U88 A;  1SAX A;  4RGU A;  2GAU A;  4QLC U;  1D3Y A;  2YX4 A;  1ZLJ A;  1Z91 A;  2HEO A;  3K1N A;  2UXX A;  5LHH A;  3RJP A;  3W6J B;  3V8K A;  3GYH X;  3QPT A;  3BJO A;  3H3Z A;  5HS8 A;  1H9T A;  3JAM Z;  3M7G A;  3LA3 A;  3LQQ A;  4L0Y B;  1U78 A;  5K5Q A;  3I59 B;  1K78 B;  1WQ2 A;  2P5L C;  3I54 A;  3JAM K;  2DI3 A;  4I0A A;  3CDH A;  3K0L A;  5HVQ C;  2ZJ2 A;  3GFI A;  3TGN A;  1SD6 A;  4JBA A;  4QWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...