3LWIA

Crystal structure of cren7-dsdna complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
58
structure length
58
Chain Sequence
SGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the interaction of the crenarchaeal chromatin protein Cren7 with DNA
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
molecule keywords Chromatin protein Cren7
total genus 4
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lwiA00
3LWHA 4R55A 3KXTA 3LWIA 4R56A 2JTMA
chains in the Genus database with same CATH superfamily
2M02A 2CUBA 3SD4A 4M78D 1NPPA 2QG9B 1VQLA 3P8DA 2RQRA 1D09B 1I5LA 2K3XA 2EYXA 1EZZB 3GF5A 1VIFA 2K4YA 3SWNA 2JW4A 1QVGS 2VVKA 1G8XA 2HKNA 3QHSA 4JRPA 3LLRA 2PU9B 2E3HA 1W1FA 4KH0B 1Q81C 3G71Q 4KT0E 5LJ5g 2XMFA 3RKYA 3QO3A 1QWFA 2E41A 4DOWA 1H3ZA 1VQPT 4Z88A 1M8VA 1TH7A 3SEMA 5GANh 3CBMA 4JRQA 2RM4A 4F7UB 1XJWB 4A53A 3C94A 3EHQA 1OX8A 4A4KA 4JPBW 5GAOq 2X51A 3EG9A 3X25B 1S72A 3EFRA 3CEYA 3SHWA 2I2LA 3MEVA 3KFVA 1FWZA 1BI3A 5GMKi 2DFUA 3MJXA 1IREB 3RBBB 2HNIA 1VQMT 2RN8A 4ELZC 1OI1A 3L2RA 1UHCA 2QQRA 1RACB 3P8HA 1WGSA 2CH4W 5LL6S 3CMEA 3CCSA 2DNUA 4M78E 5I2SA 4E7SA 3HTRA 1JBMA 3SB2A 4C8QA 3EG2A 3C12A 5AYFA 1T3LA 3RUXA 4L6V5 3NTIA 2E6ZA 5KYNA 3QIIA 3G4SA 2MAMA 1KFZA 4B9WA 2HQXA 4J8OA 1VQNQ 1LNXA 2EWNA 2DERA 3CCRQ 3QG1A 1MGQA 3JB9I 1U5SA 2V26A 1KHCA 4E7JA 1M30A 1Q7YU 3I35A 2GGRA 2DK3A 1TUDA 1MV3A 2DLPA 4Z89A 2XICA 4Q5WA 4XU0A 1RI0A 4M75E 3QBYA 1WIEA 2JXBA 5GMKe 2IIMA 3VRZA 2GQIA 1MMDA 4J6XA 2YRDA 2GF7A 3HRUA 3EGDB 2RI3A 2P0QA 2V8JA 2EQKA 2ZPFB 4NS5A 3TSWA 3HL8A 2F2VA 3UPUA 5KYXA 3OQ5A 4C8QD 3GP8A 1YIJA 2CZ6B 3URGA 2HAXA 2AIRB 2K5IA 3OB9A 3CXCP 3S3MA 3G7ZA 2A37A 1UTIA 3UA6A 2LQ8A 4IUVA 3S3OA 2YUOA 5KYYA 1M2VA 2X35A 2MK5A 5FROA 5HCKA 3ZFJA 4ZGEB 5EC7A 2HL5C 4Z8AA 1KK7A 3OYCA 1VQMQ 2HQHA 3CC4A 5LJ3f 3CCUT 1KC8U 4M77C 5IN1A 2XD0A 4RTTA 1VQOT 1WHJA 3JCMd 2K6DA 2EKHA 2W10A 1PWTA 1Q82C 4E7LA 2NUPB 5KYUB 3CC7T 2D9TA 1QVGA 2ESWA 1GFDA 2DL5A 3CC2A 4JDSA 1YJ9Q 1ZSZC 2DILA 4HVUA 5IT9E 1W2BA 5J26A 3UDCA 4M78G 2HL3A 3A8MB 1D0ZA 4BY6C 3BW1A 3CCLQ 3THKA 4FYWB 1G3SA 5IXFA 4C5HA 4CI0C 5GAMg 1VQOA 2YSQA 2A36A 1RI9A 1KJWA 3GNGA 3CCET 5GANj 2DYBA 1DJ7B 5CQYA 1G3YA 3CCQA 2CZ0B 2AK5A 4ATOA 2A7YA 1NLPC 1AD5A 3QZ9B 2EQIA 3CMET 1VA7A 2EBPA 4RTYA 2WSEE 3RNJA 2COZA 2AZVA 2D0NA 1OYXA 2M51A 1WI7A 3EFOB 4AG2C 2RJFA 1SG5A 1FMKA 1FMWA 3ER0A 2OTJA 5I21A 4A4EA 1VQ9A 3KUFA 4MZTA 4E7HA 5HKCA 3RIRA 5GAOm 4A4FA 1M3BA 3ULRB 1G3WA 1BI0A 4TVRA 4J9BA 4F04B 1GRIA 1PD1A 3CC2Q 3CXCA 2FPEA 1O75A 1BIBA 4HVVA 1X2QA 1KSWA 5LJ3d 1YP5A 3O5ZA 1WQWA 2YRCA 3CCRA 2BTTA 3OYKA 3JCMf 1RLQC 1I81A 4QQDA 1LPLA 3G4SQ 4M7AD 4GY5A 3TCJA 2H3EB 3LYIA 1Y96A 5KYWB 3DKMA 1W2BS 1X43A 1B07A 2O31A 1YJ9T 2Y4XA 3OYDA 1WJQA 1K9AA 2IG0A 2QI2A 3D7SB 3OBWA 4J9FA 3EFSA 2O4XB 3SFMA 4ZN1A 1BIAA 3OYJA 2JS2A 2C0TA 5HY6A 4AFUC 5DM7R 3CCLT 4JUVA 3QJ6A 2QA4A 5GJVB 4JLGA 2VC8A 3VS5A 2RHUA 4O6JA 5GAOn 2EYQA 4FT4A 1UJYA 1AZGB 2JVVA 1EIFA 2DE0X 4E2FB 1FMVA 1NEGA 1VQ6Q 1QQJA 2GCXA 1NYGA 3H8ZA 2JUFA 1N8RC 2AKLA 2E5KA 3LX7A 1WXUA 2CREA 3MHXA 4K11A 2GFAA 4Y28E 4J83A 3PNWC 2OX7A 1QW1A 5I2MA 5GAMe 4DBQA 4IIOA 3PVLA 3INZA 1QVFS 4IUTA 1MMAA 2O88A 1QWEA 1WNLA 2HMAA 4QW2A 4EMHA 4XAXB 2R58A 5GAMh 2JZ2A 1RLPC 4RTWA 2DVEA 5J39A 1UECA 3QKJA 3OS2A 4DA4A 1WXTA 2ROLA 4JS4A 3EG1A 4FCYA 1LVKA 1PNJA 4M75B 4CC3A 2B8AA 1WX6A 3MEUA 3JCMX 2MI6A 2BE7D 2NYSA 2Y90A 2JT4A 1MMGA 4X9CA 1S1NA 3PMIA 3CCSQ 1X6BA 4N4IA 1AHJB 2HKQB 1BCOA 2DZ9A 5FU6C 2QAZA 3G6EA 5CIUA 1X6GA 1VQKQ 2K3YA 3M0PA 4R55A 1SRMA 2OTLQ 2J06A 5KE2A 2LJ3A 1X2KA 3TSZA 1M3CA 2LT4A 2LX7A 4M78B 5C0MA 2ZAEA 4BI4A 3L2UA 2YDLA 6AT1B 4N4GA 3NFCA 1Q86C 1W4SA 2KY9A 1JO8A 2L3SA 3I9QA 1F1BB 3Q1JA 4PNOA 1YWPA 4N4HA 4M75C 2E10A 1JU5C 4VUBA 1AWWA 4Y92A 2DYIA 2VGNA 4HKEA 4F16A 3E9FA 1M1KC 2F2XA 1K9MC 2K57A 1KQSS 3LWIA 3OS1A 4LNPA 3I55T 3CCQT 1YFNA 4OB0B 3OBYA 1AWXA 3FRNA 4C92C 3TVTA 4F7UG 1M4ZA 1V76A 4LUDA 4C0GA 4PLLA 1G2BA 4IUQA 1D3BB 4M7AF 5GAOl 3REAB 4JJBA 4J9GA 1M5Q1 2ECZA 2IPOB 1XQHA 2MMPA 1BU1A 2ZPGB 2X4XA 4PJOD 3E2UA 3MO8A 4FSSA 5FU7B 3TEEA 2DL4A 2KYBA 2LNVA 1WYXA 2ABLA 1AVZC 1LCKA 1VIEA 1PKTA 2X3WD 1PC0A 3CC7A 5DY9A 1YHQT 3FLGA 2M0YA 2SRCA 2E6NA 1BKBA 2K5LA 4C5EA 2LZ6B 1CKBA 3OW2S 2K2VA 3GLXA 1M90C 2PVGB 1NE8A 3GNFB 4KGZB 3VRYA 5A0GA 1P92A 2K79A 2F2WA 4C8QF 1N5ZA 2KRNA 2L8DA 2BZYA 3QDRB 5ECAA 5GAOr 3MP6A 4XTXA 4M7DF 4JJDA 4HCBA 2QK0A 1KIKA 3CCMA 4QQ6A 2FPDA 2KRSA 2RMOA 2GFUA 3S6WA 1VQMA 4AMCA 3BE3A 3E19A 4ZTFA 5KYXB 4XTVA 4J5YA 2XK0A 2YRVA 3DLMA 2LTOA 2V1RA 4M7AE 4XQ3A 4NL3A 1MHNA 1R0CB 4FL6A 4MDXA 1HK9A 1PM3A 2DD5A 1YJNQ 2B86A 3WVDB 1JJ2P 5DLQE 2QQBA 3QJYA 5GANe 3EGXA 4FU6A 1VQ6T 4IUPA 2QXFA 2XDBA 1K0XA 2FEIA 5IH2A 1X01A 2IVWA 3EG0A 4KUDK 1MUZA 4KULA 2FPFA 3MP8A 3UF4A 1G3TA 4ME7A 4LDUA 3C0CA 4J9EA 1IXDA 1VQ5Q 1ABOA 1HSQA 2RI5A 2P4TA 2J6FA 4LE9A 2DIQA 5GAN8 4XTWA 4XTZA 2CT3A 4PL6A 1PRMC 2DA9A 2K2MA 2PVDB 5AT1B 1M1KU 1TG0A 1TU0B 3CPWS 2FYKA 2VKNA 3QZ5B 1JQQA 4PJOB 2MPXC 2YLCA 3VS1A 2A28A 2CSIA 2XI9A 3VV0A 2KYMA 3CMEQ 2J7IA 1RAFB 2L5QA 1HYOA 4LDVA 1RADB 4M77B 2JMCA 3LGLA 4KH1B 4EPCA 1YIJT 1NZ9A 2OTLT 1M1GA 4A63B 3FDRA 1YJ9A 1KC8C 2KE9A 1KC8R 2YHTA 3DB4A 5I22A 4EDUA 1YITQ 3HRTA 3PMTA 4CRIA 2YWWA 2ZPEB 2K5FA 4KRTA 3LH5A 5LJ5h 4PJOF 2JS0A 2FO0A 1D1AA 3LW5E 5A0LA 2D6FA 1VOMA 5FRNA 1VQ4T 3CC4Q 5GMKj 4OMFB 3V8KA 4M75A 3M56A 2DXUA 2XHCA 4HT8A 2AT1B 4PKCC 3RDVA 4LXCA 2MYSA 2LQWA 4OP0A 4M75G 4NL2A 4J6WA 2BZ8A 2EGEA 3PTAA 2CP2A 1ZA1B 4LUEA 3OMGA 4M77G 1ZUYA 3MEWA 1XOVA 1RABB 3WVEB 4LDXA 4JZ3A 1I1JA 2CH4A 1BB9A 2QA4Q 3NPFA 1I5OB 3CMAT 7AT1B 2DIGA 1VQLQ 3CCVQ 1VQPQ 2Z0WA 5A2QE 2EYZA 1FXXA 2DRMA 2DXBA 2JN0A 1I4K1 1PG5B 3G6ET 4E47A 2FRWA 1E6HA 4OMMA 2JM8A 1V1CA 2LCLA 5KYYB 3VYHB 3EGXB 1D0YA 2W0ZA 1K73C 3QYGB 2EJ9A 4GLKA 3HHTB 4AFSC 2JOYA 5FRMA 3I56Q 1VQ8A 5GAN7 1B3QA 3CCST 1NLOC 2DL8A 2RA2A 3JB9F 1M27C 1YI2T 2FB7A 3FB9A 1U1SA 4C92A 1TXQA 4BE1A 1LOJA 4RCBA 3NTKA 2L2PA 2AZSA 2KRMA 2FZGB 5HK3A 4XK8E 3KXTA 2DO3A 2XG8D 4IKFA 1QCFA 1KQSP 5EG2A 2F5KA 2JTMA 2CGHA 3PIOA 3MP1A 4ZTJA 4RTZA 4EMKB 2WSFE 1K73U 3LH0A 1QVPA 2JTFA 2E70A 5FLXE 5KH6A 3VUZA 3EHRA 1YI2A 2BKDN 3ZL7C 5D6XA 4PFPA 2KNBB 3R6NA 1A0NB 3A1PA 1RUWA 2RQVA 1M1FA 1WHKA 3M4GA 2QEXQ 4AFZC 2DAQA 2OTJQ 1YI2Q 2QA4T 1JRIA 2PVOB 1UUEA 1N27A 1T3SA 4J9DA 3H6ZA 1Q86U 1Q82R 1UGQB 3RMSA 5GAN4 2EYWA 4C92G 1YBYA 4DBHA 2CP3A 4J9HA 2CYZB 1BCMA 4OMQA 2D0QB 2P0PA 4XU3A 1Y0MA 1QCNA 3OYLA 1I8FA 2QQSA 1C0MA 5CR2A 2KSSA 4OMPA 4WTOB 1IB8A 1SKUB 1IZ6A 2O4XA 4RMOA 1VQOQ 4M78F 2E4HA 2EYYA 2HDAA 2HQEA 1GL5A 1AEYA 5FWBA 1YITT 5J3BA 4HVWA 3MKDA 4A4HA 2BZXA 3M0UA 1WPYA 3MCAB 2RHZA 1E7OA 4PLIA 4RTVA 3EG9B 9ATCB 4M7DB 3NMZC 1ZSZB 1O9SA 3HFOA 2HBPA 2LMJA 1GBQA 2MIOA 1IO6A 4XTYA 3X20B 3I5SA 4PJOG 5FU7C 1M1KR 2F5TX 2F1LA 2CP0A 3QWXX 5GAN2 3CCJA 4RTUA 2XU8A 4C92D 4BI3A 1Y71A 1BI1A 4QKUA 2DM1A 1ZBXA 2QEXA 4M75D 2JJ9A 3EGUA 1I0CA 2DRKA 2VWFA 1U3OA 4R56A 3CCEA 2LJ1A 1TUCA 3CMAA 2I0NA 2JM9A 2MWPA 2FRYA 4J7FA 3VS2A 3I56T 1M8MA 1ZLMA 2RQUA 1NYFA 5I11A 4E7ZA 2RH2A 3VS4A 3JCMP 1W2BP 5KCOA 2JMAA 1X27A 2V8KA 3X26B 4XU1A 1UJ0A 2NUTA 5GANd 2EGCA 2J6OA 4M7DG 3CC4T 4N0AA 2EJFA 1ZA2B 4JJNK 4F17A 2LCSA 4E7KA 4C8QB 2C0IA 3CD6T 4C0ZA 2EFIA 2RJCA 2DD4A 3NGPA 1N9SA 1JXOA 4LDYA 1Q86R 1H8KA 5CO7A 4KGXB 2JNGA 2E5QA 3CC2T 1ZHIA 4HCKA 1OV3A 1UGRB 3H0FA 5CCAA 1C6VX 2E3IA 2PTKA 4OF1A 3SWNB 3H41A 2EVRA 2H8HA 2A0FB 1IRXA 3EGDA 2WACA 2LQKA 2V8IA 2ED0A 2DMOA 4OMLA 4M7AB 3J7AF 2P0KA 1AWJA 4FSXA 4OMOA 4RG2A 4OGEA 1K73R 1ZSZA 4EMGA 2DJZA 2AKKA 2CT4A 3BDLA 4HXJA 5LJ3j 4HA8A 3CD6Q 3CXCS 2QDLA 3QPHA 4GBQA 3EH1A 4ANJA 4PFOA 5CQXA 1MV0B 1VUBA 1R0BG 2DPPB 3G71T 2J05A 3G4ST 3UA7A 4F7UA 4C5IA 1NG2A 4JZ4A 2ENMA 1ZBJA 2FVUA 1WDXA 4A54A 3JCMh 4QVCA 1YJNA 3A8OB 4AT1B 2YT6A 3EH2A 1KD1C 4M77A 3OY9A 1TOVA 3LWHA 2LT1A 3OW2P 3NHNA 3RR6A 3CMAQ 2GBQA 4KUIA 3L42A 4XTUA 4FYYB 1PCXA 5LJ3h 1FX7A 3EG3A 4RKUE 3JCMJ 4PJNA 4LDWA 2MOXA 2K7AA 3GPLA 4E7IA 2O9VA 3G6EQ 4B6MA 1VQ4A 1BBZA 3QDFA 1TSFA 3ZEHA 1YJWT 1VQ7T 2HBWA 3I55A 1H3HA 1Q7YC 3S3NA 3QYHB 2OI3A 4EIKA 2ZCFB 1Y7XA 2HCKA 4M75F 2K9GA 1YWOA 3JCMW 1KHIA 4PJMA 1K9MU 1E6GA 3JCMe 5GANf 3F70A 2E65A 2M0OA 3IQLA 2ZPBB 3RESA 3V7RA 1LJOA 2QQAA 5FWCA 3VS0A 2PNIA 1W70A 4BDYA 3OYFA 3EFOA 4F7UF 3CCJT 4DQ2A 2A3LA 1N6AA 1NJIR 5KE3A 2CKKA 2CZ1B 1Y96B 5KYWA 2MF2A 3HFNA 3J80E 2KROA 3CCMT 3A8LB 1OQKA 3PGGA 1BYMA 2XDDA 4NOYA 1RAGB 1U06A 2KAFA 4OGCA 2NLUA 2CP7A 1YJWQ 1VQ7Q 1WFWA 2E64A 2LCCA 3M4YA 2VXEA 1JXMA 2RHYA 4FT2A 3JB9G 1XTDA 1KQ2A 4MMLA 1YIJQ 3DB3A 3M59A 2K3BA 4C5GA 3M0RA 4PJOA 3G71A 3H0HA 4MDWA 4KGVB 3EAEA 3FJ5A 1SHGA 4MMKA 1WLPB 1AT1B 1QVGP 4X9DA 3QSUA 4JS5A 2NUPA 2KI7A 1PD0A 5KYUA 2D8JA 3RKXA 5KCHA 2RQWA 1MMNA 3JAME 1H641 5LJ3e 2G3RA 2CUDA 3CCLA 1G83A 2RF0A 4M7DC 3A5ZB 1UGVA 1B34B 4EMKA 4J9CA 2KGTA 2P84A 4ZGJB 2LDMA 5LJ5e 4FW1A 2OTLA 2QASA 4RUGA 2BIVA 1X75C 3LGFA 4RG8A 2R57A 3PE0A 1VYTA 4DBFA 2LJ0A 1RAHB 1IHVA 4BACA 4OB2B 2NUTB 4Y91A 1K4US 1Q81U 2VASA 3H0IA 3CCVT 4MZPA 2DBMA 1QCOA 5GAN6 3CCRT 1D1CA 3BY7A 8ATCB 5CKBA 3BFMA 3OS5A 2PUOB 1RAIB 4O5VA 4M77E 1NM7A 1YJNT 2KXDA 3OYGA 1TTHB 1N9RA 5D7UA 3I5RA 1WHHA 1Y57A 2LRQA 2L3QA 4M7DD 1GFCA 1QMCA 3JB9D 2O01E 2PZ1A 3VKIA 3OMCA 3H9NA 4KBMB 1PSEA 1VYVA 3CD6A 2EQMA 2GNCA 1GCQC 2YUPA 2O2OA 5GAMd 1ABQA 1WZOA 4PJJA 1TWBA 1UGSB 4BD3A 4M7AA 1SSFA 3SDZA 3VS7A 4EMKC 4ZNXA 4N0AC 1EX4A 2COWA 1EFNA 2EPDA 1K1ZA 2EQJA 1IHWA 4M7DA 3M9QA 4M7AG 2DEQA 4HCZA 3R6OA 1N8RU 3FEOA 4OMNA 3M5AA 1PSFA 3JCMc 1R8OB 2A08A 2EW3A 2M16A 4C8QE 5GAMf 1U8RA 4PJOC 1TS9A 1UFFA 2ATCB 2KK4A 4AG1C 3PVQA 3L2WA 2DEUA 2YXYA 3HSBA 4X34A 4D8DA 3L2QA 3CPWP 1WA7A 2KXCA 3CPFA 2QTXA 2WSCE 2X3XD 2QYZA 2DTHA 1RAEB 2DTOA 3ASKA 3P8BB 3V8JA 3VYGA 4C92B 2CSQA 2KT8A 4PK4A 4F14A 3GOXA 1VQKA 4R0KA 1M2OA 3E1SA 2ZPHB 2RI2A 4C8QG 4M77F 2QDYB 2RD1A 5GAN3 1VQPA 4LD6A 2FZKB 4WCIA 1VQ9Q 1D1BA 2CZ7B 4BDZA 4B9XA 3SWNC 5LJ3g 3X28B 1X69A 1OZ3A 3M0QA 1ZSGA 3OYAA 2YUNA 4A4GA 1NJIC 4WF2A 5IXBA 2EKOA 1Q95G 1TUGB 1ZUKA 2EGAA 1ZQ1A 3U23A 1YHQA 4M4ZA 1U1TA 3JCMg 3KBGA 1IGQA 4JRIA 2MCNA 5CKHA 3UATA 2CP5A 4IURA 1VQLT 1Z9ZA 4ORZA 4V2SA 2DL7A 4QQGA 1OULA 1M9SA 3FJPA 3OA6A 3JV3A 3N5BB 5FU6B 1AOJA 4CC2A 1Q7YR 2V1QA 1K8AR 2GQVA 4X1VA 2OJ2A 1AZEA 2GTJA 1G5VA 3VU3C 2RPNA 2VB6A 3E9GA 2VV5A 1HXDA 2HSEB 2RNAA 5A0DA 3I56A 4XU2A 2D8HA 1T0JA 2RK1A 2FL7A 1VQNA 2KT1A 4ZN3A 3GIBA 2OAWA 4OVAA 3JB9H 1S72Q 5L8RE 1H92A 1ARKA 1AWOA 2LX9A 3O8VA 2YLBA 2M9UA 2NWMA 2RJEA 4BY6B 1WHGA 4YTLA 5CVIA 4LN2A 1HD3A 4QT7A 2NUZA 1KD1U 1XNIA 2C06A 2DF6A 1M90R 1NBEB 3MEAA 4IUUA 4BE0A 1ZX6A 1VQ9T 3VS3A 3C95A 2QGFB 3QWYA 1KD1R 3V7SA 3JB9J 3OYYA 3OSVA 4BI8B 1R77A 1D3BA 2EQUA 3C4SA 3QUIA 1QKWA 3M0SA 3META 2DXTA 5CKEA 3HPWA 3REBB 4GLMA 4FIBA 2MWOA 3OYMA 5DLOA 3CCQQ 3CCEQ 4JRKA 3VS6A 4DBRA 1K0SA 1UEBA 1YCSB 2XDPA 2G6FX 2DTIA 5IHNA 2QTVA 2RQTA 3RERA 4M7DE 3VJPA 4M78C 1WJRA 4FW2A 4FYVB 1VYUA 3ME9A 1VQKT 2BE9B 1QVFP 2Y4YA 2YUQA 1KG1A 3M55A 2JTEA 2LQNA 4M77D 3OYIA 1OU8A 2F69A 1WXBA 1Z9QA 3M58A 2KQWA 3WXMB 3CQTA 3OYHA 2XIDA 1JEGA 2DJQA 2HD0A 3PFSA 1Q82U 3OYEA 3RMQA 2GTOA 3JSCA 2ZGWA 3OSSC 2LC4A 2L3PA 4DEYA 3TQ7P 1K9MR 2VGMA 1OX9A 2DZCA 3JRZA 4J6YA 4E6RA 4RTXA 2LP5A 2COYA 2DL3A 4ZGDB 2EAYA 4L5GA 4C92E 5GANg 1UDLA 2FZCB 3JCMV 2X4YA 3J81E 1NPRA 4P5NA 1NEBA 2KBTA 3M54A 5FW9A 4CC7A 2ZPIB 1QP3A 3TREA 2DBKA 4C0FA 2CP6A 2DXCA 4FYXB 1Y07A 2KEAA 2R5AA 3CCVA 2H3JA 2C0OA 5LJ5d 3G1JA 2ROTA 4OB1B 1JJ2A 1OPLA 1PKSA 2E1HA 2BUDA 3JCMb 1UGPB 1YN8A 3OYBA 2RHIA 5GMKm 4IIMA 4II1A 1YHQQ 1WHLA 2CDTA 4JLIA 1WHMA 4C0DC 4MZMA 1SSHA 3M53A 3X24B 1BI2A 3FC3A 4FM4B 1PRLC 4J9IA 4D8KA 1HJDA 3OYNA 5IAYA 2QEXT 1VQ8T 1OPKA 1V29B 2KVQG 4UC4A 1MNEA 2PQWA 1VQ5A 3M0TA 5HK0A 1QP2A 2HSPA 1OZ2A 3OW2A 4RCCA 4HCCA 3JCMQ 2EIFA 1I07A 4DOVA 4BE2A 5D6WA 3L2VA 4CC4B 1SPKA 3V8LA 3CBOA 1RAAB 5CKFA 3DLLA 1SF9A 3CPWA 4PJOE 3UWNA 3M57A 3CCJQ 2L89A 4QVDA 4HT9A 2O9SA 1T0HA 2R5MA 4BB7A 2P4RA 2FHDA 1QVFA 4ESRA 3CCUQ 1VQ6A 4C92F 5GJWB 5M9OA 3A8GB 1K8AU 1GCPA 1KQ1A 1NJIU 1RL2A 1JB0E 1SHFA 2M1HA 2QQ9A 3A98A 3HRSA 3CBPA 4M7AC 1UB4A 2J6KA 1UG1A 1WQ7A 3CC7Q 3PT9A 1BK2A 2DX1A 1GXIE 2LVMA 3VUBA 2X4JA 2EJGA 2OAUA 2FG0A 3AT1B 2PUKB 4DEXA 1S72T 4AFQC 3A8HB 4Z02A 2AHJB 2RJDA 1CKAA 4M78A 2DKGA 2QGGA 1W6XA 5GAOp 3RKWA 1K76A 3NTHA 5CKDA 1VQNT 4BUGA 1M3AA 3HKSA 2SEMA 2KDSA 4QVZA 1Q81R 1VQ4Q 1M2VB 1C1AA 2L0AA 2VYTA 2KMTA 5D6YA 1OEBA 3BDUA 5GAMj 4OB3B 4C8QC 1YJWA 1VQ7A 3UT1A 3T9NA 2ED1A 2LNHB 5CK9A 2VUBA 1UHFA 1X6OA 1PHTA 1OOTA 2KR3A 1FYNA 2D1XA 3TU4K 3HP9A 1IGUA 1JJ2S 1J3TA 5LJ5f 1QLYA 8AT1B 5IHKA 1MNDA 1QKXA 1YNZA 2RK2A 1ACMB 4F7UE 3GBQA 3L1AA 1K8AC 2RO0A 1B7TA 1VQ5T 4C0DB 1CSKA 5GAN5 2XKOC 4PFZA 4D6WA 1GBRA 2X4WA 1M90U 2HEQA 5C6SA 5L23A 2RHXA 5GMKh 4LD9K 1N8RR 1SRLA 1YITA 1YCYA 3OS0A 2E12A 4JJCA 5LJ5j 4J7IA 4ELYC 2ZZDA 3CCMQ 3V7CA 3I55Q 2CS7A 1GCQA 1ZUUA 5CAIA 1WJSA 3QXEB 1B34A 2DVJA 2VXFA 3FIFA 1SEMA 1OU9A 4PJLA 5GMKl 3AHUA 1UE9A 5IHIA 2HZYA 1D0XA 2DETA 4L59A 2OTJT 3MPUB 2X9HA 3ZBDA 3CCUA 3PIPA 1VQ8Q 2L3RA 2RB6A 3L2ZA 1KQSA
chains in the Genus database with same CATH topology
3E1SA 2HBPA 2ZPHB 4M78B 5C0MA 2RI2A 4BI4A 3L2UA 4XTYA 4M77F 3X20B 3SD4A 4C8QG 2QDYB 2RD1A 4M78D 1NPPA 4PJOG 1I5LA 4N4GA 5GAN3 1VQPA 3NFCA 5FU7C 1Q86C 3P8DA 2F5TX 4LD6A 1W4SA 2KY9A 1VQLA 3Q1JA 2K3XA 4PNOA 5GAN2 3CCJA 4N4HA 2CZ7B 2XU8A 4C92D 4BDZA 4B9XA 4M75C 3GF5A 2E10A 1VIFA 4VUBA 2K4YA 3SWNC 1Y71A 4BI3A 1BI1A 3X28B 5LJ3g 3SWNA 1OZ3A 1ZBXA 2QEXA 4M75D 1QVGS 3OYAA 2VGNA 4HKEA 3QHSA 4A4GA 1NJIC 4R56A 4JRPA 3E9FA 4WF2A 1M1KC 2EKOA 1K9MC 2K57A 3CCEA 1KQSS 3LLRA 3LWIA 2PU9B 3CMAA 3OS1A 1Q81C 3I55T 2MWPA 4KT0E 4J7FA 5LJ5g 3CCQT 1ZQ1A 4OB0B 1YHQA 3I56T 3OBYA 3FRNA 1U1TA 3JCMg 4C92C 4F7UG 1M4ZA 2RH2A 3RKYA 3KBGA 3QO3A 4C0GA 3JCMP 5KCOA 2E41A 4JRIA 4DOWA 4PLLA 4IUQA 5CKHA 1H3ZA 2V8KA 1D3BB 4IURA 1VQLT 1VQPT 4M7AF 3X26B 5GAOl 4V2SA 4XU1A 4QQGA 1M8VA 5GANd 1M9SA 1TH7A 3FJPA 3OA6A 1M5Q1 5GANh 3N5BB 4M7DG 5FU6B 3CC4T 1XQHA 2MMPA 2EJFA 3CBMA 2ZPGB 2X4XA 2RM4A 4N0AA 4F7UB 4A53A 4JJNK 4JRQA 4PJOD 3C94A 3MO8A 2GQVA 4A4KA 5FU7B 3TEEA 4C8QB 4E7KA 1G5VA 3VU3C 4C0ZA 3CD6T 2EFIA 2LNVA 2RJCA 3E9GA 5GAOq 2VV5A 1HXDA 2DD4A 1N9SA 1VIEA 3X25B 1GXIE 4LDYA 1S72A 3CC7A 5DY9A 1YHQT 3EFRA 3CEYA 5CO7A 2I2LA 3FLGA 2JNGA 3MEVA 5A0DA 3I56A 2E5QA 4XU2A 1BI3A 1FWZA 2E6NA 1ZHIA 3CC2T 5GMKi 1BKBA 2K5LA 4C5EA 1IREB 3OW2S 2HNIA 2K2VA 1VQMT 3GLXA 1M90C 2RK1A 1UGRB 2FL7A 4ELZC 2PVGB 5CCAA 1VQNA 1NE8A 1OI1A 3L2RA 4ZN3A 3GIBA 2QQRA 4OVAA 3JB9H 3GNFB 3P8HA 5L8RE 1WGSA 5A0GA 5LL6S 1P92A 3CMEA 3CCSA 4M78E 4C8QF 4OF1A 5I2SA 3SWNB 2L8DA 3QDRB 1JBMA 2LX9A 3O8VA 5GAOr 3MP6A 2YLBA 3SB2A 4XTXA 2M9UA 2RJEA 4BY6B 4C8QA 3C12A 4YTLA 5AYFA 5CVIA 2WACA 3RUXA 4M7DF 2V8IA 2LQKA 4HCBA 3CCMA 4QQ6A 1KD1U 1XNIA 4L6V5 3NTIA 2E6ZA 4M7AB 3QIIA 3G4SA 2MAMA 2C06A 2GFUA 2P0KA 3S6WA 3J7AF 3MEAA 4BE0A 4IUUA 1VQMA 4FSXA 4B9WA 3E19A 4ZTFA 2HQXA 4J8OA 1VQ9T 1LNXA 2EWNA 4RG2A 4OGEA 4J5YA 3C95A 2XK0A 1MGQA 3QG1A 4XTVA 3JB9I 4EMGA 2DJZA 2YRVA 3DLMA 2LTOA 3V7SA 1KHCA 3OYYA 3JB9J 4M7AE 4XQ3A 4E7JA 4NL3A 1MHNA 3OSVA 4FL6A 4BI8B 3BDLA 5LJ3j 4MDXA 1Q7YU 1HK9A 2DD5A 1D3BA 2EQUA 3C4SA 4HA8A 2DK3A 3WVDB 3CXCS 2QQBA 3QUIA 3QJYA 3QPHA 5DLQE 5GANe 3META 2DXTA 5CKEA 4FU6A 2XICA 4Q5WA 5CQXA 4IUPA 1VQ6T 2QXFA 3HPWA 1VUBA 1RI0A 4FIBA 2MWOA 2DPPB 3QBYA 4M75E 4XU0A 3OYMA 5GMKe 5DLOA 3G71T 2XDBA 4JRKA 3G4ST 1X01A 2IVWA 4F7UA 1UEBA 2XDPA 4J6XA 4KUDK 4KULA 4C5IA 2GF7A 3HRUA 2DTIA 2RI3A 2P0QA 2V8JA 3MP8A 2EQKA 1G3TA 2ZPFB 4ME7A 4NS5A 3HL8A 4LDUA 3RERA 2FVUA 4M7DE 3VJPA 4M78C 3UPUA 1WJRA 3OQ5A 4C8QD 3ME9A 4A54A 3GP8A 1VQKT 3JCMh 4QVCA 1YJNA 2RI5A 1YIJA 2CZ6B 3A8OB 2Y4YA 2P4TA 3URGA 2HAXA 2K5IA 3CC7T 3OB9A 1KG1A 1KD1C 3M55A 4M77A 3OY9A 3S3MA 3G7ZA 2DIQA 3LWHA 2LT1A 4M77D 5GAN8 3OYIA 2F69A 4XTWA 2LQ8A 4XTZA 4IUVA 4KUIA 3M58A 3S3OA 3L42A 4XTUA 2KQWA 2X35A 3WXMB 4PL6A 5LJ3h 1FX7A 3OYHA 2PVDB 2XIDA 4RKUE 3JCMJ 1M1KU 4LDWA 5FROA 3ZFJA 4ZGEB 3GPLA 4E7IA 3CPWS 2FYKA 2HD0A 3PFSA 1Q82U 3OYEA 3QZ5B 3RMQA 4PJOB 2YLCA 3OYCA 1VQ4A 3JSCA 2ZGWA 3OSSC 3CC4A 2XI9A 2LC4A 5LJ3f 3CCUT 1KC8U 4M77C 3VV0A 5IN1A 3ZEHA 1YJWT 1VQOT 1VQ7T 2XD0A 3I55A 2VGMA 2L5QA 1Q7YC 3S3NA 3JRZA 2DZCA 3QYHB 3JCMd 4J6YA 2ZCFB 1Y7XA 4LDVA 4M77B 3LGLA 4M75F 4EPCA 1YIJT 1NZ9A 2OTLT 4ZGDB 1Q82C 3JCMW 2EAYA 4L5GA 4C92E 1KHIA 5GANg 4E7LA 1M1GA 1K9MU 3JCMV 2X4YA 3JCMe 2D9TA 3FDRA 5GANf 3F70A 3J81E 1YJ9A 2E65A 1QVGA 1KC8C 2YHTA 3DB4A 4EDUA 2M0OA 3HRTA 3CC2A 1NPRA 3PMTA 4P5NA 2ZPBB 4JDSA 4CRIA 2ZPEB 3RESA 3V7RA 1LJOA 2K5FA 2QQAA 3M54A 5IT9E 1W2BA 5LJ5h 2ZPIB 1QP3A 3TREA 5J26A 4PJOF 3UDCA 4M78G 4C0FA 4BDYA 3LW5E 2DXCA 3A8MB 3OYFA 1Y07A 4F7UF 5A0LA 3CCJT 2D6FA 4DQ2A 2R5AA 3CCVA 4BY6C 5FRNA 3BW1A 1VQ4T 2A3LA 1N6AA 1G3SA 2H3JA 5KE3A 4C5HA 4CI0C 2CKKA 5LJ5d 2CZ1B 5GAMg 1Y96B 1VQOA 4OB1B 2MF2A 5GMKj 4OMFB 1JJ2A 3HFNA 3J80E 3V8KA 3GNGA 2E1HA 4M75A 3CCMT 2BUDA 3M56A 2DXUA 2XHCA 3JCMb 5GANj 3CCET 4HT8A 1UGPB 3A8LB 3OYBA 4PKCC 1DJ7B 2RHIA 3PGGA 5GMKm 1BYMA 2XDDA 5CQYA 1G3YA 3CCQA 4NOYA 2CZ0B 4II1A 4OP0A 4M75G 4ATOA 4NL2A 2KAFA 2A7YA 2NLUA 4J6WA 4JLIA 4OGCA 3QZ9B 3CMET 4C0DC 4MZMA 2E64A 3PTAA 2LCCA 3M4YA 2WSEE 3M53A 3X24B 1BI2A 3FC3A 2VXEA 4FM4B 2RHYA 3OMGA 4FT2A 3JB9G 1XTDA 4M77G 1KQ2A 4MMLA 1OYXA 3MEWA 1XOVA 5IAYA 3OYNA 2QEXT 3DB3A 1VQ8T 3M59A 3WVEB 4C5GA 4LDXA 4PJOA 1V29B 2KVQG 4UC4A 2RJFA 2PQWA 3G71A 4MDWA 1VQ5A 3EAEA 5HK0A 3ER0A 1QP2A 4MMKA 2OTJA 5I21A 3CMAT 1OZ2A 4A4EA 4RCCA 3OW2A 1VQ9A 4HCCA 2DIGA 3KUFA 4MZTA 4X9DA 3JCMQ 2EIFA 4DOVA 4E7HA 3QSUA 4JS5A 5A2QE 4BE2A 5D6WA 5HKCA 3L2VA 3RIRA 5GAOm 1FXXA 4A4FA 2DXBA 3V8LA 3CBOA 5CKFA 2JN0A 3DLLA 3CPWA 3RKXA 4PJOE 3UWNA 5KCHA 3JAME 1H641 1I4K1 3M57A 2L89A 4QVDA 4HT9A 3G6ET 2R5MA 4BB7A 4E47A 5LJ3e 1G3WA 2G3RA 3CCLA 1BI0A 2FHDA 1QVFA 2LCLA 4TVRA 3VYHB 1VQ6A 4C92F 4M7DC 5M9OA 3A8GB 1K8AU 3CXCA 1KQ1A 1NJIU 1O75A 1BIBA 1RL2A 3A5ZB 1K73C 1JB0E 2M1HA 3QYGB 1B34B 5LJ3d 2EJ9A 4GLKA 4EMKA 2QQ9A 3HHTB 3HRSA 1WQWA 3CBPA 3CCRA 5FRMA 2JOYA 4M7AC 1UB4A 3OYKA 3JCMf 1VQ8A 5GAN7 1I81A 3CCST 2RA2A 4QQDA 3JB9F 4ZGJB 1WQ7A 3PT9A 4M7AD 2LDMA 5LJ5e 4GY5A 3TCJA 2OTLA 1YI2T 2FB7A 2LVMA 3FB9A 2X4JA 1U1SA 2EJGA 3LYIA 3VUBA 2OAUA 1Y96A 4C92A 3DKMA 1W2BS 4BE1A 2BIVA 1LOJA 1X75C 2PUKB 4RCBA 3LGFA 1YJ9T 1S72T 4RG8A 2Y4XA 3A8HB 3OYDA 4Z02A 2AHJB 2R57A 2RJDA 1WJQA 3NTKA 4M78A 2DKGA 2IG0A 2QI2A 3OBWA 5GAOp 5HK3A 3EFSA 3RKWA 3NTHA 5CKDA 2O4XB 4XK8E 3SFMA 3KXTA 4ZN1A 4BACA 1VQNT 2DO3A 4OB2B 2XG8D 1BIAA 3OYJA 4IKFA 5HY6A 4BUGA 3HKSA 4QVZA 2KDSA 5EG2A 2F5KA 5DM7R 3CCLT 4JUVA 3QJ6A 2JTMA 4Y91A 2QA4A 2CGHA 3PIOA 1Q81U 3MP1A 4ZTJA 2VYTA 4JLGA 2VC8A 4EMKB 2WSFE 3CCVT 2KMTA 4MZPA 1K73U 2RHUA 4O6JA 5GAOn 5GAN6 3LH0A 2EYQA 5D6YA 1QVPA 4FT4A 3BDUA 3CCRT 2JVVA 1EIFA 3BY7A 2JTFA 5CKBA 2E70A 3BFMA 4OB3B 2GCXA 3OS5A 4C8QC 5GAMj 5FLXE 2PUOB 3H8ZA 5KH6A 3VUZA 2JUFA 1YJWA 1YI2A 1N8RC 1VQ7A 3UT1A 4O5VA 2BKDN 4M77E 3T9NA 5D6XA 1YJNT 3LX7A 5CK9A 2VUBA 3OYGA 1X6OA 1M1FA 1N9RA 3TU4K 2LRQA 3HP9A 3M4GA 3MHXA 2GFAA 4Y28E 1JJ2S 4J83A 2DAQA 4M7DD 3PNWC 5LJ5f 3JB9D 1QW1A 2O01E 5I2MA 5GAMe 3VKIA 3OMCA 4KBMB 1PSEA 2QA4T 3INZA 1JRIA 2RK2A 4F7UE 3CD6A 3L1AA 2EQMA 2PVOB 1K8AC 1QVFS 2RO0A 1N27A 1VQ5T 4IUTA 3H6ZA 4C0DB 1Q86U 5GAMd 5GAN5 1UGQB 2XKOC 3RMSA 5GAN4 4C92G 1WNLA 1YBYA 4D6WA 1UGSB 2X4WA 4QW2A 2CYZB 4BD3A 4EMHA 1M90U 4M7AA 1SSFA 4XAXB 3SDZA 2R58A 5GAMh 2JZ2A 5C6SA 2DVEA 4EMKC 2D0QB 2P0PA 2RHXA 3QKJA 4N0AC 4XU3A 5J39A 5GMKh 4LD9K 3OS2A 4DA4A 1YITA 4JS4A 3OYLA 1I8FA 2QQSA 5CR2A 2EQJA 2KSSA 4M7DA 3M9QA 4M7AG 2DEQA 4M75B 4HCZA 1YCYA 3R6OA 1N8RU 2B8AA 3FEOA 3MEUA 3JCMX 1IZ6A 2O4XA 4RMOA 1PSFA 1R8OB 2M16A 2MI6A 3M5AA 4M78F 3JCMc 2Y90A 2E12A 4C8QE 5GAMf 3OS0A 1U8RA 4PJOC 2KK4A 4J7IA 4X9CA 4ELYC 3PMIA 5LJ5j 2ZZDA 2HQEA 3V7CA 3L2WA 2CS7A 4N4IA 1AHJB 3HSBA 2DZ9A 5FU6C 4X34A 3L2QA 5CAIA 1WJSA 3G6EA 3QXEB 1B34A 2VXFA 3FIFA 3CPFA 5GMKl 5CIUA 1YITT 5J3BA 3AHUA 2K3YA 2QTXA 4A4HA 2WSCE 4R55A 2DTHA 1WPYA 4L59A 3MCAB 2OTJT 2DTOA 3ASKA 3P8BB 3ZBDA 3V8JA 2RHZA 3VYGA 4PLIA 4C92B 3PIPA 3CCUA 5KE2A 2L3RA 2RB6A 3L2ZA 1VQKA 3GOXA 4M7DB 1O9SA 1KQSA 2LT4A 3HFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWH A;  4R55 A;  3KXT A;  3LWI A;  4R56 A;  2JTM A; 
#chains in the Genus database with same CATH topology
 2M02 A;  2CUB A;  3SD4 A;  4M78 D;  1NPP A;  2QG9 B;  1VQL A;  3P8D A;  2RQR A;  1D09 B;  1I5L A;  2K3X A;  2EYX A;  1EZZ B;  3GF5 A;  1VIF A;  2K4Y A;  3SWN A;  2JW4 A;  1QVG S;  2VVK A;  1G8X A;  2HKN A;  3QHS A;  4JRP A;  3LLR A;  2PU9 B;  2E3H A;  1W1F A;  4KH0 B;  1Q81 C;  3G71 Q;  4KT0 E;  5LJ5 g;  2XMF A;  3RKY A;  3QO3 A;  1QWF A;  2E41 A;  4DOW A;  1H3Z A;  1VQP T;  4Z88 A;  1M8V A;  1TH7 A;  3SEM A;  5GAN h;  3CBM A;  4JRQ A;  2RM4 A;  4F7U B;  1XJW B;  4A53 A;  3C94 A;  3EHQ A;  1OX8 A;  4A4K A;  4JPB W;  5GAO q;  2X51 A;  3EG9 A;  3X25 B;  1S72 A;  3EFR A;  3CEY A;  3SHW A;  2I2L A;  3MEV A;  3KFV A;  1FWZ A;  1BI3 A;  5GMK i;  2DFU A;  3MJX A;  1IRE B;  3RBB B;  2HNI A;  1VQM T;  2RN8 A;  4ELZ C;  1OI1 A;  3L2R A;  1UHC A;  2QQR A;  1RAC B;  3P8H A;  1WGS A;  2CH4 W;  5LL6 S;  3CME A;  3CCS A;  2DNU A;  4M78 E;  5I2S A;  4E7S A;  3HTR A;  1JBM A;  3SB2 A;  4C8Q A;  3EG2 A;  3C12 A;  5AYF A;  1T3L A;  3RUX A;  4L6V 5;  3NTI A;  2E6Z A;  5KYN A;  3QII A;  3G4S A;  2MAM A;  1KFZ A;  4B9W A;  2HQX A;  4J8O A;  1VQN Q;  1LNX A;  2EWN A;  2DER A;  3CCR Q;  3QG1 A;  1MGQ A;  3JB9 I;  1U5S A;  2V26 A;  1KHC A;  4E7J A;  1M30 A;  1Q7Y U;  3I35 A;  2GGR A;  2DK3 A;  1TUD A;  1MV3 A;  2DLP A;  4Z89 A;  2XIC A;  4Q5W A;  4XU0 A;  1RI0 A;  4M75 E;  3QBY A;  1WIE A;  2JXB A;  5GMK e;  2IIM A;  3VRZ A;  2GQI A;  1MMD A;  4J6X A;  2YRD A;  2GF7 A;  3HRU A;  3EGD B;  2RI3 A;  2P0Q A;  2V8J A;  2EQK A;  2ZPF B;  4NS5 A;  3TSW A;  3HL8 A;  2F2V A;  3UPU A;  5KYX A;  3OQ5 A;  4C8Q D;  3GP8 A;  1YIJ A;  2CZ6 B;  3URG A;  2HAX A;  2AIR B;  2K5I A;  3OB9 A;  3CXC P;  3S3M A;  3G7Z A;  2A37 A;  1UTI A;  3UA6 A;  2LQ8 A;  4IUV A;  3S3O A;  2YUO A;  5KYY A;  1M2V A;  2X35 A;  2MK5 A;  5FRO A;  5HCK A;  3ZFJ A;  4ZGE B;  5EC7 A;  2HL5 C;  4Z8A A;  1KK7 A;  3OYC A;  1VQM Q;  2HQH A;  3CC4 A;  5LJ3 f;  3CCU T;  1KC8 U;  4M77 C;  5IN1 A;  2XD0 A;  4RTT A;  1VQO T;  1WHJ A;  3JCM d;  2K6D A;  2EKH A;  2W10 A;  1PWT A;  1Q82 C;  4E7L A;  2NUP B;  5KYU B;  3CC7 T;  2D9T A;  1QVG A;  2ESW A;  1GFD A;  2DL5 A;  3CC2 A;  4JDS A;  1YJ9 Q;  1ZSZ C;  2DIL A;  4HVU A;  5IT9 E;  1W2B A;  5J26 A;  3UDC A;  4M78 G;  2HL3 A;  3A8M B;  1D0Z A;  4BY6 C;  3BW1 A;  3CCL Q;  3THK A;  4FYW B;  1G3S A;  5IXF A;  4C5H A;  4CI0 C;  5GAM g;  1VQO A;  2YSQ A;  2A36 A;  1RI9 A;  1KJW A;  3GNG A;  3CCE T;  5GAN j;  2DYB A;  1DJ7 B;  5CQY A;  1G3Y A;  3CCQ A;  2CZ0 B;  2AK5 A;  4ATO A;  2A7Y A;  1NLP C;  1AD5 A;  3QZ9 B;  2EQI A;  3CME T;  1VA7 A;  2EBP A;  4RTY A;  2WSE E;  3RNJ A;  2COZ A;  2AZV A;  2D0N A;  1OYX A;  2M51 A;  1WI7 A;  3EFO B;  4AG2 C;  2RJF A;  1SG5 A;  1FMK A;  1FMW A;  3ER0 A;  2OTJ A;  5I21 A;  4A4E A;  1VQ9 A;  3KUF A;  4MZT A;  4E7H A;  5HKC A;  3RIR A;  5GAO m;  4A4F A;  1M3B A;  3ULR B;  1G3W A;  1BI0 A;  4TVR A;  4J9B A;  4F04 B;  1GRI A;  1PD1 A;  3CC2 Q;  3CXC A;  2FPE A;  1O75 A;  1BIB A;  4HVV A;  1X2Q A;  1KSW A;  5LJ3 d;  1YP5 A;  3O5Z A;  1WQW A;  2YRC A;  3CCR A;  2BTT A;  3OYK A;  3JCM f;  1RLQ C;  1I81 A;  4QQD A;  1LPL A;  3G4S Q;  4M7A D;  4GY5 A;  3TCJ A;  2H3E B;  3LYI A;  1Y96 A;  5KYW B;  3DKM A;  1W2B S;  1X43 A;  1B07 A;  2O31 A;  1YJ9 T;  2Y4X A;  3OYD A;  1WJQ A;  1K9A A;  2IG0 A;  2QI2 A;  3D7S B;  3OBW A;  4J9F A;  3EFS A;  2O4X B;  3SFM A;  4ZN1 A;  1BIA A;  3OYJ A;  2JS2 A;  2C0T A;  5HY6 A;  4AFU C;  5DM7 R;  3CCL T;  4JUV A;  3QJ6 A;  2QA4 A;  5GJV B;  4JLG A;  2VC8 A;  3VS5 A;  2RHU A;  4O6J A;  5GAO n;  2EYQ A;  4FT4 A;  1UJY A;  1AZG B;  2JVV A;  1EIF A;  2DE0 X;  4E2F B;  1FMV A;  1NEG A;  1VQ6 Q;  1QQJ A;  2GCX A;  1NYG A;  3H8Z A;  2JUF A;  1N8R C;  2AKL A;  2E5K A;  3LX7 A;  1WXU A;  2CRE A;  3MHX A;  4K11 A;  2GFA A;  4Y28 E;  4J83 A;  3PNW C;  2OX7 A;  1QW1 A;  5I2M A;  5GAM e;  4DBQ A;  4IIO A;  3PVL A;  3INZ A;  1QVF S;  4IUT A;  1MMA A;  2O88 A;  1QWE A;  1WNL A;  2HMA A;  4QW2 A;  4EMH A;  4XAX B;  2R58 A;  5GAM h;  2JZ2 A;  1RLP C;  4RTW A;  2DVE A;  5J39 A;  1UEC A;  3QKJ A;  3OS2 A;  4DA4 A;  1WXT A;  2ROL A;  4JS4 A;  3EG1 A;  4FCY A;  1LVK A;  1PNJ A;  4M75 B;  4CC3 A;  2B8A A;  1WX6 A;  3MEU A;  3JCM X;  2MI6 A;  2BE7 D;  2NYS A;  2Y90 A;  2JT4 A;  1MMG A;  4X9C A;  1S1N A;  3PMI A;  3CCS Q;  1X6B A;  4N4I A;  1AHJ B;  2HKQ B;  1BCO A;  2DZ9 A;  5FU6 C;  2QAZ A;  3G6E A;  5CIU A;  1X6G A;  1VQK Q;  2K3Y A;  3M0P A;  4R55 A;  1SRM A;  2OTL Q;  2J06 A;  5KE2 A;  2LJ3 A;  1X2K A;  3TSZ A;  1M3C A;  2LT4 A;  2LX7 A;  4M78 B;  5C0M A;  2ZAE A;  4BI4 A;  3L2U A;  2YDL A;  6AT1 B;  4N4G A;  3NFC A;  1Q86 C;  1W4S A;  2KY9 A;  1JO8 A;  2L3S A;  3I9Q A;  1F1B B;  3Q1J A;  4PNO A;  1YWP A;  4N4H A;  4M75 C;  2E10 A;  1JU5 C;  4VUB A;  1AWW A;  4Y92 A;  2DYI A;  2VGN A;  4HKE A;  4F16 A;  3E9F A;  1M1K C;  2F2X A;  1K9M C;  2K57 A;  1KQS S;  3LWI A;  3OS1 A;  4LNP A;  3I55 T;  3CCQ T;  1YFN A;  4OB0 B;  3OBY A;  1AWX A;  3FRN A;  4C92 C;  3TVT A;  4F7U G;  1M4Z A;  1V76 A;  4LUD A;  4C0G A;  4PLL A;  1G2B A;  4IUQ A;  1D3B B;  4M7A F;  5GAO l;  3REA B;  4JJB A;  4J9G A;  1M5Q 1;  2ECZ A;  2IPO B;  1XQH A;  2MMP A;  1BU1 A;  2ZPG B;  2X4X A;  4PJO D;  3E2U A;  3MO8 A;  4FSS A;  5FU7 B;  3TEE A;  2DL4 A;  2KYB A;  2LNV A;  1WYX A;  2ABL A;  1AVZ C;  1LCK A;  1VIE A;  1PKT A;  2X3W D;  1PC0 A;  3CC7 A;  5DY9 A;  1YHQ T;  3FLG A;  2M0Y A;  2SRC A;  2E6N A;  1BKB A;  2K5L A;  4C5E A;  2LZ6 B;  1CKB A;  3OW2 S;  2K2V A;  3GLX A;  1M90 C;  2PVG B;  1NE8 A;  3GNF B;  4KGZ B;  3VRY A;  5A0G A;  1P92 A;  2K79 A;  2F2W A;  4C8Q F;  1N5Z A;  2KRN A;  2L8D A;  2BZY A;  3QDR B;  5ECA A;  5GAO r;  3MP6 A;  4XTX A;  4M7D F;  4JJD A;  4HCB A;  2QK0 A;  1KIK A;  3CCM A;  4QQ6 A;  2FPD A;  2KRS A;  2RMO A;  2GFU A;  3S6W A;  1VQM A;  4AMC A;  3BE3 A;  3E19 A;  4ZTF A;  5KYX B;  4XTV A;  4J5Y A;  2XK0 A;  2YRV A;  3DLM A;  2LTO A;  2V1R A;  4M7A E;  4XQ3 A;  4NL3 A;  1MHN A;  1R0C B;  4FL6 A;  4MDX A;  1HK9 A;  1PM3 A;  2DD5 A;  1YJN Q;  2B86 A;  3WVD B;  1JJ2 P;  5DLQ E;  2QQB A;  3QJY A;  5GAN e;  3EGX A;  4FU6 A;  1VQ6 T;  4IUP A;  2QXF A;  2XDB A;  1K0X A;  2FEI A;  5IH2 A;  1X01 A;  2IVW A;  3EG0 A;  4KUD K;  1MUZ A;  4KUL A;  2FPF A;  3MP8 A;  3UF4 A;  1G3T A;  4ME7 A;  4LDU A;  3C0C A;  4J9E A;  1IXD A;  1VQ5 Q;  1ABO A;  1HSQ A;  2RI5 A;  2P4T A;  2J6F A;  4LE9 A;  2DIQ A;  5GAN 8;  4XTW A;  4XTZ A;  2CT3 A;  4PL6 A;  1PRM C;  2DA9 A;  2K2M A;  2PVD B;  5AT1 B;  1M1K U;  1TG0 A;  1TU0 B;  3CPW S;  2FYK A;  2VKN A;  3QZ5 B;  1JQQ A;  4PJO B;  2MPX C;  2YLC A;  3VS1 A;  2A28 A;  2CSI A;  2XI9 A;  3VV0 A;  2KYM A;  3CME Q;  2J7I A;  1RAF B;  2L5Q A;  1HYO A;  4LDV A;  1RAD B;  4M77 B;  2JMC A;  3LGL A;  4KH1 B;  4EPC A;  1YIJ T;  1NZ9 A;  2OTL T;  1M1G A;  4A63 B;  3FDR A;  1YJ9 A;  1KC8 C;  2KE9 A;  1KC8 R;  2YHT A;  3DB4 A;  5I22 A;  4EDU A;  1YIT Q;  3HRT A;  3PMT A;  4CRI A;  2YWW A;  2ZPE B;  2K5F A;  4KRT A;  3LH5 A;  5LJ5 h;  4PJO F;  2JS0 A;  2FO0 A;  1D1A A;  3LW5 E;  5A0L A;  2D6F A;  1VOM A;  5FRN A;  1VQ4 T;  3CC4 Q;  5GMK j;  4OMF B;  3V8K A;  4M75 A;  3M56 A;  2DXU A;  2XHC A;  4HT8 A;  2AT1 B;  4PKC C;  3RDV A;  4LXC A;  2MYS A;  2LQW A;  4OP0 A;  4M75 G;  4NL2 A;  4J6W A;  2BZ8 A;  2EGE A;  3PTA A;  2CP2 A;  1ZA1 B;  4LUE A;  3OMG A;  4M77 G;  1ZUY A;  3MEW A;  1XOV A;  1RAB B;  3WVE B;  4LDX A;  4JZ3 A;  1I1J A;  2CH4 A;  1BB9 A;  2QA4 Q;  3NPF A;  1I5O B;  3CMA T;  7AT1 B;  2DIG A;  1VQL Q;  3CCV Q;  1VQP Q;  2Z0W A;  5A2Q E;  2EYZ A;  1FXX A;  2DRM A;  2DXB A;  2JN0 A;  1I4K 1;  1PG5 B;  3G6E T;  4E47 A;  2FRW A;  1E6H A;  4OMM A;  2JM8 A;  1V1C A;  2LCL A;  5KYY B;  3VYH B;  3EGX B;  1D0Y A;  2W0Z A;  1K73 C;  3QYG B;  2EJ9 A;  4GLK A;  3HHT B;  4AFS C;  2JOY A;  5FRM A;  3I56 Q;  1VQ8 A;  5GAN 7;  1B3Q A;  3CCS T;  1NLO C;  2DL8 A;  2RA2 A;  3JB9 F;  1M27 C;  1YI2 T;  2FB7 A;  3FB9 A;  1U1S A;  4C92 A;  1TXQ A;  4BE1 A;  1LOJ A;  4RCB A;  3NTK A;  2L2P A;  2AZS A;  2KRM A;  2FZG B;  5HK3 A;  4XK8 E;  3KXT A;  2DO3 A;  2XG8 D;  4IKF A;  1QCF A;  1KQS P;  5EG2 A;  2F5K A;  2JTM A;  2CGH A;  3PIO A;  3MP1 A;  4ZTJ A;  4RTZ A;  4EMK B;  2WSF E;  1K73 U;  3LH0 A;  1QVP A;  2JTF A;  2E70 A;  5FLX E;  5KH6 A;  3VUZ A;  3EHR A;  1YI2 A;  2BKD N;  3ZL7 C;  5D6X A;  4PFP A;  2KNB B;  3R6N A;  1A0N B;  3A1P A;  1RUW A;  2RQV A;  1M1F A;  1WHK A;  3M4G A;  2QEX Q;  4AFZ C;  2DAQ A;  2OTJ Q;  1YI2 Q;  2QA4 T;  1JRI A;  2PVO B;  1UUE A;  1N27 A;  1T3S A;  4J9D A;  3H6Z A;  1Q86 U;  1Q82 R;  1UGQ B;  3RMS A;  5GAN 4;  2EYW A;  4C92 G;  1YBY A;  4DBH A;  2CP3 A;  4J9H A;  2CYZ B;  1BCM A;  4OMQ A;  2D0Q B;  2P0P A;  4XU3 A;  1Y0M A;  1QCN A;  3OYL A;  1I8F A;  2QQS A;  1C0M A;  5CR2 A;  2KSS A;  4OMP A;  4WTO B;  1IB8 A;  1SKU B;  1IZ6 A;  2O4X A;  4RMO A;  1VQO Q;  4M78 F;  2E4H A;  2EYY A;  2HDA A;  2HQE A;  1GL5 A;  1AEY A;  5FWB A;  1YIT T;  5J3B A;  4HVW A;  3MKD A;  4A4H A;  2BZX A;  3M0U A;  1WPY A;  3MCA B;  2RHZ A;  1E7O A;  4PLI A;  4RTV A;  3EG9 B;  9ATC B;  4M7D B;  3NMZ C;  1ZSZ B;  1O9S A;  3HFO A;  2HBP A;  2LMJ A;  1GBQ A;  2MIO A;  1IO6 A;  4XTY A;  3X20 B;  3I5S A;  4PJO G;  5FU7 C;  1M1K R;  2F5T X;  2F1L A;  2CP0 A;  3QWX X;  5GAN 2;  3CCJ A;  4RTU A;  2XU8 A;  4C92 D;  4BI3 A;  1Y71 A;  1BI1 A;  4QKU A;  2DM1 A;  1ZBX A;  2QEX A;  4M75 D;  2JJ9 A;  3EGU A;  1I0C A;  2DRK A;  2VWF A;  1U3O A;  4R56 A;  3CCE A;  2LJ1 A;  1TUC A;  3CMA A;  2I0N A;  2JM9 A;  2MWP A;  2FRY A;  4J7F A;  3VS2 A;  3I56 T;  1M8M A;  1ZLM A;  2RQU A;  1NYF A;  5I11 A;  4E7Z A;  2RH2 A;  3VS4 A;  3JCM P;  1W2B P;  5KCO A;  2JMA A;  1X27 A;  2V8K A;  3X26 B;  4XU1 A;  1UJ0 A;  2NUT A;  5GAN d;  2EGC A;  2J6O A;  4M7D G;  3CC4 T;  4N0A A;  2EJF A;  1ZA2 B;  4JJN K;  4F17 A;  2LCS A;  4E7K A;  4C8Q B;  2C0I A;  3CD6 T;  4C0Z A;  2EFI A;  2RJC A;  2DD4 A;  3NGP A;  1N9S A;  1JXO A;  4LDY A;  1Q86 R;  1H8K A;  5CO7 A;  4KGX B;  2JNG A;  2E5Q A;  3CC2 T;  1ZHI A;  4HCK A;  1OV3 A;  1UGR B;  3H0F A;  5CCA A;  1C6V X;  2E3I A;  2PTK A;  4OF1 A;  3SWN B;  3H41 A;  2EVR A;  2H8H A;  2A0F B;  1IRX A;  3EGD A;  2WAC A;  2LQK A;  2V8I A;  2ED0 A;  2DMO A;  4OML A;  4M7A B;  3J7A F;  2P0K A;  1AWJ A;  4FSX A;  4OMO A;  4RG2 A;  4OGE A;  1K73 R;  1ZSZ A;  4EMG A;  2DJZ A;  2AKK A;  2CT4 A;  3BDL A;  4HXJ A;  5LJ3 j;  4HA8 A;  3CD6 Q;  3CXC S;  2QDL A;  3QPH A;  4GBQ A;  3EH1 A;  4ANJ A;  4PFO A;  5CQX A;  1MV0 B;  1VUB A;  1R0B G;  2DPP B;  3G71 T;  2J05 A;  3G4S T;  3UA7 A;  4F7U A;  4C5I A;  1NG2 A;  4JZ4 A;  2ENM A;  1ZBJ A;  2FVU A;  1WDX A;  4A54 A;  3JCM h;  4QVC A;  1YJN A;  3A8O B;  4AT1 B;  2YT6 A;  3EH2 A;  1KD1 C;  4M77 A;  3OY9 A;  1TOV A;  3LWH A;  2LT1 A;  3OW2 P;  3NHN A;  3RR6 A;  3CMA Q;  2GBQ A;  4KUI A;  3L42 A;  4XTU A;  4FYY B;  1PCX A;  5LJ3 h;  1FX7 A;  3EG3 A;  4RKU E;  3JCM J;  4PJN A;  4LDW A;  2MOX A;  2K7A A;  3GPL A;  4E7I A;  2O9V A;  3G6E Q;  4B6M A;  1VQ4 A;  1BBZ A;  3QDF A;  1TSF A;  3ZEH A;  1YJW T;  1VQ7 T;  2HBW A;  3I55 A;  1H3H A;  1Q7Y C;  3S3N A;  3QYH B;  2OI3 A;  4EIK A;  2ZCF B;  1Y7X A;  2HCK A;  4M75 F;  2K9G A;  1YWO A;  3JCM W;  1KHI A;  4PJM A;  1K9M U;  1E6G A;  3JCM e;  5GAN f;  3F70 A;  2E65 A;  2M0O A;  3IQL A;  2ZPB B;  3RES A;  3V7R A;  1LJO A;  2QQA A;  5FWC A;  3VS0 A;  2PNI A;  1W70 A;  4BDY A;  3OYF A;  3EFO A;  4F7U F;  3CCJ T;  4DQ2 A;  2A3L A;  1N6A A;  1NJI R;  5KE3 A;  2CKK A;  2CZ1 B;  1Y96 B;  5KYW A;  2MF2 A;  3HFN A;  3J80 E;  2KRO A;  3CCM T;  3A8L B;  1OQK A;  3PGG A;  1BYM A;  2XDD A;  4NOY A;  1RAG B;  1U06 A;  2KAF A;  4OGC A;  2NLU A;  2CP7 A;  1YJW Q;  1VQ7 Q;  1WFW A;  2E64 A;  2LCC A;  3M4Y A;  2VXE A;  1JXM A;  2RHY A;  4FT2 A;  3JB9 G;  1XTD A;  1KQ2 A;  4MML A;  1YIJ Q;  3DB3 A;  3M59 A;  2K3B A;  4C5G A;  3M0R A;  4PJO A;  3G71 A;  3H0H A;  4MDW A;  4KGV B;  3EAE A;  3FJ5 A;  1SHG A;  4MMK A;  1WLP B;  1AT1 B;  1QVG P;  4X9D A;  3QSU A;  4JS5 A;  2NUP A;  2KI7 A;  1PD0 A;  5KYU A;  2D8J A;  3RKX A;  5KCH A;  2RQW A;  1MMN A;  3JAM E;  1H64 1;  5LJ3 e;  2G3R A;  2CUD A;  3CCL A;  1G83 A;  2RF0 A;  4M7D C;  3A5Z B;  1UGV A;  1B34 B;  4EMK A;  4J9C A;  2KGT A;  2P84 A;  4ZGJ B;  2LDM A;  5LJ5 e;  4FW1 A;  2OTL A;  2QAS A;  4RUG A;  2BIV A;  1X75 C;  3LGF A;  4RG8 A;  2R57 A;  3PE0 A;  1VYT A;  4DBF A;  2LJ0 A;  1RAH B;  1IHV A;  4BAC A;  4OB2 B;  2NUT B;  4Y91 A;  1K4U S;  1Q81 U;  2VAS A;  3H0I A;  3CCV T;  4MZP A;  2DBM A;  1QCO A;  5GAN 6;  3CCR T;  1D1C A;  3BY7 A;  8ATC B;  5CKB A;  3BFM A;  3OS5 A;  2PUO B;  1RAI B;  4O5V A;  4M77 E;  1NM7 A;  1YJN T;  2KXD A;  3OYG A;  1TTH B;  1N9R A;  5D7U A;  3I5R A;  1WHH A;  1Y57 A;  2LRQ A;  2L3Q A;  4M7D D;  1GFC A;  1QMC A;  3JB9 D;  2O01 E;  2PZ1 A;  3VKI A;  3OMC A;  3H9N A;  4KBM B;  1PSE A;  1VYV A;  3CD6 A;  2EQM A;  2GNC A;  1GCQ C;  2YUP A;  2O2O A;  5GAM d;  1ABQ A;  1WZO A;  4PJJ A;  1TWB A;  1UGS B;  4BD3 A;  4M7A A;  1SSF A;  3SDZ A;  3VS7 A;  4EMK C;  4ZNX A;  4N0A C;  1EX4 A;  2COW A;  1EFN A;  2EPD A;  1K1Z A;  2EQJ A;  1IHW A;  4M7D A;  3M9Q A;  4M7A G;  2DEQ A;  4HCZ A;  3R6O A;  1N8R U;  3FEO A;  4OMN A;  3M5A A;  1PSF A;  3JCM c;  1R8O B;  2A08 A;  2EW3 A;  2M16 A;  4C8Q E;  5GAM f;  1U8R A;  4PJO C;  1TS9 A;  1UFF A;  2ATC B;  2KK4 A;  4AG1 C;  3PVQ A;  3L2W A;  2DEU A;  2YXY A;  3HSB A;  4X34 A;  4D8D A;  3L2Q A;  3CPW P;  1WA7 A;  2KXC A;  3CPF A;  2QTX A;  2WSC E;  2X3X D;  2QYZ A;  2DTH A;  1RAE B;  2DTO A;  3ASK A;  3P8B B;  3V8J A;  3VYG A;  4C92 B;  2CSQ A;  2KT8 A;  4PK4 A;  4F14 A;  3GOX A;  1VQK A;  4R0K A;  1M2O A;  3E1S A;  2ZPH B;  2RI2 A;  4C8Q G;  4M77 F;  2QDY B;  2RD1 A;  5GAN 3;  1VQP A;  4LD6 A;  2FZK B;  4WCI A;  1VQ9 Q;  1D1B A;  2CZ7 B;  4BDZ A;  4B9X A;  3SWN C;  5LJ3 g;  3X28 B;  1X69 A;  1OZ3 A;  3M0Q A;  1ZSG A;  3OYA A;  2YUN A;  4A4G A;  1NJI C;  4WF2 A;  5IXB A;  2EKO A;  1Q95 G;  1TUG B;  1ZUK A;  2EGA A;  1ZQ1 A;  3U23 A;  1YHQ A;  4M4Z A;  1U1T A;  3JCM g;  3KBG A;  1IGQ A;  4JRI A;  2MCN A;  5CKH A;  3UAT A;  2CP5 A;  4IUR A;  1VQL T;  1Z9Z A;  4ORZ A;  4V2S A;  2DL7 A;  4QQG A;  1OUL A;  1M9S A;  3FJP A;  3OA6 A;  3JV3 A;  3N5B B;  5FU6 B;  1AOJ A;  4CC2 A;  1Q7Y R;  2V1Q A;  1K8A R;  2GQV A;  4X1V A;  2OJ2 A;  1AZE A;  2GTJ A;  1G5V A;  3VU3 C;  2RPN A;  2VB6 A;  3E9G A;  2VV5 A;  1HXD A;  2HSE B;  2RNA A;  5A0D A;  3I56 A;  4XU2 A;  2D8H A;  1T0J A;  2RK1 A;  2FL7 A;  1VQN A;  2KT1 A;  4ZN3 A;  3GIB A;  2OAW A;  4OVA A;  3JB9 H;  1S72 Q;  5L8R E;  1H92 A;  1ARK A;  1AWO A;  2LX9 A;  3O8V A;  2YLB A;  2M9U A;  2NWM A;  2RJE A;  4BY6 B;  1WHG A;  4YTL A;  5CVI A;  4LN2 A;  1HD3 A;  4QT7 A;  2NUZ A;  1KD1 U;  1XNI A;  2C06 A;  2DF6 A;  1M90 R;  1NBE B;  3MEA A;  4IUU A;  4BE0 A;  1ZX6 A;  1VQ9 T;  3VS3 A;  3C95 A;  2QGF B;  3QWY A;  1KD1 R;  3V7S A;  3JB9 J;  3OYY A;  3OSV A;  4BI8 B;  1R77 A;  1D3B A;  2EQU A;  3C4S A;  3QUI A;  1QKW A;  3M0S A;  3MET A;  2DXT A;  5CKE A;  3HPW A;  3REB B;  4GLM A;  4FIB A;  2MWO A;  3OYM A;  5DLO A;  3CCQ Q;  3CCE Q;  4JRK A;  3VS6 A;  4DBR A;  1K0S A;  1UEB A;  1YCS B;  2XDP A;  2G6F X;  2DTI A;  5IHN A;  2QTV A;  2RQT A;  3RER A;  4M7D E;  3VJP A;  4M78 C;  1WJR A;  4FW2 A;  4FYV B;  1VYU A;  3ME9 A;  1VQK T;  2BE9 B;  1QVF P;  2Y4Y A;  2YUQ A;  1KG1 A;  3M55 A;  2JTE A;  2LQN A;  4M77 D;  3OYI A;  1OU8 A;  2F69 A;  1WXB A;  1Z9Q A;  3M58 A;  2KQW A;  3WXM B;  3CQT A;  3OYH A;  2XID A;  1JEG A;  2DJQ A;  2HD0 A;  3PFS A;  1Q82 U;  3OYE A;  3RMQ A;  2GTO A;  3JSC A;  2ZGW A;  3OSS C;  2LC4 A;  2L3P A;  4DEY A;  3TQ7 P;  1K9M R;  2VGM A;  1OX9 A;  2DZC A;  3JRZ A;  4J6Y A;  4E6R A;  4RTX A;  2LP5 A;  2COY A;  2DL3 A;  4ZGD B;  2EAY A;  4L5G A;  4C92 E;  5GAN g;  1UDL A;  2FZC B;  3JCM V;  2X4Y A;  3J81 E;  1NPR A;  4P5N A;  1NEB A;  2KBT A;  3M54 A;  5FW9 A;  4CC7 A;  2ZPI B;  1QP3 A;  3TRE A;  2DBK A;  4C0F A;  2CP6 A;  2DXC A;  4FYX B;  1Y07 A;  2KEA A;  2R5A A;  3CCV A;  2H3J A;  2C0O A;  5LJ5 d;  3G1J A;  2ROT A;  4OB1 B;  1JJ2 A;  1OPL A;  1PKS A;  2E1H A;  2BUD A;  3JCM b;  1UGP B;  1YN8 A;  3OYB A;  2RHI A;  5GMK m;  4IIM A;  4II1 A;  1YHQ Q;  1WHL A;  2CDT A;  4JLI A;  1WHM A;  4C0D C;  4MZM A;  1SSH A;  3M53 A;  3X24 B;  1BI2 A;  3FC3 A;  4FM4 B;  1PRL C;  4J9I A;  4D8K A;  1HJD A;  3OYN A;  5IAY A;  2QEX T;  1VQ8 T;  1OPK A;  1V29 B;  2KVQ G;  4UC4 A;  1MNE A;  2PQW A;  1VQ5 A;  3M0T A;  5HK0 A;  1QP2 A;  2HSP A;  1OZ2 A;  3OW2 A;  4RCC A;  4HCC A;  3JCM Q;  2EIF A;  1I07 A;  4DOV A;  4BE2 A;  5D6W A;  3L2V A;  4CC4 B;  1SPK A;  3V8L A;  3CBO A;  1RAA B;  5CKF A;  3DLL A;  1SF9 A;  3CPW A;  4PJO E;  3UWN A;  3M57 A;  3CCJ Q;  2L89 A;  4QVD A;  4HT9 A;  2O9S A;  1T0H A;  2R5M A;  4BB7 A;  2P4R A;  2FHD A;  1QVF A;  4ESR A;  3CCU Q;  1VQ6 A;  4C92 F;  5GJW B;  5M9O A;  3A8G B;  1K8A U;  1GCP A;  1KQ1 A;  1NJI U;  1RL2 A;  1JB0 E;  1SHF A;  2M1H A;  2QQ9 A;  3A98 A;  3HRS A;  3CBP A;  4M7A C;  1UB4 A;  2J6K A;  1UG1 A;  1WQ7 A;  3CC7 Q;  3PT9 A;  1BK2 A;  2DX1 A;  1GXI E;  2LVM A;  3VUB A;  2X4J A;  2EJG A;  2OAU A;  2FG0 A;  3AT1 B;  2PUK B;  4DEX A;  1S72 T;  4AFQ C;  3A8H B;  4Z02 A;  2AHJ B;  2RJD A;  1CKA A;  4M78 A;  2DKG A;  2QGG A;  1W6X A;  5GAO p;  3RKW A;  1K76 A;  3NTH A;  5CKD A;  1VQN T;  4BUG A;  1M3A A;  3HKS A;  2SEM A;  2KDS A;  4QVZ A;  1Q81 R;  1VQ4 Q;  1M2V B;  1C1A A;  2L0A A;  2VYT A;  2KMT A;  5D6Y A;  1OEB A;  3BDU A;  5GAM j;  4OB3 B;  4C8Q C;  1YJW A;  1VQ7 A;  3UT1 A;  3T9N A;  2ED1 A;  2LNH B;  5CK9 A;  2VUB A;  1UHF A;  1X6O A;  1PHT A;  1OOT A;  2KR3 A;  1FYN A;  2D1X A;  3TU4 K;  3HP9 A;  1IGU A;  1JJ2 S;  1J3T A;  5LJ5 f;  1QLY A;  8AT1 B;  5IHK A;  1MND A;  1QKX A;  1YNZ A;  2RK2 A;  1ACM B;  4F7U E;  3GBQ A;  3L1A A;  1K8A C;  2RO0 A;  1B7T A;  1VQ5 T;  4C0D B;  1CSK A;  5GAN 5;  2XKO C;  4PFZ A;  4D6W A;  1GBR A;  2X4W A;  1M90 U;  2HEQ A;  5C6S A;  5L23 A;  2RHX A;  5GMK h;  4LD9 K;  1N8R R;  1SRL A;  1YIT A;  1YCY A;  3OS0 A;  2E12 A;  4JJC A;  5LJ5 j;  4J7I A;  4ELY C;  2ZZD A;  3CCM Q;  3V7C A;  3I55 Q;  2CS7 A;  1GCQ A;  1ZUU A;  5CAI A;  1WJS A;  3QXE B;  1B34 A;  2DVJ A;  2VXF A;  3FIF A;  1SEM A;  1OU9 A;  4PJL A;  5GMK l;  3AHU A;  1UE9 A;  5IHI A;  2HZY A;  1D0X A;  2DET A;  4L59 A;  2OTJ T;  3MPU B;  2X9H A;  3ZBD A;  3CCU A;  3PIP A;  1VQ8 Q;  2L3R A;  2RB6 A;  3L2Z A;  1KQS A; 
#chains in the Genus database with same CATH homology
 3E1S A;  2HBP A;  2ZPH B;  4M78 B;  5C0M A;  2RI2 A;  4BI4 A;  3L2U A;  4XTY A;  4M77 F;  3X20 B;  3SD4 A;  4C8Q G;  2QDY B;  2RD1 A;  4M78 D;  1NPP A;  4PJO G;  1I5L A;  4N4G A;  5GAN 3;  1VQP A;  3NFC A;  5FU7 C;  1Q86 C;  3P8D A;  2F5T X;  4LD6 A;  1W4S A;  2KY9 A;  1VQL A;  3Q1J A;  2K3X A;  4PNO A;  5GAN 2;  3CCJ A;  4N4H A;  2CZ7 B;  2XU8 A;  4C92 D;  4BDZ A;  4B9X A;  4M75 C;  3GF5 A;  2E10 A;  1VIF A;  4VUB A;  2K4Y A;  3SWN C;  1Y71 A;  4BI3 A;  1BI1 A;  3X28 B;  5LJ3 g;  3SWN A;  1OZ3 A;  1ZBX A;  2QEX A;  4M75 D;  1QVG S;  3OYA A;  2VGN A;  4HKE A;  3QHS A;  4A4G A;  1NJI C;  4R56 A;  4JRP A;  3E9F A;  4WF2 A;  1M1K C;  2EKO A;  1K9M C;  2K57 A;  3CCE A;  1KQS S;  3LLR A;  3LWI A;  2PU9 B;  3CMA A;  3OS1 A;  1Q81 C;  3I55 T;  2MWP A;  4KT0 E;  4J7F A;  5LJ5 g;  3CCQ T;  1ZQ1 A;  4OB0 B;  1YHQ A;  3I56 T;  3OBY A;  3FRN A;  1U1T A;  3JCM g;  4C92 C;  4F7U G;  1M4Z A;  2RH2 A;  3RKY A;  3KBG A;  3QO3 A;  4C0G A;  3JCM P;  5KCO A;  2E41 A;  4JRI A;  4DOW A;  4PLL A;  4IUQ A;  5CKH A;  1H3Z A;  2V8K A;  1D3B B;  4IUR A;  1VQL T;  1VQP T;  4M7A F;  3X26 B;  5GAO l;  4V2S A;  4XU1 A;  4QQG A;  1M8V A;  5GAN d;  1M9S A;  1TH7 A;  3FJP A;  3OA6 A;  1M5Q 1;  5GAN h;  3N5B B;  4M7D G;  5FU6 B;  3CC4 T;  1XQH A;  2MMP A;  2EJF A;  3CBM A;  2ZPG B;  2X4X A;  2RM4 A;  4N0A A;  4F7U B;  4A53 A;  4JJN K;  4JRQ A;  4PJO D;  3C94 A;  3MO8 A;  2GQV A;  4A4K A;  5FU7 B;  3TEE A;  4C8Q B;  4E7K A;  1G5V A;  3VU3 C;  4C0Z A;  3CD6 T;  2EFI A;  2LNV A;  2RJC A;  3E9G A;  5GAO q;  2VV5 A;  1HXD A;  2DD4 A;  1N9S A;  1VIE A;  3X25 B;  1GXI E;  4LDY A;  1S72 A;  3CC7 A;  5DY9 A;  1YHQ T;  3EFR A;  3CEY A;  5CO7 A;  2I2L A;  3FLG A;  2JNG A;  3MEV A;  5A0D A;  3I56 A;  2E5Q A;  4XU2 A;  1BI3 A;  1FWZ A;  2E6N A;  1ZHI A;  3CC2 T;  5GMK i;  1BKB A;  2K5L A;  4C5E A;  1IRE B;  3OW2 S;  2HNI A;  2K2V A;  1VQM T;  3GLX A;  1M90 C;  2RK1 A;  1UGR B;  2FL7 A;  4ELZ C;  2PVG B;  5CCA A;  1VQN A;  1NE8 A;  1OI1 A;  3L2R A;  4ZN3 A;  3GIB A;  2QQR A;  4OVA A;  3JB9 H;  3GNF B;  3P8H A;  5L8R E;  1WGS A;  5A0G A;  5LL6 S;  1P92 A;  3CME A;  3CCS A;  4M78 E;  4C8Q F;  4OF1 A;  5I2S A;  3SWN B;  2L8D A;  3QDR B;  1JBM A;  2LX9 A;  3O8V A;  5GAO r;  3MP6 A;  2YLB A;  3SB2 A;  4XTX A;  2M9U A;  2RJE A;  4BY6 B;  4C8Q A;  3C12 A;  4YTL A;  5AYF A;  5CVI A;  2WAC A;  3RUX A;  4M7D F;  2V8I A;  2LQK A;  4HCB A;  3CCM A;  4QQ6 A;  1KD1 U;  1XNI A;  4L6V 5;  3NTI A;  2E6Z A;  4M7A B;  3QII A;  3G4S A;  2MAM A;  2C06 A;  2GFU A;  2P0K A;  3S6W A;  3J7A F;  3MEA A;  4BE0 A;  4IUU A;  1VQM A;  4FSX A;  4B9W A;  3E19 A;  4ZTF A;  2HQX A;  4J8O A;  1VQ9 T;  1LNX A;  2EWN A;  4RG2 A;  4OGE A;  4J5Y A;  3C95 A;  2XK0 A;  1MGQ A;  3QG1 A;  4XTV A;  3JB9 I;  4EMG A;  2DJZ A;  2YRV A;  3DLM A;  2LTO A;  3V7S A;  1KHC A;  3OYY A;  3JB9 J;  4M7A E;  4XQ3 A;  4E7J A;  4NL3 A;  1MHN A;  3OSV A;  4FL6 A;  4BI8 B;  3BDL A;  5LJ3 j;  4MDX A;  1Q7Y U;  1HK9 A;  2DD5 A;  1D3B A;  2EQU A;  3C4S A;  4HA8 A;  2DK3 A;  3WVD B;  3CXC S;  2QQB A;  3QUI A;  3QJY A;  3QPH A;  5DLQ E;  5GAN e;  3MET A;  2DXT A;  5CKE A;  4FU6 A;  2XIC A;  4Q5W A;  5CQX A;  4IUP A;  1VQ6 T;  2QXF A;  3HPW A;  1VUB A;  1RI0 A;  4FIB A;  2MWO A;  2DPP B;  3QBY A;  4M75 E;  4XU0 A;  3OYM A;  5GMK e;  5DLO A;  3G71 T;  2XDB A;  4JRK A;  3G4S T;  1X01 A;  2IVW A;  4F7U A;  1UEB A;  2XDP A;  4J6X A;  4KUD K;  4KUL A;  4C5I A;  2GF7 A;  3HRU A;  2DTI A;  2RI3 A;  2P0Q A;  2V8J A;  3MP8 A;  2EQK A;  1G3T A;  2ZPF B;  4ME7 A;  4NS5 A;  3HL8 A;  4LDU A;  3RER A;  2FVU A;  4M7D E;  3VJP A;  4M78 C;  3UPU A;  1WJR A;  3OQ5 A;  4C8Q D;  3ME9 A;  4A54 A;  3GP8 A;  1VQK T;  3JCM h;  4QVC A;  1YJN A;  2RI5 A;  1YIJ A;  2CZ6 B;  3A8O B;  2Y4Y A;  2P4T A;  3URG A;  2HAX A;  2K5I A;  3CC7 T;  3OB9 A;  1KG1 A;  1KD1 C;  3M55 A;  4M77 A;  3OY9 A;  3S3M A;  3G7Z A;  2DIQ A;  3LWH A;  2LT1 A;  4M77 D;  5GAN 8;  3OYI A;  2F69 A;  4XTW A;  2LQ8 A;  4XTZ A;  4IUV A;  4KUI A;  3M58 A;  3S3O A;  3L42 A;  4XTU A;  2KQW A;  2X35 A;  3WXM B;  4PL6 A;  5LJ3 h;  1FX7 A;  3OYH A;  2PVD B;  2XID A;  4RKU E;  3JCM J;  1M1K U;  4LDW A;  5FRO A;  3ZFJ A;  4ZGE B;  3GPL A;  4E7I A;  3CPW S;  2FYK A;  2HD0 A;  3PFS A;  1Q82 U;  3OYE A;  3QZ5 B;  3RMQ A;  4PJO B;  2YLC A;  3OYC A;  1VQ4 A;  3JSC A;  2ZGW A;  3OSS C;  3CC4 A;  2XI9 A;  2LC4 A;  5LJ3 f;  3CCU T;  1KC8 U;  4M77 C;  3VV0 A;  5IN1 A;  3ZEH A;  1YJW T;  1VQO T;  1VQ7 T;  2XD0 A;  3I55 A;  2VGM A;  2L5Q A;  1Q7Y C;  3S3N A;  3JRZ A;  2DZC A;  3QYH B;  3JCM d;  4J6Y A;  2ZCF B;  1Y7X A;  4LDV A;  4M77 B;  3LGL A;  4M75 F;  4EPC A;  1YIJ T;  1NZ9 A;  2OTL T;  4ZGD B;  1Q82 C;  3JCM W;  2EAY A;  4L5G A;  4C92 E;  1KHI A;  5GAN g;  4E7L A;  1M1G A;  1K9M U;  3JCM V;  2X4Y A;  3JCM e;  2D9T A;  3FDR A;  5GAN f;  3F70 A;  3J81 E;  1YJ9 A;  2E65 A;  1QVG A;  1KC8 C;  2YHT A;  3DB4 A;  4EDU A;  2M0O A;  3HRT A;  3CC2 A;  1NPR A;  3PMT A;  4P5N A;  2ZPB B;  4JDS A;  4CRI A;  2ZPE B;  3RES A;  3V7R A;  1LJO A;  2K5F A;  2QQA A;  3M54 A;  5IT9 E;  1W2B A;  5LJ5 h;  2ZPI B;  1QP3 A;  3TRE A;  5J26 A;  4PJO F;  3UDC A;  4M78 G;  4C0F A;  4BDY A;  3LW5 E;  2DXC A;  3A8M B;  3OYF A;  1Y07 A;  4F7U F;  5A0L A;  3CCJ T;  2D6F A;  4DQ2 A;  2R5A A;  3CCV A;  4BY6 C;  5FRN A;  3BW1 A;  1VQ4 T;  2A3L A;  1N6A A;  1G3S A;  2H3J A;  5KE3 A;  4C5H A;  4CI0 C;  2CKK A;  5LJ5 d;  2CZ1 B;  5GAM g;  1Y96 B;  1VQO A;  4OB1 B;  2MF2 A;  5GMK j;  4OMF B;  1JJ2 A;  3HFN A;  3J80 E;  3V8K A;  3GNG A;  2E1H A;  4M75 A;  3CCM T;  2BUD A;  3M56 A;  2DXU A;  2XHC A;  3JCM b;  5GAN j;  3CCE T;  4HT8 A;  1UGP B;  3A8L B;  3OYB A;  4PKC C;  1DJ7 B;  2RHI A;  3PGG A;  5GMK m;  1BYM A;  2XDD A;  5CQY A;  1G3Y A;  3CCQ A;  4NOY A;  2CZ0 B;  4II1 A;  4OP0 A;  4M75 G;  4ATO A;  4NL2 A;  2KAF A;  2A7Y A;  2NLU A;  4J6W A;  4JLI A;  4OGC A;  3QZ9 B;  3CME T;  4C0D C;  4MZM A;  2E64 A;  3PTA A;  2LCC A;  3M4Y A;  2WSE E;  3M53 A;  3X24 B;  1BI2 A;  3FC3 A;  2VXE A;  4FM4 B;  2RHY A;  3OMG A;  4FT2 A;  3JB9 G;  1XTD A;  4M77 G;  1KQ2 A;  4MML A;  1OYX A;  3MEW A;  1XOV A;  5IAY A;  3OYN A;  2QEX T;  3DB3 A;  1VQ8 T;  3M59 A;  3WVE B;  4C5G A;  4LDX A;  4PJO A;  1V29 B;  2KVQ G;  4UC4 A;  2RJF A;  2PQW A;  3G71 A;  4MDW A;  1VQ5 A;  3EAE A;  5HK0 A;  3ER0 A;  1QP2 A;  4MMK A;  2OTJ A;  5I21 A;  3CMA T;  1OZ2 A;  4A4E A;  4RCC A;  3OW2 A;  1VQ9 A;  4HCC A;  2DIG A;  3KUF A;  4MZT A;  4X9D A;  3JCM Q;  2EIF A;  4DOV A;  4E7H A;  3QSU A;  4JS5 A;  5A2Q E;  4BE2 A;  5D6W A;  5HKC A;  3L2V A;  3RIR A;  5GAO m;  1FXX A;  4A4F A;  2DXB A;  3V8L A;  3CBO A;  5CKF A;  2JN0 A;  3DLL A;  3CPW A;  3RKX A;  4PJO E;  3UWN A;  5KCH A;  3JAM E;  1H64 1;  1I4K 1;  3M57 A;  2L89 A;  4QVD A;  4HT9 A;  3G6E T;  2R5M A;  4BB7 A;  4E47 A;  5LJ3 e;  1G3W A;  2G3R A;  3CCL A;  1BI0 A;  2FHD A;  1QVF A;  2LCL A;  4TVR A;  3VYH B;  1VQ6 A;  4C92 F;  4M7D C;  5M9O A;  3A8G B;  1K8A U;  3CXC A;  1KQ1 A;  1NJI U;  1O75 A;  1BIB A;  1RL2 A;  3A5Z B;  1K73 C;  1JB0 E;  2M1H A;  3QYG B;  1B34 B;  5LJ3 d;  2EJ9 A;  4GLK A;  4EMK A;  2QQ9 A;  3HHT B;  3HRS A;  1WQW A;  3CBP A;  3CCR A;  5FRM A;  2JOY A;  4M7A C;  1UB4 A;  3OYK A;  3JCM f;  1VQ8 A;  5GAN 7;  1I81 A;  3CCS T;  2RA2 A;  4QQD A;  3JB9 F;  4ZGJ B;  1WQ7 A;  3PT9 A;  4M7A D;  2LDM A;  5LJ5 e;  4GY5 A;  3TCJ A;  2OTL A;  1YI2 T;  2FB7 A;  2LVM A;  3FB9 A;  2X4J A;  1U1S A;  2EJG A;  3LYI A;  3VUB A;  2OAU A;  1Y96 A;  4C92 A;  3DKM A;  1W2B S;  4BE1 A;  2BIV A;  1LOJ A;  1X75 C;  2PUK B;  4RCB A;  3LGF A;  1YJ9 T;  1S72 T;  4RG8 A;  2Y4X A;  3A8H B;  3OYD A;  4Z02 A;  2AHJ B;  2R57 A;  2RJD A;  1WJQ A;  3NTK A;  4M78 A;  2DKG A;  2IG0 A;  2QI2 A;  3OBW A;  5GAO p;  5HK3 A;  3EFS A;  3RKW A;  3NTH A;  5CKD A;  2O4X B;  4XK8 E;  3SFM A;  3KXT A;  4ZN1 A;  4BAC A;  1VQN T;  2DO3 A;  4OB2 B;  2XG8 D;  1BIA A;  3OYJ A;  4IKF A;  5HY6 A;  4BUG A;  3HKS A;  4QVZ A;  2KDS A;  5EG2 A;  2F5K A;  5DM7 R;  3CCL T;  4JUV A;  3QJ6 A;  2JTM A;  4Y91 A;  2QA4 A;  2CGH A;  3PIO A;  1Q81 U;  3MP1 A;  4ZTJ A;  2VYT A;  4JLG A;  2VC8 A;  4EMK B;  2WSF E;  3CCV T;  2KMT A;  4MZP A;  1K73 U;  2RHU A;  4O6J A;  5GAO n;  5GAN 6;  3LH0 A;  2EYQ A;  5D6Y A;  1QVP A;  4FT4 A;  3BDU A;  3CCR T;  2JVV A;  1EIF A;  3BY7 A;  2JTF A;  5CKB A;  2E70 A;  3BFM A;  4OB3 B;  2GCX A;  3OS5 A;  4C8Q C;  5GAM j;  5FLX E;  2PUO B;  3H8Z A;  5KH6 A;  3VUZ A;  2JUF A;  1YJW A;  1YI2 A;  1N8R C;  1VQ7 A;  3UT1 A;  4O5V A;  2BKD N;  4M77 E;  3T9N A;  5D6X A;  1YJN T;  3LX7 A;  5CK9 A;  2VUB A;  3OYG A;  1X6O A;  1M1F A;  1N9R A;  3TU4 K;  2LRQ A;  3HP9 A;  3M4G A;  3MHX A;  2GFA A;  4Y28 E;  1JJ2 S;  4J83 A;  2DAQ A;  4M7D D;  3PNW C;  5LJ5 f;  3JB9 D;  1QW1 A;  2O01 E;  5I2M A;  5GAM e;  3VKI A;  3OMC A;  4KBM B;  1PSE A;  2QA4 T;  3INZ A;  1JRI A;  2RK2 A;  4F7U E;  3CD6 A;  3L1A A;  2EQM A;  2PVO B;  1K8A C;  1QVF S;  2RO0 A;  1N27 A;  1VQ5 T;  4IUT A;  3H6Z A;  4C0D B;  1Q86 U;  5GAM d;  5GAN 5;  1UGQ B;  2XKO C;  3RMS A;  5GAN 4;  4C92 G;  1WNL A;  1YBY A;  4D6W A;  1UGS B;  2X4W A;  4QW2 A;  2CYZ B;  4BD3 A;  4EMH A;  1M90 U;  4M7A A;  1SSF A;  4XAX B;  3SDZ A;  2R58 A;  5GAM h;  2JZ2 A;  5C6S A;  2DVE A;  4EMK C;  2D0Q B;  2P0P A;  2RHX A;  3QKJ A;  4N0A C;  4XU3 A;  5J39 A;  5GMK h;  4LD9 K;  3OS2 A;  4DA4 A;  1YIT A;  4JS4 A;  3OYL A;  1I8F A;  2QQS A;  5CR2 A;  2EQJ A;  2KSS A;  4M7D A;  3M9Q A;  4M7A G;  2DEQ A;  4M75 B;  4HCZ A;  1YCY A;  3R6O A;  1N8R U;  2B8A A;  3FEO A;  3MEU A;  3JCM X;  1IZ6 A;  2O4X A;  4RMO A;  1PSF A;  1R8O B;  2M16 A;  2MI6 A;  3M5A A;  4M78 F;  3JCM c;  2Y90 A;  2E12 A;  4C8Q E;  5GAM f;  3OS0 A;  1U8R A;  4PJO C;  2KK4 A;  4J7I A;  4X9C A;  4ELY C;  3PMI A;  5LJ5 j;  2ZZD A;  2HQE A;  3V7C A;  3L2W A;  2CS7 A;  4N4I A;  1AHJ B;  3HSB A;  2DZ9 A;  5FU6 C;  4X34 A;  3L2Q A;  5CAI A;  1WJS A;  3G6E A;  3QXE B;  1B34 A;  2VXF A;  3FIF A;  3CPF A;  5GMK l;  5CIU A;  1YIT T;  5J3B A;  3AHU A;  2K3Y A;  2QTX A;  4A4H A;  2WSC E;  4R55 A;  2DTH A;  1WPY A;  4L59 A;  3MCA B;  2OTJ T;  2DTO A;  3ASK A;  3P8B B;  3ZBD A;  3V8J A;  2RHZ A;  3VYG A;  4PLI A;  4C92 B;  3PIP A;  3CCU A;  5KE2 A;  2L3R A;  2RB6 A;  3L2Z A;  1VQK A;  3GOX A;  4M7D B;  1O9S A;  1KQS A;  2LT4 A;  3HFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...