3LWVB

Structure of h/aca rnp bound to a substrate rna containing 2'-deoxyuridine
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
b'FRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04135 Nop10p Nucleolar RNA-binding protein, Nop10p family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.40 Mainly Beta Single Sheet Rubrerythrin, domain 2 H/ACA ribonucleoprotein complex, subunit Nop10 3lwvB00
3LWVB 3LWQB 2HVYC 2AQCA 2AUSB 2APOB 3LWRB 3HJWB 3MQKB 3HAXC 2RFKB 3LWPB 2EY4E 3LWOB 3HJYB
chains in the Genus database with same CATH superfamily
3VPBE 2JA6L 1TWAL 4C3IL 3S14L 1PFVA 1F4LA 2VUML 2J9UB 5FLML 4QIWP 3GTJL 1I6HL 5C4XL 1IU5A 3S1QL 3CQZL 5IY0A 2R92L 3H9BA 3HOUL 3NFPI 2NVQL 1I3QL 5IYDL 1T9PA 4Y7NL 3M4OL 1R0HA 4RXNA 2JI3A 2M4YA 4X6AL 3RYGA 4A3GL 1IW7D 3MQKB 1IU6A 5M5WL 5AN9H 4A3JL 1Y1VL 1B2JA 2XJVA 2MS3A 1DX8A 3MPSA 2PSMC 2NVYL 1RDGA 2RFKB 1R0JA 3GTLL 2CKAA 3P8BA 2RDVA 4BXXL 3LWRB 5FJ8L 2Z3QB 3H0GL 4POFA 3HOXL 3B0AB 3ZG6A 2A69D 5K2ME 1VZIA 5M5YL 3LWPB 1OWBA 3KYUA 4AHYA 6RXNA 2LCQA 4AR5A 1IRNA 1VZHA 3H9CA 2YU9L 4YWLA 1SMWA 3PIO1 3B08B 4LHLA 5IYCL 3LPEB 3PZAA 1TWHL 3J7Z1 4XGHA 1C09A 5M3ML 3IU3I 2V0EA 1JYBA 5IYBL 1ODHA 2JI1A 4BY7L 5H1Sc 1CAAA 2Y0SP 4Y52L 1RDVA 1BQ8A 3H99A 5MF6A 2K2DA 2M6OA 5AI3A 1TWGL 1TWFL 2QL0A 3PIP1 3LNLA 2GMGA 5MLC3 4A3BL 1R0GA 3GTML 3K7AL 2R7ZL 3S2DL 3I4ML 1YUZA 1WCML 3H3VM 1B13A 2C6AA 2CR8A 3S1NL 1E8JA 3PO3L 2WB1P 3FKIL 4A3IL 1QQTA 3RZTA 1IROA 1BRFA 2PVXA 3HJWB 1YK5A 2ERJA 4JADA 1BQ9A 3JR7A 1SFOL 4V196 1YUXA 1VZGA 3K35A 4AI1A 2WAQP 2NVXL 2E2JL 2PVEA 1BFYA 3GTQL 2A68D 5RXNA 3S1RL 3HOWL 2KN9A 3QQCE 2L0ZA 8RXNA 1VCXA 2DSXA 4AHWA 2BE5D 2ZIXA 2V3BB 2A6HD 2ERSA 2PYAA 3HOZL 4XXBB 3I4NL 5C44L 5MFPA 5GAHc 4BBRL 3RZDL 4AI2A 4B8CD 1SMUA 3LWOB 1PZXA 3WWNB 2XJQA 1FHMA 4YWMA 4WFN1 1SMMA 3KYXA 5JVG1 3GTPL 4A3FL 2PPTA 5DM61 4AR3A 1FHHA 4AHZA 1YV1A 4C3HL 5MGNA 5AI2A 2O5JD 2AYJA 3LWQB 2A6ED 3GTGL 1LKOA 1WJVA 5EINC 3QVDA 4A3EL 3S17L 2JI2A 5MFZA 4ZN1B 5M5XL 4LHNA 4A3DL 3RZ6A 1I50L 3PO2L 2Z3RB 3PWFA 2B63L 1NXEA 2XJPA 1PFYA 3HOYL 5M3FL 4JAFA 1NNQA 2C6BA 4AI0A 2NYDA 4BY1L 4AYBP 3HJYB 1B2OA 2HVYC 3SS2A 3HAXC 3PKIA 1YK4A 4U671 2HR5A 3P2AA 1K83L 2JA8L 3PL5A 2B5ID 4A3LL 2R93L 3MSUA 1DVBA 1BE7A 1ZRPA 4TVMA 1OWCA 3J7Y1 1S24A 1RWDA 1Z92B 1CADA 1Y1WL 1T9QA 1RYQA 3H97A 4JAGA 3PKJA 2JA5L 1P7PA 4A3KL 3RZOL 4POGA 2AQCA 5IP7L 2KKDA 5DM71 4A3CL 4AHXA 3GTOL 4G6BA 7RXNA 2CKCA 2EY4E 4GS7D 1QYBA 2M4VA 4ZN3B 3S1ML 1S30A 2E2IL 4K9FA 4C3JL 2XJTA 5EIOC 4AI3A 2JA7L 3FDJA 2APOB 4BBSL 2XJSA 1H7VA 1R0FA 2V0FA 2E2HL 4E6YA 3GTKL 3HKZP 5GAGc 3M3YL 3S16L 2XJRA 5GAEc 3A44A 4A93L 1TWCL 4C2M1 4JAEA 5C3EL 4UY81 2H12A 1NXGA 4AR6A 2AUSB 2NVTL 1QCVA 2M6PA 1LKPA 5JVH1 4AR4A 1RYTA 1LKMA 1RB9A 1LTLA 1PFUA 2PMZP 2XJUA 3KYYA 3HOVL 3S15L 5IP9L 3KYWA 4ME3A 5GADc 1PFWA 4TPUA 1R9TL 3LWVB 1R0IA 3S2HL 3KYVA 4A3ML 1T9OA 1B71A 1S2ZA 5C4JL 2VL6A 3WWLA
chains in the Genus database with same CATH topology
3LWVB 3LWQB 2HVYC 2AQCA 2AUSB 2APOB 3LWRB 3HJWB 3MQKB 3HAXC 2RFKB 3LWPB 2EY4E 3LWOB 3HJYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWV B;  3LWQ B;  2HVY C;  2AQC A;  2AUS B;  2APO B;  3LWR B;  3HJW B;  3MQK B;  3HAX C;  2RFK B;  3LWP B;  2EY4 E;  3LWO B;  3HJY B; 
#chains in the Genus database with same CATH topology
 3VPB E;  2JA6 L;  1TWA L;  4C3I L;  3S14 L;  1PFV A;  1F4L A;  2VUM L;  2J9U B;  5FLM L;  4QIW P;  3GTJ L;  1I6H L;  5C4X L;  1IU5 A;  3S1Q L;  3CQZ L;  5IY0 A;  2R92 L;  3H9B A;  3HOU L;  3NFP I;  2NVQ L;  1I3Q L;  5IYD L;  1T9P A;  4Y7N L;  3M4O L;  1R0H A;  4RXN A;  2JI3 A;  2M4Y A;  4X6A L;  3RYG A;  4A3G L;  1IW7 D;  3MQK B;  1IU6 A;  5M5W L;  5AN9 H;  4A3J L;  1Y1V L;  1B2J A;  2XJV A;  2MS3 A;  1DX8 A;  3MPS A;  2PSM C;  2NVY L;  1RDG A;  2RFK B;  1R0J A;  3GTL L;  2CKA A;  3P8B A;  2RDV A;  4BXX L;  3LWR B;  5FJ8 L;  2Z3Q B;  3H0G L;  4POF A;  3HOX L;  3B0A B;  3ZG6 A;  2A69 D;  5K2M E;  1VZI A;  5M5Y L;  3LWP B;  1OWB A;  3KYU A;  4AHY A;  6RXN A;  2LCQ A;  4AR5 A;  1IRN A;  1VZH A;  3H9C A;  2YU9 L;  4YWL A;  1SMW A;  3PIO 1;  3B08 B;  4LHL A;  5IYC L;  3LPE B;  3PZA A;  1TWH L;  3J7Z 1;  4XGH A;  1C09 A;  5M3M L;  3IU3 I;  2V0E A;  1JYB A;  5IYB L;  1ODH A;  2JI1 A;  4BY7 L;  5H1S c;  1CAA A;  2Y0S P;  4Y52 L;  1RDV A;  1BQ8 A;  3H99 A;  5MF6 A;  2K2D A;  2M6O A;  5AI3 A;  1TWG L;  1TWF L;  2QL0 A;  3PIP 1;  3LNL A;  2GMG A;  5MLC 3;  4A3B L;  1R0G A;  3GTM L;  3K7A L;  2R7Z L;  3S2D L;  3I4M L;  1YUZ A;  1WCM L;  3H3V M;  1B13 A;  2C6A A;  2CR8 A;  3S1N L;  1E8J A;  3PO3 L;  2WB1 P;  3FKI L;  4A3I L;  1QQT A;  3RZT A;  1IRO A;  1BRF A;  2PVX A;  3HJW B;  1YK5 A;  2ERJ A;  4JAD A;  1BQ9 A;  3JR7 A;  1SFO L;  4V19 6;  1YUX A;  1VZG A;  3K35 A;  4AI1 A;  2WAQ P;  2NVX L;  2E2J L;  2PVE A;  1BFY A;  3GTQ L;  2A68 D;  5RXN A;  3S1R L;  3HOW L;  2KN9 A;  3QQC E;  2L0Z A;  8RXN A;  1VCX A;  2DSX A;  4AHW A;  2BE5 D;  2ZIX A;  2V3B B;  2A6H D;  2ERS A;  2PYA A;  3HOZ L;  4XXB B;  3I4N L;  5C44 L;  5MFP A;  5GAH c;  4BBR L;  3RZD L;  4AI2 A;  4B8C D;  1SMU A;  3LWO B;  1PZX A;  3WWN B;  2XJQ A;  1FHM A;  4YWM A;  4WFN 1;  1SMM A;  3KYX A;  5JVG 1;  3GTP L;  4A3F L;  2PPT A;  5DM6 1;  4AR3 A;  1FHH A;  4AHZ A;  1YV1 A;  4C3H L;  5MGN A;  5AI2 A;  2O5J D;  2AYJ A;  3LWQ B;  2A6E D;  3GTG L;  1LKO A;  1WJV A;  5EIN C;  3QVD A;  4A3E L;  3S17 L;  2JI2 A;  5MFZ A;  4ZN1 B;  5M5X L;  4LHN A;  4A3D L;  3RZ6 A;  1I50 L;  3PO2 L;  2Z3R B;  3PWF A;  2B63 L;  1NXE A;  2XJP A;  1PFY A;  3HOY L;  5M3F L;  4JAF A;  1NNQ A;  2C6B A;  4AI0 A;  2NYD A;  4BY1 L;  4AYB P;  3HJY B;  1B2O A;  2HVY C;  3SS2 A;  3HAX C;  3PKI A;  1YK4 A;  4U67 1;  2HR5 A;  3P2A A;  1K83 L;  2JA8 L;  3PL5 A;  2B5I D;  4A3L L;  2R93 L;  3MSU A;  1DVB A;  1BE7 A;  1ZRP A;  4TVM A;  1OWC A;  3J7Y 1;  1S24 A;  1RWD A;  1Z92 B;  1CAD A;  1Y1W L;  1T9Q A;  1RYQ A;  3H97 A;  4JAG A;  3PKJ A;  2JA5 L;  1P7P A;  4A3K L;  3RZO L;  4POG A;  2AQC A;  5IP7 L;  2KKD A;  5DM7 1;  4A3C L;  4AHX A;  3GTO L;  4G6B A;  7RXN A;  2CKC A;  2EY4 E;  4GS7 D;  1QYB A;  2M4V A;  4ZN3 B;  3S1M L;  1S30 A;  2E2I L;  4K9F A;  4C3J L;  2XJT A;  5EIO C;  4AI3 A;  2JA7 L;  3FDJ A;  2APO B;  4BBS L;  2XJS A;  1H7V A;  1R0F A;  2V0F A;  2E2H L;  4E6Y A;  3GTK L;  3HKZ P;  5GAG c;  3M3Y L;  3S16 L;  2XJR A;  5GAE c;  3A44 A;  4A93 L;  1TWC L;  4C2M 1;  4JAE A;  5C3E L;  4UY8 1;  2H12 A;  1NXG A;  4AR6 A;  2AUS B;  2NVT L;  1QCV A;  2M6P A;  1LKP A;  5JVH 1;  4AR4 A;  1RYT A;  1LKM A;  1RB9 A;  1LTL A;  1PFU A;  2PMZ P;  2XJU A;  3KYY A;  3HOV L;  3S15 L;  5IP9 L;  3KYW A;  4ME3 A;  5GAD c;  1PFW A;  4TPU A;  1R9T L;  3LWV B;  1R0I A;  3S2H L;  3KYV A;  4A3M L;  1T9O A;  1B71 A;  1S2Z A;  5C4J L;  2VL6 A;  3WWL A; 
#chains in the Genus database with same CATH homology
 3LWV B;  3LWQ B;  2HVY C;  2AQC A;  2AUS B;  2APO B;  3LWR B;  3HJW B;  3MQK B;  3HAX C;  2RFK B;  3LWP B;  2EY4 E;  3LWO B;  3HJY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...