3LWVA

Structure of h/aca rnp bound to a substrate rna containing 2'-deoxyuridine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
327
structure length
317
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
molecule keywords Pseudouridine synthase Cbf5
total genus 93
structure length 317
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3lwvA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3lwvA02
1ZE1A 3MQKA 3HJWA 3LWQA 3LWPA 3DH3A 1PRZA 2HVYA 2ISTA 2RFKA 2I82A 1SGVA 2EY4A 3LWOA 4LGTA 2APOA 1R3EA 3LWRA 1KSLA 4LABA 1KSKA 1KSVA 3HAXA 2AB4A 2AUSA 3U28A 1ZL3A 3ZV0C 1K8WA 1V9KA 1R3FA 3HJYA 3LWVA 3UAIA 1V9FA 1QYUA 1XPIA 1ZE2A
chains in the Genus database with same CATH superfamily
3MQKA 2KKUA 3LWPA 2ISTA 1Z2ZA 1TE7A 1KSLA 4TZ4C 1J2BA 2AB4A 3HAXA 3U28A 1ZL3A 3ZV0C 1SQWA 3UAIA 1WXXA 3LDFA 1ZE2A 1ZE1A 3M6UA 4CI1B 2Q07A 3HJWA 3LWQA 1WK2A 2AS0A 2RFKA 3C0KA 2I82A 2EY4A 4LGTA 1WXWA 1KSKA 1KSVA 4Q1TA 3M4XA 1IT8A 1K8WA 2J5TA 1R3FA 3HJYA 1UOYA 2Z0TA 3LWVA 2CX1A 2J5VA 1S04A 1ZBOA 1SZWA 3DH3A 1T5YA 4CI3B 2FRXA 2B78A 1SI7A 3LWOA 2P38A 4CI2B 1R3EA 3LWRA 3M65A 4LABA 2AUSA 3LJCA 3M6XA 2ANEA 1ZS7A 1SB7A 1XNEA 4DMGA 1QYUA 1XPIA 3D79A 3IUWA 1Q7HA 1PRZA 3M6WA 2HVYA 1SGVA 2APOA 2CWWA 1IQ8A 3M6VA 1V9KA 3VSEA 2CX0A 1IT7A 2DP9A 1V9FA 2E5OA
chains in the Genus database with same CATH topology
1ZE1A 3M6UA 3MQKA 3HJWA 1SZWA 3LWQA 3LWPA 3DH3A 1PRZA 3M6WA 2HVYA 2ISTA 2RFKA 2I82A 2FRXA 1SGVA 1SI7A 2EY4A 3LWOA 1Z2ZA 4LGTA 2APOA 1R3EA 3LWRA 1KSLA 4LABA 1KSKA 3HAXA 1KSVA 2AB4A 2AUSA 3U28A 3M4XA 1ZL3A 3ZV0C 1K8WA 3M6VA 1V9KA 3M6XA 1R3FA 3HJYA 1UOYA 1SB7A 3LWVA 3UAIA 1V9FA 1QYUA 1XPIA 1ZE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZE1 A;  3MQK A;  3HJW A;  3LWQ A;  3LWP A;  3DH3 A;  1PRZ A;  2HVY A;  2IST A;  2RFK A;  2I82 A;  1SGV A;  2EY4 A;  3LWO A;  4LGT A;  2APO A;  1R3E A;  3LWR A;  1KSL A;  4LAB A;  1KSK A;  1KSV A;  3HAX A;  2AB4 A;  2AUS A;  3U28 A;  1ZL3 A;  3ZV0 C;  1K8W A;  1V9K A;  1R3F A;  3HJY A;  3LWV A;  3UAI A;  1V9F A;  1QYU A;  1XPI A;  1ZE2 A; 
#chains in the Genus database with same CATH topology
 3MQK A;  2KKU A;  3LWP A;  2IST A;  1Z2Z A;  1TE7 A;  1KSL A;  4TZ4 C;  1J2B A;  2AB4 A;  3HAX A;  3U28 A;  1ZL3 A;  3ZV0 C;  1SQW A;  3UAI A;  1WXX A;  3LDF A;  1ZE2 A;  1ZE1 A;  3M6U A;  4CI1 B;  2Q07 A;  3HJW A;  3LWQ A;  1WK2 A;  2AS0 A;  2RFK A;  3C0K A;  2I82 A;  2EY4 A;  4LGT A;  1WXW A;  1KSK A;  1KSV A;  4Q1T A;  3M4X A;  1IT8 A;  1K8W A;  2J5T A;  1R3F A;  3HJY A;  1UOY A;  2Z0T A;  3LWV A;  2CX1 A;  2J5V A;  1S04 A;  1ZBO A;  1SZW A;  3DH3 A;  1T5Y A;  4CI3 B;  2FRX A;  2B78 A;  1SI7 A;  3LWO A;  2P38 A;  4CI2 B;  1R3E A;  3LWR A;  3M65 A;  4LAB A;  2AUS A;  3LJC A;  3M6X A;  2ANE A;  1ZS7 A;  1SB7 A;  1XNE A;  4DMG A;  1QYU A;  1XPI A;  3D79 A;  3IUW A;  1Q7H A;  1PRZ A;  3M6W A;  2HVY A;  1SGV A;  2APO A;  2CWW A;  1IQ8 A;  3M6V A;  1V9K A;  3VSE A;  2CX0 A;  1IT7 A;  2DP9 A;  1V9F A;  2E5O A; 
#chains in the Genus database with same CATH homology
 1ZE1 A;  3M6U A;  3MQK A;  3HJW A;  1SZW A;  3LWQ A;  3LWP A;  3DH3 A;  1PRZ A;  3M6W A;  2HVY A;  2IST A;  2RFK A;  2I82 A;  2FRX A;  1SGV A;  1SI7 A;  2EY4 A;  3LWO A;  1Z2Z A;  4LGT A;  2APO A;  1R3E A;  3LWR A;  1KSL A;  4LAB A;  1KSK A;  3HAX A;  1KSV A;  2AB4 A;  2AUS A;  3U28 A;  3M4X A;  1ZL3 A;  3ZV0 C;  1K8W A;  3M6V A;  1V9K A;  3M6X A;  1R3F A;  3HJY A;  1UOY A;  1SB7 A;  3LWV A;  3UAI A;  1V9F A;  1QYU A;  1XPI A;  1ZE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...