3LWIA

Crystal structure of cren7-dsdna complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
58
structure length
58
Chain Sequence
b'SGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin protein Cren7
publication title Structural insights into the interaction of the crenarchaeal chromatin protein Cren7 with DNA
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
total genus 4
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lwiA00
4R56A 3KXTA 4R55A 2JTMA 3LWIA 3LWHA
chains in the Genus database with same CATH superfamily
2LRQA 2HKNA 1TSFA 1N9SA 3BFMA 3ZEHA 4E7SA 1CSKA 3LWHA 3HSBA 1C0MA 4WCIA 3JB9H 3ZFJA 1NEBA 4ATOA 3NFCA 4RTZA 2RH2A 1HXDA 3UF4A 4FIBA 4KRTA 4JDSA 1UGPB 3P8DA 1NPPA 4A4KA 4PKCC 4C0GA 1VA7A 4XTXA 1IXDA 4E7LA 1X2QA 3TREA 1H641 2HCKA 3QYGB 3VRZA 3CCMQ 4M7AC 5FW9A 3JRZA 2RD1A 4X1VA 1VQNT 3UWNA 3TSZA 5EG2A 2KR3A 3QG1A 1QKXA 4PNOA 2COYA 5GANf 3HP9A 3OW2P 2YHTA 4J7IA 1YHQT 4J83A 3L42A 4B6MA 3ASKA 4RCCA 4AFUC 2NUTA 4CI0C 3CC2T 3SFMA 3GIBA 3TVTA 2D0NA 2LT1A 2HQHA 2B8AA 2E6ZA 2ATCB 2JTMA 3EG9A 4OB0B 2K3YA 1VQ9A 1JRIA 2V26A 2JVVA 1TS9A 3EHQA 1FXXA 4M7AD 1QVFA 2C06A 2AHJB 2RK1A 1PC0A 3ME9A 4LXCA 2YDLA 5FU6C 4FL6A 3OA6A 2O4XB 1VQMA 4HT8A 1PNJA 4QVCA 5CKDA 3RDVA 3QPHA 3FDRA 3CCVA 1VQ7A 3VS4A 3VUZA 5CK9A 4C0DC 1SKUB 1M1KR 5GANg 5HK3A 2RPNA 1IHWA 4ELZC 2EQJA 1SSHA 3CMAA 1ZBJA 2C0OA 1YBYA 1PSFA 3QSUA 2AZVA 1BYMA 3L2ZA 3DB4A 3EGDB 1K9MC 4Z89A 3RBBB 2F5TX 1WJRA 5CQXA 4IKFA 4VUBA 4BDYA 1N27A 2V8IA 1M90R 2HQXA 4B9XA 5KYWB 3QIIA 2XD0A 3M0QA 1JQQA 1X2KA 4HCKA 3MO8A 3NHNA 1VQ6T 3FC3A 1QQJA 4BY6C 2QEXT 1FMWA 2K5IA 3H8ZA 5GAOq 1KC8C 2F2VA 1KK7A 4N0AC 1IGUA 2FL7A 1YITQ 1XNIA 4C8QA 2DF6A 2EW3A 1WJSA 3M56A 3JV3A 3TU4K 2KBTA 3C12A 5I22A 2XKOC 3M53A 1WQ7A 3NTHA 5FU7C 1AOJA 3G6EQ 1BI1A 3QWXX 1D0YA 1ZSZB 2P84A 2DILA 3OYKA 1ZUYA 1S72A 1D1BA 1QWEA 3QDFA 5DLQE 3M0TA 1QCOA 2KY9A 1MMAA 1YJWQ 1H92A 2D0QB 4M7AG 4C5IA 2CP2A 5GAOr 1G5VA 2KT1A 3A8OB 2I0NA 5C0MA 4MDXA 2X4YA 3ZBDA 5GAN3 2FRWA 4EDUA 3G6EA 1YWOA 3LWIA 4HVVA 2ENMA 2GQVA 4GLMA 2MWPA 4NL2A 2JJ9A 1X6OA 2RHUA 1RLQC 1YI2A 3RERA 4C8QE 4PJOA 3OYFA 3PIOA 4M75C 2NUTB 2DVEA 5GMKi 1H3HA 2R5MA 3CCJQ 1QVFS 1PRMC 2L89A 2HAXA 4QW2A 3VYGA 3L2VA 3SHWA 1GCQA 2JTFA 3EH1A 3MEVA 2VC8A 1YITT 2YUOA 1TUGB 5EC7A 4PJNA 2JMCA 1OU9A 2J06A 2K57A 2ZAEA 2LVMA 2RK2A 3HPWA 2VXEA 2ED1A 3V7CA 3CC4Q 1B34B 3JCMg 1VQKA 3CCSA 1J3TA 3E19A 4FYWB 3LW5E 3EFOB 4LD9K 4FSXA 2WACA 4QT7A 2CUDA 3H0HA 4BD3A 1LOJA 2CSIA 1M3AA 1SRLA 4M75D 4IURA 4J8OA 2JTEA 5C6SA 4PJOE 3PT9A 2BUDA 2P0KA 3SD4A 3CC4A 2LNHB 3BE3A 4L5GA 2K3BA 2EGAA 1U06A 2YXYA 2R57A 3FJPA 3OSVA 4OVAA 4M7AF 3MEAA 1GFDA 4GLKA 1WIEA 5FRMA 1ZBXA 2KT8A 2VWFA 1BIAA 5A0DA 3CCRT 3M59A 5FWBA 3BDLA 3HKSA 1XOVA 1T3LA 1OX9A 1GBRA 5A0LA 2VB6A 4B9WA 3MJXA 3V8JA 1WYXA 1RAGB 3I56Q 2P0QA 4M77C 1UGSB 1WHLA 3JCMc 2A0FB 2A36A 2JMAA 1Q95G 1YJ9A 5I21A 2GQIA 1WJQA 1W2BP 5LJ3g 4RTTA 1JB0E 3DLMA 1EIFA 1OI1A 2ZPIB 4OMMA 2CSQA 1RUWA 3S3MA 2DX1A 1X43A 4M7AB 3MPUB 3CCUA 3OY9A 4A4FA 1LVKA 3WVEB 1HK9A 3PNWC 1M8MA 2B86A 1MUZA 2PUOB 1SG5A 3LH0A 3RKYA 1TUDA 2K9GA 2HQEA 2KE9A 2BZYA 4M77D 3INZA 4A4EA 1Q81U 3KBGA 2DD5A 2CP6A 3QWYA 2BKDN 5A2QE 3HHTB 2IIMA 2X4XA 3VRYA 3GBQA 4PLIA 2DRMA 1VQLQ 1ZX6A 4XTUA 4GY5A 3SDZA 3OS0A 1OV3A 3CQTA 3JCMX 1N8RR 4M75G 3I9QA 4PLLA 3GNGA 4F7UA 1I5OB 3G4ST 3I56T 3VS6A 3VS7A 2Y90A 1YNZA 5KCHA 4X34A 3MCAB 3CD6Q 2KAFA 1S1NA 4FT2A 2QXFA 4JRKA 4LE9A 2KSSA 2JM9A 4C0DB 2OTJQ 4E7ZA 4D6WA 4IIOA 3CCQA 5GAMg 1MMNA 2CP0A 2X9HA 2LCSA 1ZUKA 1ZA1B 3X26B 2LJ0A 2M02A 4XU3A 1ZSGA 2LP5A 3OW2A 3RNJA 1IRXA 1BK2A 3RR6A 3CMET 1XJWB 2HZYA 2ZPFB 1WHMA 4ZTJA 3TEEA 4E2FB 4F7UE 3V7RA 1EZZB 3QJ6A 4EMHA 2HD0A 3EFSA 1KD1R 1NYFA 4ME7A 2P4RA 4RUGA 1MMGA 4MMKA 1KJWA 1D09B 1PSEA 3OQ5A 4BY6B 1GCPA 1OULA 2D1XA 1GXIE 1OX8A 1VQLT 4KGXB 1M1KU 5LJ5f 1Q82C 4PK4A 3A5ZB 5IXFA 1TU0B 1K0XA 2QTVA 1AD5A 2GTJA 3O8VA 1MNEA 1I5LA 2CP3A 3UA6A 5GANd 5LL6S 1LJOA 5IT9E 4M77G 2GFUA 4Q5WA 3G71T 1TXQA 4M75F 2MCNA 3CXCA 4QQGA 5IHKA 3I55T 5FU7B 3SB2A 1M90U 2DBMA 1WHGA 5KH6A 2QA4Q 2VGMA 1PKSA 3L2UA 1VIEA 2QDLA 4R0KA 2KQWA 4N4GA 1OOTA 4E7IA 2RQVA 1R0CB 2OAUA 2K2VA 1UGQB 2CYZB 2ABLA 3RKWA 2JS0A 1MV3A 5GAN7 2DNUA 3C94A 2PU9B 3M55A 3OYLA 4KGZB 3FEOA 2EQMA 5LJ5g 3RIRA 2KYBA 4BE0A 4FU6A 4JJBA 3LLRA 5CAIA 3FB9A 4M75B 1AWOA 1K1ZA 2DZCA 2QQBA 1X01A 1Y71A 2FZKB 2O9SA 3J80E 1UG1A 5HKCA 4O6JA 1UJ0A 2HL5C 2DXUA 2W0ZA 3CPWA 2QI2A 1R8OB 2V8JA 1BI3A 1X75C 2WSFE 2D6FA 1UDLA 2LZ6B 2R5AA 1GL5A 2FPEA 2RI3A 1BCOA 1AHJB 4EPCA 1AEYA 2DIQA 1YHQA 2O01E 1MHNA 3VS1A 3PVLA 4KGVB 1NG2A 1UFFA 1W4SA 4OB2B 1Q86R 4C8QC 1D0ZA 3AT1B 2F69A 3EFRA 6AT1B 1WA7A 5KYXB 3GPLA 1RAHB 4LDWA 2ZPGB 2RI2A 3HRUA 3OW2S 1N6AA 4DBRA 2DPPB 1SSFA 2K4YA 2ZPHB 5DLOA 1M3BA 1RAFB 1Y96B 2NYSA 1U1TA 4J6YA 4AG2C 2GTOA 4V2SA 2DL5A 2M0OA 1X6GA 1VQ9Q 1G3SA 2GCXA 3CC7Q 4C5EA 1FX7A 1VQOT 3CBMA 2KYMA 2CZ1B 2VASA 1NLPC 3IQLA 3HRSA 2CGHA 2DLPA 2H3JA 3M54A 2KMTA 2DXTA 2YRCA 2DZ9A 2HBWA 2IG0A 2RO0A 5KE2A 1X27A 4OB1B 2ZGWA 1KQSA 4Z88A 2FZGB 4J9EA 1VQMQ 3OYEA 1M1KC 2E41A 3SWNA 1WXUA 4N4IA 3CC7A 3HFNA 3CCVQ 3G1JA 3UA7A 1VQ7Q 2V1RA 2KXCA 4M77B 5KYYB 4PJOC 3JCMd 4RMOA 4K11A 2KEAA 5AT1B 2EYZA 1OYXA 3BDUA 1SRMA 3FIFA 1R0BG 3CXCS 3CMAQ 3OYAA 1VIFA 2X4JA 4JS5A 3M58A 1GCQC 2PZ1A 4EMKA 3OMCA 2Y4YA 1M90C 1YP5A 1G8XA 2EBPA 1SHFA 4OMQA 1D3BA 4PJLA 1K9AA 4DBFA 3HRTA 5FLXE 3FLGA 5CCAA 4RTWA 4CC3A 2EYXA 1G83A 3M4GA 3CCMT 2RM4A 4JRIA 5CO7A 4NS5A 2E3HA 5GAN5 4BI4A 4JJNK 1RACB 2DERA 4C5HA 1WPYA 3C95A 1KFZA 1I4K1 4PJOD 1TH7A 1DJ7B 4AFZC 2RN8A 3Q1JA 3S6WA 4OB3B 1N9RA 2DVJA 2YLBA 5L8RE 4IUTA 4ORZA 2PVDB 2F2WA 2LCLA 3JCMV 2XIDA 2SRCA 2EQKA 1CKAA 2KRSA 4LDXA 4M7DA 3CPWS 1D1CA 5GAN4 5LJ3d 1KHIA 2H3EB 3OYIA 3CCVT 1MMDA 4M78A 4R55A 1BU1A 2DTOA 1HSQA 3OYBA 1VQ5Q 5IHIA 1S72Q 4Y28E 3X20B 3QBYA 3JB9D 1IO6A 3JCMP 1ZUUA 5D6XA 1YJNA 4EIKA 1W2BA 3PE0A 4J6WA 2BE7D 4CC7A 2FYKA 1VOMA 4HXJA 1YCYA 3J7AF 3QUIA 2HSEB 2E5KA 5CQYA 2EVRA 1VUBA 4D8DA 1K73R 4M4ZA 4A63B 1VQ5A 3CCEQ 4PFPA 5KCOA 1UEBA 2EJ9A 1N8RU 1YI2Q 2MWOA 2HKQB 1HJDA 4RKUE 3LYIA 3M0PA 3M57A 1C6VX 1M2VA 1HD3A 2RQTA 4M7DE 2O31A 5FROA 3QZ9B 1G3WA 1M1FA 2EGEA 3ULRB 2YRDA 3CCEA 3PVQA 2COZA 1OZ3A 3OS5A 4M78E 3E1SA 1YIJQ 1KQSS 3JCMb 2LCCA 1ZQ1A 2QASA 1V1CA 1QP2A 1R77A 1TWBA 1M2OA 1T3SA 2DBKA 1WLPB 5CVIA 1VQKQ 3CCSQ 3H41A 4UC4A 3NMZC 3EG9B 1I1JA 5GAMd 3OYHA 1YIJA 4PJOG 2JW4A 4KH1B 5GAN8 3JCMe 3EGXA 1WHKA 1RL2A 5DM7R 3E9FA 1QVPA 1LPLA 1W6XA 4BE1A 1QVGP 2DL3A 3KFVA 4II1A 1KD1U 3G6ET 4O5VA 2JT4A 3S3OA 1OZ2A 2E12A 4XU2A 2XICA 2DYBA 4KULA 5HK0A 3CCRA 1D3BB 5GANj 3C4SA 4BI8B 3A1PA 1YJWT 2LQKA 4FM4B 3PIPA 1WHJA 1UGRB 3LH5A 2DO3A 5D6YA 5M9OA 3JB9G 2RHIA 3OBWA 2EJFA 4YTLA 2AT1B 3VS5A 1JJ2P 1PKTA 3EG3A 4KH0B 1I8FA 1IGQA 4C92A 3CCLQ 4Y92A 1Z9QA 4XU1A 2GFAA 1YJ9Q 4WTOB 2KDSA 4DOWA 1Q82U 2CP5A 1Y07A 3GLXA 2O9VA 2HBPA 3UPUA 2M51A 5GANh 4J9DA 2DIGA 1ZA2B 3BW1A 5KYNA 3CCJT 5J39A 2IVWA 1KSWA 2M0YA 1VQKT 2CUBA 1W2BS 4M7DB 4HVUA 3CCST 5I2MA 3CCUQ 5LJ3e 3H0IA 2DJQA 3R6OA 3CCLA 2LNVA 4BB7A 4M78B 2EPDA 3OS1A 4X9CA 3O5ZA 5FWCA 2FEIA 4C8QB 4NL3A 2DAQA 3TCJA 3GNFB 2MPXC 1LNXA 3CC4T 4PJOF 5GMKl 3EH2A 4RTYA 3T9NA 4J6XA 5LJ5d 1QP3A 1UTIA 3VU3C 2H8HA 4J7FA 1FWZA 2JS2A 1N8RC 2J05A 4C92E 2HEQA 2YUNA 4ZN1A 1KG1A 1I81A 3LGLA 3X28B 4JLGA 4JJDA 3G4SA 5AYFA 4JRPA 2RJEA 2MF2A 4ZGDB 2L3QA 2NUPA 1QWFA 2VGNA 2O2OA 1ABOA 1M2VB 3P8BB 4BACA 3PMTA 2D8HA 3VS0A 1PWTA 1TUCA 3JB9F 1M27C 4IUPA 2DTIA 3DKMA 4HT9A 5FRNA 3RKXA 5GAN6 2FPFA 1AWXA 4ZGJB 4J9BA 2PVOB 2GGRA 2EYYA 1BI2A 2A08A 4PJOB 2XG8D 3CCQQ 2GNCA 3JCMJ 2AZSA 4LD6A 2OTLQ 2BZ8A 2LX7A 3WXMB 5GAMe 2O88A 2W10A 4MMLA 1UHCA 3X25B 1WXTA 2PNIA 4DEYA 1H8KA 2J6OA 4F7UG 1TOVA 3FJ5A 1ZLMA 1HYOA 2QG9B 1QCFA 2KNBB 3EGXB 2MMPA 2VXFA 1KD1C 3VS2A 2QAZA 4MZTA 2IPOB 2OTLA 5GAOp 4F16A 2FVUA 5CKBA 2C0TA 1VQ4A 1QCNA 2WSCE 2E70A 4XQ3A 2V8KA 3M9QA 4L6V5 2MOXA 2F2XA 2MAMA 2E64A 3OB9A 3UATA 1WDXA 2DETA 3OYDA 1VQ8Q 4HA8A 1FYNA 4JPBW 2NLUA 5CKHA 3G71A 2VUBA 4IIMA 4JRQA 1NJIR 1ABQA 2E5QA 2JM8A 2K5LA 1K4US 1Q7YR 1OQKA 1AZEA 5IN1A 4IUVA 2A3LA 3JCMh 1OPLA 3RMQA 4C5GA 4C92B 2K2MA 1K8AR 1VQ8A 3NTKA 2PUKB 3JB9I 1C1AA 4DBQA 3NGPA 3REAB 1VQPQ 5IHNA 2HDAA 1ZHIA 4MZPA 1PRLC 2FB7A 3SWNC 3PTAA 2L3PA 3H9NA 1I07A 3CD6T 3HFOA 5J26A 3QXEB 1AWJA 3MP8A 3PFSA 4AG1C 2RJCA 3L2RA 2OTJT 4L59A 2FZCB 1NZ9A 2O4XA 2RHYA 3C0CA 5LJ3j 1VQPA 3H0FA 2VVKA 4X9DA 4EMKC 2P4TA 4TVRA 2CT3A 2RHZA 1GBQA 2K7AA 1IB8A 4IUQA 2K5FA 3EHRA 5I11A 3META 2K6DA 3P8HA 5L23A 2EQIA 2CT4A 3EG2A 3EGDA 2X51A 1TG0A 2JXBA 1W70A 2CREA 1QKWA 4XTWA 1UJYA 4AMCA 5IH2A 1M4ZA 1Q86C 3QKJA 5D6WA 5LJ3h 4Y91A 1K73U 2EJGA 3MHXA 5KYWA 4OGEA 1YHQQ 1RABB 2D9TA 2ZPBB 1WQWA 2ZCFB 2M9UA 4A53A 2Y4XA 4OMPA 1RLPC 1JU5C 3CC2Q 2BZXA 1T0JA 1VQNA 1V29B 2E6NA 4M7DC 4F7UB 5HY6A 2LJ1A 3M5AA 1PHTA 1TTHB 3AHUA 4OMOA 4M78C 2JN0A 3X24B 2RQRA 1VQOA 2E3IA 4KBMB 3I5RA 3A8HB 1FMKA 4LDUA 4C0FA 3I35A 2QA4T 4M77F 3CC2A 1K76A 4PFZA 5GAMj 2X3WD 1Q81R 2EAYA 4E47A 4FYYB 4MDWA 1N5ZA 1ZSZA 4CRIA 4N4HA 2E65A 2JZ2A 4F17A 2EYWA 4DEXA 2GBQA 4AFSC 2PQWA 4M7DD 1X69A 2ED0A 3JAME 4LUEA 2RJFA 2XK0A 4GBQA 2ESWA 2LQ8A 4M78D 2RJDA 1JXMA 4HVWA 5HCKA 3S3NA 2XHCA 4C8QD 2P0PA 5GAMh 3KUFA 1U5SA 3OMGA 3PMIA 2BTTA 4QKUA 4J9FA 3CCMA 1I0CA 4JLIA 2YT6A 1YCSB 4RCBA 5GAOn 2CP7A 3FRNA 2VKNA 4RTUA 1VQ6Q 3E2UA 1QVGA 2QEXQ 3OYYA 2RHXA 5GANe 2DMOA 2X3XD 2COWA 2BIVA 2JOYA 3EGUA 2LX9A 3MP1A 2CDTA 1AT1B 1PM3A 1E6HA 2QK0A 3CEYA 4DQ2A 1VQ6A 3QO3A 1B34A 1U1SA 3THKA 4P5NA 1PCXA 2DFUA 5GAOl 2QEXA 4R56A 3CPFA 2QGFB 1H3ZA 2A37A 2L5QA 3EFOA 3NPFA 4ZN3A 3CXCP 1XQHA 2CZ6B 2DXBA 1JJ2A 1BB9A 3MKDA 1B7TA 1KIKA 1SF9A 3JB9J 1VQ9T 3QZ5B 3CC7T 2RQWA 2SEMA 3PGGA 2AKKA 3GOXA 2RF0A 3L1AA 2VV5A 2J6FA 8AT1B 5LJ5j 3URGA 1YJNQ 1RAAB 9ATCB 1RI9A 2YUPA 1NYGA 4OGCA 1K73C 2HNIA 3QDRB 1VQMT 1UHFA 4C92C 1KHCA 1VQ7T 3QYHB 5I2SA 1AWWA 1UECA 5D7UA 2A7YA 1UE9A 1RAEB 4Z02A 1O75A 1SPKA 4ZNXA 3CMAT 2MYSA 1G2BA 4M7DG 1VYUA 1VYTA 2LTOA 3MEUA 4KUDK 5LJ5h 4M78G 2QYZA 4ZTFA 1K9MR 1UUEA 1AVZC 2CKKA 3H6ZA 2OAWA 4J9GA 3EAEA 4C8QG 2XU8A 4LUDA 5KYUA 3OS2A 4BE2A 2J6KA 1WXBA 2QTXA 4RTXA 5GMKm 2ECZA 4BI3A 3CPWP 1KQ1A 2QGGA 5GMKj 1WHHA 1WGSA 2KRNA 3WVDB 2DYIA 2YUQA 2XDBA 4PL6A 4M7AA 2GF7A 5GAN2 2XI9A 4C92D 3EG0A 3LX7A 3RUXA 1Y57A 4OF1A 2CH4W 1WI7A 2MK5A 1YITA 1RI0A 2D8JA 1KC8R 2RNAA 1JO8A 2AIRB 2CH4A 4XAXB 4A4HA 4FT4A 3JCMf 2C0IA 1YJNT 2QQ9A 4J9IA 4AT1B 3DB3A 1RADB 1NBEB 4PJMA 3L2WA 5GMKh 2EIFA 2FG0A 2E4HA 2YRVA 4ANJA 3KXTA 4LDYA 2PVGB 1D0XA 1QVGS 3SWNB 1NEGA 4J9HA 1VQ5T 1YJWA 2FHDA 3GF5A 1S72T 4Z8AA 1F1BB 2OX7A 3CCRQ 1UB4A 3A8LB 3RESA 1PD0A 4CC4B 2DKGA 4J9CA 1OU8A 5CR2A 2K79A 1KQSP 4M7AE 3GP8A 3OYCA 1G3YA 2DTHA 1NJIU 2DJZA 1M8VA 2VYTA 5CIUA 2AK5A 4EMKB 2CS7A 1Q7YU 1PG5B 3U23A 3CCET 4M7DF 1QLYA 3BY7A 4KT0E 4LNPA 4QVDA 1CKBA 3J81E 1QVFP 5A0GA 2DM1A 3D7SB 2KVQG 1K8AU 4JJCA 1YI2T 4M78F 5KE3A 1Y0MA 1JJ2S 1A0NB 3G7ZA 2AKLA 3CCJA 3MP6A 1LCKA 1BKBA 4C8QF 4C0ZA 1IREB 2XDPA 1U3OA 5IAYA 3M0RA 2LQWA 2FRYA 5LJ3f 1T0HA 1YIJT 1M5Q1 4F14A 1WX6A 4XTZA 2Z0WA 2JNGA 4DBHA 2DXCA 3SEMA 4FW2A 4FYXB 3CBOA 4C92G 1UGVA 2A28A 3HTRA 2YSQA 1NLOC 4N0AA 1YWPA 2DRKA 4PFOA 4OMLA 1IZ6A 3RMSA 3NTIA 4OMNA 4RTVA 3UDCA 3G4SQ 1AZGB 2X35A 2DEQA 2DL4A 3E9GA 3OBYA 4A54A 7AT1B 4MZMA 4OP0A 3V8LA 2KGTA 4XK8E 5KYUB 2JUFA 2EKHA 1U8RA 3TQ7P 4J5YA 4HCCA 1NE8A 4E7JA 3I56A 3VUBA 3OSSC 1FMVA 1M30A 2DEUA 3VV0A 2L0AA 2R58A 3I5SA 4F04B 2RA2A 1B3QA 2RQUA 4QVZA 5GAMf 1Q86U 1EFNA 2FPDA 3CCLT 3QJYA 1ACMB 1YJ9T 3CMEQ 2G6FX 2YLCA 1E7OA 1YFNA 1YN8A 5GJVB 4OMFB 5CKFA 2G3RA 4M75A 1ARKA 4NOYA 2EWNA 2EFIA 4JS4A 1GRIA 2ZZDA 2EKOA 3A8GB 3R6NA 1V76A 3V8KA 1SEMA 3CCUT 4E7KA 2DL8A 2F5KA 4FYVB 1WFWA 3TSWA 5DY9A 2KXDA 3CMEA 4EMGA 1BIBA 4JUVA 1QMCA 1VQ4Q 1BCMA 1Z9ZA 3LGFA 4C92F 5CKEA 1NJIC 2PTKA 4KUIA 1Q7YC 1M3CA 5FU6B 2QQRA 2XDDA 1OPKA 1W1FA 3G71Q 2EGCA 4RG2A 1XTDA 1OEBA 3A8MB 2HL3A 4PJJA 1VQLA 3VJPA 3I55Q 4E7HA 2NWMA 4D8KA 1K8AC 5KYXA 2DL7A 4HKEA 2NUZA 2ZPEB 2E10A 2EQUA 4JZ4A 3OYGA 2DD4A 1Y96A 1WNLA 4M75E 1ZSZC 1MV0B 1P92A 4JZ3A 3CD6A 4XTVA 2L3RA 2LDMA 3I55A 4HCBA 4CC2A 2KK4A 2OTJA 2OJ2A 2QQAA 4QQ6A 4XTYA 1G3TA 2KI7A 4QQDA 2F1LA 3F70A 4LDVA 5GJWB 2KRMA 1BBZA 3OYJA 3CBPA 4ELYC 3CCQT 2YWWA 2CZ0B 2XMFA 3L2QA 2ROLA 2L3SA 2OTLT 3MEWA 2L2PA 2FO0A 3HL8A 4M77A 1E6GA 2J7IA 5KYYA 3EG1A 4DA4A 5J3BA 1MGQA 2I2LA 1X6BA 2DK3A 1VQ4T 3N5BB 2RMOA 1IHVA 3ZL7C 1VYVA 3QHSA 4HCZA 2LMJA 4BUGA 1NPRA 1QW1A 1Y7XA 1NM7A 2LC4A 2E1HA 4F7UF 4FSSA 1JBMA 1WZOA 2K3XA 1MNDA 1B07A 4AFQC 4ESRA 5LJ5e 5GAOm 4BDZA 3JSCA 2LT4A 2HSPA 3VS3A 1Q82R 4XU0A 2LJ3A 1VQ8T 2BE9B 2V1QA 3JCMQ 2QDYB 2ROTA 1VQNQ 1BI0A 4ZGEB 1JXOA 4DOVA 3M0SA 5ECAA 3ER0A 2LQNA 1PD1A 3M0UA 2WSEE 2NUPB 2DA9A 4WF2A 1K9MU 2MI6A 1RAIB 2QQSA 4IUUA 3UT1A 2OI3A 1K0SA 4M77E 4E6RA 3JCMW 3VYHB 1M9SA 1VQOQ 3A98A 2QA4A 8ATCB 2DE0X 1Q81C 4FW1A 2M16A 2M1HA 2MIOA 1EX4A 3DLLA 1KQ2A 2KROA 4RG8A 1GFCA 1JEGA 4A4GA 1VQPT 2L8DA 3REBB 3VKIA 3OYNA 1M1GA 1SHGA 1O9SA 3M4YA 2RI5A 4FCYA 2RB6A 5GMKe 3V7SA 3OYMA 1D1AA 2CZ7B 5IXBA 2X4WA 2EYQA 1KC8U 2HMAA 4LN2A
chains in the Genus database with same CATH topology
3CCQA 5GAMg 2LRQA 4C92C 1KHCA 1VQ7T 1N9SA 3BFMA 3QYHB 5I2SA 3ZEHA 3LWHA 3HSBA 2A7YA 3JB9H 3ZFJA 4Z02A 1O75A 3X26B 1I8FA 4ATOA 3NFCA 4C92A 3CMAT 4XU3A 2RH2A 4XU1A 2GFAA 4M7DG 1HXDA 3OW2A 2KDSA 4DOWA 4FIBA 4JDSA 1UGPB 3P8DA 1NPPA 2LTOA 1Q82U 3MEUA 1Y07A 3GLXA 4A4KA 3CMET 2HBPA 4KUDK 3UPUA 4PKCC 4C0GA 5GANh 5LJ5h 4M78G 4ZTFA 4XTXA 2DIGA 4E7LA 3BW1A 3CCJT 5J39A 2ZPFB 2IVWA 4ZTJA 3TREA 1H641 3TEEA 4F7UE 3V7RA 2CKKA 3H6ZA 4C8QG 3OS2A 3EAEA 3QJ6A 2XU8A 3QYGB 4EMHA 3CCST 4BE2A 1W2BS 4M7DB 2QTXA 5I2MA 4M7AC 5GMKm 2HD0A 3EFSA 4BI3A 3JRZA 5LJ3e 1KQ1A 2RD1A 3R6OA 1VQNT 4ME7A 5GMKj 3CCLA 4MMKA 2LNVA 3UWNA 1WGSA 5EG2A 4BB7A 1PSEA 3OQ5A 4M78B 3WVDB 4BY6B 3QG1A 3OS1A 4X9CA 4PNOA 1GXIE 2XDBA 4PL6A 1VQLT 2GF7A 5GANf 3HP9A 5LJ5f 1Q82C 5GAN2 1M1KU 4M7AA 3A5ZB 4C8QB 2XI9A 4NL3A 2DAQA 4C92D 3TCJA 3GNFB 2YHTA 4J7IA 3LX7A 3RUXA 4OF1A 1YHQT 1LNXA 4J83A 3CC4T 4PJOF 5GMKl 3O8VA 3L42A 3ASKA 1YITA 3T9NA 4RCCA 1RI0A 1I5LA 4J6XA 4CI0C 5LL6S 5LJ5d 1QP3A 5GANd 3CC2T 1LJOA 5IT9E 4M77G 4XAXB 3VU3C 4A4HA 3SFMA 4FT4A 3GIBA 3JCMf 4J7FA 2GFUA 4Q5WA 2LT1A 1FWZA 3G71T 1N8RC 1YJNT 4M75F 2B8AA 2E6ZA 4C92E 2QQ9A 3CXCA 2JTMA 4QQGA 3I55T 5FU7B 3DB3A 4ZN1A 1KG1A 1I81A 2K3YA 4OB0B 1VQ9A 3SB2A 1M90U 3LGLA 3X28B 4JLGA 2EIFA 1JRIA 5KH6A 5GMKh 3L2WA 3G4SA 5AYFA 4JRPA 2JVVA 2VGMA 2RJEA 2YRVA 1FXXA 1VIEA 2MF2A 4ZGDB 3KXTA 3L2UA 4M7AD 4LDYA 1QVFA 2VGNA 2C06A 2KQWA 2AHJB 2PVGB 4N4GA 2RK1A 4E7IA 1QVGS 3SWNB 3P8BB 4BACA 2OAUA 1VQ5T 1YJWA 3ME9A 2FHDA 3GF5A 1S72T 3PMTA 2K2VA 1UB4A 3A8LB 1UGQB 5FU6C 2CYZB 4FL6A 3OA6A 3JB9F 3RESA 2O4XB 3RKWA 2DKGA 1VQMA 5GAN7 4HT8A 4IUPA 4QVCA 2DTIA 3C94A 3DKMA 5CKDA 2PU9B 3M55A 4HT9A 5CR2A 3RKXA 3OYLA 5FRNA 5GAN6 3QPHA 3FDRA 3CCVA 4ZGJB 1VQ7A 4M7AE 3GP8A 3OYCA 2PVOB 1BI2A 3VUZA 1G3YA 4C0DC 3FEOA 5CK9A 2DTHA 1NJIU 4PJOB 2XG8D 2DJZA 2EQMA 1M8VA 2VYTA 5CIUA 5GANg 5LJ5g 5HK3A 4EMKB 3JCMJ 3RIRA 2CS7A 1Q7YU 4LD6A 4ELZC 2EQJA 4BE0A 3CMAA 3CCET 4FU6A 4M7DF 3LLRA 3BY7A 4KT0E 4QVDA 5CAIA 1YBYA 3J81E 3WXMB 5A0GA 1PSFA 3FB9A 4M75B 2KVQG 5GAMe 3QSUA 1BYMA 3L2ZA 3DB4A 1K8AU 1YI2T 4M78F 4MMLA 5KE3A 2DZCA 1K9MC 3X25B 1JJ2S 2QQBA 1X01A 2F5TX 1Y71A 3G7ZA 4F7UG 1WJRA 3CCJA 3MP6A 3J80E 5CQXA 1BKBA 4C8QF 5HKCA 4C0ZA 4O6JA 4IKFA 2MMPA 2DXUA 2VXFA 4VUBA 4BDYA 1KD1C 1N27A 1IREB 3CPWA 2XDPA 2V8IA 2QI2A 1R8OB 2HQXA 2V8JA 4MZTA 1BI3A 1X75C 4B9XA 2WSFE 3QIIA 5IAYA 5GAOp 2OTLA 2D6FA 2XD0A 5LJ3f 2R5AA 1YIJT 2RI3A 1M5Q1 2FVUA 5CKBA 3MO8A 4XTZA 1VQ6T 3FC3A 1AHJB 4EPCA 2DIQA 1VQ4A 4BY6C 2WSCE 2JNGA 2QEXT 2E70A 2O01E 1MHNA 2V8KA 2DXCA 4XQ3A 1YHQA 3M9QA 1W4SA 4L6V5 4OB2B 2K5IA 3H8ZA 4C8QC 5GAOq 2MAMA 2E64A 3OB9A 1KC8C 3OYDA 2F69A 3EFRA 4N0AC 4HA8A 3CBOA 3GPLA 2FL7A 2NLUA 4C92G 1XNIA 4LDWA 4C8QA 2ZPGB 5CKHA 2RI2A 3HRUA 3G71A 3OW2S 1WJSA 2VUBA 1N6AA 3M56A 4JRQA 3TU4K 2DPPB 2E5QA 4N0AA 2K5LA 3C12A 1SSFA 2K4YA 2ZPHB 5IN1A 2XKOC 4IUVA 5DLOA 2A3LA 1Y96B 1U1TA 3M53A 4J6YA 3JCMh 3RMQA 1IZ6A 1WQ7A 3NTHA 3NTIA 5FU7C 3RMSA 2M0OA 4C5GA 4C92B 3UDCA 4V2SA 1G3SA 2GCXA 1H3ZA 4C5EA 1FX7A 1VQ8A 1BI1A 2X35A 1VQOT 3NTKA 3CBMA 2PUKB 2CZ1B 3JB9I 3OYKA 1S72A 2DEQA 3E9GA 3OBYA 3HRSA 5DLQE 2CGHA 1ZHIA 4MZPA 2KY9A 2H3JA 3M54A 4A54A 2FB7A 3SWNC 3PTAA 2KMTA 2DXTA 2D0QB 2RO0A 2DZ9A 2IG0A 4MZMA 4OP0A 4C5IA 4OB1B 5KE2A 4M7AG 3V8LA 5GAOr 1G5VA 3A8OB 2ZGWA 4XK8E 5C0MA 2JUFA 1KQSA 3CD6T 3HFOA 4MDXA 1U8RA 3OYEA 2X4YA 3ZBDA 5GAN3 2E41A 1M1KC 4EDUA 3SWNA 5J26A 3QXEB 4J5YA 4N4IA 3G6EA 3MP8A 3CC7A 3HFNA 3PFSA 4HCCA 1NE8A 3LWIA 2RJCA 3I56A 3L2RA 4E7JA 2OTJT 2GQVA 3VUBA 2MWPA 4M77B 4L59A 4NL2A 4PJOC 1NZ9A 2O4XA 2RHYA 3OSSC 3JCMd 5LJ3j 4RMOA 1OYXA 1VQPA 3BDUA 4X9DA 3FIFA 4EMKC 1X6OA 2RHUA 2P4TA 3CXCS 3VV0A 2R58A 1YI2A 4TVRA 3OYAA 3RERA 4C8QE 1VIFA 2RA2A 2X4JA 4PJOA 2RHZA 4QVZA 5GAMf 1Q86U 4JS5A 3CCLT 3QJYA 3OYFA 3PIOA 3M58A 4IUQA 4M75C 2K5FA 1YJ9T 2YLCA 4EMKA 3META 2DVEA 3OMCA 5GMKi 4OMFB 5CKFA 2R5MA 2Y4YA 1M90C 3P8HA 1VQKT 1QVFS 1D3BA 2L89A 2HAXA 2G3RA 4M75A 4QW2A 3VYGA 3L2VA 2JTFA 4NOYA 3HRTA 5FLXE 2EWNA 3FLGA 5CCAA 2EFIA 4JS4A 2ZZDA 2EKOA 3A8GB 3MEVA 2VC8A 1YITT 3M4GA 3CCMT 3V8KA 2RM4A 4JRIA 4XTWA 5CO7A 3CCUT 4E7KA 4NS5A 2F5KA 1M4ZA 5GAN5 3QKJA 1Q86C 4BI4A 5D6WA 5LJ3h 4JJNK 5DY9A 3CMEA 4EMGA 1BIBA 4JUVA 2K57A 4Y91A 1K73U 4C5HA 2EJGA 3MHXA 1WPYA 2LVMA 3C95A 2RK2A 3HPWA 4OGEA 1I4K1 2VXEA 3V7CA 2D9TA 4PJOD 2ZPBB 1TH7A 1B34B 3LGFA 1DJ7B 1WQWA 2ZCFB 2M9UA 3JCMg 4A53A 4C92F 5CKEA 1VQKA 3Q1JA 2Y4XA 3CCSA 3S6WA 1NJIC 3E19A 3LW5E 4LD9K 4FSXA 2WACA 4KUIA 1Q7YC 1VQNA 4OB3B 4BD3A 1LOJA 5FU6B 1N9RA 2QQRA 2YLBA 2XDDA 1V29B 2E6NA 4IUTA 5L8RE 4M7DC 4F7UB 4M75D 2PVDB 5HY6A 4IURA 2LCLA 4RG2A 1XTDA 3M5AA 3A8MB 4J8OA 3JCMV 2XIDA 3VJPA 1VQLA 5C6SA 3AHUA 4E7HA 2EQKA 1K8AC 4PJOE 4M78C 3PT9A 2BUDA 2JN0A 2P0KA 3SD4A 3X24B 4HKEA 4LDXA 4M7DA 1VQOA 3CC4A 4KBMB 3CPWS 2ZPEB 4L5GA 5GAN4 2E10A 2EQUA 3OYGA 3A8HB 2DD4A 5LJ3d 1KHIA 4LDUA 3OYIA 3CCVT 2R57A 3FJPA 4C0FA 4M78A 4R55A 3OSVA 2QA4T 2DTOA 4M77F 3OYBA 1Y96A 1WNLA 4OVAA 3CC2A 4M75E 4M7AF 3MEAA 4Y28E 3X20B 1P92A 3QBYA 4GLKA 5GAMj 3JB9D 3JCMP 5FRMA 1ZBXA 5D6XA 1YJNA 3CD6A 4XTVA 2EAYA 1W2BA 2L3RA 2LDMA 4E47A 1BIAA 3I55A 4HCBA 4MDWA 4J6WA 5A0DA 3CCRT 3M59A 2FYKA 4CRIA 4N4HA 3BDLA 3HKSA 1XOVA 2KK4A 2OTJA 2E65A 2QQAA 1YCYA 3J7AF 2JZ2A 3QUIA 5A0LA 4B9WA 4QQ6A 4XTYA 1G3TA 5CQYA 3V8JA 1VUBA 4QQDA 3F70A 4LDVA 2P0QA 3OYJA 2PQWA 1VQ5A 4M7DD 4M77C 3CBPA 4ELYC 3CCQT 1UGSB 3JAME 5KCOA 3JCMc 2CZ0B 2RJFA 2XK0A 3L2QA 1UEBA 2OTLT 2LQ8A 3MEWA 2EJ9A 4M78D 1YJ9A 1N8RU 2RJDA 2MWOA 3HL8A 4M77A 5I21A 4RKUE 4DA4A 5J3BA 1MGQA 3S3NA 3LYIA 2XHCA 4C8QD 2I2LA 1WJQA 2DK3A 2P0PA 3M57A 5GAMh 1VQ4T 5LJ3g 3KUFA 1JB0E 3N5BB 3DLMA 4M7DE 5FROA 1EIFA 3OMGA 3QZ9B 3PMIA 1G3WA 1OI1A 2ZPIB 1M1FA 3S3MA 3QHSA 3CCEA 4M7AB 3CCMA 1OZ3A 3CCUA 4JLIA 4HCZA 3OS5A 4M78E 4RCBA 3E1SA 4BUGA 1NPRA 5GAOn 1QW1A 3FRNA 3OY9A 1Y7XA 3JCMb 4A4FA 1KQSS 3WVEB 1HK9A 2LCCA 1ZQ1A 3PNWC 2LC4A 2E1HA 4F7UF 1QVGA 1QP2A 3OYYA 2RHXA 1JBMA 2K3XA 2PUOB 5GANe 3LH0A 5LJ5e 3RKYA 5GAOm 2HQEA 4BDZA 3JSCA 2LT4A 2BIVA 4M77D 2JOYA 5CVIA 3INZA 2LX9A 4A4EA 4XU0A 3MP1A 3KBGA 1Q81U 1VQ8T 2DD5A 4UC4A 5GAMd 3JCMQ 3OYHA 1YIJA 2QDYB 3CEYA 4PJOG 4DQ2A 1BI0A 4ZGEB 2BKDN 4DOVA 1VQ6A 1K73C 3ER0A 5A2QE 3QO3A 3HHTB 1B34A 5GAN8 1U1SA 3JCMe 4P5NA 2X4XA 2QEXA 5GAOl 2WSEE 4PLIA 4R56A 1K9MU 1RL2A 4WF2A 2MI6A 3CPFA 4XTUA 2QQSA 4GY5A 4IUUA 3SDZA 3UT1A 3E9FA 2L5QA 5DM7R 1QVPA 3OS0A 3JCMX 4M77E 4BE1A 3JCMW 3VYHB 4ZN3A 4M75G 4PLLA 1M9SA 1XQHA 2CZ6B 2DXBA 3GNGA 4F7UA 2QA4A 1JJ2A 4II1A 3JB9J 3G6ET 3QZ5B 1VQ9T 1KD1U 3CC7T 3G4ST 3PGGA 3GOXA 1Q81C 3I56T 2M16A 2M1HA 4O5VA 3S3OA 2Y90A 3DLLA 1KQ2A 1OZ2A 4RG8A 2E12A 4XU2A 2XICA 3L1AA 2VV5A 4KULA 4A4GA 5HK0A 1VQPT 2L8DA 1D3BB 5KCHA 3CCRA 3VKIA 4X34A 5LJ5j 3MCAB 1M1GA 3C4SA 3URGA 4BI8B 3OYNA 5GANj 1O9SA 2KAFA 3M4YA 1YJWT 2LQKA 4FM4B 2RI5A 4FT2A 3PIPA 2QXFA 2RB6A 4JRKA 1UGRB 5GMKe 2KSSA 4OGCA 2HNIA 2DO3A 2CZ7B 5D6YA 5M9OA 3OYMA 3JB9G 3QDRB 2RHIA 4C0DB 2X4WA 2EYQA 1VQMT 3OBWA 1KC8U 2EJFA 3V7SA 4YTLA 4D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R56 A;  3KXT A;  4R55 A;  2JTM A;  3LWI A;  3LWH A; 
#chains in the Genus database with same CATH topology
 2LRQ A;  2HKN A;  1TSF A;  1N9S A;  3BFM A;  3ZEH A;  4E7S A;  1CSK A;  3LWH A;  3HSB A;  1C0M A;  4WCI A;  3JB9 H;  3ZFJ A;  1NEB A;  4ATO A;  3NFC A;  4RTZ A;  2RH2 A;  1HXD A;  3UF4 A;  4FIB A;  4KRT A;  4JDS A;  1UGP B;  3P8D A;  1NPP A;  4A4K A;  4PKC C;  4C0G A;  1VA7 A;  4XTX A;  1IXD A;  4E7L A;  1X2Q A;  3TRE A;  1H64 1;  2HCK A;  3QYG B;  3VRZ A;  3CCM Q;  4M7A C;  5FW9 A;  3JRZ A;  2RD1 A;  4X1V A;  1VQN T;  3UWN A;  3TSZ A;  5EG2 A;  2KR3 A;  3QG1 A;  1QKX A;  4PNO A;  2COY A;  5GAN f;  3HP9 A;  3OW2 P;  2YHT A;  4J7I A;  1YHQ T;  4J83 A;  3L42 A;  4B6M A;  3ASK A;  4RCC A;  4AFU C;  2NUT A;  4CI0 C;  3CC2 T;  3SFM A;  3GIB A;  3TVT A;  2D0N A;  2LT1 A;  2HQH A;  2B8A A;  2E6Z A;  2ATC B;  2JTM A;  3EG9 A;  4OB0 B;  2K3Y A;  1VQ9 A;  1JRI A;  2V26 A;  2JVV A;  1TS9 A;  3EHQ A;  1FXX A;  4M7A D;  1QVF A;  2C06 A;  2AHJ B;  2RK1 A;  1PC0 A;  3ME9 A;  4LXC A;  2YDL A;  5FU6 C;  4FL6 A;  3OA6 A;  2O4X B;  1VQM A;  4HT8 A;  1PNJ A;  4QVC A;  5CKD A;  3RDV A;  3QPH A;  3FDR A;  3CCV A;  1VQ7 A;  3VS4 A;  3VUZ A;  5CK9 A;  4C0D C;  1SKU B;  1M1K R;  5GAN g;  5HK3 A;  2RPN A;  1IHW A;  4ELZ C;  2EQJ A;  1SSH A;  3CMA A;  1ZBJ A;  2C0O A;  1YBY A;  1PSF A;  3QSU A;  2AZV A;  1BYM A;  3L2Z A;  3DB4 A;  3EGD B;  1K9M C;  4Z89 A;  3RBB B;  2F5T X;  1WJR A;  5CQX A;  4IKF A;  4VUB A;  4BDY A;  1N27 A;  2V8I A;  1M90 R;  2HQX A;  4B9X A;  5KYW B;  3QII A;  2XD0 A;  3M0Q A;  1JQQ A;  1X2K A;  4HCK A;  3MO8 A;  3NHN A;  1VQ6 T;  3FC3 A;  1QQJ A;  4BY6 C;  2QEX T;  1FMW A;  2K5I A;  3H8Z A;  5GAO q;  1KC8 C;  2F2V A;  1KK7 A;  4N0A C;  1IGU A;  2FL7 A;  1YIT Q;  1XNI A;  4C8Q A;  2DF6 A;  2EW3 A;  1WJS A;  3M56 A;  3JV3 A;  3TU4 K;  2KBT A;  3C12 A;  5I22 A;  2XKO C;  3M53 A;  1WQ7 A;  3NTH A;  5FU7 C;  1AOJ A;  3G6E Q;  1BI1 A;  3QWX X;  1D0Y A;  1ZSZ B;  2P84 A;  2DIL A;  3OYK A;  1ZUY A;  1S72 A;  1D1B A;  1QWE A;  3QDF A;  5DLQ E;  3M0T A;  1QCO A;  2KY9 A;  1MMA A;  1YJW Q;  1H92 A;  2D0Q B;  4M7A G;  4C5I A;  2CP2 A;  5GAO r;  1G5V A;  2KT1 A;  3A8O B;  2I0N A;  5C0M A;  4MDX A;  2X4Y A;  3ZBD A;  5GAN 3;  2FRW A;  4EDU A;  3G6E A;  1YWO A;  3LWI A;  4HVV A;  2ENM A;  2GQV A;  4GLM A;  2MWP A;  4NL2 A;  2JJ9 A;  1X6O A;  2RHU A;  1RLQ C;  1YI2 A;  3RER A;  4C8Q E;  4PJO A;  3OYF A;  3PIO A;  4M75 C;  2NUT B;  2DVE A;  5GMK i;  1H3H A;  2R5M A;  3CCJ Q;  1QVF S;  1PRM C;  2L89 A;  2HAX A;  4QW2 A;  3VYG A;  3L2V A;  3SHW A;  1GCQ A;  2JTF A;  3EH1 A;  3MEV A;  2VC8 A;  1YIT T;  2YUO A;  1TUG B;  5EC7 A;  4PJN A;  2JMC A;  1OU9 A;  2J06 A;  2K57 A;  2ZAE A;  2LVM A;  2RK2 A;  3HPW A;  2VXE A;  2ED1 A;  3V7C A;  3CC4 Q;  1B34 B;  3JCM g;  1VQK A;  3CCS A;  1J3T A;  3E19 A;  4FYW B;  3LW5 E;  3EFO B;  4LD9 K;  4FSX A;  2WAC A;  4QT7 A;  2CUD A;  3H0H A;  4BD3 A;  1LOJ A;  2CSI A;  1M3A A;  1SRL A;  4M75 D;  4IUR A;  4J8O A;  2JTE A;  5C6S A;  4PJO E;  3PT9 A;  2BUD A;  2P0K A;  3SD4 A;  3CC4 A;  2LNH B;  3BE3 A;  4L5G A;  2K3B A;  2EGA A;  1U06 A;  2YXY A;  2R57 A;  3FJP A;  3OSV A;  4OVA A;  4M7A F;  3MEA A;  1GFD A;  4GLK A;  1WIE A;  5FRM A;  1ZBX A;  2KT8 A;  2VWF A;  1BIA A;  5A0D A;  3CCR T;  3M59 A;  5FWB A;  3BDL A;  3HKS A;  1XOV A;  1T3L A;  1OX9 A;  1GBR A;  5A0L A;  2VB6 A;  4B9W A;  3MJX A;  3V8J A;  1WYX A;  1RAG B;  3I56 Q;  2P0Q A;  4M77 C;  1UGS B;  1WHL A;  3JCM c;  2A0F B;  2A36 A;  2JMA A;  1Q95 G;  1YJ9 A;  5I21 A;  2GQI A;  1WJQ A;  1W2B P;  5LJ3 g;  4RTT A;  1JB0 E;  3DLM A;  1EIF A;  1OI1 A;  2ZPI B;  4OMM A;  2CSQ A;  1RUW A;  3S3M A;  2DX1 A;  1X43 A;  4M7A B;  3MPU B;  3CCU A;  3OY9 A;  4A4F A;  1LVK A;  3WVE B;  1HK9 A;  3PNW C;  1M8M A;  2B86 A;  1MUZ A;  2PUO B;  1SG5 A;  3LH0 A;  3RKY A;  1TUD A;  2K9G A;  2HQE A;  2KE9 A;  2BZY A;  4M77 D;  3INZ A;  4A4E A;  1Q81 U;  3KBG A;  2DD5 A;  2CP6 A;  3QWY A;  2BKD N;  5A2Q E;  3HHT B;  2IIM A;  2X4X A;  3VRY A;  3GBQ A;  4PLI A;  2DRM A;  1VQL Q;  1ZX6 A;  4XTU A;  4GY5 A;  3SDZ A;  3OS0 A;  1OV3 A;  3CQT A;  3JCM X;  1N8R R;  4M75 G;  3I9Q A;  4PLL A;  3GNG A;  4F7U A;  1I5O B;  3G4S T;  3I56 T;  3VS6 A;  3VS7 A;  2Y90 A;  1YNZ A;  5KCH A;  4X34 A;  3MCA B;  3CD6 Q;  2KAF A;  1S1N A;  4FT2 A;  2QXF A;  4JRK A;  4LE9 A;  2KSS A;  2JM9 A;  4C0D B;  2OTJ Q;  4E7Z A;  4D6W A;  4IIO A;  3CCQ A;  5GAM g;  1MMN A;  2CP0 A;  2X9H A;  2LCS A;  1ZUK A;  1ZA1 B;  3X26 B;  2LJ0 A;  2M02 A;  4XU3 A;  1ZSG A;  2LP5 A;  3OW2 A;  3RNJ A;  1IRX A;  1BK2 A;  3RR6 A;  3CME T;  1XJW B;  2HZY A;  2ZPF B;  1WHM A;  4ZTJ A;  3TEE A;  4E2F B;  4F7U E;  3V7R A;  1EZZ B;  3QJ6 A;  4EMH A;  2HD0 A;  3EFS A;  1KD1 R;  1NYF A;  4ME7 A;  2P4R A;  4RUG A;  1MMG A;  4MMK A;  1KJW A;  1D09 B;  1PSE A;  3OQ5 A;  4BY6 B;  1GCP A;  1OUL A;  2D1X A;  1GXI E;  1OX8 A;  1VQL T;  4KGX B;  1M1K U;  5LJ5 f;  1Q82 C;  4PK4 A;  3A5Z B;  5IXF A;  1TU0 B;  1K0X A;  2QTV A;  1AD5 A;  2GTJ A;  3O8V A;  1MNE A;  1I5L A;  2CP3 A;  3UA6 A;  5GAN d;  5LL6 S;  1LJO A;  5IT9 E;  4M77 G;  2GFU A;  4Q5W A;  3G71 T;  1TXQ A;  4M75 F;  2MCN A;  3CXC A;  4QQG A;  5IHK A;  3I55 T;  5FU7 B;  3SB2 A;  1M90 U;  2DBM A;  1WHG A;  5KH6 A;  2QA4 Q;  2VGM A;  1PKS A;  3L2U A;  1VIE A;  2QDL A;  4R0K A;  2KQW A;  4N4G A;  1OOT A;  4E7I A;  2RQV A;  1R0C B;  2OAU A;  2K2V A;  1UGQ B;  2CYZ B;  2ABL A;  3RKW A;  2JS0 A;  1MV3 A;  5GAN 7;  2DNU A;  3C94 A;  2PU9 B;  3M55 A;  3OYL A;  4KGZ B;  3FEO A;  2EQM A;  5LJ5 g;  3RIR A;  2KYB A;  4BE0 A;  4FU6 A;  4JJB A;  3LLR A;  5CAI A;  3FB9 A;  4M75 B;  1AWO A;  1K1Z A;  2DZC A;  2QQB A;  1X01 A;  1Y71 A;  2FZK B;  2O9S A;  3J80 E;  1UG1 A;  5HKC A;  4O6J A;  1UJ0 A;  2HL5 C;  2DXU A;  2W0Z A;  3CPW A;  2QI2 A;  1R8O B;  2V8J A;  1BI3 A;  1X75 C;  2WSF E;  2D6F A;  1UDL A;  2LZ6 B;  2R5A A;  1GL5 A;  2FPE A;  2RI3 A;  1BCO A;  1AHJ B;  4EPC A;  1AEY A;  2DIQ A;  1YHQ A;  2O01 E;  1MHN A;  3VS1 A;  3PVL A;  4KGV B;  1NG2 A;  1UFF A;  1W4S A;  4OB2 B;  1Q86 R;  4C8Q C;  1D0Z A;  3AT1 B;  2F69 A;  3EFR A;  6AT1 B;  1WA7 A;  5KYX B;  3GPL A;  1RAH B;  4LDW A;  2ZPG B;  2RI2 A;  3HRU A;  3OW2 S;  1N6A A;  4DBR A;  2DPP B;  1SSF A;  2K4Y A;  2ZPH B;  5DLO A;  1M3B A;  1RAF B;  1Y96 B;  2NYS A;  1U1T A;  4J6Y A;  4AG2 C;  2GTO A;  4V2S A;  2DL5 A;  2M0O A;  1X6G A;  1VQ9 Q;  1G3S A;  2GCX A;  3CC7 Q;  4C5E A;  1FX7 A;  1VQO T;  3CBM A;  2KYM A;  2CZ1 B;  2VAS A;  1NLP C;  3IQL A;  3HRS A;  2CGH A;  2DLP A;  2H3J A;  3M54 A;  2KMT A;  2DXT A;  2YRC A;  2DZ9 A;  2HBW A;  2IG0 A;  2RO0 A;  5KE2 A;  1X27 A;  4OB1 B;  2ZGW A;  1KQS A;  4Z88 A;  2FZG B;  4J9E A;  1VQM Q;  3OYE A;  1M1K C;  2E41 A;  3SWN A;  1WXU A;  4N4I A;  3CC7 A;  3HFN A;  3CCV Q;  3G1J A;  3UA7 A;  1VQ7 Q;  2V1R A;  2KXC A;  4M77 B;  5KYY B;  4PJO C;  3JCM d;  4RMO A;  4K11 A;  2KEA A;  5AT1 B;  2EYZ A;  1OYX A;  3BDU A;  1SRM A;  3FIF A;  1R0B G;  3CXC S;  3CMA Q;  3OYA A;  1VIF A;  2X4J A;  4JS5 A;  3M58 A;  1GCQ C;  2PZ1 A;  4EMK A;  3OMC A;  2Y4Y A;  1M90 C;  1YP5 A;  1G8X A;  2EBP A;  1SHF A;  4OMQ A;  1D3B A;  4PJL A;  1K9A A;  4DBF A;  3HRT A;  5FLX E;  3FLG A;  5CCA A;  4RTW A;  4CC3 A;  2EYX A;  1G83 A;  3M4G A;  3CCM T;  2RM4 A;  4JRI A;  5CO7 A;  4NS5 A;  2E3H A;  5GAN 5;  4BI4 A;  4JJN K;  1RAC B;  2DER A;  4C5H A;  1WPY A;  3C95 A;  1KFZ A;  1I4K 1;  4PJO D;  1TH7 A;  1DJ7 B;  4AFZ C;  2RN8 A;  3Q1J A;  3S6W A;  4OB3 B;  1N9R A;  2DVJ A;  2YLB A;  5L8R E;  4IUT A;  4ORZ A;  2PVD B;  2F2W A;  2LCL A;  3JCM V;  2XID A;  2SRC A;  2EQK A;  1CKA A;  2KRS A;  4LDX A;  4M7D A;  3CPW S;  1D1C A;  5GAN 4;  5LJ3 d;  1KHI A;  2H3E B;  3OYI A;  3CCV T;  1MMD A;  4M78 A;  4R55 A;  1BU1 A;  2DTO A;  1HSQ A;  3OYB A;  1VQ5 Q;  5IHI A;  1S72 Q;  4Y28 E;  3X20 B;  3QBY A;  3JB9 D;  1IO6 A;  3JCM P;  1ZUU A;  5D6X A;  1YJN A;  4EIK A;  1W2B A;  3PE0 A;  4J6W A;  2BE7 D;  4CC7 A;  2FYK A;  1VOM A;  4HXJ A;  1YCY A;  3J7A F;  3QUI A;  2HSE B;  2E5K A;  5CQY A;  2EVR A;  1VUB A;  4D8D A;  1K73 R;  4M4Z A;  4A63 B;  1VQ5 A;  3CCE Q;  4PFP A;  5KCO A;  1UEB A;  2EJ9 A;  1N8R U;  1YI2 Q;  2MWO A;  2HKQ B;  1HJD A;  4RKU E;  3LYI A;  3M0P A;  3M57 A;  1C6V X;  1M2V A;  1HD3 A;  2RQT A;  4M7D E;  2O31 A;  5FRO A;  3QZ9 B;  1G3W A;  1M1F A;  2EGE A;  3ULR B;  2YRD A;  3CCE A;  3PVQ A;  2COZ A;  1OZ3 A;  3OS5 A;  4M78 E;  3E1S A;  1YIJ Q;  1KQS S;  3JCM b;  2LCC A;  1ZQ1 A;  2QAS A;  1V1C A;  1QP2 A;  1R77 A;  1TWB A;  1M2O A;  1T3S A;  2DBK A;  1WLP B;  5CVI A;  1VQK Q;  3CCS Q;  3H41 A;  4UC4 A;  3NMZ C;  3EG9 B;  1I1J A;  5GAM d;  3OYH A;  1YIJ A;  4PJO G;  2JW4 A;  4KH1 B;  5GAN 8;  3JCM e;  3EGX A;  1WHK A;  1RL2 A;  5DM7 R;  3E9F A;  1QVP A;  1LPL A;  1W6X A;  4BE1 A;  1QVG P;  2DL3 A;  3KFV A;  4II1 A;  1KD1 U;  3G6E T;  4O5V A;  2JT4 A;  3S3O A;  1OZ2 A;  2E12 A;  4XU2 A;  2XIC A;  2DYB A;  4KUL A;  5HK0 A;  3CCR A;  1D3B B;  5GAN j;  3C4S A;  4BI8 B;  3A1P A;  1YJW T;  2LQK A;  4FM4 B;  3PIP A;  1WHJ A;  1UGR B;  3LH5 A;  2DO3 A;  5D6Y A;  5M9O A;  3JB9 G;  2RHI A;  3OBW A;  2EJF A;  4YTL A;  2AT1 B;  3VS5 A;  1JJ2 P;  1PKT A;  3EG3 A;  4KH0 B;  1I8F A;  1IGQ A;  4C92 A;  3CCL Q;  4Y92 A;  1Z9Q A;  4XU1 A;  2GFA A;  1YJ9 Q;  4WTO B;  2KDS A;  4DOW A;  1Q82 U;  2CP5 A;  1Y07 A;  3GLX A;  2O9V A;  2HBP A;  3UPU A;  2M51 A;  5GAN h;  4J9D A;  2DIG A;  1ZA2 B;  3BW1 A;  5KYN A;  3CCJ T;  5J39 A;  2IVW A;  1KSW A;  2M0Y A;  1VQK T;  2CUB A;  1W2B S;  4M7D B;  4HVU A;  3CCS T;  5I2M A;  3CCU Q;  5LJ3 e;  3H0I A;  2DJQ A;  3R6O A;  3CCL A;  2LNV A;  4BB7 A;  4M78 B;  2EPD A;  3OS1 A;  4X9C A;  3O5Z A;  5FWC A;  2FEI A;  4C8Q B;  4NL3 A;  2DAQ A;  3TCJ A;  3GNF B;  2MPX C;  1LNX A;  3CC4 T;  4PJO F;  5GMK l;  3EH2 A;  4RTY A;  3T9N A;  4J6X A;  5LJ5 d;  1QP3 A;  1UTI A;  3VU3 C;  2H8H A;  4J7F A;  1FWZ A;  2JS2 A;  1N8R C;  2J05 A;  4C92 E;  2HEQ A;  2YUN A;  4ZN1 A;  1KG1 A;  1I81 A;  3LGL A;  3X28 B;  4JLG A;  4JJD A;  3G4S A;  5AYF A;  4JRP A;  2RJE A;  2MF2 A;  4ZGD B;  2L3Q A;  2NUP A;  1QWF A;  2VGN A;  2O2O A;  1ABO A;  1M2V B;  3P8B B;  4BAC A;  3PMT A;  2D8H A;  3VS0 A;  1PWT A;  1TUC A;  3JB9 F;  1M27 C;  4IUP A;  2DTI A;  3DKM A;  4HT9 A;  5FRN A;  3RKX A;  5GAN 6;  2FPF A;  1AWX A;  4ZGJ B;  4J9B A;  2PVO B;  2GGR A;  2EYY A;  1BI2 A;  2A08 A;  4PJO B;  2XG8 D;  3CCQ Q;  2GNC A;  3JCM J;  2AZS A;  4LD6 A;  2OTL Q;  2BZ8 A;  2LX7 A;  3WXM B;  5GAM e;  2O88 A;  2W10 A;  4MML A;  1UHC A;  3X25 B;  1WXT A;  2PNI A;  4DEY A;  1H8K A;  2J6O A;  4F7U G;  1TOV A;  3FJ5 A;  1ZLM A;  1HYO A;  2QG9 B;  1QCF A;  2KNB B;  3EGX B;  2MMP A;  2VXF A;  1KD1 C;  3VS2 A;  2QAZ A;  4MZT A;  2IPO B;  2OTL A;  5GAO p;  4F16 A;  2FVU A;  5CKB A;  2C0T A;  1VQ4 A;  1QCN A;  2WSC E;  2E70 A;  4XQ3 A;  2V8K A;  3M9Q A;  4L6V 5;  2MOX A;  2F2X A;  2MAM A;  2E64 A;  3OB9 A;  3UAT A;  1WDX A;  2DET A;  3OYD A;  1VQ8 Q;  4HA8 A;  1FYN A;  4JPB W;  2NLU A;  5CKH A;  3G71 A;  2VUB A;  4IIM A;  4JRQ A;  1NJI R;  1ABQ A;  2E5Q A;  2JM8 A;  2K5L A;  1K4U S;  1Q7Y R;  1OQK A;  1AZE A;  5IN1 A;  4IUV A;  2A3L A;  3JCM h;  1OPL A;  3RMQ A;  4C5G A;  4C92 B;  2K2M A;  1K8A R;  1VQ8 A;  3NTK A;  2PUK B;  3JB9 I;  1C1A A;  4DBQ A;  3NGP A;  3REA B;  1VQP Q;  5IHN A;  2HDA A;  1ZHI A;  4MZP A;  1PRL C;  2FB7 A;  3SWN C;  3PTA A;  2L3P A;  3H9N A;  1I07 A;  3CD6 T;  3HFO A;  5J26 A;  3QXE B;  1AWJ A;  3MP8 A;  3PFS A;  4AG1 C;  2RJC A;  3L2R A;  2OTJ T;  4L59 A;  2FZC B;  1NZ9 A;  2O4X A;  2RHY A;  3C0C A;  5LJ3 j;  1VQP A;  3H0F A;  2VVK A;  4X9D A;  4EMK C;  2P4T A;  4TVR A;  2CT3 A;  2RHZ A;  1GBQ A;  2K7A A;  1IB8 A;  4IUQ A;  2K5F A;  3EHR A;  5I11 A;  3MET A;  2K6D A;  3P8H A;  5L23 A;  2EQI A;  2CT4 A;  3EG2 A;  3EGD A;  2X51 A;  1TG0 A;  2JXB A;  1W70 A;  2CRE A;  1QKW A;  4XTW A;  1UJY A;  4AMC A;  5IH2 A;  1M4Z A;  1Q86 C;  3QKJ A;  5D6W A;  5LJ3 h;  4Y91 A;  1K73 U;  2EJG A;  3MHX A;  5KYW A;  4OGE A;  1YHQ Q;  1RAB B;  2D9T A;  2ZPB B;  1WQW A;  2ZCF B;  2M9U A;  4A53 A;  2Y4X A;  4OMP A;  1RLP C;  1JU5 C;  3CC2 Q;  2BZX A;  1T0J A;  1VQN A;  1V29 B;  2E6N A;  4M7D C;  4F7U B;  5HY6 A;  2LJ1 A;  3M5A A;  1PHT A;  1TTH B;  3AHU A;  4OMO A;  4M78 C;  2JN0 A;  3X24 B;  2RQR A;  1VQO A;  2E3I A;  4KBM B;  3I5R A;  3A8H B;  1FMK A;  4LDU A;  4C0F A;  3I35 A;  2QA4 T;  4M77 F;  3CC2 A;  1K76 A;  4PFZ A;  5GAM j;  2X3W D;  1Q81 R;  2EAY A;  4E47 A;  4FYY B;  4MDW A;  1N5Z A;  1ZSZ A;  4CRI A;  4N4H A;  2E65 A;  2JZ2 A;  4F17 A;  2EYW A;  4DEX A;  2GBQ A;  4AFS C;  2PQW A;  4M7D D;  1X69 A;  2ED0 A;  3JAM E;  4LUE A;  2RJF A;  2XK0 A;  4GBQ A;  2ESW A;  2LQ8 A;  4M78 D;  2RJD A;  1JXM A;  4HVW A;  5HCK A;  3S3N A;  2XHC A;  4C8Q D;  2P0P A;  5GAM h;  3KUF A;  1U5S A;  3OMG A;  3PMI A;  2BTT A;  4QKU A;  4J9F A;  3CCM A;  1I0C A;  4JLI A;  2YT6 A;  1YCS B;  4RCB A;  5GAO n;  2CP7 A;  3FRN A;  2VKN A;  4RTU A;  1VQ6 Q;  3E2U A;  1QVG A;  2QEX Q;  3OYY A;  2RHX A;  5GAN e;  2DMO A;  2X3X D;  2COW A;  2BIV A;  2JOY A;  3EGU A;  2LX9 A;  3MP1 A;  2CDT A;  1AT1 B;  1PM3 A;  1E6H A;  2QK0 A;  3CEY A;  4DQ2 A;  1VQ6 A;  3QO3 A;  1B34 A;  1U1S A;  3THK A;  4P5N A;  1PCX A;  2DFU A;  5GAO l;  2QEX A;  4R56 A;  3CPF A;  2QGF B;  1H3Z A;  2A37 A;  2L5Q A;  3EFO A;  3NPF A;  4ZN3 A;  3CXC P;  1XQH A;  2CZ6 B;  2DXB A;  1JJ2 A;  1BB9 A;  3MKD A;  1B7T A;  1KIK A;  1SF9 A;  3JB9 J;  1VQ9 T;  3QZ5 B;  3CC7 T;  2RQW A;  2SEM A;  3PGG A;  2AKK A;  3GOX A;  2RF0 A;  3L1A A;  2VV5 A;  2J6F A;  8AT1 B;  5LJ5 j;  3URG A;  1YJN Q;  1RAA B;  9ATC B;  1RI9 A;  2YUP A;  1NYG A;  4OGC A;  1K73 C;  2HNI A;  3QDR B;  1VQM T;  1UHF A;  4C92 C;  1KHC A;  1VQ7 T;  3QYH B;  5I2S A;  1AWW A;  1UEC A;  5D7U A;  2A7Y A;  1UE9 A;  1RAE B;  4Z02 A;  1O75 A;  1SPK A;  4ZNX A;  3CMA T;  2MYS A;  1G2B A;  4M7D G;  1VYU A;  1VYT A;  2LTO A;  3MEU A;  4KUD K;  5LJ5 h;  4M78 G;  2QYZ A;  4ZTF A;  1K9M R;  1UUE A;  1AVZ C;  2CKK A;  3H6Z A;  2OAW A;  4J9G A;  3EAE A;  4C8Q G;  2XU8 A;  4LUD A;  5KYU A;  3OS2 A;  4BE2 A;  2J6K A;  1WXB A;  2QTX A;  4RTX A;  5GMK m;  2ECZ A;  4BI3 A;  3CPW P;  1KQ1 A;  2QGG A;  5GMK j;  1WHH A;  1WGS A;  2KRN A;  3WVD B;  2DYI A;  2YUQ A;  2XDB A;  4PL6 A;  4M7A A;  2GF7 A;  5GAN 2;  2XI9 A;  4C92 D;  3EG0 A;  3LX7 A;  3RUX A;  1Y57 A;  4OF1 A;  2CH4 W;  1WI7 A;  2MK5 A;  1YIT A;  1RI0 A;  2D8J A;  1KC8 R;  2RNA A;  1JO8 A;  2AIR B;  2CH4 A;  4XAX B;  4A4H A;  4FT4 A;  3JCM f;  2C0I A;  1YJN T;  2QQ9 A;  4J9I A;  4AT1 B;  3DB3 A;  1RAD B;  1NBE B;  4PJM A;  3L2W A;  5GMK h;  2EIF A;  2FG0 A;  2E4H A;  2YRV A;  4ANJ A;  3KXT A;  4LDY A;  2PVG B;  1D0X A;  1QVG S;  3SWN B;  1NEG A;  4J9H A;  1VQ5 T;  1YJW A;  2FHD A;  3GF5 A;  1S72 T;  4Z8A A;  1F1B B;  2OX7 A;  3CCR Q;  1UB4 A;  3A8L B;  3RES A;  1PD0 A;  4CC4 B;  2DKG A;  4J9C A;  1OU8 A;  5CR2 A;  2K79 A;  1KQS P;  4M7A E;  3GP8 A;  3OYC A;  1G3Y A;  2DTH A;  1NJI U;  2DJZ A;  1M8V A;  2VYT A;  5CIU A;  2AK5 A;  4EMK B;  2CS7 A;  1Q7Y U;  1PG5 B;  3U23 A;  3CCE T;  4M7D F;  1QLY A;  3BY7 A;  4KT0 E;  4LNP A;  4QVD A;  1CKB A;  3J81 E;  1QVF P;  5A0G A;  2DM1 A;  3D7S B;  2KVQ G;  1K8A U;  4JJC A;  1YI2 T;  4M78 F;  5KE3 A;  1Y0M A;  1JJ2 S;  1A0N B;  3G7Z A;  2AKL A;  3CCJ A;  3MP6 A;  1LCK A;  1BKB A;  4C8Q F;  4C0Z A;  1IRE B;  2XDP A;  1U3O A;  5IAY A;  3M0R A;  2LQW A;  2FRY A;  5LJ3 f;  1T0H A;  1YIJ T;  1M5Q 1;  4F14 A;  1WX6 A;  4XTZ A;  2Z0W A;  2JNG A;  4DBH A;  2DXC A;  3SEM A;  4FW2 A;  4FYX B;  3CBO A;  4C92 G;  1UGV A;  2A28 A;  3HTR A;  2YSQ A;  1NLO C;  4N0A A;  1YWP A;  2DRK A;  4PFO A;  4OML A;  1IZ6 A;  3RMS A;  3NTI A;  4OMN A;  4RTV A;  3UDC A;  3G4S Q;  1AZG B;  2X35 A;  2DEQ A;  2DL4 A;  3E9G A;  3OBY A;  4A54 A;  7AT1 B;  4MZM A;  4OP0 A;  3V8L A;  2KGT A;  4XK8 E;  5KYU B;  2JUF A;  2EKH A;  1U8R A;  3TQ7 P;  4J5Y A;  4HCC A;  1NE8 A;  4E7J A;  3I56 A;  3VUB A;  3OSS C;  1FMV A;  1M30 A;  2DEU A;  3VV0 A;  2L0A A;  2R58 A;  3I5S A;  4F04 B;  2RA2 A;  1B3Q A;  2RQU A;  4QVZ A;  5GAM f;  1Q86 U;  1EFN A;  2FPD A;  3CCL T;  3QJY A;  1ACM B;  1YJ9 T;  3CME Q;  2G6F X;  2YLC A;  1E7O A;  1YFN A;  1YN8 A;  5GJV B;  4OMF B;  5CKF A;  2G3R A;  4M75 A;  1ARK A;  4NOY A;  2EWN A;  2EFI A;  4JS4 A;  1GRI A;  2ZZD A;  2EKO A;  3A8G B;  3R6N A;  1V76 A;  3V8K A;  1SEM A;  3CCU T;  4E7K A;  2DL8 A;  2F5K A;  4FYV B;  1WFW A;  3TSW A;  5DY9 A;  2KXD A;  3CME A;  4EMG A;  1BIB A;  4JUV A;  1QMC A;  1VQ4 Q;  1BCM A;  1Z9Z A;  3LGF A;  4C92 F;  5CKE A;  1NJI C;  2PTK A;  4KUI A;  1Q7Y C;  1M3C A;  5FU6 B;  2QQR A;  2XDD A;  1OPK A;  1W1F A;  3G71 Q;  2EGC A;  4RG2 A;  1XTD A;  1OEB A;  3A8M B;  2HL3 A;  4PJJ A;  1VQL A;  3VJP A;  3I55 Q;  4E7H A;  2NWM A;  4D8K A;  1K8A C;  5KYX A;  2DL7 A;  4HKE A;  2NUZ A;  2ZPE B;  2E10 A;  2EQU A;  4JZ4 A;  3OYG A;  2DD4 A;  1Y96 A;  1WNL A;  4M75 E;  1ZSZ C;  1MV0 B;  1P92 A;  4JZ3 A;  3CD6 A;  4XTV A;  2L3R A;  2LDM A;  3I55 A;  4HCB A;  4CC2 A;  2KK4 A;  2OTJ A;  2OJ2 A;  2QQA A;  4QQ6 A;  4XTY A;  1G3T A;  2KI7 A;  4QQD A;  2F1L A;  3F70 A;  4LDV A;  5GJW B;  2KRM A;  1BBZ A;  3OYJ A;  3CBP A;  4ELY C;  3CCQ T;  2YWW A;  2CZ0 B;  2XMF A;  3L2Q A;  2ROL A;  2L3S A;  2OTL T;  3MEW A;  2L2P A;  2FO0 A;  3HL8 A;  4M77 A;  1E6G A;  2J7I A;  5KYY A;  3EG1 A;  4DA4 A;  5J3B A;  1MGQ A;  2I2L A;  1X6B A;  2DK3 A;  1VQ4 T;  3N5B B;  2RMO A;  1IHV A;  3ZL7 C;  1VYV A;  3QHS A;  4HCZ A;  2LMJ A;  4BUG A;  1NPR A;  1QW1 A;  1Y7X A;  1NM7 A;  2LC4 A;  2E1H A;  4F7U F;  4FSS A;  1JBM A;  1WZO A;  2K3X A;  1MND A;  1B07 A;  4AFQ C;  4ESR A;  5LJ5 e;  5GAO m;  4BDZ A;  3JSC A;  2LT4 A;  2HSP A;  3VS3 A;  1Q82 R;  4XU0 A;  2LJ3 A;  1VQ8 T;  2BE9 B;  2V1Q A;  3JCM Q;  2QDY B;  2ROT A;  1VQN Q;  1BI0 A;  4ZGE B;  1JXO A;  4DOV A;  3M0S A;  5ECA A;  3ER0 A;  2LQN A;  1PD1 A;  3M0U A;  2WSE E;  2NUP B;  2DA9 A;  4WF2 A;  1K9M U;  2MI6 A;  1RAI B;  2QQS A;  4IUU A;  3UT1 A;  2OI3 A;  1K0S A;  4M77 E;  4E6R A;  3JCM W;  3VYH B;  1M9S A;  1VQO Q;  3A98 A;  2QA4 A;  8ATC B;  2DE0 X;  1Q81 C;  4FW1 A;  2M16 A;  2M1H A;  2MIO A;  1EX4 A;  3DLL A;  1KQ2 A;  2KRO A;  4RG8 A;  1GFC A;  1JEG A;  4A4G A;  1VQP T;  2L8D A;  3REB B;  3VKI A;  3OYN A;  1M1G A;  1SHG A;  1O9S A;  3M4Y A;  2RI5 A;  4FCY A;  2RB6 A;  5GMK e;  3V7S A;  3OYM A;  1D1A A;  2CZ7 B;  5IXB A;  2X4W A;  2EYQ A;  1KC8 U;  2HMA A;  4LN2 A; 
#chains in the Genus database with same CATH homology
 3CCQ A;  5GAM g;  2LRQ A;  4C92 C;  1KHC A;  1VQ7 T;  1N9S A;  3BFM A;  3QYH B;  5I2S A;  3ZEH A;  3LWH A;  3HSB A;  2A7Y A;  3JB9 H;  3ZFJ A;  4Z02 A;  1O75 A;  3X26 B;  1I8F A;  4ATO A;  3NFC A;  4C92 A;  3CMA T;  4XU3 A;  2RH2 A;  4XU1 A;  2GFA A;  4M7D G;  1HXD A;  3OW2 A;  2KDS A;  4DOW A;  4FIB A;  4JDS A;  1UGP B;  3P8D A;  1NPP A;  2LTO A;  1Q82 U;  3MEU A;  1Y07 A;  3GLX A;  4A4K A;  3CME T;  2HBP A;  4KUD K;  3UPU A;  4PKC C;  4C0G A;  5GAN h;  5LJ5 h;  4M78 G;  4ZTF A;  4XTX A;  2DIG A;  4E7L A;  3BW1 A;  3CCJ T;  5J39 A;  2ZPF B;  2IVW A;  4ZTJ A;  3TRE A;  1H64 1;  3TEE A;  4F7U E;  3V7R A;  2CKK A;  3H6Z A;  4C8Q G;  3OS2 A;  3EAE A;  3QJ6 A;  2XU8 A;  3QYG B;  4EMH A;  3CCS T;  4BE2 A;  1W2B S;  4M7D B;  2QTX A;  5I2M A;  4M7A C;  5GMK m;  2HD0 A;  3EFS A;  4BI3 A;  3JRZ A;  5LJ3 e;  1KQ1 A;  2RD1 A;  3R6O A;  1VQN T;  4ME7 A;  5GMK j;  3CCL A;  4MMK A;  2LNV A;  3UWN A;  1WGS A;  5EG2 A;  4BB7 A;  1PSE A;  3OQ5 A;  4M78 B;  3WVD B;  4BY6 B;  3QG1 A;  3OS1 A;  4X9C A;  4PNO A;  1GXI E;  2XDB A;  4PL6 A;  1VQL T;  2GF7 A;  5GAN f;  3HP9 A;  5LJ5 f;  1Q82 C;  5GAN 2;  1M1K U;  4M7A A;  3A5Z B;  4C8Q B;  2XI9 A;  4NL3 A;  2DAQ A;  4C92 D;  3TCJ A;  3GNF B;  2YHT A;  4J7I A;  3LX7 A;  3RUX A;  4OF1 A;  1YHQ T;  1LNX A;  4J83 A;  3CC4 T;  4PJO F;  5GMK l;  3O8V A;  3L42 A;  3ASK A;  1YIT A;  3T9N A;  4RCC A;  1RI0 A;  1I5L A;  4J6X A;  4CI0 C;  5LL6 S;  5LJ5 d;  1QP3 A;  5GAN d;  3CC2 T;  1LJO A;  5IT9 E;  4M77 G;  4XAX B;  3VU3 C;  4A4H A;  3SFM A;  4FT4 A;  3GIB A;  3JCM f;  4J7F A;  2GFU A;  4Q5W A;  2LT1 A;  1FWZ A;  3G71 T;  1N8R C;  1YJN T;  4M75 F;  2B8A A;  2E6Z A;  4C92 E;  2QQ9 A;  3CXC A;  2JTM A;  4QQG A;  3I55 T;  5FU7 B;  3DB3 A;  4ZN1 A;  1KG1 A;  1I81 A;  2K3Y A;  4OB0 B;  1VQ9 A;  3SB2 A;  1M90 U;  3LGL A;  3X28 B;  4JLG A;  2EIF A;  1JRI A;  5KH6 A;  5GMK h;  3L2W A;  3G4S A;  5AYF A;  4JRP A;  2JVV A;  2VGM A;  2RJE A;  2YRV A;  1FXX A;  1VIE A;  2MF2 A;  4ZGD B;  3KXT A;  3L2U A;  4M7A D;  4LDY A;  1QVF A;  2VGN A;  2C06 A;  2KQW A;  2AHJ B;  2PVG B;  4N4G A;  2RK1 A;  4E7I A;  1QVG S;  3SWN B;  3P8B B;  4BAC A;  2OAU A;  1VQ5 T;  1YJW A;  3ME9 A;  2FHD A;  3GF5 A;  1S72 T;  3PMT A;  2K2V A;  1UB4 A;  3A8L B;  1UGQ B;  5FU6 C;  2CYZ B;  4FL6 A;  3OA6 A;  3JB9 F;  3RES A;  2O4X B;  3RKW A;  2DKG A;  1VQM A;  5GAN 7;  4HT8 A;  4IUP A;  4QVC A;  2DTI A;  3C94 A;  3DKM A;  5CKD A;  2PU9 B;  3M55 A;  4HT9 A;  5CR2 A;  3RKX A;  3OYL A;  5FRN A;  5GAN 6;  3QPH A;  3FDR A;  3CCV A;  4ZGJ B;  1VQ7 A;  4M7A E;  3GP8 A;  3OYC A;  2PVO B;  1BI2 A;  3VUZ A;  1G3Y A;  4C0D C;  3FEO A;  5CK9 A;  2DTH A;  1NJI U;  4PJO B;  2XG8 D;  2DJZ A;  2EQM A;  1M8V A;  2VYT A;  5CIU A;  5GAN g;  5LJ5 g;  5HK3 A;  4EMK B;  3JCM J;  3RIR A;  2CS7 A;  1Q7Y U;  4LD6 A;  4ELZ C;  2EQJ A;  4BE0 A;  3CMA A;  3CCE T;  4FU6 A;  4M7D F;  3LLR A;  3BY7 A;  4KT0 E;  4QVD A;  5CAI A;  1YBY A;  3J81 E;  3WXM B;  5A0G A;  1PSF A;  3FB9 A;  4M75 B;  2KVQ G;  5GAM e;  3QSU A;  1BYM A;  3L2Z A;  3DB4 A;  1K8A U;  1YI2 T;  4M78 F;  4MML A;  5KE3 A;  2DZC A;  1K9M C;  3X25 B;  1JJ2 S;  2QQB A;  1X01 A;  2F5T X;  1Y71 A;  3G7Z A;  4F7U G;  1WJR A;  3CCJ A;  3MP6 A;  3J80 E;  5CQX A;  1BKB A;  4C8Q F;  5HKC A;  4C0Z A;  4O6J A;  4IKF A;  2MMP A;  2DXU A;  2VXF A;  4VUB A;  4BDY A;  1KD1 C;  1N27 A;  1IRE B;  3CPW A;  2XDP A;  2V8I A;  2QI2 A;  1R8O B;  2HQX A;  2V8J A;  4MZT A;  1BI3 A;  1X75 C;  4B9X A;  2WSF E;  3QII A;  5IAY A;  5GAO p;  2OTL A;  2D6F A;  2XD0 A;  5LJ3 f;  2R5A A;  1YIJ T;  2RI3 A;  1M5Q 1;  2FVU A;  5CKB A;  3MO8 A;  4XTZ A;  1VQ6 T;  3FC3 A;  1AHJ B;  4EPC A;  2DIQ A;  1VQ4 A;  4BY6 C;  2WSC E;  2JNG A;  2QEX T;  2E70 A;  2O01 E;  1MHN A;  2V8K A;  2DXC A;  4XQ3 A;  1YHQ A;  3M9Q A;  1W4S A;  4L6V 5;  4OB2 B;  2K5I A;  3H8Z A;  4C8Q C;  5GAO q;  2MAM A;  2E64 A;  3OB9 A;  1KC8 C;  3OYD A;  2F69 A;  3EFR A;  4N0A C;  4HA8 A;  3CBO A;  3GPL A;  2FL7 A;  2NLU A;  4C92 G;  1XNI A;  4LDW A;  4C8Q A;  2ZPG B;  5CKH A;  2RI2 A;  3HRU A;  3G71 A;  3OW2 S;  1WJS A;  2VUB A;  1N6A A;  3M56 A;  4JRQ A;  3TU4 K;  2DPP B;  2E5Q A;  4N0A A;  2K5L A;  3C12 A;  1SSF A;  2K4Y A;  2ZPH B;  5IN1 A;  2XKO C;  4IUV A;  5DLO A;  2A3L A;  1Y96 B;  1U1T A;  3M53 A;  4J6Y A;  3JCM h;  3RMQ A;  1IZ6 A;  1WQ7 A;  3NTH A;  3NTI A;  5FU7 C;  3RMS A;  2M0O A;  4C5G A;  4C92 B;  3UDC A;  4V2S A;  1G3S A;  2GCX A;  1H3Z A;  4C5E A;  1FX7 A;  1VQ8 A;  1BI1 A;  2X35 A;  1VQO T;  3NTK A;  3CBM A;  2PUK B;  2CZ1 B;  3JB9 I;  3OYK A;  1S72 A;  2DEQ A;  3E9G A;  3OBY A;  3HRS A;  5DLQ E;  2CGH A;  1ZHI A;  4MZP A;  2KY9 A;  2H3J A;  3M54 A;  4A54 A;  2FB7 A;  3SWN C;  3PTA A;  2KMT A;  2DXT A;  2D0Q B;  2RO0 A;  2DZ9 A;  2IG0 A;  4MZM A;  4OP0 A;  4C5I A;  4OB1 B;  5KE2 A;  4M7A G;  3V8L A;  5GAO r;  1G5V A;  3A8O B;  2ZGW A;  4XK8 E;  5C0M A;  2JUF A;  1KQS A;  3CD6 T;  3HFO A;  4MDX A;  1U8R A;  3OYE A;  2X4Y A;  3ZBD A;  5GAN 3;  2E41 A;  1M1K C;  4EDU A;  3SWN A;  5J26 A;  3QXE B;  4J5Y A;  4N4I A;  3G6E A;  3MP8 A;  3CC7 A;  3HFN A;  3PFS A;  4HCC A;  1NE8 A;  3LWI A;  2RJC A;  3I56 A;  3L2R A;  4E7J A;  2OTJ T;  2GQV A;  3VUB A;  2MWP A;  4M77 B;  4L59 A;  4NL2 A;  4PJO C;  1NZ9 A;  2O4X A;  2RHY A;  3OSS C;  3JCM d;  5LJ3 j;  4RMO A;  1OYX A;  1VQP A;  3BDU A;  4X9D A;  3FIF A;  4EMK C;  1X6O A;  2RHU A;  2P4T A;  3CXC S;  3VV0 A;  2R58 A;  1YI2 A;  4TVR A;  3OYA A;  3RER A;  4C8Q E;  1VIF A;  2RA2 A;  2X4J A;  4PJO A;  2RHZ A;  4QVZ A;  5GAM f;  1Q86 U;  4JS5 A;  3CCL T;  3QJY A;  3OYF A;  3PIO A;  3M58 A;  4IUQ A;  4M75 C;  2K5F A;  1YJ9 T;  2YLC A;  4EMK A;  3MET A;  2DVE A;  3OMC A;  5GMK i;  4OMF B;  5CKF A;  2R5M A;  2Y4Y A;  1M90 C;  3P8H A;  1VQK T;  1QVF S;  1D3B A;  2L89 A;  2HAX A;  2G3R A;  4M75 A;  4QW2 A;  3VYG A;  3L2V A;  2JTF A;  4NOY A;  3HRT A;  5FLX E;  2EWN A;  3FLG A;  5CCA A;  2EFI A;  4JS4 A;  2ZZD A;  2EKO A;  3A8G B;  3MEV A;  2VC8 A;  1YIT T;  3M4G A;  3CCM T;  3V8K A;  2RM4 A;  4JRI A;  4XTW A;  5CO7 A;  3CCU T;  4E7K A;  4NS5 A;  2F5K A;  1M4Z A;  5GAN 5;  3QKJ A;  1Q86 C;  4BI4 A;  5D6W A;  5LJ3 h;  4JJN K;  5DY9 A;  3CME A;  4EMG A;  1BIB A;  4JUV A;  2K57 A;  4Y91 A;  1K73 U;  4C5H A;  2EJG A;  3MHX A;  1WPY A;  2LVM A;  3C95 A;  2RK2 A;  3HPW A;  4OGE A;  1I4K 1;  2VXE A;  3V7C A;  2D9T A;  4PJO D;  2ZPB B;  1TH7 A;  1B34 B;  3LGF A;  1DJ7 B;  1WQW A;  2ZCF B;  2M9U A;  3JCM g;  4A53 A;  4C92 F;  5CKE A;  1VQK A;  3Q1J A;  2Y4X A;  3CCS A;  3S6W A;  1NJI C;  3E19 A;  3LW5 E;  4LD9 K;  4FSX A;  2WAC A;  4KUI A;  1Q7Y C;  1VQN A;  4OB3 B;  4BD3 A;  1LOJ A;  5FU6 B;  1N9R A;  2QQR A;  2YLB A;  2XDD A;  1V29 B;  2E6N A;  4IUT A;  5L8R E;  4M7D C;  4F7U B;  4M75 D;  2PVD B;  5HY6 A;  4IUR A;  2LCL A;  4RG2 A;  1XTD A;  3M5A A;  3A8M B;  4J8O A;  3JCM V;  2XID A;  3VJP A;  1VQL A;  5C6S A;  3AHU A;  4E7H A;  2EQK A;  1K8A C;  4PJO E;  4M78 C;  3PT9 A;  2BUD A;  2JN0 A;  2P0K A;  3SD4 A;  3X24 B;  4HKE A;  4LDX A;  4M7D A;  1VQO A;  3CC4 A;  4KBM B;  3CPW S;  2ZPE B;  4L5G A;  5GAN 4;  2E10 A;  2EQU A;  3OYG A;  3A8H B;  2DD4 A;  5LJ3 d;  1KHI A;  4LDU A;  3OYI A;  3CCV T;  2R57 A;  3FJP A;  4C0F A;  4M78 A;  4R55 A;  3OSV A;  2QA4 T;  2DTO A;  4M77 F;  3OYB A;  1Y96 A;  1WNL A;  4OVA A;  3CC2 A;  4M75 E;  4M7A F;  3MEA A;  4Y28 E;  3X20 B;  1P92 A;  3QBY A;  4GLK A;  5GAM j;  3JB9 D;  3JCM P;  5FRM A;  1ZBX A;  5D6X A;  1YJN A;  3CD6 A;  4XTV A;  2EAY A;  1W2B A;  2L3R A;  2LDM A;  4E47 A;  1BIA A;  3I55 A;  4HCB A;  4MDW A;  4J6W A;  5A0D A;  3CCR T;  3M59 A;  2FYK A;  4CRI A;  4N4H A;  3BDL A;  3HKS A;  1XOV A;  2KK4 A;  2OTJ A;  2E65 A;  2QQA A;  1YCY A;  3J7A F;  2JZ2 A;  3QUI A;  5A0L A;  4B9W A;  4QQ6 A;  4XTY A;  1G3T A;  5CQY A;  3V8J A;  1VUB A;  4QQD A;  3F70 A;  4LDV A;  2P0Q A;  3OYJ A;  2PQW A;  1VQ5 A;  4M7D D;  4M77 C;  3CBP A;  4ELY C;  3CCQ T;  1UGS B;  3JAM E;  5KCO A;  3JCM c;  2CZ0 B;  2RJF A;  2XK0 A;  3L2Q A;  1UEB A;  2OTL T;  2LQ8 A;  3MEW A;  2EJ9 A;  4M78 D;  1YJ9 A;  1N8R U;  2RJD A;  2MWO A;  3HL8 A;  4M77 A;  5I21 A;  4RKU E;  4DA4 A;  5J3B A;  1MGQ A;  3S3N A;  3LYI A;  2XHC A;  4C8Q D;  2I2L A;  1WJQ A;  2DK3 A;  2P0P A;  3M57 A;  5GAM h;  1VQ4 T;  5LJ3 g;  3KUF A;  1JB0 E;  3N5B B;  3DLM A;  4M7D E;  5FRO A;  1EIF A;  3OMG A;  3QZ9 B;  3PMI A;  1G3W A;  1OI1 A;  2ZPI B;  1M1F A;  3S3M A;  3QHS A;  3CCE A;  4M7A B;  3CCM A;  1OZ3 A;  3CCU A;  4JLI A;  4HCZ A;  3OS5 A;  4M78 E;  4RCB A;  3E1S A;  4BUG A;  1NPR A;  5GAO n;  1QW1 A;  3FRN A;  3OY9 A;  1Y7X A;  3JCM b;  4A4F A;  1KQS S;  3WVE B;  1HK9 A;  2LCC A;  1ZQ1 A;  3PNW C;  2LC4 A;  2E1H A;  4F7U F;  1QVG A;  1QP2 A;  3OYY A;  2RHX A;  1JBM A;  2K3X A;  2PUO B;  5GAN e;  3LH0 A;  5LJ5 e;  3RKY A;  5GAO m;  2HQE A;  4BDZ A;  3JSC A;  2LT4 A;  2BIV A;  4M77 D;  2JOY A;  5CVI A;  3INZ A;  2LX9 A;  4A4E A;  4XU0 A;  3MP1 A;  3KBG A;  1Q81 U;  1VQ8 T;  2DD5 A;  4UC4 A;  5GAM d;  3JCM Q;  3OYH A;  1YIJ A;  2QDY B;  3CEY A;  4PJO G;  4DQ2 A;  1BI0 A;  4ZGE B;  2BKD N;  4DOV A;  1VQ6 A;  1K73 C;  3ER0 A;  5A2Q E;  3QO3 A;  3HHT B;  1B34 A;  5GAN 8;  1U1S A;  3JCM e;  4P5N A;  2X4X A;  2QEX A;  5GAO l;  2WSE E;  4PLI A;  4R56 A;  1K9M U;  1RL2 A;  4WF2 A;  2MI6 A;  3CPF A;  4XTU A;  2QQS A;  4GY5 A;  4IUU A;  3SDZ A;  3UT1 A;  3E9F A;  2L5Q A;  5DM7 R;  1QVP A;  3OS0 A;  3JCM X;  4M77 E;  4BE1 A;  3JCM W;  3VYH B;  4ZN3 A;  4M75 G;  4PLL A;  1M9S A;  1XQH A;  2CZ6 B;  2DXB A;  3GNG A;  4F7U A;  2QA4 A;  1JJ2 A;  4II1 A;  3JB9 J;  3G6E T;  3QZ5 B;  1VQ9 T;  1KD1 U;  3CC7 T;  3G4S T;  3PGG A;  3GOX A;  1Q81 C;  3I56 T;  2M16 A;  2M1H A;  4O5V A;  3S3O A;  2Y90 A;  3DLL A;  1KQ2 A;  1OZ2 A;  4RG8 A;  2E12 A;  4XU2 A;  2XIC A;  3L1A A;  2VV5 A;  4KUL A;  4A4G A;  5HK0 A;  1VQP T;  2L8D A;  1D3B B;  5KCH A;  3CCR A;  3VKI A;  4X34 A;  5LJ5 j;  3MCA B;  1M1G A;  3C4S A;  3URG A;  4BI8 B;  3OYN A;  5GAN j;  1O9S A;  2KAF A;  3M4Y A;  1YJW T;  2LQK A;  4FM4 B;  2RI5 A;  4FT2 A;  3PIP A;  2QXF A;  2RB6 A;  4JRK A;  1UGR B;  5GMK e;  2KSS A;  4OGC A;  2HNI A;  2DO3 A;  2CZ7 B;  5D6Y A;  5M9O A;  3OYM A;  3JB9 G;  3QDR B;  2RHI A;  4C0D B;  2X4W A;  2EYQ A;  1VQM T;  3OBW A;  1KC8 U;  2EJF A;  3V7S A;  4YTL A;  4D6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...