3LWQA

Structure of h/aca rnp bound to a substrate rna containing 3mu
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
326
structure length
316
Chain Sequence
ILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 92
structure length 316
sequence length 326
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3lwqA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3lwqA02
1KSLA 2I82A 3ZV0C 3DH3A 1PRZA 1KSKA 1SGVA 1ZL3A 4LGTA 1V9KA 3UAIA 2APOA 1QYUA 3MQKA 2HVYA 1ZE1A 3LWOA 3HJYA 2AUSA 2RFKA 1K8WA 3HAXA 1V9FA 3LWQA 2AB4A 1KSVA 1R3FA 3LWVA 2ISTA 2EY4A 3U28A 4LABA 3LWPA 1ZE2A 3HJWA 1XPIA 3LWRA 1R3EA
chains in the Genus database with same CATH superfamily
1KSLA 3ZV0C 1ZL3A 2APOA 1Q7HA 3MQKA 2HVYA 1ZE1A 3M6UA 2AUSA 3VSEA 3LWQA 4Q1TA 1XNEA 2CWWA 3LWVA 3M65A 2J5TA 2CX1A 4CI3B 3LDFA 1XPIA 3M6WA 3DH3A 2FRXA 1PRZA 1KSKA 3UAIA 2KKUA 1SQWA 2AB4A 1KSVA 3M4XA 2P38A 1WXWA 2ANEA 3LWPA 1ZE2A 2DP9A 2AS0A 1WK2A 3LWRA 1IQ8A 2I82A 2E5OA 1IT8A 1J2BA 3LWOA 1TE7A 2B78A 3LJCA 3HJYA 1WXXA 3D79A 1IT7A 1SB7A 1S04A 4CI1B 2ISTA 1SZWA 2Z0TA 3HJWA 3M6VA 1R3EA 2J5VA 1UOYA 1SGVA 3M6XA 4LGTA 1V9KA 1QYUA 1ZBOA 1Z2ZA 4TZ4C 1T5YA 1K8WA 2RFKA 3HAXA 1V9FA 1R3FA 2Q07A 1ZS7A 3IUWA 2EY4A 4DMGA 3U28A 4LABA 1SI7A 4CI2B 2CX0A 3C0KA
chains in the Genus database with same CATH topology
1KSLA 2I82A 3ZV0C 3DH3A 2FRXA 1PRZA 1UOYA 1KSKA 1SGVA 3M6XA 1ZL3A 4LGTA 1V9KA 3UAIA 2APOA 1QYUA 3MQKA 2HVYA 1ZE1A 3LWOA 3HJYA 1Z2ZA 3M6UA 2AUSA 2RFKA 1K8WA 3HAXA 1V9FA 3LWQA 2AB4A 1SB7A 1KSVA 1R3FA 3LWVA 3M4XA 2ISTA 2EY4A 3U28A 4LABA 3LWPA 1SI7A 1SZWA 1ZE2A 3HJWA 3M6VA 1XPIA 3M6WA 3LWRA 1R3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSL A;  2I82 A;  3ZV0 C;  3DH3 A;  1PRZ A;  1KSK A;  1SGV A;  1ZL3 A;  4LGT A;  1V9K A;  3UAI A;  2APO A;  1QYU A;  3MQK A;  2HVY A;  1ZE1 A;  3LWO A;  3HJY A;  2AUS A;  2RFK A;  1K8W A;  3HAX A;  1V9F A;  3LWQ A;  2AB4 A;  1KSV A;  1R3F A;  3LWV A;  2IST A;  2EY4 A;  3U28 A;  4LAB A;  3LWP A;  1ZE2 A;  3HJW A;  1XPI A;  3LWR A;  1R3E A; 
#chains in the Genus database with same CATH topology
 1KSL A;  3ZV0 C;  1ZL3 A;  2APO A;  1Q7H A;  3MQK A;  2HVY A;  1ZE1 A;  3M6U A;  2AUS A;  3VSE A;  3LWQ A;  4Q1T A;  1XNE A;  2CWW A;  3LWV A;  3M65 A;  2J5T A;  2CX1 A;  4CI3 B;  3LDF A;  1XPI A;  3M6W A;  3DH3 A;  2FRX A;  1PRZ A;  1KSK A;  3UAI A;  2KKU A;  1SQW A;  2AB4 A;  1KSV A;  3M4X A;  2P38 A;  1WXW A;  2ANE A;  3LWP A;  1ZE2 A;  2DP9 A;  2AS0 A;  1WK2 A;  3LWR A;  1IQ8 A;  2I82 A;  2E5O A;  1IT8 A;  1J2B A;  3LWO A;  1TE7 A;  2B78 A;  3LJC A;  3HJY A;  1WXX A;  3D79 A;  1IT7 A;  1SB7 A;  1S04 A;  4CI1 B;  2IST A;  1SZW A;  2Z0T A;  3HJW A;  3M6V A;  1R3E A;  2J5V A;  1UOY A;  1SGV A;  3M6X A;  4LGT A;  1V9K A;  1QYU A;  1ZBO A;  1Z2Z A;  4TZ4 C;  1T5Y A;  1K8W A;  2RFK A;  3HAX A;  1V9F A;  1R3F A;  2Q07 A;  1ZS7 A;  3IUW A;  2EY4 A;  4DMG A;  3U28 A;  4LAB A;  1SI7 A;  4CI2 B;  2CX0 A;  3C0K A; 
#chains in the Genus database with same CATH homology
 1KSL A;  2I82 A;  3ZV0 C;  3DH3 A;  2FRX A;  1PRZ A;  1UOY A;  1KSK A;  1SGV A;  3M6X A;  1ZL3 A;  4LGT A;  1V9K A;  3UAI A;  2APO A;  1QYU A;  3MQK A;  2HVY A;  1ZE1 A;  3LWO A;  3HJY A;  1Z2Z A;  3M6U A;  2AUS A;  2RFK A;  1K8W A;  3HAX A;  1V9F A;  3LWQ A;  2AB4 A;  1SB7 A;  1KSV A;  1R3F A;  3LWV A;  3M4X A;  2IST A;  2EY4 A;  3U28 A;  4LAB A;  3LWP A;  1SI7 A;  1SZW A;  1ZE2 A;  3HJW A;  3M6V A;  1XPI A;  3M6W A;  3LWR A;  1R3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...