3LWQA

Structure of h/aca rnp bound to a substrate rna containing 3mu
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
326
structure length
316
Chain Sequence
ILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
molecule keywords Pseudouridine synthase Cbf5
total genus 92
structure length 316
sequence length 326
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3lwqA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3lwqA02
2EY4A 1K8WA 2ISTA 1V9FA 2AUSA 3LWOA 3HJYA 1KSVA 2HVYA 3LWVA 2RFKA 4LGTA 2AB4A 3MQKA 1PRZA 2APOA 1KSLA 1ZL3A 1XPIA 3DH3A 1V9KA 1ZE1A 3HAXA 4LABA 1QYUA 3ZV0C 3LWPA 1R3FA 3HJWA 1SGVA 2I82A 3U28A 1ZE2A 3UAIA 1KSKA 1R3EA 3LWQA 3LWRA
chains in the Genus database with same CATH superfamily
2EY4A 2P38A 3LWOA 2E5OA 3MQKA 1PRZA 1KSLA 1ZL3A 1T5YA 2Q07A 3M6UA 3M6VA 4LABA 1ZBOA 2I82A 1R3EA 1UOYA 3LDFA 1ZS7A 3LWRA 4DMGA 1K8WA 3IUWA 2CX0A 1SQWA 2ISTA 3VSEA 1V9FA 1KSVA 3LWVA 2RFKA 3M4XA 1WXXA 1S04A 1WXWA 1Q7HA 2Z0TA 3C0KA 1XPIA 2AS0A 2KKUA 1QYUA 1R3FA 3U28A 1ZE2A 1XNEA 3M65A 2DP9A 4Q1TA 1SZWA 2AUSA 3HJYA 2HVYA 2J5VA 1IT7A 3M6WA 2B78A 4TZ4C 3DH3A 1ZE1A 2CX1A 4CI2B 3LWPA 3HJWA 1IQ8A 1KSKA 4CI3B 2CWWA 1SI7A 2ANEA 3D79A 1J2BA 4LGTA 1IT8A 2FRXA 3LJCA 2AB4A 1Z2ZA 2APOA 1SB7A 3M6XA 1V9KA 1WK2A 3HAXA 3ZV0C 1SGVA 4CI1B 2J5TA 3UAIA 3LWQA 1TE7A
chains in the Genus database with same CATH topology
2EY4A 1K8WA 1SZWA 1SI7A 2ISTA 1V9FA 2AUSA 3LWOA 3HJYA 1KSVA 2HVYA 3LWVA 2RFKA 3M4XA 2FRXA 4LGTA 2AB4A 3MQKA 1PRZA 3M6WA 1Z2ZA 2APOA 1KSLA 1ZL3A 1SB7A 3M6XA 1XPIA 1V9KA 3DH3A 1ZE1A 3M6VA 3M6UA 3HAXA 4LABA 1QYUA 3ZV0C 3LWPA 1R3FA 3HJWA 1SGVA 2I82A 3U28A 1ZE2A 3UAIA 1UOYA 1KSKA 1R3EA 3LWQA 3LWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY4 A;  1K8W A;  2IST A;  1V9F A;  2AUS A;  3LWO A;  3HJY A;  1KSV A;  2HVY A;  3LWV A;  2RFK A;  4LGT A;  2AB4 A;  3MQK A;  1PRZ A;  2APO A;  1KSL A;  1ZL3 A;  1XPI A;  3DH3 A;  1V9K A;  1ZE1 A;  3HAX A;  4LAB A;  1QYU A;  3ZV0 C;  3LWP A;  1R3F A;  3HJW A;  1SGV A;  2I82 A;  3U28 A;  1ZE2 A;  3UAI A;  1KSK A;  1R3E A;  3LWQ A;  3LWR A; 
#chains in the Genus database with same CATH topology
 2EY4 A;  2P38 A;  3LWO A;  2E5O A;  3MQK A;  1PRZ A;  1KSL A;  1ZL3 A;  1T5Y A;  2Q07 A;  3M6U A;  3M6V A;  4LAB A;  1ZBO A;  2I82 A;  1R3E A;  1UOY A;  3LDF A;  1ZS7 A;  3LWR A;  4DMG A;  1K8W A;  3IUW A;  2CX0 A;  1SQW A;  2IST A;  3VSE A;  1V9F A;  1KSV A;  3LWV A;  2RFK A;  3M4X A;  1WXX A;  1S04 A;  1WXW A;  1Q7H A;  2Z0T A;  3C0K A;  1XPI A;  2AS0 A;  2KKU A;  1QYU A;  1R3F A;  3U28 A;  1ZE2 A;  1XNE A;  3M65 A;  2DP9 A;  4Q1T A;  1SZW A;  2AUS A;  3HJY A;  2HVY A;  2J5V A;  1IT7 A;  3M6W A;  2B78 A;  4TZ4 C;  3DH3 A;  1ZE1 A;  2CX1 A;  4CI2 B;  3LWP A;  3HJW A;  1IQ8 A;  1KSK A;  4CI3 B;  2CWW A;  1SI7 A;  2ANE A;  3D79 A;  1J2B A;  4LGT A;  1IT8 A;  2FRX A;  3LJC A;  2AB4 A;  1Z2Z A;  2APO A;  1SB7 A;  3M6X A;  1V9K A;  1WK2 A;  3HAX A;  3ZV0 C;  1SGV A;  4CI1 B;  2J5T A;  3UAI A;  3LWQ A;  1TE7 A; 
#chains in the Genus database with same CATH homology
 2EY4 A;  1K8W A;  1SZW A;  1SI7 A;  2IST A;  1V9F A;  2AUS A;  3LWO A;  3HJY A;  1KSV A;  2HVY A;  3LWV A;  2RFK A;  3M4X A;  2FRX A;  4LGT A;  2AB4 A;  3MQK A;  1PRZ A;  3M6W A;  1Z2Z A;  2APO A;  1KSL A;  1ZL3 A;  1SB7 A;  3M6X A;  1XPI A;  1V9K A;  3DH3 A;  1ZE1 A;  3M6V A;  3M6U A;  3HAX A;  4LAB A;  1QYU A;  3ZV0 C;  3LWP A;  1R3F A;  3HJW A;  1SGV A;  2I82 A;  3U28 A;  1ZE2 A;  3UAI A;  1UOY A;  1KSK A;  1R3E A;  3LWQ A;  3LWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...