3LWVC

Structure of h/aca rnp bound to a substrate rna containing 2'-deoxyuridine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 38
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwvC00
1Q81H 3JCMM 1YIJF 4LCKA 3CCQF 1RLGA 3AGKA 3HAXD 3JAMM 3CXCF 3PLAC 1GO1A 3G4SF 3CC2F 1E7KA 3LWPC 1M90H 1VQLF 3PAFA 2LBWA 3J81M 3VI6A 3LFOA 3OBYA 1NMUB 5GIPC 3CMEF 2VGNA 3V7QA 3CMAF 3CCJF 4NUTA 3J7AR 2LBXA 5IT9M 5DCVA 1NJIH 1VQOF 3OW2F 3CD6F 1W3EX 3HJWC 1X7OA 1YJWF 3N4YA 4BW0B 4TZZA 1T0KB 3NMUC 3FFMA 1ZWZA 1YHQF 5FJ4C 3IR9A 1N8RH 3NK6A 1VQ6F 2OTLF 3RA6A 1VQMF 1YJ9F 3N4ZA 1K73H 2AIFA 3MCAB 1Q86H 3NK7A 4C4WC 1DT9A 2CZWA 2OTJF 3CC4F 1CN7A 3CCMF 1VQ7F 3CG6A 1X52A 1VQPF 3V7EA 3SIVA 1VQ4F 5A2QM 1W42A 1VQNF 3SIUA 3CCUF 2FC3A 1YITF 1SDSA 3I55F 3CCVF 1YI2F 1QVFF 1H7MA 3GYQA 3ON1A 2KTUA 3E1YA 3CPWF 5GAPK 1S72F 3I56F 3RA5A 1K9MH 1W40A 5GINC 3LWOC 1KC8H 3LWQC 1QVGF 5GIOC 1XBIA 5G4UC 3O85A 1KD1H 1K8AH 1VQ8F 1VQ5F 1VQ9F 1CK2A 1JJ2F 3CC7F 2BO1A 1YJNF 1IPAA 1KQSF 2HVYD 3LWVC 1Q82H 2ALEA 5EWRA 3J80M 1VQKF 2WALA 3NVIB 5EO3A 2JNBA 3OBWA 3CCEF 1Q7YH 3CCLF 3WXMB 2OZBA 2VGMA 3G71F 1X7PA 2QI2A 3VMFB 4X3LA 5FLXM 2QEXF 1W41A 3G6EF 3CCRF 1RA4A 3E20B 2OHWA 5GANK 1GZ0A 3LWRC 1M1KH 5G4VC 1GO0A 3NVKE 2I6DA 2QA4F 3CPQA 3CCSF 2KTVA 4BY9D 2KG4A 4X3MA 1W2BF 1PXWA
chains in the Genus database with same CATH superfamily
3JCMM 1YIJF 2H8CA 2NMUA 4YJ2B 3HAXD 3JAMM 1Z5VA 3ELCA 3ERNA 2R6R1 5KMGB 3MDOA 3K2XA 3JASB 5B8FA 3E22A 2BTUA 3VIUA 2VGNA 3CMAF 3JAKA 3UT5B 5FNVB 3CCJF 3J7AR 5EYPA 1IV2A 1FNJA 4TV9A 3F6MA 3VYTC 3P4EA 1CLIA 4U39A 1NJIH 1U3LA 4YJ3B 4ZOLA 5HP8A 5JCOA 3HJWC 1X7OA 5JQGA 3N4YA 3VOAA 2CW4A 4X1IA 2CWJA 1T0KB 3FFMA 3K14A 2F9ZC 1ZWZA 5GONB 1YQNA 1N8RH 3OONA 3EORA 3M84A 4BT4A 2CSLA 3C9SA 3I3FA 5EB1B 3WJPA 3ZO8A 2OTLF 2ZVZA 4O4IB 3N4ZA 2AIFA 3MCAB 2UZHA 4EI8A 1Q86H 3WGMA 3F0EA 5EZYA 3E22B 4WBNA 3ZP4A 3KJKA 1VQ7F 3CG6A 2LBTA 1X52A 4DRXA 3DC2A 2N48A 5BMVA 1W42A 2FC3A 4ZOLB 1YI2F 2LCAA 1SZQA 3HTNA 1W5FA 3BYQA 2Z01A 4O2AB 5GAPK 3I56F 4C8GA 4ZI7B 1W40A 5GINC 3S06A 5CA1A 2GZLA 1XRGA 1XBIA 2UYNB 2YXZA 5C8YB 2ZOVA 1VQ5F 5J2TA 4IHJA 3WPXA 5KX5A 4G4ZA 2RHHA 2UYPA 1KQSF 4C82A 3LWVC 4O2BB 3RYHB 2ALEA 3J80M 4I50B 4ZHWA 5EO3A 5AVMA 5HY2A 3CCEF 3WXMB 2HS0A 2VGMA 4RQOA 3D00A 4X3LA 5LXTB 1JFFB 1KNJA 5ITZA 3F0DA 5CA1B 3ESJA 5IJ9A 1RA4A 3DDNA 3HKDA 1XHOA 5GANK 3C8LA 4TV8B 3GHZA 2QA4F 4BY9D 3TD5A 4BT3A 4NWOB 2DYYA 4ZHVA 1RLUA 4LCKA 3CCQF 4G4YA 5HP7A 2HRUA 3AGKA 3P0ZA 2VXYA 1XV2A 4LNUB 5HXZA 2RB9A 2RHJA 1FFXA 3JARB 3VO8A 1VQLF 2L26A 3MQWA 3VOBA 2IAFA 2Z1EA 3LFOA 5ITZB 3JAWB 3MBMA 3WGKA 5IJ9B 4NUTA 2LBXA 5DCVA 4X1YB 3ZOPA 4ERHA 4O4HB 1W3EX 2HP0B 4ZK7A 1VK3A 2GVIA 5CB4A 2HS4A 1QU9A 1YHQF 1IV3A 5EIBD 3IR9A 5FJ4C 5LOVA 3NK6A 3D01A 1QAHA 4X20A 1YJ9F 3GTZA 3HKEA 4EB6A 1K73H 3LYBA 5J2UB 4ZHQB 4IIJA 1DT9A 2R751 5HXUA 4FFBA 2CZWA 3HKBB 4ZHYB 1VH8A 1TUBA 2Q1YA 3WPWA 3JALA 1T0AA 1SA0A 2ZAUA 4HNAA 5JVDA 1VQNF 5LYJA 3VYUC 1QVFF 2GLZA 2BTQB 2KTUA 4G4XA 3RA5A 1KC8H 2QTPA 3LWQC 5LP6A 4U3JA 4XCQA 3RYCA 5GIOC 2YYEA 3O85A 1UFYA 1KD1H 2RHLA 5JH7A 1JJ2F 4EB6B 1DBFA 2EWCA 2BO1A 3N2GA 4O4JA 2HVYD 1W55A 1FSZA 1W581 1W5BA 3JAKB 1VQKF 2I6RA 1JD1A 5EYPB 3K12A 4C8IA 4TV9B 5LA6A 3OBWA 1X7PA 5CA0A 5MN5A 5JQGB 3U0OA 3KJJA 4X1IB 1GX1A 2HX0A 1IV1A 1W41A 3TD4A 3JATA 3HKCA 3G6EF 3KIZA 2Z1FA 3RE3A 3WGLA 1M1KH 3VYSC 3K0TA 2ZODA 3F0FA 3KHNA 2I6DA 3N2KA 2VAMA 3CPQA 3FPIA 5EZYB 4BT6A 5JCOC 3CCSF 1TVKA 4WBNB 2PMPA 1Q81H 2VAWA 4DRXB 3IKFA 5LA6B 5BMVB 2CVLA 3PLAC 5IYZA 1GO1A 3B6NA 4F6RA 4G4WA 1M90H 3S02A 2HS3A 3RYFA 2ZVYA 3PAFA 3QHDA 2LBWA 3J81M 4I55A 3WJRA 3VI6A 3RYIA 3HKCB 1NMUB 1OFUA 3CMEF 1W59A 3V7QA 4O4LA 1PF5A 3MCQA 5J2TB 4IHJB 5IT9M 1U3PA 2AIZP 5HY0A 5KX5B 3LDTA 3VCZA 1VQOF 3CD6F 5EIBC 4BW0B 2Z1TA 3S0HA 4BT5A 2UYJA 4M8IA 3F0GA 4I4TA 1H48A 1ONIA 1VQ6F 1NQ3A 5IJ0A 1VQMF 3LMEA 4C4WC 4KWEA 4E6EA 1Z5WA 1J7HA 3C9RA 2UYKA 3RYIB 2OTJF 1CN7A 3HKDB 3L7QA 4YJ2A 1VQPF 5HY1A 3KE1A 3QTYA 3SIUA 2HRYA 3CCUF 2AMTA 3I55F 3CCVF 1FNKA 3S0YA 3CPWF 5KMGA 1K9MH 2V9YA 3S0WA 3JASA 1FFXB 3WJQA 5G4UC 1VQ8F 1K8AH 2ZF8A 1VQ9F 2CHTA 3CC7F 4TUYA 1IPAA 4YJ3A 2Z1UA 2B33A 1Q82H 5EWRA 3FD6A 4C81A 2WALA 2JNBA 1Q7YH 4EI7A 3CCLF 5GONA 3WGNA 3G71F 1VQVA 3VMFB 5FLXM 1W57A 2QEXF 5CB4B 4O4IA 3CYQA 2BTOA 4B62A 5LOVB 2IQQA 2KGWA 3CCRF 2OTMA 1GZ0A 4X20B 3LWRC 1W5EA 1Q8RA 3HKEB 5HY4A 1ODEA 1GO0A 4IIJB 4TUYB 3IEQA 2CHSA 4FFBB 3R0PA 1W2BF 1U40A 1TUBB 2H8EA 4O2AA 2G9IA 1RLGA 4ZI7A 3JALB 1SA0B 4HNAB 4C8EA 5JVDB 2RHOA 3CXCF 1OAPA 5LYJB 3G4SF 4BVQA 3CC2F 2DT4A 1E7KA 2UYNA 5C8YA 3LWPC 4R40B 5MN6A 3JVHA 3M1XA 1RQ7A 3OBYA 5LP6B 5GIPC 3HWUA 4U3JB 4O2BA 3RYHA 3RYCB 4X1KA 4I50A 5JH7B 3IEWA 3C9TA 1H47A 2P6YA 3N2GB 4O4JB 3OW2F 1UI9A 1VHAA 1YJWF 4B46A 3Q8HA 4TZZA 5LXTA 1JY8A 4EI9A 3NMUC 1JFFA 3WGJA 5LP6C 3V4DA 5CA0B 3IMPA 4TV8A 3RA6A 4BVRA 1KNKA 3NK7A 3JATB 5HWEA 3CC4F 4NQ3A 3P10A 3CCMF 2W8BC 2IG8A 4X1KB 3QUWA 3SIVA 3V7EA 1VQ4F 3IKEA 1X25A 5EB0A 5A2QM 3N2KB 5MN4A 4LNUA 4BVSA 1YITF 1SDSA 1TVKB 1R1MA 2MQEA 1H7MA 3JARA 3ON1A 3GYQA 3FBAA 2HP3A 3E1YA 1S72F 2Q1XA 4RHAA 3LWOC 1JN1A 3M4SA 2H6LA 5EAZA 3JAWA 5IYZB 3I7TA 1QVGF 4F6RB 4DXDA 3ZP7A 1CK2A 3RYFB 3CYPB 3T80A 4G4VA 4I55B 4B45A 4X1YA 3D54A 3VTIC 1YJNF 4O4HA 4BT7A 3S03A 2HP0A 3C9UA 4O4LB 1IV4A 4B5CA 3NVIB 2OZBA 1W5AA 1QD9A 2QI2A 2FGYA 4BT2A 4G88A 5J2UA 1COMA 2K1SA 4ZHQA 2PHNA 4I4TB 1RQ2A 2VAPA 3HKBA 4PWTA 3UT5A 3TD3A 5FNVA 3E20B 5IJ0B 2OHWA 1U43A 3CB2A 5G4VC 3NVKE 3V3TA 2KTVA 3FD5A 2KG4A 4BVTA 4X3MA 1YGYA 2HQSC 1PXWA
chains in the Genus database with same CATH topology
1Q81H 3JCMM 1YIJF 4LCKA 3CCQF 1RLGA 3AGKA 3HAXD 3JAMM 3CXCF 3PLAC 1GO1A 5HXZA 3G4SF 4BVQA 3CC2F 1E7KA 3LWPC 1M90H 1VQLF 3PAFA 2LBWA 3J81M 3VI6A 3LFOA 3OBYA 1NMUB 5GIPC 3CMEF 2VGNA 3V7QA 3CMAF 3CCJF 4NUTA 3J7AR 2LBXA 5IT9M 5DCVA 5HY0A 1NJIH 1VQOF 3OW2F 3CD6F 1W3EX 3HJWC 1X7OA 1YJWF 3N4YA 4BW0B 4TZZA 1T0KB 4EI9A 3NMUC 3FFMA 2F9ZC 1ZWZA 1YHQF 5FJ4C 3IR9A 1N8RH 3NK6A 1VQ6F 2OTLF 3RA6A 1VQMF 4BVRA 1YJ9F 3N4ZA 1K73H 2AIFA 3MCAB 1Q86H 3NK7A 4EI8A 4C4WC 1DT9A 5HXUA 5HWEA 2CZWA 2OTJF 3CC4F 4NQ3A 1CN7A 3CCMF 1VQ7F 3CG6A 1X52A 1VQPF 3V7EA 3SIVA 1VQ4F 5HY1A 5A2QM 1W42A 1VQNF 3SIUA 4BVSA 3CCUF 2FC3A 1YITF 1SDSA 3I55F 3CCVF 1YI2F 1QVFF 1H7MA 2GLZA 3GYQA 3ON1A 2KTUA 3E1YA 3CPWF 5GAPK 1S72F 3I56F 3RA5A 1K9MH 1W40A 5GINC 3LWOC 1KC8H 3LWQC 1QVGF 4XCQA 5GIOC 1XBIA 5G4UC 3O85A 1KD1H 1K8AH 1VQ8F 1VQ5F 1VQ9F 1CK2A 1JJ2F 3CC7F 2BO1A 1YJNF 1IPAA 1KQSF 2HVYD 3LWVC 1Q82H 2ALEA 5EWRA 3J80M 1VQKF 2WALA 3NVIB 5EO3A 2JNBA 3OBWA 5HY2A 3CCEF 1Q7YH 4EI7A 3CCLF 3WXMB 2OZBA 2VGMA 3G71F 1X7PA 2QI2A 3VMFB 3D00A 2FGYA 4X3LA 5FLXM 2QEXF 1W41A 3G6EF 3CCRF 1RA4A 3E20B 2OHWA 5GANK 1GZ0A 3LWRC 1M1KH 5HY4A 5G4VC 1GO0A 3NVKE 2I6DA 2QA4F 3CPQA 3CCSF 3V3TA 2KTVA 4BY9D 2KG4A 4BVTA 4X3MA 1W2BF 1PXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 H;  3JCM M;  1YIJ F;  4LCK A;  3CCQ F;  1RLG A;  3AGK A;  3HAX D;  3JAM M;  3CXC F;  3PLA C;  1GO1 A;  3G4S F;  3CC2 F;  1E7K A;  3LWP C;  1M90 H;  1VQL F;  3PAF A;  2LBW A;  3J81 M;  3VI6 A;  3LFO A;  3OBY A;  1NMU B;  5GIP C;  3CME F;  2VGN A;  3V7Q A;  3CMA F;  3CCJ F;  4NUT A;  3J7A R;  2LBX A;  5IT9 M;  5DCV A;  1NJI H;  1VQO F;  3OW2 F;  3CD6 F;  1W3E X;  3HJW C;  1X7O A;  1YJW F;  3N4Y A;  4BW0 B;  4TZZ A;  1T0K B;  3NMU C;  3FFM A;  1ZWZ A;  1YHQ F;  5FJ4 C;  3IR9 A;  1N8R H;  3NK6 A;  1VQ6 F;  2OTL F;  3RA6 A;  1VQM F;  1YJ9 F;  3N4Z A;  1K73 H;  2AIF A;  3MCA B;  1Q86 H;  3NK7 A;  4C4W C;  1DT9 A;  2CZW A;  2OTJ F;  3CC4 F;  1CN7 A;  3CCM F;  1VQ7 F;  3CG6 A;  1X52 A;  1VQP F;  3V7E A;  3SIV A;  1VQ4 F;  5A2Q M;  1W42 A;  1VQN F;  3SIU A;  3CCU F;  2FC3 A;  1YIT F;  1SDS A;  3I55 F;  3CCV F;  1YI2 F;  1QVF F;  1H7M A;  3GYQ A;  3ON1 A;  2KTU A;  3E1Y A;  3CPW F;  5GAP K;  1S72 F;  3I56 F;  3RA5 A;  1K9M H;  1W40 A;  5GIN C;  3LWO C;  1KC8 H;  3LWQ C;  1QVG F;  5GIO C;  1XBI A;  5G4U C;  3O85 A;  1KD1 H;  1K8A H;  1VQ8 F;  1VQ5 F;  1VQ9 F;  1CK2 A;  1JJ2 F;  3CC7 F;  2BO1 A;  1YJN F;  1IPA A;  1KQS F;  2HVY D;  3LWV C;  1Q82 H;  2ALE A;  5EWR A;  3J80 M;  1VQK F;  2WAL A;  3NVI B;  5EO3 A;  2JNB A;  3OBW A;  3CCE F;  1Q7Y H;  3CCL F;  3WXM B;  2OZB A;  2VGM A;  3G71 F;  1X7P A;  2QI2 A;  3VMF B;  4X3L A;  5FLX M;  2QEX F;  1W41 A;  3G6E F;  3CCR F;  1RA4 A;  3E20 B;  2OHW A;  5GAN K;  1GZ0 A;  3LWR C;  1M1K H;  5G4V C;  1GO0 A;  3NVK E;  2I6D A;  2QA4 F;  3CPQ A;  3CCS F;  2KTV A;  4BY9 D;  2KG4 A;  4X3M A;  1W2B F;  1PXW A; 
#chains in the Genus database with same CATH topology
 3JCM M;  1YIJ F;  2H8C A;  2NMU A;  4YJ2 B;  3HAX D;  3JAM M;  1Z5V A;  3ELC A;  3ERN A;  2R6R 1;  5KMG B;  3MDO A;  3K2X A;  3JAS B;  5B8F A;  3E22 A;  2BTU A;  3VIU A;  2VGN A;  3CMA F;  3JAK A;  3UT5 B;  5FNV B;  3CCJ F;  3J7A R;  5EYP A;  1IV2 A;  1FNJ A;  4TV9 A;  3F6M A;  3VYT C;  3P4E A;  1CLI A;  4U39 A;  1NJI H;  1U3L A;  4YJ3 B;  4ZOL A;  5HP8 A;  5JCO A;  3HJW C;  1X7O A;  5JQG A;  3N4Y A;  3VOA A;  2CW4 A;  4X1I A;  2CWJ A;  1T0K B;  3FFM A;  3K14 A;  2F9Z C;  1ZWZ A;  5GON B;  1YQN A;  1N8R H;  3OON A;  3EOR A;  3M84 A;  4BT4 A;  2CSL A;  3C9S A;  3I3F A;  5EB1 B;  3WJP A;  3ZO8 A;  2OTL F;  2ZVZ A;  4O4I B;  3N4Z A;  2AIF A;  3MCA B;  2UZH A;  4EI8 A;  1Q86 H;  3WGM A;  3F0E A;  5EZY A;  3E22 B;  4WBN A;  3ZP4 A;  3KJK A;  1VQ7 F;  3CG6 A;  2LBT A;  1X52 A;  4DRX A;  3DC2 A;  2N48 A;  5BMV A;  1W42 A;  2FC3 A;  4ZOL B;  1YI2 F;  2LCA A;  1SZQ A;  3HTN A;  1W5F A;  3BYQ A;  2Z01 A;  4O2A B;  5GAP K;  3I56 F;  4C8G A;  4ZI7 B;  1W40 A;  5GIN C;  3S06 A;  5CA1 A;  2GZL A;  1XRG A;  1XBI A;  2UYN B;  2YXZ A;  5C8Y B;  2ZOV A;  1VQ5 F;  5J2T A;  4IHJ A;  3WPX A;  5KX5 A;  4G4Z A;  2RHH A;  2UYP A;  1KQS F;  4C82 A;  3LWV C;  4O2B B;  3RYH B;  2ALE A;  3J80 M;  4I50 B;  4ZHW A;  5EO3 A;  5AVM A;  5HY2 A;  3CCE F;  3WXM B;  2HS0 A;  2VGM A;  4RQO A;  3D00 A;  4X3L A;  5LXT B;  1JFF B;  1KNJ A;  5ITZ A;  3F0D A;  5CA1 B;  3ESJ A;  5IJ9 A;  1RA4 A;  3DDN A;  3HKD A;  1XHO A;  5GAN K;  3C8L A;  4TV8 B;  3GHZ A;  2QA4 F;  4BY9 D;  3TD5 A;  4BT3 A;  4NWO B;  2DYY A;  4ZHV A;  1RLU A;  4LCK A;  3CCQ F;  4G4Y A;  5HP7 A;  2HRU A;  3AGK A;  3P0Z A;  2VXY A;  1XV2 A;  4LNU B;  5HXZ A;  2RB9 A;  2RHJ A;  1FFX A;  3JAR B;  3VO8 A;  1VQL F;  2L26 A;  3MQW A;  3VOB A;  2IAF A;  2Z1E A;  3LFO A;  5ITZ B;  3JAW B;  3MBM A;  3WGK A;  5IJ9 B;  4NUT A;  2LBX A;  5DCV A;  4X1Y B;  3ZOP A;  4ERH A;  4O4H B;  1W3E X;  2HP0 B;  4ZK7 A;  1VK3 A;  2GVI A;  5CB4 A;  2HS4 A;  1QU9 A;  1YHQ F;  1IV3 A;  5EIB D;  3IR9 A;  5FJ4 C;  5LOV A;  3NK6 A;  3D01 A;  1QAH A;  4X20 A;  1YJ9 F;  3GTZ A;  3HKE A;  4EB6 A;  1K73 H;  3LYB A;  5J2U B;  4ZHQ B;  4IIJ A;  1DT9 A;  2R75 1;  5HXU A;  4FFB A;  2CZW A;  3HKB B;  4ZHY B;  1VH8 A;  1TUB A;  2Q1Y A;  3WPW A;  3JAL A;  1T0A A;  1SA0 A;  2ZAU A;  4HNA A;  5JVD A;  1VQN F;  5LYJ A;  3VYU C;  1QVF F;  2GLZ A;  2BTQ B;  2KTU A;  4G4X A;  3RA5 A;  1KC8 H;  2QTP A;  3LWQ C;  5LP6 A;  4U3J A;  4XCQ A;  3RYC A;  5GIO C;  2YYE A;  3O85 A;  1UFY A;  1KD1 H;  2RHL A;  5JH7 A;  1JJ2 F;  4EB6 B;  1DBF A;  2EWC A;  2BO1 A;  3N2G A;  4O4J A;  2HVY D;  1W55 A;  1FSZ A;  1W58 1;  1W5B A;  3JAK B;  1VQK F;  2I6R A;  1JD1 A;  5EYP B;  3K12 A;  4C8I A;  4TV9 B;  5LA6 A;  3OBW A;  1X7P A;  5CA0 A;  5MN5 A;  5JQG B;  3U0O A;  3KJJ A;  4X1I B;  1GX1 A;  2HX0 A;  1IV1 A;  1W41 A;  3TD4 A;  3JAT A;  3HKC A;  3G6E F;  3KIZ A;  2Z1F A;  3RE3 A;  3WGL A;  1M1K H;  3VYS C;  3K0T A;  2ZOD A;  3F0F A;  3KHN A;  2I6D A;  3N2K A;  2VAM A;  3CPQ A;  3FPI A;  5EZY B;  4BT6 A;  5JCO C;  3CCS F;  1TVK A;  4WBN B;  2PMP A;  1Q81 H;  2VAW A;  4DRX B;  3IKF A;  5LA6 B;  5BMV B;  2CVL A;  3PLA C;  5IYZ A;  1GO1 A;  3B6N A;  4F6R A;  4G4W A;  1M90 H;  3S02 A;  2HS3 A;  3RYF A;  2ZVY A;  3PAF A;  3QHD A;  2LBW A;  3J81 M;  4I55 A;  3WJR A;  3VI6 A;  3RYI A;  3HKC B;  1NMU B;  1OFU A;  3CME F;  1W59 A;  3V7Q A;  4O4L A;  1PF5 A;  3MCQ A;  5J2T B;  4IHJ B;  5IT9 M;  1U3P A;  2AIZ P;  5HY0 A;  5KX5 B;  3LDT A;  3VCZ A;  1VQO F;  3CD6 F;  5EIB C;  4BW0 B;  2Z1T A;  3S0H A;  4BT5 A;  2UYJ A;  4M8I A;  3F0G A;  4I4T A;  1H48 A;  1ONI A;  1VQ6 F;  1NQ3 A;  5IJ0 A;  1VQM F;  3LME A;  4C4W C;  4KWE A;  4E6E A;  1Z5W A;  1J7H A;  3C9R A;  2UYK A;  3RYI B;  2OTJ F;  1CN7 A;  3HKD B;  3L7Q A;  4YJ2 A;  1VQP F;  5HY1 A;  3KE1 A;  3QTY A;  3SIU A;  2HRY A;  3CCU F;  2AMT A;  3I55 F;  3CCV F;  1FNK A;  3S0Y A;  3CPW F;  5KMG A;  1K9M H;  2V9Y A;  3S0W A;  3JAS A;  1FFX B;  3WJQ A;  5G4U C;  1VQ8 F;  1K8A H;  2ZF8 A;  1VQ9 F;  2CHT A;  3CC7 F;  4TUY A;  1IPA A;  4YJ3 A;  2Z1U A;  2B33 A;  1Q82 H;  5EWR A;  3FD6 A;  4C81 A;  2WAL A;  2JNB A;  1Q7Y H;  4EI7 A;  3CCL F;  5GON A;  3WGN A;  3G71 F;  1VQV A;  3VMF B;  5FLX M;  1W57 A;  2QEX F;  5CB4 B;  4O4I A;  3CYQ A;  2BTO A;  4B62 A;  5LOV B;  2IQQ A;  2KGW A;  3CCR F;  2OTM A;  1GZ0 A;  4X20 B;  3LWR C;  1W5E A;  1Q8R A;  3HKE B;  5HY4 A;  1ODE A;  1GO0 A;  4IIJ B;  4TUY B;  3IEQ A;  2CHS A;  4FFB B;  3R0P A;  1W2B F;  1U40 A;  1TUB B;  2H8E A;  4O2A A;  2G9I A;  1RLG A;  4ZI7 A;  3JAL B;  1SA0 B;  4HNA B;  4C8E A;  5JVD B;  2RHO A;  3CXC F;  1OAP A;  5LYJ B;  3G4S F;  4BVQ A;  3CC2 F;  2DT4 A;  1E7K A;  2UYN A;  5C8Y A;  3LWP C;  4R40 B;  5MN6 A;  3JVH A;  3M1X A;  1RQ7 A;  3OBY A;  5LP6 B;  5GIP C;  3HWU A;  4U3J B;  4O2B A;  3RYH A;  3RYC B;  4X1K A;  4I50 A;  5JH7 B;  3IEW A;  3C9T A;  1H47 A;  2P6Y A;  3N2G B;  4O4J B;  3OW2 F;  1UI9 A;  1VHA A;  1YJW F;  4B46 A;  3Q8H A;  4TZZ A;  5LXT A;  1JY8 A;  4EI9 A;  3NMU C;  1JFF A;  3WGJ A;  5LP6 C;  3V4D A;  5CA0 B;  3IMP A;  4TV8 A;  3RA6 A;  4BVR A;  1KNK A;  3NK7 A;  3JAT B;  5HWE A;  3CC4 F;  4NQ3 A;  3P10 A;  3CCM F;  2W8B C;  2IG8 A;  4X1K B;  3QUW A;  3SIV A;  3V7E A;  1VQ4 F;  3IKE A;  1X25 A;  5EB0 A;  5A2Q M;  3N2K B;  5MN4 A;  4LNU A;  4BVS A;  1YIT F;  1SDS A;  1TVK B;  1R1M A;  2MQE A;  1H7M A;  3JAR A;  3ON1 A;  3GYQ A;  3FBA A;  2HP3 A;  3E1Y A;  1S72 F;  2Q1X A;  4RHA A;  3LWO C;  1JN1 A;  3M4S A;  2H6L A;  5EAZ A;  3JAW A;  5IYZ B;  3I7T A;  1QVG F;  4F6R B;  4DXD A;  3ZP7 A;  1CK2 A;  3RYF B;  3CYP B;  3T80 A;  4G4V A;  4I55 B;  4B45 A;  4X1Y A;  3D54 A;  3VTI C;  1YJN F;  4O4H A;  4BT7 A;  3S03 A;  2HP0 A;  3C9U A;  4O4L B;  1IV4 A;  4B5C A;  3NVI B;  2OZB A;  1W5A A;  1QD9 A;  2QI2 A;  2FGY A;  4BT2 A;  4G88 A;  5J2U A;  1COM A;  2K1S A;  4ZHQ A;  2PHN A;  4I4T B;  1RQ2 A;  2VAP A;  3HKB A;  4PWT A;  3UT5 A;  3TD3 A;  5FNV A;  3E20 B;  5IJ0 B;  2OHW A;  1U43 A;  3CB2 A;  5G4V C;  3NVK E;  3V3T A;  2KTV A;  3FD5 A;  2KG4 A;  4BVT A;  4X3M A;  1YGY A;  2HQS C;  1PXW A; 
#chains in the Genus database with same CATH homology
 1Q81 H;  3JCM M;  1YIJ F;  4LCK A;  3CCQ F;  1RLG A;  3AGK A;  3HAX D;  3JAM M;  3CXC F;  3PLA C;  1GO1 A;  5HXZ A;  3G4S F;  4BVQ A;  3CC2 F;  1E7K A;  3LWP C;  1M90 H;  1VQL F;  3PAF A;  2LBW A;  3J81 M;  3VI6 A;  3LFO A;  3OBY A;  1NMU B;  5GIP C;  3CME F;  2VGN A;  3V7Q A;  3CMA F;  3CCJ F;  4NUT A;  3J7A R;  2LBX A;  5IT9 M;  5DCV A;  5HY0 A;  1NJI H;  1VQO F;  3OW2 F;  3CD6 F;  1W3E X;  3HJW C;  1X7O A;  1YJW F;  3N4Y A;  4BW0 B;  4TZZ A;  1T0K B;  4EI9 A;  3NMU C;  3FFM A;  2F9Z C;  1ZWZ A;  1YHQ F;  5FJ4 C;  3IR9 A;  1N8R H;  3NK6 A;  1VQ6 F;  2OTL F;  3RA6 A;  1VQM F;  4BVR A;  1YJ9 F;  3N4Z A;  1K73 H;  2AIF A;  3MCA B;  1Q86 H;  3NK7 A;  4EI8 A;  4C4W C;  1DT9 A;  5HXU A;  5HWE A;  2CZW A;  2OTJ F;  3CC4 F;  4NQ3 A;  1CN7 A;  3CCM F;  1VQ7 F;  3CG6 A;  1X52 A;  1VQP F;  3V7E A;  3SIV A;  1VQ4 F;  5HY1 A;  5A2Q M;  1W42 A;  1VQN F;  3SIU A;  4BVS A;  3CCU F;  2FC3 A;  1YIT F;  1SDS A;  3I55 F;  3CCV F;  1YI2 F;  1QVF F;  1H7M A;  2GLZ A;  3GYQ A;  3ON1 A;  2KTU A;  3E1Y A;  3CPW F;  5GAP K;  1S72 F;  3I56 F;  3RA5 A;  1K9M H;  1W40 A;  5GIN C;  3LWO C;  1KC8 H;  3LWQ C;  1QVG F;  4XCQ A;  5GIO C;  1XBI A;  5G4U C;  3O85 A;  1KD1 H;  1K8A H;  1VQ8 F;  1VQ5 F;  1VQ9 F;  1CK2 A;  1JJ2 F;  3CC7 F;  2BO1 A;  1YJN F;  1IPA A;  1KQS F;  2HVY D;  3LWV C;  1Q82 H;  2ALE A;  5EWR A;  3J80 M;  1VQK F;  2WAL A;  3NVI B;  5EO3 A;  2JNB A;  3OBW A;  5HY2 A;  3CCE F;  1Q7Y H;  4EI7 A;  3CCL F;  3WXM B;  2OZB A;  2VGM A;  3G71 F;  1X7P A;  2QI2 A;  3VMF B;  3D00 A;  2FGY A;  4X3L A;  5FLX M;  2QEX F;  1W41 A;  3G6E F;  3CCR F;  1RA4 A;  3E20 B;  2OHW A;  5GAN K;  1GZ0 A;  3LWR C;  1M1K H;  5HY4 A;  5G4V C;  1GO0 A;  3NVK E;  2I6D A;  2QA4 F;  3CPQ A;  3CCS F;  3V3T A;  2KTV A;  4BY9 D;  2KG4 A;  4BVT A;  4X3M A;  1W2B F;  1PXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...