3LWOA

Structure of h/aca rnp bound to a substrate rna containing 5bru
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
327
structure length
317
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Glycosidic bond conformation preference plays a pivotal role in catalysis of RNA pseudouridylation: a combined simulation and structural study.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 89
structure length 317
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3lwoA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3lwoA02
3LWPA 2AUSA 2EY4A 3MQKA 4LABA 3LWQA 1KSLA 3DH3A 2RFKA 2I82A 1V9KA 3UAIA 1ZL3A 1R3FA 1XPIA 4LGTA 1PRZA 3U28A 1QYUA 3HJWA 2ISTA 3ZV0C 3HAXA 1R3EA 1ZE2A 1ZE1A 3LWOA 1SGVA 1K8WA 1KSKA 1V9FA 3LWVA 2HVYA 3HJYA 2APOA 1KSVA 3LWRA 2AB4A
chains in the Genus database with same CATH superfamily
2E5OA 3LDFA 2EY4A 3VSEA 1IT8A 4CI3B 4CI2B 2J5VA 3M6WA 2AS0A 3UAIA 1XPIA 4DMGA 1QYUA 1Z2ZA 3HJWA 1R3EA 3HAXA 4CI1B 4Q1TA 1Q7HA 2HVYA 4TZ4C 2APOA 1ZS7A 3LWRA 3LJCA 1WK2A 3LWPA 3M6XA 1SQWA 2CWWA 2I82A 1V9KA 1SB7A 1ZL3A 2KKUA 4LGTA 2ANEA 2ISTA 3C0KA 2J5TA 1SGVA 1K8WA 1KSKA 1XNEA 1SZWA 3M6VA 2AB4A 2P38A 2AUSA 3MQKA 4LABA 1TE7A 1ZBOA 3IUWA 2RFKA 1T5YA 1R3FA 3ZV0C 3D79A 1ZE2A 3LWOA 1V9FA 3HJYA 2CX1A 3M65A 2DP9A 2B78A 3M6UA 3M4XA 1IT7A 3LWQA 1KSLA 1S04A 3DH3A 1WXXA 1PRZA 2CX0A 3U28A 1WXWA 1J2BA 1IQ8A 1SI7A 1ZE1A 3LWVA 1KSVA 1UOYA 2Z0TA 2Q07A 2FRXA
chains in the Genus database with same CATH topology
3LWPA 3M6UA 3M6XA 2AUSA 2EY4A 3M4XA 3MQKA 4LABA 3LWQA 1KSLA 3DH3A 2RFKA 2I82A 1V9KA 1SB7A 3M6WA 3UAIA 1R3FA 1ZL3A 1XPIA 4LGTA 1PRZA 3U28A 1QYUA 1Z2ZA 3HJWA 2ISTA 3ZV0C 3HAXA 1R3EA 1ZE2A 1SI7A 1ZE1A 3LWOA 1SGVA 1K8WA 1KSKA 1V9FA 1SZWA 3LWVA 3M6VA 2HVYA 3HJYA 2APOA 1KSVA 2AB4A 1UOYA 3LWRA 2FRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWP A;  2AUS A;  2EY4 A;  3MQK A;  4LAB A;  3LWQ A;  1KSL A;  3DH3 A;  2RFK A;  2I82 A;  1V9K A;  3UAI A;  1ZL3 A;  1R3F A;  1XPI A;  4LGT A;  1PRZ A;  3U28 A;  1QYU A;  3HJW A;  2IST A;  3ZV0 C;  3HAX A;  1R3E A;  1ZE2 A;  1ZE1 A;  3LWO A;  1SGV A;  1K8W A;  1KSK A;  1V9F A;  3LWV A;  2HVY A;  3HJY A;  2APO A;  1KSV A;  3LWR A;  2AB4 A; 
#chains in the Genus database with same CATH topology
 2E5O A;  3LDF A;  2EY4 A;  3VSE A;  1IT8 A;  4CI3 B;  4CI2 B;  2J5V A;  3M6W A;  2AS0 A;  3UAI A;  1XPI A;  4DMG A;  1QYU A;  1Z2Z A;  3HJW A;  1R3E A;  3HAX A;  4CI1 B;  4Q1T A;  1Q7H A;  2HVY A;  4TZ4 C;  2APO A;  1ZS7 A;  3LWR A;  3LJC A;  1WK2 A;  3LWP A;  3M6X A;  1SQW A;  2CWW A;  2I82 A;  1V9K A;  1SB7 A;  1ZL3 A;  2KKU A;  4LGT A;  2ANE A;  2IST A;  3C0K A;  2J5T A;  1SGV A;  1K8W A;  1KSK A;  1XNE A;  1SZW A;  3M6V A;  2AB4 A;  2P38 A;  2AUS A;  3MQK A;  4LAB A;  1TE7 A;  1ZBO A;  3IUW A;  2RFK A;  1T5Y A;  1R3F A;  3ZV0 C;  3D79 A;  1ZE2 A;  3LWO A;  1V9F A;  3HJY A;  2CX1 A;  3M65 A;  2DP9 A;  2B78 A;  3M6U A;  3M4X A;  1IT7 A;  3LWQ A;  1KSL A;  1S04 A;  3DH3 A;  1WXX A;  1PRZ A;  2CX0 A;  3U28 A;  1WXW A;  1J2B A;  1IQ8 A;  1SI7 A;  1ZE1 A;  3LWV A;  1KSV A;  1UOY A;  2Z0T A;  2Q07 A;  2FRX A; 
#chains in the Genus database with same CATH homology
 3LWP A;  3M6U A;  3M6X A;  2AUS A;  2EY4 A;  3M4X A;  3MQK A;  4LAB A;  3LWQ A;  1KSL A;  3DH3 A;  2RFK A;  2I82 A;  1V9K A;  1SB7 A;  3M6W A;  3UAI A;  1R3F A;  1ZL3 A;  1XPI A;  4LGT A;  1PRZ A;  3U28 A;  1QYU A;  1Z2Z A;  3HJW A;  2IST A;  3ZV0 C;  3HAX A;  1R3E A;  1ZE2 A;  1SI7 A;  1ZE1 A;  3LWO A;  1SGV A;  1K8W A;  1KSK A;  1V9F A;  1SZW A;  3LWV A;  3M6V A;  2HVY A;  3HJY A;  2APO A;  1KSV A;  2AB4 A;  1UOY A;  3LWR A;  2FRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...