3LWOC

Structure of h/aca rnp bound to a substrate rna containing 5bru
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Glycosidic bond conformation preference plays a pivotal role in catalysis of RNA pseudouridylation: a combined simulation and structural study.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwoC00
3CG6A 1GO1A 3VMFB 2KG4A 1YJNF 1VQ4F 1M90H 3JAMM 1VQOF 2OTLF 4C4WC 1NMUB 1KC8H 4NUTA 1YITF 4X3LA 1DT9A 2BO1A 3G6EF 1X7PA 3GYQA 2OZBA 1NJIH 1X7OA 3G4SF 1VQMF 1GZ0A 1W40A 1E7KA 3CD6F 5GAPK 2OTJF 3JCMM 1YJWF 5DCVA 2QA4F 1S72F 3AGKA 1XBIA 1VQKF 1KD1H 1K9MH 3NMUC 1QVFF 1VQ8F 3CCJF 2JNBA 1Q86H 1RA4A 3CCLF 1YHQF 1K73H 1VQ6F 5G4UC 3RA6A 5GINC 3IR9A 3LWPC 3NVIB 2QEXF 1CK2A 1W3EX 2VGMA 3MCAB 1Q82H 1PXWA 2FC3A 2KTUA 3J80M 2HVYD 2KTVA 1Q7YH 3PAFA 3LWRC 3HJWC 2QI2A 5G4VC 1ZWZA 3V7EA 5GIOC 1YJ9F 1H7MA 3J81M 2LBXA 1VQLF 1X52A 3CXCF 1YI2F 3PLAC 1VQPF 2VGNA 3WXMB 1YIJF 3CC2F 3CC4F 3ON1A 3CCRF 4BY9D 5FJ4C 1RLGA 5GANK 3NK6A 1T0KB 4TZZA 1KQSF 3OBWA 3CC7F 3N4YA 2ALEA 3NK7A 2CZWA 1VQ7F 1IPAA 5A2QM 1CN7A 3I55F 3LFOA 5GIPC 1W41A 3FFMA 5EO3A 2WALA 3N4ZA 3LWOC 3CCEF 1W2BF 1N8RH 3CCSF 4X3MA 3O85A 1W42A 2I6DA 3E20B 3J7AR 3CMAF 3I56F 1VQ9F 3VI6A 2OHWA 3LWQC 3SIUA 4LCKA 1Q81H 3CCQF 1JJ2F 3CCVF 2LBWA 3LWVC 3HAXD 3G71F 5EWRA 3E1YA 3V7QA 1M1KH 3CPQA 3OW2F 1QVGF 1VQNF 3CCUF 2AIFA 1GO0A 5IT9M 3RA5A 3SIVA 3NVKE 1K8AH 3CPWF 3OBYA 3CMEF 1VQ5F 3CCMF 1SDSA 4BW0B 5FLXM
chains in the Genus database with same CATH superfamily
1W57A 3KIZA 3VMFB 1YJNF 3KE1A 1VQ4F 1M90H 1R1MA 5J2TA 5EIBC 1JFFA 4R40B 3IEQA 2LBTA 1H47A 3JVHA 5AVMA 4X3LA 2UYJA 3C9SA 2ZAUA 2BO1A 5LYJA 5EAZA 3RYFB 2HS3A 1E7KA 2BTOA 3CD6F 3TD3A 1U3PA 2QA4F 1UI9A 2H6LA 1VQKF 1KD1H 2W8BC 4BVRA 2PHNA 5LP6C 1RQ2A 3CCJF 2PMPA 2UYKA 3ZO8A 3S02A 2B33A 2EWCA 4ZOLB 3IKEA 4B45A 1VQ6F 5IYZA 3ZOPA 3M4SA 3RA6A 1Z5VA 3K2XA 4I50A 5LP6B 2QEXF 1W3EX 1FSZA 3K14A 3MCAB 1Q82H 5ITZA 4G4ZA 4O4LA 2OTMA 4PWTA 3KHNA 2KTVA 1Q7YH 2Z1EA 2GZLA 5G4VC 3WJRA 2VAPA 4O4IA 1H7MA 1TUBA 1Z5WA 3J81M 1T0AA 2IG8A 3ZP7A 5CA1B 3S0YA 4ZHQB 1RLUA 3JARA 4DXDA 4X1KB 1YI2F 4FFBB 3MQWA 4TUYB 5HWEA 3CCRF 5IJ9A 4B5CA 5EYPA 1RLGA 4X20A 3NK6A 2HRYA 4I4TB 2UYNA 1W5FA 1VK3A 2BTUA 3C9UA 1CN7A 3I55F 1J7HA 3LFOA 5HY4A 4IHJB 2HS4A 5CA0B 3CCEF 5JCOA 1W2BF 3JALB 3BYQA 1W42A 4C8GA 3HKCB 3E20B 3J7AR 5EB0A 4C81A 5EZYA 3VTIC 2UYPA 4F6RA 1VQ9F 3JAWA 4O4JA 3LWQC 5FNVB 2R6R1 2F9ZC 5JQGA 3LWVC 3G71F 5EWRA 3ELCA 3OW2F 1QVGF 1FNKA 4O2BB 4B62A 5JH7A 4O4HB 2N48A 2VAMA 1YQNA 3M1XA 3P10A 4G4XA 4BT5A 3RA5A 3SIVA 1YGYA 1IV3A 2HS0A 4BW0B 1GX1A 3DC2A 1FNJA 2Z1TA 3MBMA 2V9YA 3VCZA 4TV9B 2OTLF 3M84A 2ZVYA 4C4WC 4U3JA 2HX0A 3CYPB 3F0DA 1FFXA 3QHDA 4ZHYB 3RYHB 4BVSA 2ZOVA 3ESJA 1YITF 4X1YA 3JAKB 2BTQB 4EB6B 3F0FA 4YJ2B 3B6NA 5J2UA 1X7PA 1U3LA 1NJIH 3HKBB 1GZ0A 5KX5B 1W40A 2LCAA 5GAPK 4G4VA 5HY2A 3WPWA 5DCVA 1K9MH 1JY8A 2AIZP 1PF5A 2HQSC 3QUWA 3CCLF 3E22B 3L7QA 1K73H 2H8EA 5G4UC 5GINC 5LA6A 1CK2A 1PXWA 5B8FA 2KTUA 3WJPA 3D54A 3N2GB 3J80M 3VIUA 1ODEA 5EB1B 3WJQA 3V7EA 3V4DA 3UT5A 5LOVB 4TV8B 4ZOLA 2ZVZA 3DDNA 1XRGA 4BT4A 1SZQA 3JASA 3KJJA 5GONA 3RYIB 3WGNA 3K12A 2LBXA 1VQLF 1X52A 5LP6A 3PLAC 3JATB 2VGNA 4G88A 2RHOA 3WPXA 3HKEB 3CC4F 4M8IA 2ZODA 3U0OA 4TZZA 3D01A 3OBWA 1JFFB 5BMVB 3NK7A 2CZWA 1VQ7F 1IPAA 5MN6A 2CWJA 3P0ZA 5JVDA 4EI7A 5GIPC 4FFBA 3TD5A 3F0GA 5LYJB 3VO8A 2WALA 2KGWA 3N4ZA 2VAWA 3LWOC 1N8RH 2DYYA 3CCSF 4X3MA 1OAPA 3RYCA 4I4TA 4ZI7A 3I56F 3F0EA 3VI6A 1SA0A 1RQ7A 3CCQF 3GHZA 3IEWA 1M1KH 2GVIA 1VQNF 5IJ0A 1GO0A 3HKCA 5IYZB 3C8LA 3WGKA 4I50B 2GLZA 2H8CA 5ITZB 3CCMF 3N2KB 3CG6A 1GO1A 1VH8A 4X1IB 3V3TA 3P4EA 2Q1XA 4I55A 4WBNA 4O4HA 4O4IB 4E6EA 1U43A 1TUBB 4NUTA 4B46A 3MCQA 5KMGA 2HP3A 1TVKA 3G6EF 1X7OA 5EIBD 3G4SF 5IJ9B 5EYPB 1OFUA 2OTJF 1XHOA 4C82A 2L26A 1YJWF 4HNAA 1QU9A 1XBIA 2UYNB 3AGKA 5HP7A 1QVFF 3RYHA 4LNUA 3GTZA 4IIJA 4DRXA 4YJ2A 2P6YA 3S0WA 1DBFA 5KX5A 1NQ3A 1JN1A 5CB4B 3HKDA 5EZYB 3LWPC 4F6RB 3JAWB 3FBAA 2IQQA 4O4JB 2VGMA 2FC3A 3WGJA 3EORA 4O2AA 5HXUA 2VXYA 2HVYD 5JQGB 4EI9A 3PAFA 3HJWC 2QI2A 3D00A 5LXTB 1YJ9F 4C8EA 1IV4A 2MQEA 3R0PA 4BT2A 3WGMA 4XCQA 1IV2A 3C9TA 4BT7A 3S03A 1VQPF 2HP0B 1YIJF 3ON1A 3S0HA 3VYTC 5FJ4C 2Z1UA 3RYFA 4NQ3A 5GANK 1T0KB 5LOVA 4U3JB 3MDOA 1QAHA 4X1YB 5A2QM 4YJ3B 1IV1A 3JATA 1W41A 2CSLA 5HY0A 2QTPA 3FFMA 5J2UB 3CYQA 5EO3A 2I6DA 2OHWA 5BMVA 5C8YB 1JD1A 3SIUA 4LCKA 2RHJA 1Q81H 2Z01A 3HAXD 1VHAA 3HTNA 5J2TB 3CCUF 5HXZA 2AIFA 4BVQA 5CA1A 5IT9M 4G4WA 4ZHQA 1QD9A 5LA6B 4BVTA 4X1KA 1K8AH 3CPWF 3NVKE 3CMEF 1W581 2R751 1SDSA 3FD5A 5FLXM 1Q8RA 4TUYA 2Q1YA 2KG4A 1W55A 2I6RA 3JAMM 3UT5B 1VQOF 2NMUA 2G9IA 3JASB 5GONB 1NMUB 3F6MA 1KC8H 1DT9A 1UFYA 5MN4A 1VQVA 3VYSC 4IHJA 5CA0A 1X25A 3I3FA 3N2KA 4ZK7A 3GYQA 2OZBA 1COMA 2Z1FA 1VQMF 1W59A 3JALA 2UZHA 2YYEA 4X1IA 3S06A 2IAFA 3JCMM 3CB2A 3I7TA 1S72F 3NMUC 5FNVA 1VQ8F 1H48A 4O4LB 2JNBA 1Q86H 2CHSA 1RA4A 5JVDB 1YHQF 3ZP4A 4O2BA 4ZHWA 1KNKA 1XV2A 2K1SA 3FPIA 3RYCB 3IR9A 4ZI7B 3NVIB 3JARB 3LMEA 3HWUA 3IKFA 4BT3A 1SA0B 3RE3A 3T80A 3KJKA 3TD4A 1W5EA 3LWRC 1ZWZA 4X20B 5JCOC 5GIOC 4TV9A 5MN5A 4U39A 3WGLA 5IJ0B 5CB4A 4BT6A 1KNJA 3VOBA 3CXCF 3VOAA 3JAKA 4C8IA 4NWOB 4EB6A 1U40A 2ZF8A 3WXMB 4G4YA 3ERNA 2RHHA 3CC2F 4EI8A 4RQOA 4BY9D 3HKBA 5LXTA 5HP8A 4I55B 1KQSF 3CC7F 4WBNB 3IMPA 3K0TA 3N4YA 3OONA 2ALEA 4ERHA 2RHLA 1W5BA 3E22A 2HP0A 1CLIA 5KMGB 2HRUA 1TVKB 5JH7B 3QTYA 3O85A 3LYBA 1W5AA 3CMAF 4HNAB 2CVLA 1JJ2F 4LNUB 3N2GA 3CCVF 2LBWA 3C9RA 4YJ3A 4IIJB 4DRXB 3E1YA 3V7QA 3CPQA 4RHAA 4TV8A 5HY1A 3Q8HA 2FGYA 2YXZA 3RYIA 1FFXB 2RB9A 2AMTA 2CHTA 2CW4A 2DT4A 3HKDB 4ZHVA 3FD6A 1ONIA 3OBYA 5C8YA 4KWEA 3VYUC 3HKEA 1VQ5F 3LDTA 4O2AB
chains in the Genus database with same CATH topology
3CG6A 1GO1A 3VMFB 2KG4A 1YJNF 1VQ4F 1M90H 3V3TA 3JAMM 1VQOF 2OTLF 4C4WC 1NMUB 1KC8H 4BVSA 4NUTA 1YITF 4X3LA 1DT9A 2BO1A 3G6EF 1X7PA 3GYQA 2OZBA 1NJIH 1X7OA 3G4SF 1VQMF 1GZ0A 1W40A 1E7KA 3CD6F 5GAPK 2OTJF 5HY2A 3JCMM 1YJWF 5DCVA 2QA4F 1S72F 3AGKA 1XBIA 1VQKF 1KD1H 1K9MH 3NMUC 4BVRA 1VQ8F 1QVFF 3CCJF 2JNBA 1Q86H 1RA4A 3CCLF 1YHQF 1K73H 1VQ6F 5G4UC 3RA6A 5GINC 3IR9A 3LWPC 3NVIB 2QEXF 1CK2A 1W3EX 2VGMA 3MCAB 1Q82H 1PXWA 2FC3A 2KTUA 3J80M 5HXUA 2HVYD 2KTVA 1Q7YH 4EI9A 3PAFA 3LWRC 3HJWC 2QI2A 3D00A 1ZWZA 5G4VC 3V7EA 5GIOC 1YJ9F 1H7MA 3J81M 2LBXA 1VQLF 1X52A 3CXCF 1YI2F 4XCQA 3PLAC 1VQPF 2VGNA 3WXMB 1YIJF 3CC2F 3CC4F 3ON1A 5HWEA 3CCRF 4EI8A 4BY9D 5FJ4C 1RLGA 4NQ3A 5GANK 3NK6A 1T0KB 4TZZA 1KQSF 3OBWA 3CC7F 3N4YA 2ALEA 3NK7A 2CZWA 1VQ7F 1IPAA 5A2QM 1CN7A 3I55F 3LFOA 5GIPC 1W41A 4EI7A 5HY4A 5HY0A 3FFMA 5EO3A 2WALA 3N4ZA 3LWOC 3CCEF 1W2BF 1N8RH 3CCSF 4X3MA 3O85A 1W42A 2I6DA 3E20B 3J7AR 3CMAF 3I56F 1VQ9F 3VI6A 2OHWA 3LWQC 3SIUA 4LCKA 1Q81H 3CCQF 1JJ2F 3CCVF 2LBWA 2F9ZC 3LWVC 3HAXD 3G71F 5EWRA 3E1YA 3V7QA 1M1KH 3CPQA 3OW2F 1QVGF 1VQNF 5HY1A 3CCUF 5HXZA 2AIFA 4BVQA 2FGYA 1GO0A 5IT9M 3RA5A 3SIVA 3NVKE 4BVTA 1K8AH 3CPWF 3OBYA 2GLZA 3CMEF 1VQ5F 3CCMF 1SDSA 4BW0B 5FLXM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CG6 A;  1GO1 A;  3VMF B;  2KG4 A;  1YJN F;  1VQ4 F;  1M90 H;  3JAM M;  1VQO F;  2OTL F;  4C4W C;  1NMU B;  1KC8 H;  4NUT A;  1YIT F;  4X3L A;  1DT9 A;  2BO1 A;  3G6E F;  1X7P A;  3GYQ A;  2OZB A;  1NJI H;  1X7O A;  3G4S F;  1VQM F;  1GZ0 A;  1W40 A;  1E7K A;  3CD6 F;  5GAP K;  2OTJ F;  3JCM M;  1YJW F;  5DCV A;  2QA4 F;  1S72 F;  3AGK A;  1XBI A;  1VQK F;  1KD1 H;  1K9M H;  3NMU C;  1QVF F;  1VQ8 F;  3CCJ F;  2JNB A;  1Q86 H;  1RA4 A;  3CCL F;  1YHQ F;  1K73 H;  1VQ6 F;  5G4U C;  3RA6 A;  5GIN C;  3IR9 A;  3LWP C;  3NVI B;  2QEX F;  1CK2 A;  1W3E X;  2VGM A;  3MCA B;  1Q82 H;  1PXW A;  2FC3 A;  2KTU A;  3J80 M;  2HVY D;  2KTV A;  1Q7Y H;  3PAF A;  3LWR C;  3HJW C;  2QI2 A;  5G4V C;  1ZWZ A;  3V7E A;  5GIO C;  1YJ9 F;  1H7M A;  3J81 M;  2LBX A;  1VQL F;  1X52 A;  3CXC F;  1YI2 F;  3PLA C;  1VQP F;  2VGN A;  3WXM B;  1YIJ F;  3CC2 F;  3CC4 F;  3ON1 A;  3CCR F;  4BY9 D;  5FJ4 C;  1RLG A;  5GAN K;  3NK6 A;  1T0K B;  4TZZ A;  1KQS F;  3OBW A;  3CC7 F;  3N4Y A;  2ALE A;  3NK7 A;  2CZW A;  1VQ7 F;  1IPA A;  5A2Q M;  1CN7 A;  3I55 F;  3LFO A;  5GIP C;  1W41 A;  3FFM A;  5EO3 A;  2WAL A;  3N4Z A;  3LWO C;  3CCE F;  1W2B F;  1N8R H;  3CCS F;  4X3M A;  3O85 A;  1W42 A;  2I6D A;  3E20 B;  3J7A R;  3CMA F;  3I56 F;  1VQ9 F;  3VI6 A;  2OHW A;  3LWQ C;  3SIU A;  4LCK A;  1Q81 H;  3CCQ F;  1JJ2 F;  3CCV F;  2LBW A;  3LWV C;  3HAX D;  3G71 F;  5EWR A;  3E1Y A;  3V7Q A;  1M1K H;  3CPQ A;  3OW2 F;  1QVG F;  1VQN F;  3CCU F;  2AIF A;  1GO0 A;  5IT9 M;  3RA5 A;  3SIV A;  3NVK E;  1K8A H;  3CPW F;  3OBY A;  3CME F;  1VQ5 F;  3CCM F;  1SDS A;  4BW0 B;  5FLX M; 
#chains in the Genus database with same CATH topology
 1W57 A;  3KIZ A;  3VMF B;  1YJN F;  3KE1 A;  1VQ4 F;  1M90 H;  1R1M A;  5J2T A;  5EIB C;  1JFF A;  4R40 B;  3IEQ A;  2LBT A;  1H47 A;  3JVH A;  5AVM A;  4X3L A;  2UYJ A;  3C9S A;  2ZAU A;  2BO1 A;  5LYJ A;  5EAZ A;  3RYF B;  2HS3 A;  1E7K A;  2BTO A;  3CD6 F;  3TD3 A;  1U3P A;  2QA4 F;  1UI9 A;  2H6L A;  1VQK F;  1KD1 H;  2W8B C;  4BVR A;  2PHN A;  5LP6 C;  1RQ2 A;  3CCJ F;  2PMP A;  2UYK A;  3ZO8 A;  3S02 A;  2B33 A;  2EWC A;  4ZOL B;  3IKE A;  4B45 A;  1VQ6 F;  5IYZ A;  3ZOP A;  3M4S A;  3RA6 A;  1Z5V A;  3K2X A;  4I50 A;  5LP6 B;  2QEX F;  1W3E X;  1FSZ A;  3K14 A;  3MCA B;  1Q82 H;  5ITZ A;  4G4Z A;  4O4L A;  2OTM A;  4PWT A;  3KHN A;  2KTV A;  1Q7Y H;  2Z1E A;  2GZL A;  5G4V C;  3WJR A;  2VAP A;  4O4I A;  1H7M A;  1TUB A;  1Z5W A;  3J81 M;  1T0A A;  2IG8 A;  3ZP7 A;  5CA1 B;  3S0Y A;  4ZHQ B;  1RLU A;  3JAR A;  4DXD A;  4X1K B;  1YI2 F;  4FFB B;  3MQW A;  4TUY B;  5HWE A;  3CCR F;  5IJ9 A;  4B5C A;  5EYP A;  1RLG A;  4X20 A;  3NK6 A;  2HRY A;  4I4T B;  2UYN A;  1W5F A;  1VK3 A;  2BTU A;  3C9U A;  1CN7 A;  3I55 F;  1J7H A;  3LFO A;  5HY4 A;  4IHJ B;  2HS4 A;  5CA0 B;  3CCE F;  5JCO A;  1W2B F;  3JAL B;  3BYQ A;  1W42 A;  4C8G A;  3HKC B;  3E20 B;  3J7A R;  5EB0 A;  4C81 A;  5EZY A;  3VTI C;  2UYP A;  4F6R A;  1VQ9 F;  3JAW A;  4O4J A;  3LWQ C;  5FNV B;  2R6R 1;  2F9Z C;  5JQG A;  3LWV C;  3G71 F;  5EWR A;  3ELC A;  3OW2 F;  1QVG F;  1FNK A;  4O2B B;  4B62 A;  5JH7 A;  4O4H B;  2N48 A;  2VAM A;  1YQN A;  3M1X A;  3P10 A;  4G4X A;  4BT5 A;  3RA5 A;  3SIV A;  1YGY A;  1IV3 A;  2HS0 A;  4BW0 B;  1GX1 A;  3DC2 A;  1FNJ A;  2Z1T A;  3MBM A;  2V9Y A;  3VCZ A;  4TV9 B;  2OTL F;  3M84 A;  2ZVY A;  4C4W C;  4U3J A;  2HX0 A;  3CYP B;  3F0D A;  1FFX A;  3QHD A;  4ZHY B;  3RYH B;  4BVS A;  2ZOV A;  3ESJ A;  1YIT F;  4X1Y A;  3JAK B;  2BTQ B;  4EB6 B;  3F0F A;  4YJ2 B;  3B6N A;  5J2U A;  1X7P A;  1U3L A;  1NJI H;  3HKB B;  1GZ0 A;  5KX5 B;  1W40 A;  2LCA A;  5GAP K;  4G4V A;  5HY2 A;  3WPW A;  5DCV A;  1K9M H;  1JY8 A;  2AIZ P;  1PF5 A;  2HQS C;  3QUW A;  3CCL F;  3E22 B;  3L7Q A;  1K73 H;  2H8E A;  5G4U C;  5GIN C;  5LA6 A;  1CK2 A;  1PXW A;  5B8F A;  2KTU A;  3WJP A;  3D54 A;  3N2G B;  3J80 M;  3VIU A;  1ODE A;  5EB1 B;  3WJQ A;  3V7E A;  3V4D A;  3UT5 A;  5LOV B;  4TV8 B;  4ZOL A;  2ZVZ A;  3DDN A;  1XRG A;  4BT4 A;  1SZQ A;  3JAS A;  3KJJ A;  5GON A;  3RYI B;  3WGN A;  3K12 A;  2LBX A;  1VQL F;  1X52 A;  5LP6 A;  3PLA C;  3JAT B;  2VGN A;  4G88 A;  2RHO A;  3WPX A;  3HKE B;  3CC4 F;  4M8I A;  2ZOD A;  3U0O A;  4TZZ A;  3D01 A;  3OBW A;  1JFF B;  5BMV B;  3NK7 A;  2CZW A;  1VQ7 F;  1IPA A;  5MN6 A;  2CWJ A;  3P0Z A;  5JVD A;  4EI7 A;  5GIP C;  4FFB A;  3TD5 A;  3F0G A;  5LYJ B;  3VO8 A;  2WAL A;  2KGW A;  3N4Z A;  2VAW A;  3LWO C;  1N8R H;  2DYY A;  3CCS F;  4X3M A;  1OAP A;  3RYC A;  4I4T A;  4ZI7 A;  3I56 F;  3F0E A;  3VI6 A;  1SA0 A;  1RQ7 A;  3CCQ F;  3GHZ A;  3IEW A;  1M1K H;  2GVI A;  1VQN F;  5IJ0 A;  1GO0 A;  3HKC A;  5IYZ B;  3C8L A;  3WGK A;  4I50 B;  2GLZ A;  2H8C A;  5ITZ B;  3CCM F;  3N2K B;  3CG6 A;  1GO1 A;  1VH8 A;  4X1I B;  3V3T A;  3P4E A;  2Q1X A;  4I55 A;  4WBN A;  4O4H A;  4O4I B;  4E6E A;  1U43 A;  1TUB B;  4NUT A;  4B46 A;  3MCQ A;  5KMG A;  2HP3 A;  1TVK A;  3G6E F;  1X7O A;  5EIB D;  3G4S F;  5IJ9 B;  5EYP B;  1OFU A;  2OTJ F;  1XHO A;  4C82 A;  2L26 A;  1YJW F;  4HNA A;  1QU9 A;  1XBI A;  2UYN B;  3AGK A;  5HP7 A;  1QVF F;  3RYH A;  4LNU A;  3GTZ A;  4IIJ A;  4DRX A;  4YJ2 A;  2P6Y A;  3S0W A;  1DBF A;  5KX5 A;  1NQ3 A;  1JN1 A;  5CB4 B;  3HKD A;  5EZY B;  3LWP C;  4F6R B;  3JAW B;  3FBA A;  2IQQ A;  4O4J B;  2VGM A;  2FC3 A;  3WGJ A;  3EOR A;  4O2A A;  5HXU A;  2VXY A;  2HVY D;  5JQG B;  4EI9 A;  3PAF A;  3HJW C;  2QI2 A;  3D00 A;  5LXT B;  1YJ9 F;  4C8E A;  1IV4 A;  2MQE A;  3R0P A;  4BT2 A;  3WGM A;  4XCQ A;  1IV2 A;  3C9T A;  4BT7 A;  3S03 A;  1VQP F;  2HP0 B;  1YIJ F;  3ON1 A;  3S0H A;  3VYT C;  5FJ4 C;  2Z1U A;  3RYF A;  4NQ3 A;  5GAN K;  1T0K B;  5LOV A;  4U3J B;  3MDO A;  1QAH A;  4X1Y B;  5A2Q M;  4YJ3 B;  1IV1 A;  3JAT A;  1W41 A;  2CSL A;  5HY0 A;  2QTP A;  3FFM A;  5J2U B;  3CYQ A;  5EO3 A;  2I6D A;  2OHW A;  5BMV A;  5C8Y B;  1JD1 A;  3SIU A;  4LCK A;  2RHJ A;  1Q81 H;  2Z01 A;  3HAX D;  1VHA A;  3HTN A;  5J2T B;  3CCU F;  5HXZ A;  2AIF A;  4BVQ A;  5CA1 A;  5IT9 M;  4G4W A;  4ZHQ A;  1QD9 A;  5LA6 B;  4BVT A;  4X1K A;  1K8A H;  3CPW F;  3NVK E;  3CME F;  1W58 1;  2R75 1;  1SDS A;  3FD5 A;  5FLX M;  1Q8R A;  4TUY A;  2Q1Y A;  2KG4 A;  1W55 A;  2I6R A;  3JAM M;  3UT5 B;  1VQO F;  2NMU A;  2G9I A;  3JAS B;  5GON B;  1NMU B;  3F6M A;  1KC8 H;  1DT9 A;  1UFY A;  5MN4 A;  1VQV A;  3VYS C;  4IHJ A;  5CA0 A;  1X25 A;  3I3F A;  3N2K A;  4ZK7 A;  3GYQ A;  2OZB A;  1COM A;  2Z1F A;  1VQM F;  1W59 A;  3JAL A;  2UZH A;  2YYE A;  4X1I A;  3S06 A;  2IAF A;  3JCM M;  3CB2 A;  3I7T A;  1S72 F;  3NMU C;  5FNV A;  1VQ8 F;  1H48 A;  4O4L B;  2JNB A;  1Q86 H;  2CHS A;  1RA4 A;  5JVD B;  1YHQ F;  3ZP4 A;  4O2B A;  4ZHW A;  1KNK A;  1XV2 A;  2K1S A;  3FPI A;  3RYC B;  3IR9 A;  4ZI7 B;  3NVI B;  3JAR B;  3LME A;  3HWU A;  3IKF A;  4BT3 A;  1SA0 B;  3RE3 A;  3T80 A;  3KJK A;  3TD4 A;  1W5E A;  3LWR C;  1ZWZ A;  4X20 B;  5JCO C;  5GIO C;  4TV9 A;  5MN5 A;  4U39 A;  3WGL A;  5IJ0 B;  5CB4 A;  4BT6 A;  1KNJ A;  3VOB A;  3CXC F;  3VOA A;  3JAK A;  4C8I A;  4NWO B;  4EB6 A;  1U40 A;  2ZF8 A;  3WXM B;  4G4Y A;  3ERN A;  2RHH A;  3CC2 F;  4EI8 A;  4RQO A;  4BY9 D;  3HKB A;  5LXT A;  5HP8 A;  4I55 B;  1KQS F;  3CC7 F;  4WBN B;  3IMP A;  3K0T A;  3N4Y A;  3OON A;  2ALE A;  4ERH A;  2RHL A;  1W5B A;  3E22 A;  2HP0 A;  1CLI A;  5KMG B;  2HRU A;  1TVK B;  5JH7 B;  3QTY A;  3O85 A;  3LYB A;  1W5A A;  3CMA F;  4HNA B;  2CVL A;  1JJ2 F;  4LNU B;  3N2G A;  3CCV F;  2LBW A;  3C9R A;  4YJ3 A;  4IIJ B;  4DRX B;  3E1Y A;  3V7Q A;  3CPQ A;  4RHA A;  4TV8 A;  5HY1 A;  3Q8H A;  2FGY A;  2YXZ A;  3RYI A;  1FFX B;  2RB9 A;  2AMT A;  2CHT A;  2CW4 A;  2DT4 A;  3HKD B;  4ZHV A;  3FD6 A;  1ONI A;  3OBY A;  5C8Y A;  4KWE A;  3VYU C;  3HKE A;  1VQ5 F;  3LDT A;  4O2A B; 
#chains in the Genus database with same CATH homology
 3CG6 A;  1GO1 A;  3VMF B;  2KG4 A;  1YJN F;  1VQ4 F;  1M90 H;  3V3T A;  3JAM M;  1VQO F;  2OTL F;  4C4W C;  1NMU B;  1KC8 H;  4BVS A;  4NUT A;  1YIT F;  4X3L A;  1DT9 A;  2BO1 A;  3G6E F;  1X7P A;  3GYQ A;  2OZB A;  1NJI H;  1X7O A;  3G4S F;  1VQM F;  1GZ0 A;  1W40 A;  1E7K A;  3CD6 F;  5GAP K;  2OTJ F;  5HY2 A;  3JCM M;  1YJW F;  5DCV A;  2QA4 F;  1S72 F;  3AGK A;  1XBI A;  1VQK F;  1KD1 H;  1K9M H;  3NMU C;  4BVR A;  1VQ8 F;  1QVF F;  3CCJ F;  2JNB A;  1Q86 H;  1RA4 A;  3CCL F;  1YHQ F;  1K73 H;  1VQ6 F;  5G4U C;  3RA6 A;  5GIN C;  3IR9 A;  3LWP C;  3NVI B;  2QEX F;  1CK2 A;  1W3E X;  2VGM A;  3MCA B;  1Q82 H;  1PXW A;  2FC3 A;  2KTU A;  3J80 M;  5HXU A;  2HVY D;  2KTV A;  1Q7Y H;  4EI9 A;  3PAF A;  3LWR C;  3HJW C;  2QI2 A;  3D00 A;  1ZWZ A;  5G4V C;  3V7E A;  5GIO C;  1YJ9 F;  1H7M A;  3J81 M;  2LBX A;  1VQL F;  1X52 A;  3CXC F;  1YI2 F;  4XCQ A;  3PLA C;  1VQP F;  2VGN A;  3WXM B;  1YIJ F;  3CC2 F;  3CC4 F;  3ON1 A;  5HWE A;  3CCR F;  4EI8 A;  4BY9 D;  5FJ4 C;  1RLG A;  4NQ3 A;  5GAN K;  3NK6 A;  1T0K B;  4TZZ A;  1KQS F;  3OBW A;  3CC7 F;  3N4Y A;  2ALE A;  3NK7 A;  2CZW A;  1VQ7 F;  1IPA A;  5A2Q M;  1CN7 A;  3I55 F;  3LFO A;  5GIP C;  1W41 A;  4EI7 A;  5HY4 A;  5HY0 A;  3FFM A;  5EO3 A;  2WAL A;  3N4Z A;  3LWO C;  3CCE F;  1W2B F;  1N8R H;  3CCS F;  4X3M A;  3O85 A;  1W42 A;  2I6D A;  3E20 B;  3J7A R;  3CMA F;  3I56 F;  1VQ9 F;  3VI6 A;  2OHW A;  3LWQ C;  3SIU A;  4LCK A;  1Q81 H;  3CCQ F;  1JJ2 F;  3CCV F;  2LBW A;  2F9Z C;  3LWV C;  3HAX D;  3G71 F;  5EWR A;  3E1Y A;  3V7Q A;  1M1K H;  3CPQ A;  3OW2 F;  1QVG F;  1VQN F;  5HY1 A;  3CCU F;  5HXZ A;  2AIF A;  4BVQ A;  2FGY A;  1GO0 A;  5IT9 M;  3RA5 A;  3SIV A;  3NVK E;  4BVT A;  1K8A H;  3CPW F;  3OBY A;  2GLZ A;  3CME F;  1VQ5 F;  3CCM F;  1SDS A;  4BW0 B;  5FLX M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...