3LWOC

Structure of h/aca rnp bound to a substrate rna containing 5bru
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycosidic bond conformation preference plays a pivotal role in catalysis of RNA pseudouridylation: a combined simulation and structural study.
pubmed doi rcsb
molecule keywords Pseudouridine synthase Cbf5
molecule tags Isomerase/rna binding protein/rna
source organism Pyrococcus furiosus
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwoC00
1X7PA 5GANK 3CCEF 1YJ9F 3HAXD 3CMEF 3NVKE 4TZZA 3AGKA 1Q82H 3ON1A 2QEXF 2HVYD 3LWVC 1M1KH 3O85A 3G6EF 1E7KA 1GO0A 1QVGF 1VQMF 1M90H 3HJWC 3CCJF 3CCLF 2OTLF 1KD1H 1K8AH 3NK6A 3J7AR 1YI2F 2OTJF 2KTVA 2LBWA 3CC7F 1VQNF 3SIVA 1YIJF 5G4UC 1H7MA 2ALEA 3CMAF 3E1YA 2CZWA 2JNBA 3CCSF 2WALA 3OBWA 5FJ4C 1CN7A 3VMFB 1Q7YH 1Q86H 2OZBA 1VQ8F 1QVFF 3CCVF 2LBXA 4X3MA 3CCMF 5A2QM 4BW0B 3JCMM 3OW2F 3VI6A 5GINC 1X52A 5IT9M 1VQ6F 4X3LA 2AIFA 1IPAA 5EWRA 2KG4A 1XBIA 3LWPC 3RA6A 3RA5A 3CCUF 1YHQF 3NK7A 3IR9A 2QI2A 1GO1A 3OBYA 3PAFA 3CCRF 1CK2A 1GZ0A 3CG6A 1KQSF 1RA4A 1VQ4F 1RLGA 1YJNF 2KTUA 3I55F 1X7OA 1N8RH 2VGNA 5GIPC 3N4YA 3G4SF 1YITF 1SDSA 3CCQF 1ZWZA 1VQPF 1JJ2F 3LWRC 3MCAB 1VQ7F 1T0KB 2FC3A 5DCVA 1NMUB 1K73H 1VQLF 4NUTA 3V7EA 1S72F 4BY9D 1W2BF 3J80M 1YJWF 1K9MH 1VQOF 3N4ZA 2QA4F 1NJIH 3WXMB 3SIUA 4C4WC 3CXCF 3LWQC 3PLAC 1W42A 3J81M 3NMUC 3FFMA 2BO1A 3G71F 3CC2F 1VQ9F 4LCKA 3GYQA 1W3EX 3V7QA 2OHWA 3E20B 5FLXM 1VQ5F 2VGMA 1W40A 3I56F 1PXWA 3JAMM 1DT9A 3CPWF 1KC8H 3CC4F 3NVIB 3CPQA 1Q81H 1VQKF 2I6DA 5GIOC 3LFOA 3CD6F 5EO3A 1W41A 5G4VC 3LWOC 5GAPK
chains in the Genus database with same CATH superfamily
1X7PA 4F6RA 5HP7A 3NVKE 3I3FA 3VYSC 1Q82H 2HS0A 3ON1A 4X20B 2W8BC 3JVHA 3UT5B 2DT4A 4BT4A 2QEXF 2HVYD 2B33A 3HKEB 3MCQA 5JQGB 5LYJB 4O4HA 3O85A 3G6EF 1QVGF 3N2GB 4F6RB 1M90H 3HJWC 3CCJF 1KD1H 3F0EA 3QTYA 4LNUA 4X1IA 4IIJB 2LBWA 3CC7F 1T0AA 5JVDB 2GVIA 3RYIB 1JD1A 3VOBA 3TD5A 2ALEA 3CMAF 3E1YA 2CZWA 2WALA 1QU9A 4BT7A 3JAWA 3VMFB 1FNKA 5IJ9A 2HP3A 2RHLA 4NWOB 5FNVA 1J7HA 2BTUA 1W55A 2NMUA 3MDOA 5A2QM 3S0YA 3VI6A 1Z5VA 3GHZA 1VQ6F 2AIFA 1IPAA 3WGNA 4C81A 4DRXA 2QTPA 5FNVB 2KG4A 3CYPB 3LWPC 3VO8A 3LMEA 3RA5A 4G4WA 3ZO8A 2Z01A 4TV8A 1GX1A 1YHQF 2QI2A 3C9SA 1GO1A 3K2XA 3L7QA 5HY1A 3WJPA 2AIZP 1W581 3IKFA 4HNAA 1CLIA 3ZOPA 2KTUA 2ZODA 1VHAA 2HP0A 3RYCA 1N8RH 4TV8B 3KJKA 3ZP7A 3N4YA 5JCOA 3HWUA 3VCZA 3G4SF 3FPIA 1NQ3A 1FFXA 3DDNA 3K12A 5EZYA 1H48A 3IEWA 1VQ7F 5DCVA 5IYZA 1NMUB 4HNAB 4X1KB 2HX0A 5EYPA 1S72F 3K14A 2QA4F 1NJIH 2Q1XA 3WXMB 1IV4A 3CXCF 3PLAC 1W42A 3EORA 3J81M 4ZHWA 1IV1A 3F6MA 4ZHYB 5KMGA 5JH7A 4O4JB 2VAPA 4TUYA 2HRUA 4LCKA 3GYQA 2VXYA 5IYZB 3HKBB 3F0DA 2VGMA 1PXWA 2LCAA 5MN5A 1VQKF 4ZI7A 4EB6B 1JFFA 2RHHA 3N2KA 2K1SA 1W41A 4BT6A 2OTMA 5G4VC 5GAPK 1JN1A 4O2BA 3HAXD 4TZZA 3AGKA 3I7TA 2R6R1 1H47A 1JFFB 3VOAA 2F9ZC 1M1KH 5KX5B 3Q8HA 1GO0A 2HQSC 1VQMF 4O2BB 3RYHB 2VAWA 5C8YA 3K0TA 4BVQA 2OTLF 4U3JA 1JY8A 1YI2F 5IJ0B 3JASB 2YYEA 1YIJF 5G4UC 4O4LA 3M84A 3HKCB 3C8LA 4O4IA 1W57A 4G4YA 5ITZB 2YXZA 3ESJA 5C8YB 2PMPA 3GTZA 3OBWA 3IEQA 1CN7A 3FD5A 1VH8A 3ZP4A 4BVTA 5CA1A 1QVFF 1U3PA 3JARA 2V9YA 4BW0B 4ZHQA 2HS4A 3WJRA 2RHOA 1X52A 4X3LA 3V3TA 1RLUA 1XBIA 2AMTA 1XHOA 3JAKA 4O2AA 3RA6A 5CA1B 4O4HB 5EIBC 1TVKA 2PHNA 5LA6A 2KGWA 3MQWA 2EWCA 3RYFA 2IAFA 3OBYA 4BT5A 1CK2A 3VYTC 3CG6A 4IHJA 4WBNA 4BT2A 1IV2A 3HKDA 1UFYA 2G9IA 3D00A 3TD4A 1VQ4F 3R0PA 4LNUB 4X1IB 4BVRA 2L26A 4BVSA 1XRGA 3I55F 1X7OA 2VGNA 5LA6B 3KJJA 5EIBD 1YITF 1SDSA 1VQPF 1JJ2F 1U40A 1X25A 3P4EA 4EI7A 3LWRC 1QAHA 2ZVZA 4I4TA 4WBNB 3JAWB 4NUTA 5IJ9B 2CW4A 1VQOF 3N4ZA 3S0HA 3SIUA 3F0GA 5GONA 2BO1A 1RQ2A 3CC2F 1XV2A 4I4TB 5EB1B 3P10A 4ZOLA 5JCOC 1W3EX 4DRXB 2OHWA 3E20B 5J2TA 1VQ5F 5J2UA 1W40A 1DT9A 3CPWF 4B45A 1KC8H 3C9UA 5LP6A 4R40B 2RHJA 3LFOA 3LWOC 4ZOLB 1FSZA 3JATA 3T80A 1FNJA 3CCEF 3CMEF 3S03A 2HP0B 5HWEA 5HY4A 3RYCB 3OONA 2CWJA 5LOVA 1FFXB 3LWVC 4YJ2A 5EZYB 2BTQB 3WGJA 1E7KA 5HY2A 4DXDA 5EYPB 4EI8A 1K8AH 2VAMA 3LYBA 5KMGB 2OTJF 5JH7B 2KTVA 5EAZA 1VQNF 3TD3A 5LXTA 3SIVA 4YJ2B 4TUYB 4I55A 4B5CA 3CYQA 4U39A 2UZHA 1Z5WA 1R1MA 3IKEA 4ZI7B 1Q7YH 1Q86H 2R751 3N2KB 4B62A 1VQ8F 1KNKA 5LXTB 3QUWA 4FFBA 4C82A 2LBXA 2UYPA 3P0ZA 3CCMF 3WPXA 4X1YA 3WGLA 2HS3A 4EI9A 4B46A 5EWRA 5CB4A 5MN4A 4E6EA 5B8FA 2I6RA 2IG8A 1U43A 3CCUF 2Z1TA 4TV9A 2UYKA 2DYYA 3NK7A 4NQ3A 3E22A 3PAFA 2UYNA 2CHSA 4I50A 3CCRF 1W5AA 4U3JB 4ZHVA 4BT3A 3JALA 1YJNF 3M4SA 3WGMA 2Q1YA 3S02A 2H8EA 4O4LB 4M8IA 1VQVA 4O4IB 2LBTA 5GIPC 4C8EA 4X20A 4I50B 2UYNB 1VK3A 4C8IA 3HKEA 3MCAB 5LYJA 1T0KB 3N2GA 1W2BF 3RE3A 2FGYA 3VYUC 4C4WC 3JARB 4XCQA 4RHAA 4ZHQB 4IIJA 3ELCA 3CB2A 5JVDA 3RYIA 2GLZA 3V4DA 2ZF8A 4O2AB 2RB9A 3JAKB 4RQOA 3D54A 1OAPA 3CC4F 1TVKB 3CPQA 2HRYA 3RYFB 2I6DA 2P6YA 1RQ7A 5GIOC 4KWEA 4IHJB 3HKDB 2CVLA 4G4XA 3C9TA 5HP8A 5GANK 3FD6A 1YJ9F 1KNJA 2IQQA 3B6NA 2Z1UA 3HTNA 1TUBA 1ONIA 3FBAA 3WPWA 5LP6C 3S0WA 1QD9A 3WGKA 3CCLF 1COMA 3VTIC 3NK6A 3U0OA 5GONB 4PWTA 3VIUA 3J7AR 1U3LA 2ZVYA 1TUBB 5HY0A 1W5EA 5HXZA 1DBFA 5AVMA 5CA0A 1H7MA 1YQNA 5HXUA 4YJ3A 1W59A 5J2TB 2JNBA 5J2UB 3CCSF 2MQEA 5FJ4C 5LP6B 4X1KA 2OZBA 3KIZA 1PF5A 3CCVF 4G88A 2UYJA 5CA0B 5BMVA 4X3MA 3JATB 4YJ3B 4ZK7A 3C9RA 4O4JA 3JCMM 3OW2F 5GINC 5IT9M 1SZQA 3KHNA 3HKBA 3LDTA 3MBMA 5LOVB 1W5FA 4G4VA 3DC2A 3QHDA 5BMVB 3IR9A 4EB6A 2CSLA 3KE1A 3M1XA 1SA0A 1GZ0A 3ERNA 1KQSF 1RA4A 1OFUA 1RLGA 3BYQA 4I55B 3F0FA 3D01A 3WJQA 1ZWZA 3CCQF 1SA0B 5KX5A 2FC3A 1K73H 1VQLF 3V7EA 2H6LA 1YGYA 2BTOA 3RYHA 4C8GA 3J80M 4BY9D 1YJWF 3IMPA 1K9MH 4FFBB 2H8CA 2Z1FA 2ZOVA 3LWQC 3NMUC 2N48A 3FFMA 2CHTA 5IJ0A 3G71F 3JASA 1VQ9F 4X1YB 4ERHA 3HKCA 2GZLA 1Q8RA 3V7QA 5ITZA 1IV3A 5FLXM 1ODEA 3S06A 5CB4B 2Z1EA 3I56F 1W5BA 5MN6A 3JAMM 2ZAUA 3NVIB 4TV9B 1Q81H 3E22B 3UT5A 3CD6F 5JQGA 1UI9A 5EB0A 5EO3A 3JALB 4G4ZA
chains in the Genus database with same CATH topology
1X7PA 5GANK 3CCEF 1YJ9F 3HAXD 3CMEF 3NVKE 4TZZA 3AGKA 5HWEA 5HY4A 1Q82H 3ON1A 2QEXF 2HVYD 2F9ZC 3LWVC 1M1KH 3O85A 3G6EF 5HY2A 1E7KA 1GO0A 1QVGF 1VQMF 1M90H 3HJWC 4BVQA 3CCJF 3CCLF 2OTLF 1KD1H 4EI8A 1K8AH 3NK6A 3J7AR 1YI2F 2OTJF 2KTVA 2LBWA 3CC7F 1VQNF 5HY0A 3SIVA 1YIJF 5G4UC 5HXZA 5HXUA 1H7MA 2ALEA 3CMAF 3E1YA 2CZWA 2JNBA 3CCSF 2WALA 3OBWA 5FJ4C 1CN7A 3VMFB 1Q7YH 1Q86H 2OZBA 1VQ8F 4BVTA 3CCVF 1QVFF 2LBXA 4X3MA 3CCMF 5A2QM 4BW0B 3JCMM 3OW2F 3VI6A 5GINC 1X52A 5IT9M 1VQ6F 4X3LA 3V3TA 2AIFA 1IPAA 4EI9A 5EWRA 2KG4A 1XBIA 3LWPC 3RA6A 3RA5A 3CCUF 1YHQF 3NK7A 3IR9A 2QI2A 4NQ3A 1GO1A 3OBYA 3PAFA 3CCRF 1CK2A 1GZ0A 5HY1A 3CG6A 1KQSF 1RA4A 3D00A 1VQ4F 1RLGA 1YJNF 4BVRA 4BVSA 2KTUA 3I55F 1X7OA 1N8RH 2VGNA 5GIPC 3N4YA 3G4SF 1YITF 1SDSA 3CCQF 1ZWZA 1VQPF 1JJ2F 3LWRC 4EI7A 3MCAB 1VQ7F 1T0KB 2FC3A 5DCVA 1NMUB 1K73H 1VQLF 4NUTA 3V7EA 1S72F 4BY9D 1W2BF 3J80M 1YJWF 1K9MH 1VQOF 3N4ZA 2QA4F 2FGYA 1NJIH 3WXMB 3SIUA 4C4WC 3CXCF 4XCQA 3LWQC 1W42A 3J81M 3NMUC 3PLAC 3FFMA 2BO1A 3G71F 3CC2F 1VQ9F 4LCKA 3GYQA 2GLZA 1W3EX 3V7QA 2OHWA 3E20B 5FLXM 1VQ5F 2VGMA 1W40A 3I56F 1PXWA 3JAMM 1DT9A 3CPWF 1KC8H 3CC4F 3NVIB 3CPQA 1Q81H 1VQKF 2I6DA 3LFOA 5GIOC 3CD6F 5EO3A 1W41A 5G4VC 3LWOC 5GAPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7P A;  5GAN K;  3CCE F;  1YJ9 F;  3HAX D;  3CME F;  3NVK E;  4TZZ A;  3AGK A;  1Q82 H;  3ON1 A;  2QEX F;  2HVY D;  3LWV C;  1M1K H;  3O85 A;  3G6E F;  1E7K A;  1GO0 A;  1QVG F;  1VQM F;  1M90 H;  3HJW C;  3CCJ F;  3CCL F;  2OTL F;  1KD1 H;  1K8A H;  3NK6 A;  3J7A R;  1YI2 F;  2OTJ F;  2KTV A;  2LBW A;  3CC7 F;  1VQN F;  3SIV A;  1YIJ F;  5G4U C;  1H7M A;  2ALE A;  3CMA F;  3E1Y A;  2CZW A;  2JNB A;  3CCS F;  2WAL A;  3OBW A;  5FJ4 C;  1CN7 A;  3VMF B;  1Q7Y H;  1Q86 H;  2OZB A;  1VQ8 F;  1QVF F;  3CCV F;  2LBX A;  4X3M A;  3CCM F;  5A2Q M;  4BW0 B;  3JCM M;  3OW2 F;  3VI6 A;  5GIN C;  1X52 A;  5IT9 M;  1VQ6 F;  4X3L A;  2AIF A;  1IPA A;  5EWR A;  2KG4 A;  1XBI A;  3LWP C;  3RA6 A;  3RA5 A;  3CCU F;  1YHQ F;  3NK7 A;  3IR9 A;  2QI2 A;  1GO1 A;  3OBY A;  3PAF A;  3CCR F;  1CK2 A;  1GZ0 A;  3CG6 A;  1KQS F;  1RA4 A;  1VQ4 F;  1RLG A;  1YJN F;  2KTU A;  3I55 F;  1X7O A;  1N8R H;  2VGN A;  5GIP C;  3N4Y A;  3G4S F;  1YIT F;  1SDS A;  3CCQ F;  1ZWZ A;  1VQP F;  1JJ2 F;  3LWR C;  3MCA B;  1VQ7 F;  1T0K B;  2FC3 A;  5DCV A;  1NMU B;  1K73 H;  1VQL F;  4NUT A;  3V7E A;  1S72 F;  4BY9 D;  1W2B F;  3J80 M;  1YJW F;  1K9M H;  1VQO F;  3N4Z A;  2QA4 F;  1NJI H;  3WXM B;  3SIU A;  4C4W C;  3CXC F;  3LWQ C;  3PLA C;  1W42 A;  3J81 M;  3NMU C;  3FFM A;  2BO1 A;  3G71 F;  3CC2 F;  1VQ9 F;  4LCK A;  3GYQ A;  1W3E X;  3V7Q A;  2OHW A;  3E20 B;  5FLX M;  1VQ5 F;  2VGM A;  1W40 A;  3I56 F;  1PXW A;  3JAM M;  1DT9 A;  3CPW F;  1KC8 H;  3CC4 F;  3NVI B;  3CPQ A;  1Q81 H;  1VQK F;  2I6D A;  5GIO C;  3LFO A;  3CD6 F;  5EO3 A;  1W41 A;  5G4V C;  3LWO C;  5GAP K; 
#chains in the Genus database with same CATH topology
 1X7P A;  4F6R A;  5HP7 A;  3NVK E;  3I3F A;  3VYS C;  1Q82 H;  2HS0 A;  3ON1 A;  4X20 B;  2W8B C;  3JVH A;  3UT5 B;  2DT4 A;  4BT4 A;  2QEX F;  2HVY D;  2B33 A;  3HKE B;  3MCQ A;  5JQG B;  5LYJ B;  4O4H A;  3O85 A;  3G6E F;  1QVG F;  3N2G B;  4F6R B;  1M90 H;  3HJW C;  3CCJ F;  1KD1 H;  3F0E A;  3QTY A;  4LNU A;  4X1I A;  4IIJ B;  2LBW A;  3CC7 F;  1T0A A;  5JVD B;  2GVI A;  3RYI B;  1JD1 A;  3VOB A;  3TD5 A;  2ALE A;  3CMA F;  3E1Y A;  2CZW A;  2WAL A;  1QU9 A;  4BT7 A;  3JAW A;  3VMF B;  1FNK A;  5IJ9 A;  2HP3 A;  2RHL A;  4NWO B;  5FNV A;  1J7H A;  2BTU A;  1W55 A;  2NMU A;  3MDO A;  5A2Q M;  3S0Y A;  3VI6 A;  1Z5V A;  3GHZ A;  1VQ6 F;  2AIF A;  1IPA A;  3WGN A;  4C81 A;  4DRX A;  2QTP A;  5FNV B;  2KG4 A;  3CYP B;  3LWP C;  3VO8 A;  3LME A;  3RA5 A;  4G4W A;  3ZO8 A;  2Z01 A;  4TV8 A;  1GX1 A;  1YHQ F;  2QI2 A;  3C9S A;  1GO1 A;  3K2X A;  3L7Q A;  5HY1 A;  3WJP A;  2AIZ P;  1W58 1;  3IKF A;  4HNA A;  1CLI A;  3ZOP A;  2KTU A;  2ZOD A;  1VHA A;  2HP0 A;  3RYC A;  1N8R H;  4TV8 B;  3KJK A;  3ZP7 A;  3N4Y A;  5JCO A;  3HWU A;  3VCZ A;  3G4S F;  3FPI A;  1NQ3 A;  1FFX A;  3DDN A;  3K12 A;  5EZY A;  1H48 A;  3IEW A;  1VQ7 F;  5DCV A;  5IYZ A;  1NMU B;  4HNA B;  4X1K B;  2HX0 A;  5EYP A;  1S72 F;  3K14 A;  2QA4 F;  1NJI H;  2Q1X A;  3WXM B;  1IV4 A;  3CXC F;  3PLA C;  1W42 A;  3EOR A;  3J81 M;  4ZHW A;  1IV1 A;  3F6M A;  4ZHY B;  5KMG A;  5JH7 A;  4O4J B;  2VAP A;  4TUY A;  2HRU A;  4LCK A;  3GYQ A;  2VXY A;  5IYZ B;  3HKB B;  3F0D A;  2VGM A;  1PXW A;  2LCA A;  5MN5 A;  1VQK F;  4ZI7 A;  4EB6 B;  1JFF A;  2RHH A;  3N2K A;  2K1S A;  1W41 A;  4BT6 A;  2OTM A;  5G4V C;  5GAP K;  1JN1 A;  4O2B A;  3HAX D;  4TZZ A;  3AGK A;  3I7T A;  2R6R 1;  1H47 A;  1JFF B;  3VOA A;  2F9Z C;  1M1K H;  5KX5 B;  3Q8H A;  1GO0 A;  2HQS C;  1VQM F;  4O2B B;  3RYH B;  2VAW A;  5C8Y A;  3K0T A;  4BVQ A;  2OTL F;  4U3J A;  1JY8 A;  1YI2 F;  5IJ0 B;  3JAS B;  2YYE A;  1YIJ F;  5G4U C;  4O4L A;  3M84 A;  3HKC B;  3C8L A;  4O4I A;  1W57 A;  4G4Y A;  5ITZ B;  2YXZ A;  3ESJ A;  5C8Y B;  2PMP A;  3GTZ A;  3OBW A;  3IEQ A;  1CN7 A;  3FD5 A;  1VH8 A;  3ZP4 A;  4BVT A;  5CA1 A;  1QVF F;  1U3P A;  3JAR A;  2V9Y A;  4BW0 B;  4ZHQ A;  2HS4 A;  3WJR A;  2RHO A;  1X52 A;  4X3L A;  3V3T A;  1RLU A;  1XBI A;  2AMT A;  1XHO A;  3JAK A;  4O2A A;  3RA6 A;  5CA1 B;  4O4H B;  5EIB C;  1TVK A;  2PHN A;  5LA6 A;  2KGW A;  3MQW A;  2EWC A;  3RYF A;  2IAF A;  3OBY A;  4BT5 A;  1CK2 A;  3VYT C;  3CG6 A;  4IHJ A;  4WBN A;  4BT2 A;  1IV2 A;  3HKD A;  1UFY A;  2G9I A;  3D00 A;  3TD4 A;  1VQ4 F;  3R0P A;  4LNU B;  4X1I B;  4BVR A;  2L26 A;  4BVS A;  1XRG A;  3I55 F;  1X7O A;  2VGN A;  5LA6 B;  3KJJ A;  5EIB D;  1YIT F;  1SDS A;  1VQP F;  1JJ2 F;  1U40 A;  1X25 A;  3P4E A;  4EI7 A;  3LWR C;  1QAH A;  2ZVZ A;  4I4T A;  4WBN B;  3JAW B;  4NUT A;  5IJ9 B;  2CW4 A;  1VQO F;  3N4Z A;  3S0H A;  3SIU A;  3F0G A;  5GON A;  2BO1 A;  1RQ2 A;  3CC2 F;  1XV2 A;  4I4T B;  5EB1 B;  3P10 A;  4ZOL A;  5JCO C;  1W3E X;  4DRX B;  2OHW A;  3E20 B;  5J2T A;  1VQ5 F;  5J2U A;  1W40 A;  1DT9 A;  3CPW F;  4B45 A;  1KC8 H;  3C9U A;  5LP6 A;  4R40 B;  2RHJ A;  3LFO A;  3LWO C;  4ZOL B;  1FSZ A;  3JAT A;  3T80 A;  1FNJ A;  3CCE F;  3CME F;  3S03 A;  2HP0 B;  5HWE A;  5HY4 A;  3RYC B;  3OON A;  2CWJ A;  5LOV A;  1FFX B;  3LWV C;  4YJ2 A;  5EZY B;  2BTQ B;  3WGJ A;  1E7K A;  5HY2 A;  4DXD A;  5EYP B;  4EI8 A;  1K8A H;  2VAM A;  3LYB A;  5KMG B;  2OTJ F;  5JH7 B;  2KTV A;  5EAZ A;  1VQN F;  3TD3 A;  5LXT A;  3SIV A;  4YJ2 B;  4TUY B;  4I55 A;  4B5C A;  3CYQ A;  4U39 A;  2UZH A;  1Z5W A;  1R1M A;  3IKE A;  4ZI7 B;  1Q7Y H;  1Q86 H;  2R75 1;  3N2K B;  4B62 A;  1VQ8 F;  1KNK A;  5LXT B;  3QUW A;  4FFB A;  4C82 A;  2LBX A;  2UYP A;  3P0Z A;  3CCM F;  3WPX A;  4X1Y A;  3WGL A;  2HS3 A;  4EI9 A;  4B46 A;  5EWR A;  5CB4 A;  5MN4 A;  4E6E A;  5B8F A;  2I6R A;  2IG8 A;  1U43 A;  3CCU F;  2Z1T A;  4TV9 A;  2UYK A;  2DYY A;  3NK7 A;  4NQ3 A;  3E22 A;  3PAF A;  2UYN A;  2CHS A;  4I50 A;  3CCR F;  1W5A A;  4U3J B;  4ZHV A;  4BT3 A;  3JAL A;  1YJN F;  3M4S A;  3WGM A;  2Q1Y A;  3S02 A;  2H8E A;  4O4L B;  4M8I A;  1VQV A;  4O4I B;  2LBT A;  5GIP C;  4C8E A;  4X20 A;  4I50 B;  2UYN B;  1VK3 A;  4C8I A;  3HKE A;  3MCA B;  5LYJ A;  1T0K B;  3N2G A;  1W2B F;  3RE3 A;  2FGY A;  3VYU C;  4C4W C;  3JAR B;  4XCQ A;  4RHA A;  4ZHQ B;  4IIJ A;  3ELC A;  3CB2 A;  5JVD A;  3RYI A;  2GLZ A;  3V4D A;  2ZF8 A;  4O2A B;  2RB9 A;  3JAK B;  4RQO A;  3D54 A;  1OAP A;  3CC4 F;  1TVK B;  3CPQ A;  2HRY A;  3RYF B;  2I6D A;  2P6Y A;  1RQ7 A;  5GIO C;  4KWE A;  4IHJ B;  3HKD B;  2CVL A;  4G4X A;  3C9T A;  5HP8 A;  5GAN K;  3FD6 A;  1YJ9 F;  1KNJ A;  2IQQ A;  3B6N A;  2Z1U A;  3HTN A;  1TUB A;  1ONI A;  3FBA A;  3WPW A;  5LP6 C;  3S0W A;  1QD9 A;  3WGK A;  3CCL F;  1COM A;  3VTI C;  3NK6 A;  3U0O A;  5GON B;  4PWT A;  3VIU A;  3J7A R;  1U3L A;  2ZVY A;  1TUB B;  5HY0 A;  1W5E A;  5HXZ A;  1DBF A;  5AVM A;  5CA0 A;  1H7M A;  1YQN A;  5HXU A;  4YJ3 A;  1W59 A;  5J2T B;  2JNB A;  5J2U B;  3CCS F;  2MQE A;  5FJ4 C;  5LP6 B;  4X1K A;  2OZB A;  3KIZ A;  1PF5 A;  3CCV F;  4G88 A;  2UYJ A;  5CA0 B;  5BMV A;  4X3M A;  3JAT B;  4YJ3 B;  4ZK7 A;  3C9R A;  4O4J A;  3JCM M;  3OW2 F;  5GIN C;  5IT9 M;  1SZQ A;  3KHN A;  3HKB A;  3LDT A;  3MBM A;  5LOV B;  1W5F A;  4G4V A;  3DC2 A;  3QHD A;  5BMV B;  3IR9 A;  4EB6 A;  2CSL A;  3KE1 A;  3M1X A;  1SA0 A;  1GZ0 A;  3ERN A;  1KQS F;  1RA4 A;  1OFU A;  1RLG A;  3BYQ A;  4I55 B;  3F0F A;  3D01 A;  3WJQ A;  1ZWZ A;  3CCQ F;  1SA0 B;  5KX5 A;  2FC3 A;  1K73 H;  1VQL F;  3V7E A;  2H6L A;  1YGY A;  2BTO A;  3RYH A;  4C8G A;  3J80 M;  4BY9 D;  1YJW F;  3IMP A;  1K9M H;  4FFB B;  2H8C A;  2Z1F A;  2ZOV A;  3LWQ C;  3NMU C;  2N48 A;  3FFM A;  2CHT A;  5IJ0 A;  3G71 F;  3JAS A;  1VQ9 F;  4X1Y B;  4ERH A;  3HKC A;  2GZL A;  1Q8R A;  3V7Q A;  5ITZ A;  1IV3 A;  5FLX M;  1ODE A;  3S06 A;  5CB4 B;  2Z1E A;  3I56 F;  1W5B A;  5MN6 A;  3JAM M;  2ZAU A;  3NVI B;  4TV9 B;  1Q81 H;  3E22 B;  3UT5 A;  3CD6 F;  5JQG A;  1UI9 A;  5EB0 A;  5EO3 A;  3JAL B;  4G4Z A; 
#chains in the Genus database with same CATH homology
 1X7P A;  5GAN K;  3CCE F;  1YJ9 F;  3HAX D;  3CME F;  3NVK E;  4TZZ A;  3AGK A;  5HWE A;  5HY4 A;  1Q82 H;  3ON1 A;  2QEX F;  2HVY D;  2F9Z C;  3LWV C;  1M1K H;  3O85 A;  3G6E F;  5HY2 A;  1E7K A;  1GO0 A;  1QVG F;  1VQM F;  1M90 H;  3HJW C;  4BVQ A;  3CCJ F;  3CCL F;  2OTL F;  1KD1 H;  4EI8 A;  1K8A H;  3NK6 A;  3J7A R;  1YI2 F;  2OTJ F;  2KTV A;  2LBW A;  3CC7 F;  1VQN F;  5HY0 A;  3SIV A;  1YIJ F;  5G4U C;  5HXZ A;  5HXU A;  1H7M A;  2ALE A;  3CMA F;  3E1Y A;  2CZW A;  2JNB A;  3CCS F;  2WAL A;  3OBW A;  5FJ4 C;  1CN7 A;  3VMF B;  1Q7Y H;  1Q86 H;  2OZB A;  1VQ8 F;  4BVT A;  3CCV F;  1QVF F;  2LBX A;  4X3M A;  3CCM F;  5A2Q M;  4BW0 B;  3JCM M;  3OW2 F;  3VI6 A;  5GIN C;  1X52 A;  5IT9 M;  1VQ6 F;  4X3L A;  3V3T A;  2AIF A;  1IPA A;  4EI9 A;  5EWR A;  2KG4 A;  1XBI A;  3LWP C;  3RA6 A;  3RA5 A;  3CCU F;  1YHQ F;  3NK7 A;  3IR9 A;  2QI2 A;  4NQ3 A;  1GO1 A;  3OBY A;  3PAF A;  3CCR F;  1CK2 A;  1GZ0 A;  5HY1 A;  3CG6 A;  1KQS F;  1RA4 A;  3D00 A;  1VQ4 F;  1RLG A;  1YJN F;  4BVR A;  4BVS A;  2KTU A;  3I55 F;  1X7O A;  1N8R H;  2VGN A;  5GIP C;  3N4Y A;  3G4S F;  1YIT F;  1SDS A;  3CCQ F;  1ZWZ A;  1VQP F;  1JJ2 F;  3LWR C;  4EI7 A;  3MCA B;  1VQ7 F;  1T0K B;  2FC3 A;  5DCV A;  1NMU B;  1K73 H;  1VQL F;  4NUT A;  3V7E A;  1S72 F;  4BY9 D;  1W2B F;  3J80 M;  1YJW F;  1K9M H;  1VQO F;  3N4Z A;  2QA4 F;  2FGY A;  1NJI H;  3WXM B;  3SIU A;  4C4W C;  3CXC F;  4XCQ A;  3LWQ C;  1W42 A;  3J81 M;  3NMU C;  3PLA C;  3FFM A;  2BO1 A;  3G71 F;  3CC2 F;  1VQ9 F;  4LCK A;  3GYQ A;  2GLZ A;  1W3E X;  3V7Q A;  2OHW A;  3E20 B;  5FLX M;  1VQ5 F;  2VGM A;  1W40 A;  3I56 F;  1PXW A;  3JAM M;  1DT9 A;  3CPW F;  1KC8 H;  3CC4 F;  3NVI B;  3CPQ A;  1Q81 H;  1VQK F;  2I6D A;  3LFO A;  5GIO C;  3CD6 F;  5EO3 A;  1W41 A;  5G4V C;  3LWO C;  5GAP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...