3LWQA

Structure of h/aca rnp bound to a substrate rna containing 3mu
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
326
structure length
316
Chain Sequence
b'ILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 92
structure length 316
sequence length 326
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3lwqA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3lwqA02
3LWOA 3U28A 4LABA 1QYUA 3HJYA 1PRZA 1XPIA 3MQKA 1ZE1A 2I82A 3HJWA 3LWPA 1R3FA 1KSLA 2ISTA 1R3EA 2HVYA 1V9KA 2RFKA 1KSKA 4LGTA 3UAIA 3LWRA 3LWVA 3DH3A 3LWQA 1K8WA 1SGVA 3ZV0C 2EY4A 2APOA 1KSVA 2AUSA 3HAXA 1V9FA 2AB4A 1ZE2A 1ZL3A
chains in the Genus database with same CATH superfamily
1ZE1A 3LWPA 1XNEA 2E5OA 1R3EA 1WXXA 1SQWA 2HVYA 2RFKA 3LWRA 3LWVA 1WK2A 1IT8A 2FRXA 1TE7A 2ANEA 3M6UA 3LWOA 1Z2ZA 2B78A 1ZS7A 4Q1TA 4CI3B 1IQ8A 3D79A 3HJWA 3VSEA 2CX1A 1KSKA 3M6VA 3LWQA 2CWWA 1K8WA 1KSVA 2AB4A 3C0KA 3LDFA 1SZWA 3U28A 1ZBOA 1Q7HA 2AS0A 2CX0A 3HJYA 1QYUA 1XPIA 2P38A 3M4XA 2ISTA 1IT7A 2DP9A 1V9KA 4DMGA 3UAIA 4CI2B 3LJCA 1J2BA 2Z0TA 2AUSA 1ZE2A 3HAXA 1V9FA 1UOYA 1T5YA 2KKUA 4LABA 3M6XA 1PRZA 3MQKA 2I82A 3IUWA 1R3FA 1WXWA 1KSLA 1SI7A 2J5TA 2J5VA 4LGTA 1SB7A 3DH3A 1SGVA 2Q07A 4TZ4C 1S04A 2EY4A 2APOA 3ZV0C 3M6WA 1ZL3A 3M65A 4CI1B
chains in the Genus database with same CATH topology
3LWOA 1SZWA 3U28A 1Z2ZA 4LABA 3M6XA 3HJYA 1PRZA 1QYUA 1XPIA 3MQKA 1ZL3A 1ZE1A 2I82A 3HJWA 3M4XA 3LWPA 1R3FA 1KSLA 1SI7A 2ISTA 1R3EA 2HVYA 1V9KA 2RFKA 1KSKA 4LGTA 3UAIA 3LWRA 3LWVA 1SB7A 3M6VA 3DH3A 3LWQA 2FRXA 1K8WA 1SGVA 3ZV0C 2EY4A 2APOA 1KSVA 2AUSA 3HAXA 1V9FA 3M6WA 2AB4A 3M6UA 1ZE2A 1UOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWO A;  3U28 A;  4LAB A;  1QYU A;  3HJY A;  1PRZ A;  1XPI A;  3MQK A;  1ZE1 A;  2I82 A;  3HJW A;  3LWP A;  1R3F A;  1KSL A;  2IST A;  1R3E A;  2HVY A;  1V9K A;  2RFK A;  1KSK A;  4LGT A;  3UAI A;  3LWR A;  3LWV A;  3DH3 A;  3LWQ A;  1K8W A;  1SGV A;  3ZV0 C;  2EY4 A;  2APO A;  1KSV A;  2AUS A;  3HAX A;  1V9F A;  2AB4 A;  1ZE2 A;  1ZL3 A; 
#chains in the Genus database with same CATH topology
 1ZE1 A;  3LWP A;  1XNE A;  2E5O A;  1R3E A;  1WXX A;  1SQW A;  2HVY A;  2RFK A;  3LWR A;  3LWV A;  1WK2 A;  1IT8 A;  2FRX A;  1TE7 A;  2ANE A;  3M6U A;  3LWO A;  1Z2Z A;  2B78 A;  1ZS7 A;  4Q1T A;  4CI3 B;  1IQ8 A;  3D79 A;  3HJW A;  3VSE A;  2CX1 A;  1KSK A;  3M6V A;  3LWQ A;  2CWW A;  1K8W A;  1KSV A;  2AB4 A;  3C0K A;  3LDF A;  1SZW A;  3U28 A;  1ZBO A;  1Q7H A;  2AS0 A;  2CX0 A;  3HJY A;  1QYU A;  1XPI A;  2P38 A;  3M4X A;  2IST A;  1IT7 A;  2DP9 A;  1V9K A;  4DMG A;  3UAI A;  4CI2 B;  3LJC A;  1J2B A;  2Z0T A;  2AUS A;  1ZE2 A;  3HAX A;  1V9F A;  1UOY A;  1T5Y A;  2KKU A;  4LAB A;  3M6X A;  1PRZ A;  3MQK A;  2I82 A;  3IUW A;  1R3F A;  1WXW A;  1KSL A;  1SI7 A;  2J5T A;  2J5V A;  4LGT A;  1SB7 A;  3DH3 A;  1SGV A;  2Q07 A;  4TZ4 C;  1S04 A;  2EY4 A;  2APO A;  3ZV0 C;  3M6W A;  1ZL3 A;  3M65 A;  4CI1 B; 
#chains in the Genus database with same CATH homology
 3LWO A;  1SZW A;  3U28 A;  1Z2Z A;  4LAB A;  3M6X A;  3HJY A;  1PRZ A;  1QYU A;  1XPI A;  3MQK A;  1ZL3 A;  1ZE1 A;  2I82 A;  3HJW A;  3M4X A;  3LWP A;  1R3F A;  1KSL A;  1SI7 A;  2IST A;  1R3E A;  2HVY A;  1V9K A;  2RFK A;  1KSK A;  4LGT A;  3UAI A;  3LWR A;  3LWV A;  1SB7 A;  3M6V A;  3DH3 A;  3LWQ A;  2FRX A;  1K8W A;  1SGV A;  3ZV0 C;  2EY4 A;  2APO A;  1KSV A;  2AUS A;  3HAX A;  1V9F A;  3M6W A;  2AB4 A;  3M6U A;  1ZE2 A;  1UOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...