3LWVC

Structure of h/aca rnp bound to a substrate rna containing 2'-deoxyuridine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
b'KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 38
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwvC00
2CZWA 3AGKA 2I6DA 3LWVC 1GO0A 2KTVA 1W3EX 5G4VC 1KD1H 1W41A 4C4WC 3CCVF 3J81M 3O85A 1VQ5F 3CCRF 3LWOC 5EWRA 1PXWA 3NK7A 3LFOA 1RA4A 3CXCF 5GAPK 1NJIH 1KC8H 3CMEF 1YJNF 3PAFA 2BO1A 1W40A 2KTUA 3MCAB 1M90H 1RLGA 2ALEA 3N4ZA 3CC2F 1X7PA 2LBXA 3CCUF 1VQ6F 1VQMF 5DCVA 3CPWF 3VI6A 1N8RH 1X7OA 5EO3A 2OZBA 2VGMA 3V7EA 3I55F 3J7AR 2JNBA 3WXMB 2AIFA 5GANK 3V7QA 3LWRC 1CK2A 5A2QM 3NK6A 1GO1A 1DT9A 1T0KB 3JCMM 3GYQA 5GINC 1IPAA 1W2BF 3SIUA 2OTJF 1Q86H 1ZWZA 5IT9M 1VQKF 2VGNA 3LWPC 1K9MH 2FC3A 1YITF 1QVFF 3OBYA 1K73H 3OW2F 1YJWF 1VQ4F 1VQ9F 1YHQF 1VQ8F 3N4YA 1H7MA 3RA6A 3IR9A 4TZZA 1K8AH 3CCJF 1Q81H 1Q82H 1W42A 3CCMF 1SDSA 4NUTA 2OHWA 1X52A 1GZ0A 3SIVA 5FJ4C 5GIPC 2LBWA 1YIJF 3NVKE 1VQ7F 3CPQA 3CCQF 3E1YA 1XBIA 3CCSF 3G4SF 4BW0B 3PLAC 3CCLF 1VQPF 3HJWC 3JAMM 1VQNF 4X3LA 3HAXD 3LWQC 3VMFB 3OBWA 1VQLF 3E20B 2KG4A 1YJ9F 1VQOF 3CC4F 3G71F 1S72F 1YI2F 3CD6F 3CMAF 1QVGF 1CN7A 1NMUB 3NVIB 5FLXM 2QI2A 3CCEF 1M1KH 3ON1A 3CG6A 3NMUC 3RA5A 2WALA 3CC7F 3G6EF 4BY9D 1Q7YH 4X3MA 3J80M 2QA4F 5G4UC 1KQSF 2QEXF 1JJ2F 3FFMA 5GIOC 3I56F 2HVYD 4LCKA 1E7KA 2OTLF
chains in the Genus database with same CATH superfamily
1XHOA 3F0DA 1TUBB 5G4VC 5IJ9B 1KD1H 5EZYA 3Q8HA 3WJPA 3HKCB 4YJ2A 2Z1TA 5LOVB 1FNKA 3LFOA 1RA4A 4R40B 3HWUA 3CMEF 3V3TA 1IV1A 3MCAB 1RLGA 1SA0A 5C8YB 1VQ6F 1U3PA 3S0WA 1N8RH 2NMUA 2HS3A 2VGMA 3WPXA 2ZOVA 2JNBA 2HP0A 2AIFA 3E22A 5FNVB 5ITZA 5JCOC 3LDTA 2UYJA 4EB6A 3N2GA 3U0OA 3C9RA 5A2QM 3ZOPA 3NK6A 4F6RB 1VHAA 1GO1A 2RHOA 4U3JB 2UZHA 3ZP7A 1YGYA 4PWTA 3GYQA 5AVMA 4I50A 1UFYA 2IG8A 3WGKA 4BT5A 3N2KA 1ZWZA 3F0EA 4BVSA 5JH7B 1K9MH 5KX5B 1YQNA 1Z5VA 1YHQF 3MQWA 1W55A 2FGYA 3ESJA 5J2UB 5IYZA 2H6LA 2H8EA 3N4YA 4C8GA 1H7MA 1TVKB 3IKEA 3RA6A 3WGLA 1K8AH 3CCJF 1TUBA 3CCMF 5IJ9A 2QTPA 4NUTA 2P6YA 3JASB 3HKCA 2Z1EA 4BT4A 5LOVA 3CPQA 3CCSF 5HXZA 3RE3A 4X1IB 5HP8A 5C8YA 5JVDA 3R0PA 3M1XA 2BTUA 4TV9B 5IJ0B 1U40A 4G4VA 1IV4A 4TV8B 3CD6F 1QVGF 3OONA 3C9TA 3GHZA 5CA0A 3L7QA 4YJ3B 5FLXM 5LYJA 2QI2A 1J7HA 4F6RA 2L26A 3JALA 4BY9D 4U3JA 1W5AA 4ZOLA 3JARB 2Z1UA 5G4UC 2N48A 1KQSF 5KMGB 4LCKA 3I56F 5ITZB 2W8BC 5LP6C 4EI7A 3DDNA 2HS4A 2CZWA 3N2GB 5JH7A 3TD5A 3LWVC 4RHAA 4O4JA 3CYPB 1W41A 5KX5A 3CCVF 4RQOA 3O85A 5J2UA 3P0ZA 3VYUC 3K12A 1RLUA 4NQ3A 1NJIH 4E6EA 3JATB 3PAFA 1YJNF 2BO1A 1FNJA 2IAFA 3JASA 3CPWF 1X7OA 3F0FA 1JN1A 3VTIC 5J2TB 1DBFA 2RHLA 3IEQA 3B6NA 3J7AR 3WXMB 3M84A 3HKBA 3VCZA 2H8CA 3ZO8A 4X1IA 3VOBA 2AMTA 5CB4B 4XCQA 2HP3A 1JFFA 3LWRC 2Q1XA 4HNAB 4TV9A 2HRYA 3MCQA 4I55B 4O4IA 5IJ0A 4IHJA 1DT9A 3LMEA 3TD3A 4TV8A 1VQVA 5CA1B 1Q86H 5JVDB 4YJ3A 2VGNA 3WGNA 2UYPA 2CSLA 3CB2A 3DC2A 3OBYA 1VQ9F 3JARA 3RYCA 3D54A 5KMGA 1NQ3A 5EYPA 5CA0B 5LXTB 4DRXB 4TUYA 3C8LA 4ZHWA 3HTNA 5EB1B 5LYJB 4O2BB 2RHHA 3C9UA 1UI9A 5BMVB 1SDSA 3JALB 1H48A 1GZ0A 3F0GA 4ZOLB 1VQ7F 2RB9A 2GLZA 3E1YA 1XBIA 1QU9A 3JATA 2R751 2ZVZA 2PMPA 3I7TA 4BW0B 3PLAC 4O4JB 1VQPF 1QAHA 2ZODA 3FD5A 4G4XA 3D01A 4I4TA 4G88A 3OBWA 3E20B 5J2TA 3S0YA 2EWCA 3FBAA 2GZLA 3CMAF 1CN7A 3T80A 1NMUB 2HX0A 5GONB 5CB4A 4HNAA 3CG6A 2GVIA 3RA5A 3CC7F 4I55A 4C8IA 2CHSA 2CW4A 5EB0A 5MN6A 3WJQA 3HKBB 5CA1A 2OTLF 1QD9A 1JFFB 3RYIB 4X1KB 1W3EX 4O4IB 4C4WC 2CWJA 4IHJB 5EIBD 1X25A 1XV2A 1Z5WA 3KJJA 3CCRF 3IMPA 3LWOC 5EWRA 1PXWA 3NK7A 5LXTA 4DRXA 2VAMA 3V4DA 3CXCF 2HQSC 1W40A 2KTUA 4O2BA 4X1YB 2ALEA 3BYQA 3VIUA 5BMVA 5HP7A 3N4ZA 4IIJB 1X7PA 3CCUF 1VQMF 3VYSC 3RYCB 2RHJA 5LA6B 3VI6A 5EO3A 5EYPB 4TUYB 3I55F 1OFUA 3ERNA 3K14A 1W5BA 3V7QA 1PF5A 3RYHB 1CK2A 3I3FA 1ONIA 1FSZA 3WGMA 4O2AB 3VO8A 5JQGB 2LBTA 4WBNB 3KJKA 5JCOA 4ZHVA 5HY2A 4ERHA 3VYTC 4ZHYB 4BVQA 5GINC 4ZK7A 1W2BF 1H47A 1W59A 2OTJF 2G9IA 5GONA 2ZAUA 1VQKF 4BT7A 4X20B 3LWPC 2VAWA 3C9SA 1YITF 3JAWA 4I4TB 2CVLA 3OW2F 5LP6B 1YJWF 4C8EA 1JY8A 2Q1YA 4FFBA 5HXUA 2KGWA 1RQ2A 4TZZA 4EI9A 3RYIA 1Q81H 4X1KA 1KNKA 1W42A 2OHWA 3SIVA 4BT3A 1U3LA 4DXDA 5GIPC 2LBWA 1YIJF 3NVKE 3GTZA 3IEWA 3KIZA 4ZI7B 4X1YA 4O4LA 1FFXB 2R6R1 3CCLF 3HJWC 1VQNF 3HAXD 4IIJA 1ODEA 2ZF8A 2BTQB 5LA6A 5HY4A 3QHDA 1VQLF 1YJ9F 5HY1A 2VXYA 1VQOF 2Z1FA 2OTMA 1R1MA 3UT5A 2F9ZC 4BVRA 3HKDB 3RYHA 3CCEF 3S02A 3ON1A 1M1KH 1W5EA 2ZVYA 2UYNB 4O2AA 5JQGA 4WBNA 3S06A 2QA4F 1JJ2F 3FFMA 5GIOC 3IKFA 2BTOA 1COMA 3AGKA 3D00A 1KNJA 4X20A 3WGJA 2HRUA 2I6DA 2LCAA 1GO0A 2KTVA 3RYFA 2VAPA 1T0AA 3ZP4A 5LP6A 3J81M 3TD4A 1VQ5F 4BVTA 1VK3A 5GAPK 1KC8H 3JAKB 2IQQA 1M90H 3JVHA 1XRGA 4G4YA 3JAWB 3S03A 3CC2F 2LBXA 4O4HA 5DCVA 4FFBB 5MN5A 4B46A 1IV2A 2OZBA 4LNUB 3QUWA 3V7EA 2CHTA 4ZHQA 4ZI7A 5EIBC 3HKEB 5GANK 1FFXA 4B62A 3K0TA 2K1SA 1JD1A 2DYYA 3F6MA 4NWOB 3MDOA 5B8FA 1T0KB 1W581 3JCMM 3FPIA 1IPAA 3S0HA 3WPWA 3SIUA 3QTYA 2AIZP 4O4LB 1Q8RA 5IT9M 5HY0A 3CYQA 1RQ7A 3HKDA 5EAZA 2FC3A 3WJRA 2YYEA 2B33A 2UYNA 5EZYB 1QVFF 3P10A 1K73H 1VQ4F 4YJ2B 3ELCA 4EI8A 1GX1A 1VQ8F 3K2XA 3IR9A 3KE1A 3UT5B 3EORA 4U39A 5FNVA 1Q82H 1OAPA 1SA0B 1IV3A 4G4ZA 1X52A 3VOAA 5FJ4C 2YXZA 3P4EA 4B5CA 3MBMA 4C81A 3CCQF 3FD6A 1SZQA 2UYKA 2HP0B 1VH8A 3E22B 3JAKA 3G4SF 2I6RA 2MQEA 1W5FA 3RYFB 4BT6A 3JAMM 4X3LA 4EB6B 3LWQC 4C82A 2PHNA 3VMFB 1U43A 4LNUA 2KG4A 4M8IA 1W57A 3CC4F 3G71F 4I50B 1S72F 1CLIA 1YI2F 4B45A 3HKEA 3N2KB 1TVKA 3NVIB 4KWEA 4O4HB 4BT2A 2Z01A 3NMUC 2WALA 3LYBA 4G4WA 3G6EF 3M4SA 1Q7YH 4X3MA 3J80M 2HS0A 4ZHQB 2DT4A 5HWEA 5MN4A 3KHNA 5IYZB 2QEXF 2HVYD 1E7KA 2V9YA
chains in the Genus database with same CATH topology
2CZWA 3AGKA 3D00A 2I6DA 3LWVC 1GO0A 2KTVA 1W3EX 5G4VC 1KD1H 1W41A 4C4WC 3CCVF 3J81M 3O85A 1VQ5F 3CCRF 3LWOC 5EWRA 1PXWA 3NK7A 3LFOA 1RA4A 4BVTA 4NQ3A 5GAPK 3CXCF 1NJIH 3CMEF 1YJNF 3PAFA 1KC8H 3V3TA 2BO1A 1W40A 2KTUA 3MCAB 1M90H 1RLGA 2ALEA 3N4ZA 3CC2F 1X7PA 2LBXA 3CCUF 1VQ6F 1VQMF 5DCVA 3CPWF 3VI6A 1N8RH 1X7OA 5EO3A 2OZBA 2VGMA 3V7EA 3I55F 3J7AR 2JNBA 3WXMB 2AIFA 5GANK 3V7QA 4XCQA 3LWRC 1CK2A 5A2QM 3NK6A 1GO1A 1DT9A 5HY2A 1T0KB 3JCMM 4BVQA 3GYQA 5GINC 1IPAA 1W2BF 3SIUA 2OTJF 1Q86H 1ZWZA 5IT9M 5HY0A 1VQKF 2VGNA 4BVSA 3LWPC 1K9MH 2FC3A 1YITF 1QVFF 3OBYA 1K73H 3OW2F 1YJWF 1VQ4F 1VQ9F 1YHQF 5HXUA 2FGYA 4EI8A 1VQ8F 3N4YA 1H7MA 3RA6A 3IR9A 4TZZA 1K8AH 3CCJF 4EI9A 1Q81H 1Q82H 1W42A 3CCMF 1SDSA 4NUTA 2OHWA 1X52A 1GZ0A 3SIVA 5FJ4C 5GIPC 2LBWA 1YIJF 3NVKE 1VQ7F 3CPQA 2GLZA 3CCQF 3E1YA 1XBIA 3CCSF 5HXZA 3G4SF 4BW0B 3PLAC 3CCLF 1VQPF 3HJWC 3JAMM 1VQNF 4X3LA 3HAXD 3LWQC 3VMFB 5HY4A 3OBWA 1VQLF 3E20B 2KG4A 5HY1A 1YJ9F 1VQOF 3CC4F 3G71F 1S72F 1YI2F 3CD6F 3CMAF 1QVGF 1CN7A 1NMUB 3NVIB 5FLXM 2F9ZC 4BVRA 2QI2A 3CCEF 1M1KH 3ON1A 3CG6A 3NMUC 3RA5A 2WALA 3CC7F 3G6EF 4BY9D 1Q7YH 4X3MA 3J80M 5HWEA 2QA4F 5G4UC 1KQSF 2QEXF 1JJ2F 3FFMA 5GIOC 3I56F 2HVYD 4LCKA 4EI7A 1E7KA 2OTLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZW A;  3AGK A;  2I6D A;  3LWV C;  1GO0 A;  2KTV A;  1W3E X;  5G4V C;  1KD1 H;  1W41 A;  4C4W C;  3CCV F;  3J81 M;  3O85 A;  1VQ5 F;  3CCR F;  3LWO C;  5EWR A;  1PXW A;  3NK7 A;  3LFO A;  1RA4 A;  3CXC F;  5GAP K;  1NJI H;  1KC8 H;  3CME F;  1YJN F;  3PAF A;  2BO1 A;  1W40 A;  2KTU A;  3MCA B;  1M90 H;  1RLG A;  2ALE A;  3N4Z A;  3CC2 F;  1X7P A;  2LBX A;  3CCU F;  1VQ6 F;  1VQM F;  5DCV A;  3CPW F;  3VI6 A;  1N8R H;  1X7O A;  5EO3 A;  2OZB A;  2VGM A;  3V7E A;  3I55 F;  3J7A R;  2JNB A;  3WXM B;  2AIF A;  5GAN K;  3V7Q A;  3LWR C;  1CK2 A;  5A2Q M;  3NK6 A;  1GO1 A;  1DT9 A;  1T0K B;  3JCM M;  3GYQ A;  5GIN C;  1IPA A;  1W2B F;  3SIU A;  2OTJ F;  1Q86 H;  1ZWZ A;  5IT9 M;  1VQK F;  2VGN A;  3LWP C;  1K9M H;  2FC3 A;  1YIT F;  1QVF F;  3OBY A;  1K73 H;  3OW2 F;  1YJW F;  1VQ4 F;  1VQ9 F;  1YHQ F;  1VQ8 F;  3N4Y A;  1H7M A;  3RA6 A;  3IR9 A;  4TZZ A;  1K8A H;  3CCJ F;  1Q81 H;  1Q82 H;  1W42 A;  3CCM F;  1SDS A;  4NUT A;  2OHW A;  1X52 A;  1GZ0 A;  3SIV A;  5FJ4 C;  5GIP C;  2LBW A;  1YIJ F;  3NVK E;  1VQ7 F;  3CPQ A;  3CCQ F;  3E1Y A;  1XBI A;  3CCS F;  3G4S F;  4BW0 B;  3PLA C;  3CCL F;  1VQP F;  3HJW C;  3JAM M;  1VQN F;  4X3L A;  3HAX D;  3LWQ C;  3VMF B;  3OBW A;  1VQL F;  3E20 B;  2KG4 A;  1YJ9 F;  1VQO F;  3CC4 F;  3G71 F;  1S72 F;  1YI2 F;  3CD6 F;  3CMA F;  1QVG F;  1CN7 A;  1NMU B;  3NVI B;  5FLX M;  2QI2 A;  3CCE F;  1M1K H;  3ON1 A;  3CG6 A;  3NMU C;  3RA5 A;  2WAL A;  3CC7 F;  3G6E F;  4BY9 D;  1Q7Y H;  4X3M A;  3J80 M;  2QA4 F;  5G4U C;  1KQS F;  2QEX F;  1JJ2 F;  3FFM A;  5GIO C;  3I56 F;  2HVY D;  4LCK A;  1E7K A;  2OTL F; 
#chains in the Genus database with same CATH topology
 1XHO A;  3F0D A;  1TUB B;  5G4V C;  5IJ9 B;  1KD1 H;  5EZY A;  3Q8H A;  3WJP A;  3HKC B;  4YJ2 A;  2Z1T A;  5LOV B;  1FNK A;  3LFO A;  1RA4 A;  4R40 B;  3HWU A;  3CME F;  3V3T A;  1IV1 A;  3MCA B;  1RLG A;  1SA0 A;  5C8Y B;  1VQ6 F;  1U3P A;  3S0W A;  1N8R H;  2NMU A;  2HS3 A;  2VGM A;  3WPX A;  2ZOV A;  2JNB A;  2HP0 A;  2AIF A;  3E22 A;  5FNV B;  5ITZ A;  5JCO C;  3LDT A;  2UYJ A;  4EB6 A;  3N2G A;  3U0O A;  3C9R A;  5A2Q M;  3ZOP A;  3NK6 A;  4F6R B;  1VHA A;  1GO1 A;  2RHO A;  4U3J B;  2UZH A;  3ZP7 A;  1YGY A;  4PWT A;  3GYQ A;  5AVM A;  4I50 A;  1UFY A;  2IG8 A;  3WGK A;  4BT5 A;  3N2K A;  1ZWZ A;  3F0E A;  4BVS A;  5JH7 B;  1K9M H;  5KX5 B;  1YQN A;  1Z5V A;  1YHQ F;  3MQW A;  1W55 A;  2FGY A;  3ESJ A;  5J2U B;  5IYZ A;  2H6L A;  2H8E A;  3N4Y A;  4C8G A;  1H7M A;  1TVK B;  3IKE A;  3RA6 A;  3WGL A;  1K8A H;  3CCJ F;  1TUB A;  3CCM F;  5IJ9 A;  2QTP A;  4NUT A;  2P6Y A;  3JAS B;  3HKC A;  2Z1E A;  4BT4 A;  5LOV A;  3CPQ A;  3CCS F;  5HXZ A;  3RE3 A;  4X1I B;  5HP8 A;  5C8Y A;  5JVD A;  3R0P A;  3M1X A;  2BTU A;  4TV9 B;  5IJ0 B;  1U40 A;  4G4V A;  1IV4 A;  4TV8 B;  3CD6 F;  1QVG F;  3OON A;  3C9T A;  3GHZ A;  5CA0 A;  3L7Q A;  4YJ3 B;  5FLX M;  5LYJ A;  2QI2 A;  1J7H A;  4F6R A;  2L26 A;  3JAL A;  4BY9 D;  4U3J A;  1W5A A;  4ZOL A;  3JAR B;  2Z1U A;  5G4U C;  2N48 A;  1KQS F;  5KMG B;  4LCK A;  3I56 F;  5ITZ B;  2W8B C;  5LP6 C;  4EI7 A;  3DDN A;  2HS4 A;  2CZW A;  3N2G B;  5JH7 A;  3TD5 A;  3LWV C;  4RHA A;  4O4J A;  3CYP B;  1W41 A;  5KX5 A;  3CCV F;  4RQO A;  3O85 A;  5J2U A;  3P0Z A;  3VYU C;  3K12 A;  1RLU A;  4NQ3 A;  1NJI H;  4E6E A;  3JAT B;  3PAF A;  1YJN F;  2BO1 A;  1FNJ A;  2IAF A;  3JAS A;  3CPW F;  1X7O A;  3F0F A;  1JN1 A;  3VTI C;  5J2T B;  1DBF A;  2RHL A;  3IEQ A;  3B6N A;  3J7A R;  3WXM B;  3M84 A;  3HKB A;  3VCZ A;  2H8C A;  3ZO8 A;  4X1I A;  3VOB A;  2AMT A;  5CB4 B;  4XCQ A;  2HP3 A;  1JFF A;  3LWR C;  2Q1X A;  4HNA B;  4TV9 A;  2HRY A;  3MCQ A;  4I55 B;  4O4I A;  5IJ0 A;  4IHJ A;  1DT9 A;  3LME A;  3TD3 A;  4TV8 A;  1VQV A;  5CA1 B;  1Q86 H;  5JVD B;  4YJ3 A;  2VGN A;  3WGN A;  2UYP A;  2CSL A;  3CB2 A;  3DC2 A;  3OBY A;  1VQ9 F;  3JAR A;  3RYC A;  3D54 A;  5KMG A;  1NQ3 A;  5EYP A;  5CA0 B;  5LXT B;  4DRX B;  4TUY A;  3C8L A;  4ZHW A;  3HTN A;  5EB1 B;  5LYJ B;  4O2B B;  2RHH A;  3C9U A;  1UI9 A;  5BMV B;  1SDS A;  3JAL B;  1H48 A;  1GZ0 A;  3F0G A;  4ZOL B;  1VQ7 F;  2RB9 A;  2GLZ A;  3E1Y A;  1XBI A;  1QU9 A;  3JAT A;  2R75 1;  2ZVZ A;  2PMP A;  3I7T A;  4BW0 B;  3PLA C;  4O4J B;  1VQP F;  1QAH A;  2ZOD A;  3FD5 A;  4G4X A;  3D01 A;  4I4T A;  4G88 A;  3OBW A;  3E20 B;  5J2T A;  3S0Y A;  2EWC A;  3FBA A;  2GZL A;  3CMA F;  1CN7 A;  3T80 A;  1NMU B;  2HX0 A;  5GON B;  5CB4 A;  4HNA A;  3CG6 A;  2GVI A;  3RA5 A;  3CC7 F;  4I55 A;  4C8I A;  2CHS A;  2CW4 A;  5EB0 A;  5MN6 A;  3WJQ A;  3HKB B;  5CA1 A;  2OTL F;  1QD9 A;  1JFF B;  3RYI B;  4X1K B;  1W3E X;  4O4I B;  4C4W C;  2CWJ A;  4IHJ B;  5EIB D;  1X25 A;  1XV2 A;  1Z5W A;  3KJJ A;  3CCR F;  3IMP A;  3LWO C;  5EWR A;  1PXW A;  3NK7 A;  5LXT A;  4DRX A;  2VAM A;  3V4D A;  3CXC F;  2HQS C;  1W40 A;  2KTU A;  4O2B A;  4X1Y B;  2ALE A;  3BYQ A;  3VIU A;  5BMV A;  5HP7 A;  3N4Z A;  4IIJ B;  1X7P A;  3CCU F;  1VQM F;  3VYS C;  3RYC B;  2RHJ A;  5LA6 B;  3VI6 A;  5EO3 A;  5EYP B;  4TUY B;  3I55 F;  1OFU A;  3ERN A;  3K14 A;  1W5B A;  3V7Q A;  1PF5 A;  3RYH B;  1CK2 A;  3I3F A;  1ONI A;  1FSZ A;  3WGM A;  4O2A B;  3VO8 A;  5JQG B;  2LBT A;  4WBN B;  3KJK A;  5JCO A;  4ZHV A;  5HY2 A;  4ERH A;  3VYT C;  4ZHY B;  4BVQ A;  5GIN C;  4ZK7 A;  1W2B F;  1H47 A;  1W59 A;  2OTJ F;  2G9I A;  5GON A;  2ZAU A;  1VQK F;  4BT7 A;  4X20 B;  3LWP C;  2VAW A;  3C9S A;  1YIT F;  3JAW A;  4I4T B;  2CVL A;  3OW2 F;  5LP6 B;  1YJW F;  4C8E A;  1JY8 A;  2Q1Y A;  4FFB A;  5HXU A;  2KGW A;  1RQ2 A;  4TZZ A;  4EI9 A;  3RYI A;  1Q81 H;  4X1K A;  1KNK A;  1W42 A;  2OHW A;  3SIV A;  4BT3 A;  1U3L A;  4DXD A;  5GIP C;  2LBW A;  1YIJ F;  3NVK E;  3GTZ A;  3IEW A;  3KIZ A;  4ZI7 B;  4X1Y A;  4O4L A;  1FFX B;  2R6R 1;  3CCL F;  3HJW C;  1VQN F;  3HAX D;  4IIJ A;  1ODE A;  2ZF8 A;  2BTQ B;  5LA6 A;  5HY4 A;  3QHD A;  1VQL F;  1YJ9 F;  5HY1 A;  2VXY A;  1VQO F;  2Z1F A;  2OTM A;  1R1M A;  3UT5 A;  2F9Z C;  4BVR A;  3HKD B;  3RYH A;  3CCE F;  3S02 A;  3ON1 A;  1M1K H;  1W5E A;  2ZVY A;  2UYN B;  4O2A A;  5JQG A;  4WBN A;  3S06 A;  2QA4 F;  1JJ2 F;  3FFM A;  5GIO C;  3IKF A;  2BTO A;  1COM A;  3AGK A;  3D00 A;  1KNJ A;  4X20 A;  3WGJ A;  2HRU A;  2I6D A;  2LCA A;  1GO0 A;  2KTV A;  3RYF A;  2VAP A;  1T0A A;  3ZP4 A;  5LP6 A;  3J81 M;  3TD4 A;  1VQ5 F;  4BVT A;  1VK3 A;  5GAP K;  1KC8 H;  3JAK B;  2IQQ A;  1M90 H;  3JVH A;  1XRG A;  4G4Y A;  3JAW B;  3S03 A;  3CC2 F;  2LBX A;  4O4H A;  5DCV A;  4FFB B;  5MN5 A;  4B46 A;  1IV2 A;  2OZB A;  4LNU B;  3QUW A;  3V7E A;  2CHT A;  4ZHQ A;  4ZI7 A;  5EIB C;  3HKE B;  5GAN K;  1FFX A;  4B62 A;  3K0T A;  2K1S A;  1JD1 A;  2DYY A;  3F6M A;  4NWO B;  3MDO A;  5B8F A;  1T0K B;  1W58 1;  3JCM M;  3FPI A;  1IPA A;  3S0H A;  3WPW A;  3SIU A;  3QTY A;  2AIZ P;  4O4L B;  1Q8R A;  5IT9 M;  5HY0 A;  3CYQ A;  1RQ7 A;  3HKD A;  5EAZ A;  2FC3 A;  3WJR A;  2YYE A;  2B33 A;  2UYN A;  5EZY B;  1QVF F;  3P10 A;  1K73 H;  1VQ4 F;  4YJ2 B;  3ELC A;  4EI8 A;  1GX1 A;  1VQ8 F;  3K2X A;  3IR9 A;  3KE1 A;  3UT5 B;  3EOR A;  4U39 A;  5FNV A;  1Q82 H;  1OAP A;  1SA0 B;  1IV3 A;  4G4Z A;  1X52 A;  3VOA A;  5FJ4 C;  2YXZ A;  3P4E A;  4B5C A;  3MBM A;  4C81 A;  3CCQ F;  3FD6 A;  1SZQ A;  2UYK A;  2HP0 B;  1VH8 A;  3E22 B;  3JAK A;  3G4S F;  2I6R A;  2MQE A;  1W5F A;  3RYF B;  4BT6 A;  3JAM M;  4X3L A;  4EB6 B;  3LWQ C;  4C82 A;  2PHN A;  3VMF B;  1U43 A;  4LNU A;  2KG4 A;  4M8I A;  1W57 A;  3CC4 F;  3G71 F;  4I50 B;  1S72 F;  1CLI A;  1YI2 F;  4B45 A;  3HKE A;  3N2K B;  1TVK A;  3NVI B;  4KWE A;  4O4H B;  4BT2 A;  2Z01 A;  3NMU C;  2WAL A;  3LYB A;  4G4W A;  3G6E F;  3M4S A;  1Q7Y H;  4X3M A;  3J80 M;  2HS0 A;  4ZHQ B;  2DT4 A;  5HWE A;  5MN4 A;  3KHN A;  5IYZ B;  2QEX F;  2HVY D;  1E7K A;  2V9Y A; 
#chains in the Genus database with same CATH homology
 2CZW A;  3AGK A;  3D00 A;  2I6D A;  3LWV C;  1GO0 A;  2KTV A;  1W3E X;  5G4V C;  1KD1 H;  1W41 A;  4C4W C;  3CCV F;  3J81 M;  3O85 A;  1VQ5 F;  3CCR F;  3LWO C;  5EWR A;  1PXW A;  3NK7 A;  3LFO A;  1RA4 A;  4BVT A;  4NQ3 A;  5GAP K;  3CXC F;  1NJI H;  3CME F;  1YJN F;  3PAF A;  1KC8 H;  3V3T A;  2BO1 A;  1W40 A;  2KTU A;  3MCA B;  1M90 H;  1RLG A;  2ALE A;  3N4Z A;  3CC2 F;  1X7P A;  2LBX A;  3CCU F;  1VQ6 F;  1VQM F;  5DCV A;  3CPW F;  3VI6 A;  1N8R H;  1X7O A;  5EO3 A;  2OZB A;  2VGM A;  3V7E A;  3I55 F;  3J7A R;  2JNB A;  3WXM B;  2AIF A;  5GAN K;  3V7Q A;  4XCQ A;  3LWR C;  1CK2 A;  5A2Q M;  3NK6 A;  1GO1 A;  1DT9 A;  5HY2 A;  1T0K B;  3JCM M;  4BVQ A;  3GYQ A;  5GIN C;  1IPA A;  1W2B F;  3SIU A;  2OTJ F;  1Q86 H;  1ZWZ A;  5IT9 M;  5HY0 A;  1VQK F;  2VGN A;  4BVS A;  3LWP C;  1K9M H;  2FC3 A;  1YIT F;  1QVF F;  3OBY A;  1K73 H;  3OW2 F;  1YJW F;  1VQ4 F;  1VQ9 F;  1YHQ F;  5HXU A;  2FGY A;  4EI8 A;  1VQ8 F;  3N4Y A;  1H7M A;  3RA6 A;  3IR9 A;  4TZZ A;  1K8A H;  3CCJ F;  4EI9 A;  1Q81 H;  1Q82 H;  1W42 A;  3CCM F;  1SDS A;  4NUT A;  2OHW A;  1X52 A;  1GZ0 A;  3SIV A;  5FJ4 C;  5GIP C;  2LBW A;  1YIJ F;  3NVK E;  1VQ7 F;  3CPQ A;  2GLZ A;  3CCQ F;  3E1Y A;  1XBI A;  3CCS F;  5HXZ A;  3G4S F;  4BW0 B;  3PLA C;  3CCL F;  1VQP F;  3HJW C;  3JAM M;  1VQN F;  4X3L A;  3HAX D;  3LWQ C;  3VMF B;  5HY4 A;  3OBW A;  1VQL F;  3E20 B;  2KG4 A;  5HY1 A;  1YJ9 F;  1VQO F;  3CC4 F;  3G71 F;  1S72 F;  1YI2 F;  3CD6 F;  3CMA F;  1QVG F;  1CN7 A;  1NMU B;  3NVI B;  5FLX M;  2F9Z C;  4BVR A;  2QI2 A;  3CCE F;  1M1K H;  3ON1 A;  3CG6 A;  3NMU C;  3RA5 A;  2WAL A;  3CC7 F;  3G6E F;  4BY9 D;  1Q7Y H;  4X3M A;  3J80 M;  5HWE A;  2QA4 F;  5G4U C;  1KQS F;  2QEX F;  1JJ2 F;  3FFM A;  5GIO C;  3I56 F;  2HVY D;  4LCK A;  4EI7 A;  1E7K A;  2OTL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...