3LWVC

Structure of h/aca rnp bound to a substrate rna containing 2'-deoxyuridine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 38
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwvC00
1JJ2F 1RLGA 1VQMF 1X52A 3CPWF 1M90H 1VQ9F 3J81M 2AIFA 3G6EF 1YI2F 3LWVC 1VQ6F 2OHWA 3OW2F 3PAFA 3G4SF 2OZBA 2JNBA 4BW0B 1SDSA 3JAMM 1X7PA 5GINC 3CXCF 2ALEA 1VQOF 3SIVA 5IT9M 3VMFB 1W2BF 3NK6A 1Q86H 1DT9A 2OTJF 1YJWF 1W3EX 3E20B 1CK2A 2LBWA 3V7QA 1Q7YH 1X7OA 3GYQA 4TZZA 5G4UC 5GIOC 5GIPC 3OBWA 5GANK 3RA6A 3LWPC 3CCLF 1S72F 2QI2A 4BY9D 1NJIH 3J80M 3CCQF 2VGNA 3JCMM 2KTUA 4C4WC 3CG6A 2OTLF 3NK7A 5FLXM 1KD1H 3AGKA 2QEXF 5FJ4C 3CCSF 3LWRC 1RA4A 3PLAC 1PXWA 3MCAB 2KG4A 3FFMA 1GZ0A 3CC2F 2KTVA 3WXMB 1W40A 1IPAA 4NUTA 1VQPF 3G71F 3HAXD 1N8RH 3NVIB 3N4YA 1CN7A 1VQKF 2QA4F 1Q82H 2VGMA 3CCVF 2BO1A 3ON1A 3LWQC 1VQ5F 1GO1A 1GO0A 1QVFF 1VQLF 3O85A 3J7AR 1W42A 3CC4F 1E7KA 1YITF 1VQNF 2I6DA 3VI6A 1T0KB 1VQ4F 3V7EA 1YHQF 2LBXA 3CC7F 3CCUF 3NMUC 3CD6F 1W41A 1Q81H 1NMUB 5EWRA 1KC8H 1VQ7F 3CCJF 1VQ8F 1K9MH 3I56F 3CMAF 1XBIA 1YIJF 5EO3A 1QVGF 3SIUA 1H7MA 3CMEF 3HJWC 3RA5A 4LCKA 3IR9A 3I55F 2WALA 5GAPK 1K8AH 3CCEF 1K73H 4X3LA 3CCMF 3CCRF 1KQSF 3CPQA 5A2QM 3LWOC 2HVYD 1YJ9F 1ZWZA 3OBYA 3LFOA 4X3MA 3N4ZA 3NVKE 2CZWA 1YJNF 5G4VC 2FC3A 5DCVA 1M1KH 3E1YA
chains in the Genus database with same CATH superfamily
4G4YA 2I6RA 3JASB 4LNUA 1X52A 5HP8A 4TV9A 4ZK7A 3VOBA 3G6EF 1GX1A 2OHWA 3M1XA 3PAFA 3OW2F 2UZHA 5EB0A 4IIJA 2Z1UA 4O2AB 3R0PA 3G4SF 4O4HA 3VYUC 5C8YB 5CB4A 1X7PA 2ALEA 1VQOF 1JFFB 3DDNA 2GZLA 4C81A 1DT9A 1Z5VA 4IHJA 1W581 4O4JB 4O2BA 1X7OA 4LNUB 4DRXA 2RHOA 1R1MA 5GIPC 3FBAA 4TV9B 3MQWA 3C9SA 3RA6A 5LXTA 3LWPC 3CCLF 3S02A 4I50A 3QHDA 1Q8RA 4IIJB 5FLXM 2OTLF 5BMVA 3CCSF 1RA4A 5CB4B 5HY1A 3PLAC 1ONIA 3WPWA 2VAWA 1GZ0A 5LP6A 4HNAB 3WGKA 1W40A 3TD4A 4BVTA 1VQPF 4O2BB 5EB1B 3M84A 4DRXB 1Q82H 4FFBA 5FNVA 3ON1A 2YYEA 1GO1A 1VQ5F 4X20A 5KMGA 5LXTB 3UT5A 4BT7A 3CC4F 4I50B 4G88A 1E7KA 5CA1A 3JARA 4BVQA 3K14A 3S0YA 3ERNA 2I6DA 2IG8A 5BMVB 3VI6A 1T0KB 5HP7A 1YHQF 2P6YA 2LBXA 2UYNA 3VCZA 2H8EA 2ZOVA 5LP6B 1KC8H 5HY2A 3ZP4A 1K9MH 3I56F 1IV4A 1YIJF 5JCOA 5EO3A 3SIUA 3HTNA 3KIZA 4X1YB 5MN5A 3QTYA 3K0TA 4C82A 1H7MA 4FFBB 3RA5A 3HJWC 3IR9A 2WALA 4C8IA 4X20B 1X25A 3KJKA 1COMA 3RYIA 5KMGB 2DYYA 4X3LA 3UT5B 1VHAA 3CCMF 3ZO8A 4BT2A 2HP3A 5CA1B 1RQ7A 3JARB 3RYFA 5LP6C 2HVYD 1ZWZA 5KX5A 2UYNB 3HKDA 3LMEA 1H48A 3C8LA 5G4VC 4NWOB 3K12A 3KE1A 5J2TA 1JJ2F 1UI9A 1VQMF 3CPWF 5EYPB 1M90H 2HP0A 2AIFA 3WGNA 2HS4A 2CHSA 1VQ6F 4F6RA 3RYIB 4YJ2A 4I4TB 5ITZA 3OONA 3RYFB 3QUWA 4G4ZA 4BW0B 2EWCA 1W59A 5C8YA 2GVIA 5KX5B 3VO8A 4DXDA 5IT9M 2V9YA 3MCQA 3VMFB 3P4EA 5JCOC 2HQSC 3NK6A 3IEWA 5J2TB 4I55A 4O4JA 3M4SA 3V7QA 2N48A 5G4UC 2CVLA 5GANK 3U0OA 3FPIA 2HP0B 2Q1XA 3J80M 3CCQF 2HS0A 4F6RB 2KTUA 3F6MA 4YJ2B 5ITZB 3CG6A 3NK7A 4KWEA 4BT4A 1KD1H 3MCAB 2KG4A 4BT5A 1RLUA 3WXMB 4HNAA 1IPAA 1FSZA 2BTOA 3MDOA 2HX0A 1N8RH 3HKCA 4I55B 2IAFA 3VIUA 3L7QA 2QA4F 4ZHWA 2QTPA 4BT6A 3LWQC 1VQLF 3JAKA 4X1IA 4B62A 4ZHQB 5EAZA 4E6EA 1FNJA 1VQNF 1NQ3A 3C9TA 3F0DA 2OTMA 3BYQA 2PMPA 2CHTA 4B5CA 4B45A 3JAWA 2RHHA 4ERHA 2GLZA 3CCUF 5IYZA 3NMUC 3I3FA 2FGYA 1NMUB 5EWRA 2NMUA 5HXUA 3RYHA 3HKCB 1QVGF 3ELCA 4X1YA 3C9RA 2BTQB 5GAPK 3CCEF 3IEQA 5LOVA 3JAKB 4X1IB 5A2QM 3OBYA 4X3MA 2F9ZC 3Q8HA 5CA0A 3N2GA 3JAWB 1SA0A 5IYZB 3NVKE 1YJNF 3EORA 2FC3A 3J7AR 5DCVA 1RLGA 3RYHB 2ZF8A 3E22A 5EYPA 2G9IA 4WBNA 3J81M 3T80A 2RHJA 4TUYA 1U3LA 5LOVB 1IV3A 4I4TA 1FFXA 3V4DA 1DBFA 4U39A 2LBTA 1SDSA 3JATB 3S0HA 2Q1YA 4C8EA 5GINC 1T0AA 3JVHA 3TD3A 3CXCF 3WGLA 5CA0B 3N2GB 2Z1FA 3D54A 1SA0B 2AIZP 2PHNA 1W2BF 1W5FA 3S03A 1Q86H 2OTJF 2W8BC 5MN4A 3E20B 1CK2A 2AMTA 4TZZA 1TVKA 3E22B 1XRGA 3OBWA 1S72F 3HKBB 4EI7A 4WBNB 5J2UA 4BY9D 1NJIH 4TUYB 4C4WC 3AGKA 2QEXF 1FFXB 1FNKA 3C9UA 3F0EA 2Z1EA 3FFMA 2CWJA 3RYCA 3HKEB 3CC2F 1H47A 2UYKA 3G71F 2UYPA 5HXZA 3HAXD 2KGWA 2ZVZA 3N4YA 1CN7A 1VQKF 3IKFA 1VQVA 2Z1TA 1TVKB 4G4XA 1QU9A 1SZQA 1QVFF 5J2UB 4X1KA 1W42A 4ZHQA 5IJ9A 1W5EA 3ZP7A 2HRYA 5AVMA 3IMPA 1VQ4F 3V7EA 1Z5WA 2H8CA 3D01A 5JH7A 3I7TA 3RYCB 1U43A 4NQ3A 1Q81H 3ZOPA 1VQ7F 1VK3A 4G4WA 1VQ8F 4ZI7A 4BVRA 1W5BA 3D00A 1XBIA 4RQOA 2B33A 3LDTA 3JALA 1ODEA 2HS3A 2VXYA 3KJJA 3I55F 2DT4A 3MBMA 4YJ3A 4X1KB 4G4VA 5IJ9B 3CPQA 3LFOA 1OFUA 3WJPA 5JH7B 2YXZA 3B6NA 4ZHVA 5HWEA 3N4ZA 4ZOLA 4BVSA 5IJ0A 2H6LA 2CZWA 1OAPA 3WPXA 2RB9A 1M1KH 3F0FA 3E1YA 2VAPA 4ZI7B 3S0WA 5MN6A 1U40A 1UFYA 3JALB 1VQ9F 5LYJA 1YI2F 3LWVC 4YJ3B 1YGYA 3GTZA 3N2KA 2OZBA 5B8FA 2JNBA 3IKEA 5EIBC 5JQGA 3DC2A 2VAMA 1JD1A 4TV8A 4O4HB 4EB6A 2ZAUA 3JATA 2BTUA 3JAMM 3P10A 3VYTC 3VYSC 3SIVA 3S06A 4ZOLB 5IJ0B 3WJQA 1VH8A 4IHJB 3RE3A 3FD6A 1U3PA 1YJWF 3ESJA 1W3EX 2LBWA 1Q7YH 5JVDA 3GYQA 3KHNA 4EI9A 5GIOC 1YQNA 5EZYA 3HKBA 2QI2A 5LYJB 1XV2A 2VGNA 3JCMM 3TD5A 3N2KB 1KNKA 2MQEA 4U3JA 5JQGB 5FJ4C 2Z01A 4TV8B 1W57A 1CLIA 3P0ZA 1PF5A 5LA6A 4EB6B 1XHOA 3LWRC 1PXWA 2ZODA 4EI8A 3HKEA 2KTVA 5GONA 4NUTA 1IV2A 3F0GA 3NVIB 2R751 4O4IA 1JN1A 1IV1A 3VOAA 5JVDB 4PWTA 1QD9A 3V3TA 3CYPB 5FNVB 2VGMA 3CCVF 2BO1A 1TUBA 1GO0A 4O4LA 3CYQA 5EZYB 4XCQA 3O85A 3WGMA 4C8GA 1YITF 2LCAA 5HY0A 4U3JB 4M8IA 3GHZA 1W55A 5LA6B 3CC7F 2L26A 4R40B 2ZVYA 4B46A 3CD6F 1W41A 5GONB 3CCJF 5HY4A 3WGJA 3JASA 3CMAF 2HRUA 2RHLA 5EIBD 2IQQA 4O4IB 1W5AA 3CMEF 4LCKA 1TUBB 1JY8A 3WJRA 4O4LB 1K8AH 1RQ2A 2K1SA 1K73H 3FD5A 4O2AA 1KNJA 2R6R1 3CCRF 1KQSF 1QAHA 2CW4A 2CSLA 3LWOC 4RHAA 1YJ9F 1JFFA 3HKDB 4BT3A 3HWUA 3LYBA 3VTIC 1J7HA 2UYJA 3K2XA 4ZHYB 3CB2A
chains in the Genus database with same CATH topology
1JJ2F 1RLGA 1VQMF 1X52A 3CPWF 1M90H 1VQ9F 3J81M 2AIFA 3G6EF 1YI2F 3LWVC 1VQ6F 2OHWA 3OW2F 3PAFA 3G4SF 2OZBA 2JNBA 4BW0B 1SDSA 3JAMM 1X7PA 5GINC 3CXCF 2ALEA 1VQOF 3SIVA 5IT9M 3VMFB 1W2BF 3NK6A 1Q86H 1DT9A 2OTJF 1YJWF 1W3EX 3E20B 1CK2A 2LBWA 3V7QA 1Q7YH 1X7OA 3GYQA 4TZZA 5G4UC 4EI9A 5GIOC 5GIPC 3OBWA 5GANK 3RA6A 3LWPC 3CCLF 4EI7A 1S72F 2QI2A 4BY9D 1NJIH 3J80M 3CCQF 2VGNA 3JCMM 2KTUA 4C4WC 3CG6A 2OTLF 3NK7A 5FLXM 1KD1H 3AGKA 2QEXF 5FJ4C 3CCSF 3LWRC 1RA4A 5HY1A 3PLAC 1PXWA 3MCAB 2KG4A 3FFMA 1GZ0A 4EI8A 3CC2F 3WXMB 2KTVA 1W40A 1IPAA 4BVTA 4NUTA 1VQPF 3G71F 5HXZA 3HAXD 1N8RH 3NVIB 3N4YA 1CN7A 1VQKF 2QA4F 3V3TA 1Q82H 2VGMA 3CCVF 2BO1A 3ON1A 3LWQC 1VQ5F 1GO1A 1GO0A 1QVFF 4XCQA 1VQLF 3O85A 3J7AR 1W42A 3CC4F 1E7KA 4BVQA 1YITF 1VQNF 5HY0A 2I6DA 3VI6A 1T0KB 1VQ4F 3V7EA 1YHQF 2LBXA 3CC7F 2GLZA 3CCUF 3NMUC 3CD6F 1W41A 4NQ3A 2FGYA 1Q81H 1NMUB 5EWRA 1KC8H 1VQ7F 5HY2A 3CCJF 1VQ8F 5HXUA 5HY4A 1K9MH 4BVRA 3I56F 3D00A 3CMAF 1XBIA 1YIJF 5EO3A 1QVGF 3SIUA 1H7MA 3CMEF 3HJWC 3RA5A 4LCKA 3IR9A 3I55F 2WALA 5GAPK 1K8AH 3CCEF 1K73H 4X3LA 3CCMF 3CCRF 1KQSF 3CPQA 5A2QM 3LWOC 2HVYD 1YJ9F 1ZWZA 3OBYA 3LFOA 4X3MA 2F9ZC 5HWEA 3N4ZA 4BVSA 3NVKE 2CZWA 1YJNF 5G4VC 2FC3A 5DCVA 1M1KH 3E1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 F;  1RLG A;  1VQM F;  1X52 A;  3CPW F;  1M90 H;  1VQ9 F;  3J81 M;  2AIF A;  3G6E F;  1YI2 F;  3LWV C;  1VQ6 F;  2OHW A;  3OW2 F;  3PAF A;  3G4S F;  2OZB A;  2JNB A;  4BW0 B;  1SDS A;  3JAM M;  1X7P A;  5GIN C;  3CXC F;  2ALE A;  1VQO F;  3SIV A;  5IT9 M;  3VMF B;  1W2B F;  3NK6 A;  1Q86 H;  1DT9 A;  2OTJ F;  1YJW F;  1W3E X;  3E20 B;  1CK2 A;  2LBW A;  3V7Q A;  1Q7Y H;  1X7O A;  3GYQ A;  4TZZ A;  5G4U C;  5GIO C;  5GIP C;  3OBW A;  5GAN K;  3RA6 A;  3LWP C;  3CCL F;  1S72 F;  2QI2 A;  4BY9 D;  1NJI H;  3J80 M;  3CCQ F;  2VGN A;  3JCM M;  2KTU A;  4C4W C;  3CG6 A;  2OTL F;  3NK7 A;  5FLX M;  1KD1 H;  3AGK A;  2QEX F;  5FJ4 C;  3CCS F;  3LWR C;  1RA4 A;  3PLA C;  1PXW A;  3MCA B;  2KG4 A;  3FFM A;  1GZ0 A;  3CC2 F;  2KTV A;  3WXM B;  1W40 A;  1IPA A;  4NUT A;  1VQP F;  3G71 F;  3HAX D;  1N8R H;  3NVI B;  3N4Y A;  1CN7 A;  1VQK F;  2QA4 F;  1Q82 H;  2VGM A;  3CCV F;  2BO1 A;  3ON1 A;  3LWQ C;  1VQ5 F;  1GO1 A;  1GO0 A;  1QVF F;  1VQL F;  3O85 A;  3J7A R;  1W42 A;  3CC4 F;  1E7K A;  1YIT F;  1VQN F;  2I6D A;  3VI6 A;  1T0K B;  1VQ4 F;  3V7E A;  1YHQ F;  2LBX A;  3CC7 F;  3CCU F;  3NMU C;  3CD6 F;  1W41 A;  1Q81 H;  1NMU B;  5EWR A;  1KC8 H;  1VQ7 F;  3CCJ F;  1VQ8 F;  1K9M H;  3I56 F;  3CMA F;  1XBI A;  1YIJ F;  5EO3 A;  1QVG F;  3SIU A;  1H7M A;  3CME F;  3HJW C;  3RA5 A;  4LCK A;  3IR9 A;  3I55 F;  2WAL A;  5GAP K;  1K8A H;  3CCE F;  1K73 H;  4X3L A;  3CCM F;  3CCR F;  1KQS F;  3CPQ A;  5A2Q M;  3LWO C;  2HVY D;  1YJ9 F;  1ZWZ A;  3OBY A;  3LFO A;  4X3M A;  3N4Z A;  3NVK E;  2CZW A;  1YJN F;  5G4V C;  2FC3 A;  5DCV A;  1M1K H;  3E1Y A; 
#chains in the Genus database with same CATH topology
 4G4Y A;  2I6R A;  3JAS B;  4LNU A;  1X52 A;  5HP8 A;  4TV9 A;  4ZK7 A;  3VOB A;  3G6E F;  1GX1 A;  2OHW A;  3M1X A;  3PAF A;  3OW2 F;  2UZH A;  5EB0 A;  4IIJ A;  2Z1U A;  4O2A B;  3R0P A;  3G4S F;  4O4H A;  3VYU C;  5C8Y B;  5CB4 A;  1X7P A;  2ALE A;  1VQO F;  1JFF B;  3DDN A;  2GZL A;  4C81 A;  1DT9 A;  1Z5V A;  4IHJ A;  1W58 1;  4O4J B;  4O2B A;  1X7O A;  4LNU B;  4DRX A;  2RHO A;  1R1M A;  5GIP C;  3FBA A;  4TV9 B;  3MQW A;  3C9S A;  3RA6 A;  5LXT A;  3LWP C;  3CCL F;  3S02 A;  4I50 A;  3QHD A;  1Q8R A;  4IIJ B;  5FLX M;  2OTL F;  5BMV A;  3CCS F;  1RA4 A;  5CB4 B;  5HY1 A;  3PLA C;  1ONI A;  3WPW A;  2VAW A;  1GZ0 A;  5LP6 A;  4HNA B;  3WGK A;  1W40 A;  3TD4 A;  4BVT A;  1VQP F;  4O2B B;  5EB1 B;  3M84 A;  4DRX B;  1Q82 H;  4FFB A;  5FNV A;  3ON1 A;  2YYE A;  1GO1 A;  1VQ5 F;  4X20 A;  5KMG A;  5LXT B;  3UT5 A;  4BT7 A;  3CC4 F;  4I50 B;  4G88 A;  1E7K A;  5CA1 A;  3JAR A;  4BVQ A;  3K14 A;  3S0Y A;  3ERN A;  2I6D A;  2IG8 A;  5BMV B;  3VI6 A;  1T0K B;  5HP7 A;  1YHQ F;  2P6Y A;  2LBX A;  2UYN A;  3VCZ A;  2H8E A;  2ZOV A;  5LP6 B;  1KC8 H;  5HY2 A;  3ZP4 A;  1K9M H;  3I56 F;  1IV4 A;  1YIJ F;  5JCO A;  5EO3 A;  3SIU A;  3HTN A;  3KIZ A;  4X1Y B;  5MN5 A;  3QTY A;  3K0T A;  4C82 A;  1H7M A;  4FFB B;  3RA5 A;  3HJW C;  3IR9 A;  2WAL A;  4C8I A;  4X20 B;  1X25 A;  3KJK A;  1COM A;  3RYI A;  5KMG B;  2DYY A;  4X3L A;  3UT5 B;  1VHA A;  3CCM F;  3ZO8 A;  4BT2 A;  2HP3 A;  5CA1 B;  1RQ7 A;  3JAR B;  3RYF A;  5LP6 C;  2HVY D;  1ZWZ A;  5KX5 A;  2UYN B;  3HKD A;  3LME A;  1H48 A;  3C8L A;  5G4V C;  4NWO B;  3K12 A;  3KE1 A;  5J2T A;  1JJ2 F;  1UI9 A;  1VQM F;  3CPW F;  5EYP B;  1M90 H;  2HP0 A;  2AIF A;  3WGN A;  2HS4 A;  2CHS A;  1VQ6 F;  4F6R A;  3RYI B;  4YJ2 A;  4I4T B;  5ITZ A;  3OON A;  3RYF B;  3QUW A;  4G4Z A;  4BW0 B;  2EWC A;  1W59 A;  5C8Y A;  2GVI A;  5KX5 B;  3VO8 A;  4DXD A;  5IT9 M;  2V9Y A;  3MCQ A;  3VMF B;  3P4E A;  5JCO C;  2HQS C;  3NK6 A;  3IEW A;  5J2T B;  4I55 A;  4O4J A;  3M4S A;  3V7Q A;  2N48 A;  5G4U C;  2CVL A;  5GAN K;  3U0O A;  3FPI A;  2HP0 B;  2Q1X A;  3J80 M;  3CCQ F;  2HS0 A;  4F6R B;  2KTU A;  3F6M A;  4YJ2 B;  5ITZ B;  3CG6 A;  3NK7 A;  4KWE A;  4BT4 A;  1KD1 H;  3MCA B;  2KG4 A;  4BT5 A;  1RLU A;  3WXM B;  4HNA A;  1IPA A;  1FSZ A;  2BTO A;  3MDO A;  2HX0 A;  1N8R H;  3HKC A;  4I55 B;  2IAF A;  3VIU A;  3L7Q A;  2QA4 F;  4ZHW A;  2QTP A;  4BT6 A;  3LWQ C;  1VQL F;  3JAK A;  4X1I A;  4B62 A;  4ZHQ B;  5EAZ A;  4E6E A;  1FNJ A;  1VQN F;  1NQ3 A;  3C9T A;  3F0D A;  2OTM A;  3BYQ A;  2PMP A;  2CHT A;  4B5C A;  4B45 A;  3JAW A;  2RHH A;  4ERH A;  2GLZ A;  3CCU F;  5IYZ A;  3NMU C;  3I3F A;  2FGY A;  1NMU B;  5EWR A;  2NMU A;  5HXU A;  3RYH A;  3HKC B;  1QVG F;  3ELC A;  4X1Y A;  3C9R A;  2BTQ B;  5GAP K;  3CCE F;  3IEQ A;  5LOV A;  3JAK B;  4X1I B;  5A2Q M;  3OBY A;  4X3M A;  2F9Z C;  3Q8H A;  5CA0 A;  3N2G A;  3JAW B;  1SA0 A;  5IYZ B;  3NVK E;  1YJN F;  3EOR A;  2FC3 A;  3J7A R;  5DCV A;  1RLG A;  3RYH B;  2ZF8 A;  3E22 A;  5EYP A;  2G9I A;  4WBN A;  3J81 M;  3T80 A;  2RHJ A;  4TUY A;  1U3L A;  5LOV B;  1IV3 A;  4I4T A;  1FFX A;  3V4D A;  1DBF A;  4U39 A;  2LBT A;  1SDS A;  3JAT B;  3S0H A;  2Q1Y A;  4C8E A;  5GIN C;  1T0A A;  3JVH A;  3TD3 A;  3CXC F;  3WGL A;  5CA0 B;  3N2G B;  2Z1F A;  3D54 A;  1SA0 B;  2AIZ P;  2PHN A;  1W2B F;  1W5F A;  3S03 A;  1Q86 H;  2OTJ F;  2W8B C;  5MN4 A;  3E20 B;  1CK2 A;  2AMT A;  4TZZ A;  1TVK A;  3E22 B;  1XRG A;  3OBW A;  1S72 F;  3HKB B;  4EI7 A;  4WBN B;  5J2U A;  4BY9 D;  1NJI H;  4TUY B;  4C4W C;  3AGK A;  2QEX F;  1FFX B;  1FNK A;  3C9U A;  3F0E A;  2Z1E A;  3FFM A;  2CWJ A;  3RYC A;  3HKE B;  3CC2 F;  1H47 A;  2UYK A;  3G71 F;  2UYP A;  5HXZ A;  3HAX D;  2KGW A;  2ZVZ A;  3N4Y A;  1CN7 A;  1VQK F;  3IKF A;  1VQV A;  2Z1T A;  1TVK B;  4G4X A;  1QU9 A;  1SZQ A;  1QVF F;  5J2U B;  4X1K A;  1W42 A;  4ZHQ A;  5IJ9 A;  1W5E A;  3ZP7 A;  2HRY A;  5AVM A;  3IMP A;  1VQ4 F;  3V7E A;  1Z5W A;  2H8C A;  3D01 A;  5JH7 A;  3I7T A;  3RYC B;  1U43 A;  4NQ3 A;  1Q81 H;  3ZOP A;  1VQ7 F;  1VK3 A;  4G4W A;  1VQ8 F;  4ZI7 A;  4BVR A;  1W5B A;  3D00 A;  1XBI A;  4RQO A;  2B33 A;  3LDT A;  3JAL A;  1ODE A;  2HS3 A;  2VXY A;  3KJJ A;  3I55 F;  2DT4 A;  3MBM A;  4YJ3 A;  4X1K B;  4G4V A;  5IJ9 B;  3CPQ A;  3LFO A;  1OFU A;  3WJP A;  5JH7 B;  2YXZ A;  3B6N A;  4ZHV A;  5HWE A;  3N4Z A;  4ZOL A;  4BVS A;  5IJ0 A;  2H6L A;  2CZW A;  1OAP A;  3WPX A;  2RB9 A;  1M1K H;  3F0F A;  3E1Y A;  2VAP A;  4ZI7 B;  3S0W A;  5MN6 A;  1U40 A;  1UFY A;  3JAL B;  1VQ9 F;  5LYJ A;  1YI2 F;  3LWV C;  4YJ3 B;  1YGY A;  3GTZ A;  3N2K A;  2OZB A;  5B8F A;  2JNB A;  3IKE A;  5EIB C;  5JQG A;  3DC2 A;  2VAM A;  1JD1 A;  4TV8 A;  4O4H B;  4EB6 A;  2ZAU A;  3JAT A;  2BTU A;  3JAM M;  3P10 A;  3VYT C;  3VYS C;  3SIV A;  3S06 A;  4ZOL B;  5IJ0 B;  3WJQ A;  1VH8 A;  4IHJ B;  3RE3 A;  3FD6 A;  1U3P A;  1YJW F;  3ESJ A;  1W3E X;  2LBW A;  1Q7Y H;  5JVD A;  3GYQ A;  3KHN A;  4EI9 A;  5GIO C;  1YQN A;  5EZY A;  3HKB A;  2QI2 A;  5LYJ B;  1XV2 A;  2VGN A;  3JCM M;  3TD5 A;  3N2K B;  1KNK A;  2MQE A;  4U3J A;  5JQG B;  5FJ4 C;  2Z01 A;  4TV8 B;  1W57 A;  1CLI A;  3P0Z A;  1PF5 A;  5LA6 A;  4EB6 B;  1XHO A;  3LWR C;  1PXW A;  2ZOD A;  4EI8 A;  3HKE A;  2KTV A;  5GON A;  4NUT A;  1IV2 A;  3F0G A;  3NVI B;  2R75 1;  4O4I A;  1JN1 A;  1IV1 A;  3VOA A;  5JVD B;  4PWT A;  1QD9 A;  3V3T A;  3CYP B;  5FNV B;  2VGM A;  3CCV F;  2BO1 A;  1TUB A;  1GO0 A;  4O4L A;  3CYQ A;  5EZY B;  4XCQ A;  3O85 A;  3WGM A;  4C8G A;  1YIT F;  2LCA A;  5HY0 A;  4U3J B;  4M8I A;  3GHZ A;  1W55 A;  5LA6 B;  3CC7 F;  2L26 A;  4R40 B;  2ZVY A;  4B46 A;  3CD6 F;  1W41 A;  5GON B;  3CCJ F;  5HY4 A;  3WGJ A;  3JAS A;  3CMA F;  2HRU A;  2RHL A;  5EIB D;  2IQQ A;  4O4I B;  1W5A A;  3CME F;  4LCK A;  1TUB B;  1JY8 A;  3WJR A;  4O4L B;  1K8A H;  1RQ2 A;  2K1S A;  1K73 H;  3FD5 A;  4O2A A;  1KNJ A;  2R6R 1;  3CCR F;  1KQS F;  1QAH A;  2CW4 A;  2CSL A;  3LWO C;  4RHA A;  1YJ9 F;  1JFF A;  3HKD B;  4BT3 A;  3HWU A;  3LYB A;  3VTI C;  1J7H A;  2UYJ A;  3K2X A;  4ZHY B;  3CB2 A; 
#chains in the Genus database with same CATH homology
 1JJ2 F;  1RLG A;  1VQM F;  1X52 A;  3CPW F;  1M90 H;  1VQ9 F;  3J81 M;  2AIF A;  3G6E F;  1YI2 F;  3LWV C;  1VQ6 F;  2OHW A;  3OW2 F;  3PAF A;  3G4S F;  2OZB A;  2JNB A;  4BW0 B;  1SDS A;  3JAM M;  1X7P A;  5GIN C;  3CXC F;  2ALE A;  1VQO F;  3SIV A;  5IT9 M;  3VMF B;  1W2B F;  3NK6 A;  1Q86 H;  1DT9 A;  2OTJ F;  1YJW F;  1W3E X;  3E20 B;  1CK2 A;  2LBW A;  3V7Q A;  1Q7Y H;  1X7O A;  3GYQ A;  4TZZ A;  5G4U C;  4EI9 A;  5GIO C;  5GIP C;  3OBW A;  5GAN K;  3RA6 A;  3LWP C;  3CCL F;  4EI7 A;  1S72 F;  2QI2 A;  4BY9 D;  1NJI H;  3J80 M;  3CCQ F;  2VGN A;  3JCM M;  2KTU A;  4C4W C;  3CG6 A;  2OTL F;  3NK7 A;  5FLX M;  1KD1 H;  3AGK A;  2QEX F;  5FJ4 C;  3CCS F;  3LWR C;  1RA4 A;  5HY1 A;  3PLA C;  1PXW A;  3MCA B;  2KG4 A;  3FFM A;  1GZ0 A;  4EI8 A;  3CC2 F;  3WXM B;  2KTV A;  1W40 A;  1IPA A;  4BVT A;  4NUT A;  1VQP F;  3G71 F;  5HXZ A;  3HAX D;  1N8R H;  3NVI B;  3N4Y A;  1CN7 A;  1VQK F;  2QA4 F;  3V3T A;  1Q82 H;  2VGM A;  3CCV F;  2BO1 A;  3ON1 A;  3LWQ C;  1VQ5 F;  1GO1 A;  1GO0 A;  1QVF F;  4XCQ A;  1VQL F;  3O85 A;  3J7A R;  1W42 A;  3CC4 F;  1E7K A;  4BVQ A;  1YIT F;  1VQN F;  5HY0 A;  2I6D A;  3VI6 A;  1T0K B;  1VQ4 F;  3V7E A;  1YHQ F;  2LBX A;  3CC7 F;  2GLZ A;  3CCU F;  3NMU C;  3CD6 F;  1W41 A;  4NQ3 A;  2FGY A;  1Q81 H;  1NMU B;  5EWR A;  1KC8 H;  1VQ7 F;  5HY2 A;  3CCJ F;  1VQ8 F;  5HXU A;  5HY4 A;  1K9M H;  4BVR A;  3I56 F;  3D00 A;  3CMA F;  1XBI A;  1YIJ F;  5EO3 A;  1QVG F;  3SIU A;  1H7M A;  3CME F;  3HJW C;  3RA5 A;  4LCK A;  3IR9 A;  3I55 F;  2WAL A;  5GAP K;  1K8A H;  3CCE F;  1K73 H;  4X3L A;  3CCM F;  3CCR F;  1KQS F;  3CPQ A;  5A2Q M;  3LWO C;  2HVY D;  1YJ9 F;  1ZWZ A;  3OBY A;  3LFO A;  4X3M A;  2F9Z C;  5HWE A;  3N4Z A;  4BVS A;  3NVK E;  2CZW A;  1YJN F;  5G4V C;  2FC3 A;  5DCV A;  1M1K H;  3E1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...