3LX6A

Crystal structure of putative dna cytosine methylase from shigella flexneri 2a str. 2457t
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
391
structure length
368
Chain Sequence
TLLPKPPEHHPHYAFRFIDLFAGIGGIRRGFESIGGQCVFTSEWNKHAVRTYKANHYCDPATHHFNEDIRDITLSHQEGVSDEAAAEHIRQHIPEHDVLLAGFPCQPFSLAACDTQGTLFFDVVRIIDARRPAMFVLENVKNLKSHDKGKTFRIIMQTLDELGYDVADAEDNGPDDPKIIDGKHFLPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPVLWKYLYRYAKKYGMVYPNNPQSVTRTLSARYYKDGAEILIDRGWDMATGEKDFDDPLNQQHRPRRLTPRECARLMGFEAPGEAKFRIPVSDTQAYRQFGNSVVVPVFAAVAKLLEPKIKQAVALRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative dna cytosine methylase from shigella flexneri 2a str. 2457T
rcsb
source organism Shigella flexneri 2a
molecule tags Transferase
molecule keywords Cytosine-specific methyltransferase
total genus 118
structure length 368
sequence length 391
chains with identical sequence B
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2010-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lx6A01
3.90.120.30 Alpha Beta Alpha-Beta Complex DNA Methylase; Chain A, domain 2 DNA Methylase; Chain A, domain 2 3lx6A02
4NECA 2OKCA 5DTRA 5FTWA 4E2YA 1EJ6A 1SG9A 4RTMA 3ERCA 4QQNA 4X61A 2QRVB 4M7RA 5EIFA 1Q0TA 1EQAA 2VDUE 3G8BA 3HCEA 3GRYA 3KQVA 3DMHA 1NE2A 3BGDA 3O4FA 5GM1A 3T7TA 4C4AA 4EQZA 2PX5A 2UYHA 3OZSA 3EVCA 2FK8A 2YTZA 4E32A 4AUKA 2P7IA 1VLMA 3R0QA 3UZUA 2AN3A 4E31A 2P35A 3HP7A 1L3IA 4R6WA 1H1DA 5JR3A 1KPHA 2PX2A 1WY7A 3MCZA 4PYLA 2E5WA 2YXDA 4EK9A 2VP3A 5IKMA 2ERCA 3HEMA 2G1PA 4FGZA 3FRHA 4DZRA 3NMUF 4KW7A 1JR4A 3GRRA 1ZHFA 2BM8A 4PGHA 5CM2Z 5DM4A 5GWXA 4DMGA 2GLUA 3TM4A 2HWKA 3DR5A 3FUWA 3QOXA 4MQ4A 2BM9A 2PT9A 3G2PA 3UJBA 4DCGA 1QYRA 1XTPA 3BZBA 3FZGA 2F8LA 1NW3A 2ZW9A 1XCLA 4X1OA 3CGGA 1KP9A 4FZVA 5FWAA 3DOUA 3GCZA 3UFBA 1NBHA 2H1RA 4CWAA 2B9EA 4XUDA 1B42A 5E9QA 4YUVA 3K6RA 3MB5A 3JWGA 5FHQA 3IYLW 3G89A 5EMLA 1QAQA 2AN5A 5ICCA 3LCUA 4ER5A 1P91A 4OBWA 5P8WA 3LL7A 3LBYA 4EKIA 4P58A 2YX1A 2OB1A 2PX8A 1XDZA 5FCDA 1JTFA 4AZSA 2PWPA 3KR0A 1JQEA 5EKXA 2ONZA 2HTEA 3G7UA 2AVNA 4CKCA 1ZGAA 2ZTHA 2GAFA 4X41A 2ZWAA 5DTQA 3EVBA 4HTFB 3LKZA 1EJ0A 3I64A 3KPWA 3VYWA 4PWYA 2JG3A 1FPQA 4FSXA 2P7HA 5K0LA 4HC4A 5LQKA 1FJXA 1RI3A 1JTEA 3JWJA 2ZLBA 3HA7A 5DSXA 1XVAA 4AZTA 1UIRA 3KQOA 3BWMA 2FK7A 2PY6A 5CVJA 2OYRA 3SVZA 4FT4A 2PJDA 3TKYA 4DF3A 5LQAA 5HIKA 5C1IA 1IM8A 4YUXA 3CJQA 5DSTA 1G38A 2AOTA 4IWNA 5K0JA 4MWZA 5EKUA 1KIAA 3LGAA 3FPJA 1NBIA 3NVKI 2XVMA 3T7SA 3FTFA 1YZ3A 3JWHA 2FRXA 1XCJA 2BR3A 3M6UA 3ORHA 4ER7A 5BXYA 1KYWA 5K09A 5DT2A 2C7OA 2Y1WA 1F38A 4BLUA 3NVMB 4EVIA 2XYVA 3B3JA 3R9XB 3A26A 1KPGA 2PXCA 4RVDA 4RTNA 2AOUB 2P3OA 2VDVE 3LHDA 5K0BA 2I62A 3DXXA 3TPZA 4HH4A 1R18A 3M70A 3PLAE 4PYQA 4YMGA 1AQJA 5K0NA 4QDKA 3LSTA 3C3YA 1RI1A 4PYMA 5EMKA 4LWOA 3FUTA 3FPEA 5K0FA 5HFJA 3THRA 1P39A 4BP3A 4OX9Y 5ICEA 1ZG3A 1M6EX 1JSZA 5DM1A 1D2CA 2GPYA 3MQ2A 4AZWA 4HRAA 3SR4A 5EZSA 4QVGA 5FULA 4E2ZA 1AF7A 4XUCA 8MHTA 4WVLA 3UJ9A 3FUVA 3I53A 1YB2A 2NXNA 5HIJA 4GF5A 2XYRA 5GIOE 5FQOA 3BXOA 5E1MA 2C7PA 2ONYA 4QTTB 2JH9A 2NXJA 2VS1A 4EKGA 4KVZA 1YFLA 1JSXA 4E70A 3I5UA 2IBSA 1EIZA 3AY0A 3KQQA 1WG8A 3M4XA 3GXOA 5FUBA 1G8SA 1O54A 3PX3A 4QTUB 4A6EA 4X60A 3G2OA 5BW5A 5K0CA 2P40A 5E2AA 3R24A 3EEOA 4GOOD 3HCCA 3KKZA 2QM3A 2JHPA 2CMHA 5KQSA 4CKBA 1VP9A 2WA1A 2EG5A 3ELWA 4JXJA 5M5BA 3DTNA 4RTSA 3LDUA 3E23A 2WA2A 2AVDA 3V97A 1Q0SA 4ER6A 2B78A 3HCAA 1NKVA 4RTRA 1I1NA 4ISCA 2H00A 3P8ZA 2AOWA 1OR8A 2BR4A 3KPUA 5C9ZA 5B1SA 3EMBA 3TRKA 4GEKA 3LBFA 1D2HA 2KW5A 3IV6A 3OE5A 4GC5A 1YFJA 2Z6AA 1BKYA 1NT2A 1HNNA 1L3BA 4E33A 3S68A 3BUSA 1KHHA 3EGIA 5EC8A 1NV8A 3X0DA 3EVFA 2AS0A 3CKKA 4YUWA 4BY9E 3P2IA 2ZVJA 3OFJA 5CIYA 2IH4A 2ZULA 2I6GA 5HOQA 5DPMA 1NV9A 5DM2A 5C0OE 4LG1A 3G2QA 2P1DA 4U7TB 2Z6QA 3NW9A 2IIPA 3GRUA 1JG2A 2YXEA 4PYIA 3ER8A 4C03A 5ICFA 3E8SA 3CJRA 4C07A 2OY0A 3SMQA 2PX4A 3FTDA 2B25A 3CCFA 1X1CA 3OPNA 3MGGA 5GP1A 3KQMA 5CVUA 3LDFA 5FHRA 3CBGA 4PIPA 2BZGA 5EMMA 3HCBA 3NWBA 4LWPA 2GH1A 3PS9A 3SXJA 5K03A 5GIPE 3TM5A 4PNEA 1ZQ9A 2PWYA 3IEIA 4PYKA 5K01A 2VDWA 5CVEA 3P71T 2ZZNA 3P9IA 3VSEA 4R6XA 4C08A 3BKXA 5EPEA 2IDKA 3FTCA 3ME5A 2YVLA 5ERGB 1SQGA 3RW9A 1XDSA 1X1AA 3KR1A 4KDRA 5D1NA 3UBTA 5F2KA 1P1BA 5K0GA 3A25A 3CVOA 3NDIA 1RI2A 1T43A 3Q7EA 1U2ZA 4AZVA 5DWQA 3FTEA 3MERA 1YUBA 4HGZA 3R6TA 5EG5A 4R8RA 3A4TA 3REOA 1G55A 3CJTA 1VQ1A 4Y2HA 5U4XA 5GINE 2FYTA 4M36A 2YQZA 2JH8A 3GGDA 3SSNA 3NDJA 2FCAA 1R00A 1RJGA 2V7EA 5CCXA 4V0RA 5HILA 5T6BA 2O05A 5CVVA 2OB2A 1NW7A 3OE4A 4BP1A 3SX0A 4FP9A 3WSTA 5DTMA 2CMGA 2N47A 2WK1A 3QV2A 3TQSA 2IDJA 2R6ZA 2OZVA 1RJDA 2PSSA 4HG2A 4RTPA 2BR5A 3MAGA 4OBXA 4DQ0A 2LD4A 3AXTA 3EVGA 3KPYA 2BH2A 2JJQA 1SUIA 3NWEA 4O29A 4M38A 4F86A 1QAOA 4IV8A 1YZHA 3C3PA 5EEHA 5HIIA 4PGGA 1VE3A 1WXXA 2NXEA 3K0BA 2H11A 3KQPA 3NJRA 3TKAA 2AR0A 5FA8A 3R3HA 5BW4A 4R05A 3I9FA 5CCBA 2IBTA 1EG2A 4YMHA 4XUEA 4RVGA 4GOMD 2P8JA 3DLIA 4ATNA 2NP6A 3DMGA 3DUWA 1RI5A 5DM0A 3TMAA 3BWCA 1RJFA 3PTAA 4RTOA 2EJUA 2NNWB 3BWYA 1WZNA 3B5IA 3FPHA 2AOUA 2HNKA 3HA3A 1NW5A 3ID6C 5EMJA 1VP3A 3DH0A 3OU6A 1P1CA 1ZKDA 5LQNA 3ELDA 4GOND 3HVKA 2DULA 4YUZA 2V74B 3UA4A 1Y8CA 2AZTA 10MHA 3HVIA 3V8VA 3GIWA 3A7EA 2EFJA 1QZZA 3BGIA 4QDJA 3KQYA 4YV2A 4KRGA 4RVFA 1G6Q1 2HMYB 3M6VA 5EHGA 3RODA 2AOTB 1JQDA 3E7PA 5D1HA 4GC9A 2O57A 5E9JA 1WS6A 3GWZA 3DP7A 5KS2A 1I4WA 2G72A 3ANXA 4QQKA 2PVCA 2P3LA 5K8VA 2UZ4A 1VIDA 4LECA 3C6KA 3BKWA 2AN4A 3P9KA 1NW6A 2IFTA 4P7KA 4UOEA 3BGVA 1VL5A 3SSMA 4KIFA 2PLWA 2UYQA 4PONA 1RJEA 2IGTA 1XJ5A 4IKPA 2JHCA 3UJDA 3TOSA 2B2CA 3LX6A 3I58A 2G8NA 5E9WA 4C05A 4XCXA 3KHKA 2XVAA 1SUSA 2IP2A 2P41A 3PT9A 4Y30A 1MJFA 5BP7A 2HV9A 1KR5A 2QRVA 3AWIA 2G71A 4PCAA 4GBED 2DPMA 1DUSA 2ZZMA 2EJTA 4RTLA 1DL5A 3PB3A 3DMFA 4OA5A 1FP1D 3OZTA 5E1OA 4QVKA 5G02A 2IPXA 3KQSA 4CKEA 5E1DA 4OQEA 5DX8A 1KXZA 2GA9A 5HZMA 3HM2A 3O31A 2ZBQA 4OA8A 3DULA 3UJ6A 1IXKA 3HA5A 3KU1A 4MTLA 1IY9A 4RWZA 4RYLA 5EEGA 3SSOA 3IHTA 2QE6A 4RTQA 5LR6A 1N7IA 1BC5A 2G70A 3HCFA 3MTEA 3M33A 3PFGA 5LSAA 1X1BA 4R8SA 5KVAA 1SKMA 1X19A 4OQDA 1JG3A 3BWBA 5CUQA 3LDGA 4EMSA 3LKDA 1SQFA 4C04A 4G56A 1JQ3A 1BOOA 4YV1A 2VZ9A 2ZCJA 1AV6A 3VC1A 3GRVA 5FQNA 1XXLA 2Y1XA 3M6XA 3OFKA 3JWIA 4KIGA 4KWCA 1R74A 3SGLA 4POOA 3LECA 1BHJA 3T7RA 1KPIA 3MCTA 3PX2A 3ELYA 1L3CA 2QYOA 1FP2A 1ORIA 5HIMA 3THSA 1M6YA 3EGEA 3UJAA 4C06A 4PYJA 3HTXA 3EVZA 4K6MA 3B3FA 3CC8A 3DLCA 3ELUA 3KPVA 3KR2A 4E30A 5F2NA 3G88A 4CXMA 2UYCA 1SVUA 5HEKA 4BLVA 1M0EA 3D2LA 3NTVA 5DXJA 4F85A 2IH5A 3H2BA 1PJZA 2ORED 5LQUA 3OCJA 4A6DA 5CD1A 4DA4A 1TW2A 2HR1A 1DCTA 1Z3CA 2OO3A 3GU3A 4U7PB 5LQRA 4HTFA 2YXLA 2YUIA 3UWPA 1QANA 3MHTA 1WXWA 2PXAA 4PYNA 3EVAA 2K4MA 2ZSUA 5FA5A 2O0LA 3SM3A 4L7VA 2Z6UA 2FPOA 5E2BA 4DCMA 2O06A 1QAMA 4CTJA 3EVEA 4MHTA 4FSDA 5ICGA 4P7JA 3B3GA 2OXTA 4WXHA 5MHTA 5DXAA 2ZFUA 2ZIEA 1FBNA 2QY6A 5DRTA 4RTJA 2CL5A 5DX0A 3HVJA 2ESRA 2CKDA 3KQTA 5K0EA 3TFWA 4IV0A 5DRYA 3EGVA 3OU7A 5GOZA 1TPYA 5T67A 2CWWA 4H0NA 4KDCA 1PRYA 5EGSA 1O9GA 3AJDA 1NW8A 3EPPA 2PKWA 3OU2A 1O9HA 2JHAA 3P9CA 3HNRA 3GDHA 3BT7A 5GM2A 3O7WA 3UA3A 5KQRA 4PCLA 3P2KA 5EIWA 1RI4A 3FYCA 5E8RA 2C7QA 1N2XA 2P3QA 3F4KA 3LCCA 5DX1A 3UJ8A 4DKJA 3FUUA 4RTKA 1I9GA 1D2GA 2ZIGA 1ORHA 1AQIA 3G5LA 5LQCA 3DXZA 4RV9A 4QPNA 1UFKA 3QOWA 3VC2A 3A27A 3GO4A 3DXYA 5FADA 3C6MA 3RIEA 2NXCA 2PT6A 5EOVA 3EVDA 5JUWA 2ZWVA 3ER9A 2ZBRA 3EEYA 3PVCA 4HGYA 2AOXA 4RSRA 4Z2YA 4GUAA 4FR0A 2I7CA 3GRZA 3M6WA 1V39A 4GQBA 1L9KA 4P7GA 2B3TA 3TLJA 1MHTA 2I9KA 1G8AA 4B17A 3GNLA 1L1EA 4M37A 3FUXA 2GS9A 4P7FA 3UJCA 3Q87B 2R3SA 4ER0A 1N7JA 2OPBA 5EHIA 3B7PA 3G8AA 3U81A 7MHTA 1XDUA 2UYOA 4V0QA 4PIMA 1INLA 4YV0A 3KPJA 5K05A 4QPPA 2C7RA 3EMDA 2ZZKA 5KYGA 2XYQA 1UWVA 5EZQA 3B89A 3FRIA 9MHTA 1VPTA 4F84A 3HVHA 3L8DA 4BLWA 4X63A 5CVDA 5E1BA 5IH3A 3T0IA 4AX8A 5F2OA 2ADMA 4FT2A 3FPGA 1F3LA 3OZRA 1HMYA 4MIKA 1JG1A 4PYOA 5H02A 2NP7A 3LCVB 2FHPA 5LQJA 4PINA 3PFHA 3FYDA 5T64A 5FWDA 1R6AA 3A7DA 4E2XA 2O07A 1R8YA 2YR0A 4YUYA 2IH2A 2OBFA 5E8JA 3AXSA 3G5TA 4E2WA 4CTKA 2GB4A 4DM3A 2PXXA 1VBFA 2NYUA 4HSGA 4ZTBA 3UJ7A 3P9NA 1YF3A 2A14A 3G2MA 3KQWA 2Q41A 4FS8A 1JG4A 1EAMA 3LPMA 4RVHA 3E05A 5DLYA 2PV0A 3KR9A 3MTIA 4RX1A 4GOLD 3C0KA 5EQJB 2PBFA 3P2EA 2ZBPA 1X1DA 1KYZA 3HCDA 2PGXA 2ZIFA 5EVJA 1TW3A 2EX4A 1ZGJA 3GJYA 1R8XA 3TR6A 2AOVA 4ER3A 3P97A 2XBMA 1G60A 3FPFA
chains in the Genus database with same CATH superfamily
4KPUB 4RHYA 3VTAA 2O2IA 4QXRA 3A9VA 3WLQA 4D4GA 1QONA 5FTWA 1OFTA 3UHAA 2J9GA 4FKMA 1R5NA 4L02A 4ENVA 1UUFA 3HB5X 3KV1A 5IDYA 3J81A 2FDCA 3NM4A 2XADA 1DJPA 2B94A 4GM1A 3QPDA 4YWJA 3TAUA 2JK1A 2PFSA 3CLRC 4BNYA 2ZAGA 3HCEA 3GRYA 4MNTA 1Q0TA 3KJIA 4GI1A 1NNUA 1A82A 1TLLA 2FQXA 4I5DA 4P36A 4EH1A 1JI0A 1JKJB 1OV6A 3FLMA 4IQ8A 3I32A 3LO8A 1MT0A 5H70A 3UZUA 3PQ4A 2J9FA 4PRZA 1O08A 2H4FA 2PMDA 1H1TA 3E61A 4LCBA 5AJTA 3HP7A 4R6WA 3W77A 4AD8A 1KJYA 2DQYA 1KPHA 3FTNA 4YJ2A 3DZFA 1V4NA 1LDMA 2FJUA 2PX3A 3KC2A 5CYPA 4QT4A 5EZ6B 5AVXA 4B45A 2ID4A 2X0RA 1HDRA 2BN4A 3AQ4A 3IOMA 4PSCA 3KCQA 1F51E 1Y82A 4Y2RA 4H2DA 3OE7D 5AYVA 1ZHOA 4DREA 1WAMA 2B1IA 1XTPA 3P5BA 2WMYA 4AY2A 2Q07A 3DE6X 1OAAA 4RGQA 1FDWA 3QFCA 3LT5A 1CF4A 1WUKS 3KJXA 4OBEA 3K70B 1CD5A 4B32A 5LPNA 1DU4A 1SC1A 1T3ZA 1BX0A 1Q17A 2JIZA 2AN5A 1YJQA 4BAUA 3GRAA 3OQBA 4X6XA 1TUBA 4JKOA 1H23A 1DBVO 3F1LA 5KJFA 2Q46A 3FOZA 1E5VA 3ACBA 3KR0A 3OY7A 5JXIA 4LXIA 1JQEA 2XWBF 3CPSA 1FEZA 3D6HA 3H18A 1JL3A 2VNIA 3PPVA 4Q5IA 2ZJ6A 3EVBA 3K2EA 5JZ9A 1E2UA 1UT8A 1QVWA 3OHPA 4DQDA 1KJJA 4QDZA 4DLBA 1IPFA 2YYZA 5G0SA 1RI3A 1OIVA 4QUIA 4RWEA 5A7GA 2HA2A 4MQ5A 4DF3A 4MGHA 3PDJA 4L8GA 1T3GA 3IR7A 5KTNA 1QHYA 2BFMA 2CVHA 1G38A 5SYAA 1ONPA 1QH9A 3NX4A 1FL9A 4PU0A 4TWRA 3S2IA 4ALJA 3HV2A 1NJSA 4H9GA 3OM0A 3T7SA 2FCRA 2EERA 1QOQB 2JFGA 3TLZA 2C7OA 4BMPB 4YVFA 4BMSA 3VZCA 1LI4A 4UW9A 5EJ7A 2UZAA 3KQKA 2JKVA 4HN9A 4PPQA 4KOEC 4US2R 4J0GA 5TMEA 1HTBA 1HWYA 2XSZA 4M8LA 3AEUA 3PUYA 1JWAB 2A1TS 4C7MA 1R1DA 1F2UB 1I10A 3GRKA 5D7BA 2QMQA 5AVKA 3ZCUA 1O97D 3MJDA 4KG7A 1I6WA 5CD1A 5CB4A 3AI7A 3T1QA 1Y98A 3H7IA 3N3BC 4G5GA 5AVQA 1PHPA 2AA3A 2C00A 2ZRCA 3AB3A 1LQ2A 2WYWA 4R1OA 2VDOB 3MW8A 4BL5A 1KMCA 2D5AA 2ZS7A 3OIYA 1IY8A 1TCBA 1OASA 3BTVA 3GGSA 3B8HA 2RGEA 4KH1A 2NU6A 3VU9A 1R4MB 5LLSA 1PLJA 4JL8A 4AQDA 3D3JA 4QYMA 4Q9AA 4DRZA 1PTJA 3TGPA 5CB0A 2AC2A 5K51A 1TU0A 2WTUA 5FOWA 3QVJA 5GIOE 3KXLA 1QP8A 3NZEA 3WRWA 3WGUA 1A7AA 5IKXA 1C0KA 2EL7A 5C1OA 4U0KA 5L95A 1DAMA 1XKTA 4LZPA 3IAUA 4CG2A 2WKRA 2BSQA 1ENPA 1Z12A 2ZI6A 3BA1A 1NXQA 4D4MA 1MORA 3GXOA 4HN4B 1B2LA 1Q1EA 4JLOA 1UC4B 3DTYA 4Z86A 2QVXX 1DRWA 1R0YA 2GZ3A 5E2AA 3EEOA 3I5XA 1YR2A 2FFQA 4WPGA 1H2YA 2XMBA 5D87A 2A7XA 1WZUA 4FHDA 2RD2A 1N25A 1DB3A 3WV4A 1FJ2A 3C8UA 4M0EA 1GQQA 3I76A 1KORA 4JZKA 3ZXIA 2AVDA 4FFVA 2IZZA 1GPMA 3ROXA 4CCYA 5ILOA 4DR7B 3B70A 1ZH2A 2BCGY 3QVOA 3L6RA 1H5UA 1RKBA 2NN3C 2BMVA 4IXWA 4Y6RA 5KX5A 3KPUA 3KZCA 1XBTA 2ZJ0A 5FA6A 5C9ZA 1W29A 1UZUA 4ZK2A 1K7YA 2C54A 1D2HA 3GAFA 5TVKA 3HVUA 3RTGA 2Z6AA 3FNIA 4CLEA 2CLKB 3W5BA 4WZZA 1GVNB 3BUSA 2HHJA 3L7CA 1DRKA 2QOEA 3EPHA 3JQ8A 1SKYB 3A3YA 1K0UA 5IFKA 5BSFA 2DWOA 4TRJA 1FDIA 4XJTA 1A9XB 3ZVLA 4C2BA 1Q1GA 2VP5A 4N65A 1DCKA 1Z0KA 3HJGA 4ZTZB 1PE0A 2Y66A 4ZJUA 4K1LA 5JS2A 1A2QA 2YXEA 2O0MA 3H5WA 1NUQA 5HJEA 4MP3A 4Y6GB 4C4YA 2HFKA 3SYMA 1A9XA 4H3VA 5G41A 3SDSA 1MEOA 5EJEA 2B25A 3EFEA 1TAUA 4QELA 3CCFA 4AKSA 3BGWA 4AF7A 3K2IA 3KQMA 1XF1A 2QUIA 4TVSA 4GLJA 4PZLA 1BO6A 1RZ3A 5JRDS 3W5HA 3CT4A 4CV1A 3LK7A 2UKDA 3QLJA 3CG0A 2QRKA 3M3HA 1ZZEA 1FP4B 1QO9A 4EF5A 4XJSA 1RPTA 1K8XB 2G36A 1D2EA 1Z8DA 4C08A 3PR2B 5JEEA 5H80A 1RAIA 3RW9A 1X94A 3P9ZA 2DR2A 5HYVA 4B76A 1U2QA 3C41J 1QFXA 2OESA 3IVGA 3M6MD 1XYVA 5JDIA 5KNLA 5IMBA 4FLMA 3L0CA 3ZLBA 1HZZC 4FBGA 5IKOA 4EITA 2HCTA 5KDDA 2AE2A 4PN7A 2GI4A 4V1CI 2V7QA 1OREA 2FYTA 2ZIVB 2YQZA 1K6XA 2BLLA 2YXBA 3E6AA 3L49A 3OD5A 1PN3A 2WTAA 5FF9A 1TM2A 4K3UA 1P19A 5JMWA 3TZ6A 2OZLB 5BSUA 4CRWB 4NCAA 1ZBDA 2Q3FA 3HR7A 5E9AA 1OX4B 1KQNA 4KACA 2PPVA 1V4VA 1TMGE 1U1CA 1YZVA 2RGDA 5CH5A 3TQSA 1TTHA 1GO2A 1UOEA 2AZDA 3AUFA 3FOWA 1RJDA 5C8YB 2JLVA 1Z3IX 4OBXA 1OY1A 1VB5A 4PN3A 1C8LA 4O4JA 4F6RA 1RD4A 5CB4F 1LLDA 3HLTA 2QN1A 4IV8A 4D9JA 5EEHA 1JIQA 1VE3A 4P2BA 3N70A 3NJRA 4XSVA 2ZTLA 3RADC 4CM8A 5J5AA 4FFBA 4C5CA 4EFMA 2WG1A 3PV0A 3EE6A 4H6XA 4N49A 4NULA 4XUEA 5CNMA 1QUFA 3QRWA 1R10A 2BKAA 4AMYA 1A8HA 1RWWA 1SN7A 4HNGA 4IIBA 3NHZA 2EZUA 3C3EA 4RLFA 3BWEA 2XXBA 3AEKB 1M75A 4XGIA 3VDRA 2PU7A 4AM8A 4B3HA 2QUHA 2F3QA 3BWCA 5DNVA 1V11B 3QFHA 3WNVA 4AIRA 3BWYA 5EMJA 5T57A 4Q05A 5K0SA 4QYIB 2GCOB 4JOSA 3VXKA 3HVKA 1JQAA 4QYWA 3RROA 3ZCQA 4EG5A 3R40A 3ZJ5A 1N6OA 1ZINA 4P93A 3OTOB 5IJ0A 3L0DA 2C97A 5J2TA 3BGIA 1YTUA 4F9EA 1EFTA 1EWKA 1UBEA 2B6HA 3IDAA 2BFDA 2JNWA 3AHGA 4QDJA 4XPIB 3UG7A 1EB9A 1N1GA 1U7UA 1YNOA 1ZEJA 3A9RA 4ZOLB 2X41A 1MQ8B 2AOTB 5H1YA 2F55A 1R6UA 4I50F 1JDPA 3I6MA 3DP7A 2J85A 3LKVA 3Q3GE 4G5RA 2G72A 1QRAA 4ZV4A 1GPNA 5BQ5A 2G5GX 2I78A 1CULC 1BEEA 2JEYA 2XDWA 4WOBA 1H22A 1UH5A 2F2TA 3D8SA 5DHPA 4OIFA 1Q7EA 2O0KA 4FD2A 5GVRA 2VUIB 2CLCX 4YHBA 4K9SA 4BTLA 2HL6A 4RVSA 3GROA 1E6MA 1GUDA 2VP6A 4UATA 3HBLA 4LKOA 4GQAA 2WVJA 2QMHA 3BB4A 4W4TA 4FMCF 1VJCA 1Z47A 2ECOA 4ZV7A 3GBSA 1E3WB 3DBLA 2D7JA 1B8UA 1MJFA 4LRXA 3DZHA 3ZC3A 2QRVA 3AWIA 4EUHA 5J1SB 2JLAA 1JSCA 2QTNA 4M1MA 4KR7A 5K3OA 4CL0A 3DMFA 3F5FA 2EC5A 5BOSA 5A5DA 1WP9A 3RGWS 1UEIA 1RKVA 1DVRA 2QTBA 1EAYA 1UXOA 4W8OA 3ONEA 5CNKA 3J7TA 4B4KA 2MSWA 4AAYA 2A0YA 2QPAA 4K40A 5JU6A 1T8UA 1VIVA 2M98A 2ZJZA 1OT3A 3FFAA 1RQ7A 3L8YA 3MTEA 3QE2A 1UBMS 3LWNA 4N1AA 3VR2D 4LFBB 1VE9A 2EJCA 5FL7A 4N6OA 4ZZ0A 4UPDA 1I36A 1Z7GA 3K7EA 3GOHA 5LQSA 4C04A 5F4ZA 3MTQA 3PQ7A 3T41A 4Y0NA 4CKYA 4OQQA 1V9SA 4IMJB 3BE8A 2AV6A 2OHVA 3LECA 3IH5A 4R2JA 3BRSA 5FLXA 1IRIA 3ELYA 1UWLA 1L3CA 2QNRA 3KAKA 5HIMA 5L7YA 3W8EA 4A0QA 1TGYA 621PA 3BCUA 3VPGA 4JLKA 2X7HA 1E2LA 2I54A 3R9KA 2Q2VA 4RANA 4OGGA 4EY3A 1KXJA 4D92A 1QCDA 4TGLA 2YOHA 1ITZA 5TQVA 3WZLA 4E30A 4WACA 5IYZA 3D54D 1B0ZA 1SVUA 2W9XA 3DOOA 4BLOA 4CLOA 3K9QO 5HK8A 4KSBA 3GELA 4Y6PA 1ZU5A 3LPLA 5J4KA 2YNMC 2QXTA 3FX2A 3I3SR 3NBZC 3DZDA 3ZWBA 4BNLA 2V6GA 5JYDA 5LQUA 3HMQA 1NUAA 1Z3CA 1C3JA 2R86A 4U7PB 4B4WA 2H1OA 2GBPA 4JYAB 4NCKA 3AUSA 3FVTA 3OT1A 1X3SA 1NL3A 5DLEA 2ILTA 2XR1A 4ZP1A 3RKUA 3ZU4A 4BO0A 1C7QA 1OZGA 2SICE 3RS7A 2Z5VA 3PQ8A 4F2WA 1UPAA 2ZRLA 1NBMA 1US8B 1Z4QA 4OHMA 1Z25A 4LCJA 3DAFA 3KT3A 5E2BA 1TCCA 2GRUA 1XYYA 3EDYA 3X2SA 1IAVA 4MUGA 4MHTA 2H3EA 1WEKA 1WF3A 2HDHA 3D6FA 3AP2A 3CO0S 4UMDA 1NG9A 2LR0A 5E7JA 4X85A 5DCUA 2RGCA 4NYMR 3FM9A 5IXJA 1JEAA 2HUNA 3HK2A 5JJIA 3ZDCA 5C46F 4A1FA 2G4CA 4IKEA 1M34A 5BMVF 4L8WB 3A4NA 3VI3B 1HLGA 1FZTA 3G0GA 1EFDN 2R5WA 2CNDA 1ODFA 1LX6A 4RA9B 4GD3Q 1YQXA 3WDKA 3MMSA 4F60A 3OUUA 1G5FA 2YNMA 1D1PA 4REQB 5ALRA 2AB0A 3FHTA 3P2KA 3FDZB 4QWMA 3DZIA 5EIWA 3FPBA 3GG2A 2GBIA 1NF2A 3QVUA 3R3UA 1MB3A 4Q37A 4QQFA 3V2HA 3FUUA 3ZK8A 1B0PA 2JFUA 4LY3A 4YO7A 3U44B 3ZW8A 1YD7A 4NE7A 4RV9A 4O33A 2QIPA 2J59A 3H7AA 2ADFA 1MOSA 1PDOA 1NTRA 2NT4A 4D79A 3OLYA 4QM6A 4GIBA 5H83A 4EI2A 5BYKA 2V7GA 2HHHB 1JA9A 3IDFA 4C4ZA 3JZFA 3WI7A 1RFLA 2BFEB 1UJ4A 5F12A 3KTDA 4F3TA 5THQA 3E9RA 2AJLI 2OKGA 3F6YA 4OI2A 3U17A 1OB2A 3UAVA 1D07A 1XDDA 3H1PA 3T5MA 2PKQO 4GT1A 4C9BA 3UWMA 4LSWA 3AW8A 3HFJA 4EHNA 2Z58A 1ZI8A 4MA0A 3IE1A 2WAMA 2BEWA 2VWQA 2XHEA 3R3ZA 4M86A 1TKAA 5CFPA 1U3FA 3DGFC 2ZZKA 1PJ3A 1UJBA 3HYLA 1G8JA 3MTBA 4EW6A 3EC7A 2X23A 5EJMA 1IATA 3TFQA 4BLWA 4X63A 5CVDA 4QJ4A 4NBRA 2YZGA 1M6VA 3NNDA 5F2OA 4UM9D 3JQ7B 1QTQA 4RV5A 2IHJA 4DDKA 4ECEA 3IBGA 4II7A 2XTZA 4KFRA 1L4MA 1CV2A 2H31A 3VR6A 1X87A 4PR3A 2D06A 4RPIA 1VGQA 3SLKA 1XNRB 1SC9A 4ZPXA 4R8MA 2IH2A 1JG6A 5E8JA 2PS1A 5LMUB 3R5JA 4OHKA 1FNMA 3OHMA 2DPXA 4ZTBA 5GOTA 3SJAA 4BIIA 3DZBA 1H85A 1TQ2A 3FMFA 3G68A 3K0AA 4KR0A 4XYBA 1VBKA 1JQKA 1QF6A 1QMGA 1EP1B 4UCQA 2ODQA 3DNPA 4F97A 5DN6D 4ENRA 1V6SA 1F6BA 1QHIA 4DC0A 5JZBA 1XCPA 3ABQB 4OHUA 2Q4OA 1S9DA 2V97A 1DMSA 1YIDA 2WPNA 2L17A 4JJFA 4HNTA 3ZGNA 1V1RA 4Q7JB 1NU8A 2WR8A 2A1UA 3PJDA 3DW1X 4N54A 4FE4A 1MQ9A 4K81B 2H2GA 1H8HA 1S8AA 1QR6A 1Y6QA 1NE7A 2UDPA 1LRLA 3QE4A 3QLTA 4XQ9A 5LKRA 1EXNA 1ZI6A 1A9RA 3NR2A 1L2TA 1G59A 1GV0A 4E4TA 1WD7A 4OQ4A 1C1DB 3K9BA 3N28A 2H0QA 5UKDA 2PNJA 1KTIA 3SCZA 3O4FA 1W8DA 2PD3A 3T7TA 2GN4A 1DLIA 1UDXA 1W8IA 2XF2A 2HEIA 3TH5A 5KMGA 5EJ4A 1W75A 3PQFA 4MVJG 3WWCA 4CDNA 1K7EB 1VHWA 4WMLA 3QX8A 1XB2A 2Z8ZA 3VR3D 2IOFK 3FE2A 4O08A 5IUNC 1L3IA 5J2UF 1P3JA 4X54A 2YOFA 1ENYA 4AMZA 2YXDA 1IWOA 1QF7A 3IKLA 3VC7A 1BH2A 2XZTA 2HYIC 4B3RB 1NJ6A 1R0KA 2D74A 3OOHA 4GSLA 2AMYA 3KTAB 4KAJA 5KVVA 5D00A 2LCFA 4KXLA 2SCUB 3OA2A 1QF9A 2ZREA 4HWKA 2AXQA 5C2JB 2F8LA 1NW3A 4JSRA 4EBFA 4FZVA 4ZZIA 2OV3A 3DOUA 3PHHA 4BDSA 3M1AA 3V4FA 3O9ZA 5AVSA 2Z43A 1FFXA 3NHFA 5BR1A 2R9VA 1CUSA 5FHQA 3A3KA 4OP1A 2UVDA 1EWQA 3KD2A 5CP8A 2GCOA 3IT0A 1C9DB 1N2EA 2BDUA 2PGIA 3EQ6A 3WO0A 5FV7A 4WN9B 4PNZA 4YJFB 2QX6A 2CVZA 1RQXA 3CPEA 3KFLA 4K7JA 5JSKA 3WL7A 1EK0A 4OHBA 5CXUA 2PUCA 4FI3F 5JOQA 3CXRA 3CUEF 7YASA 1MGOA 1GNQA 5CGQB 1N6RA 1SG0A 3HJUA 5ALTA 3C1TA 2D54A 3IO5A 1CDEA 2P2YA 5ALOA 3AC0A 5EIBC 5L3VA 4MV4A 3ZGVA 1ZH4A 2JG3A 1Z6XA 3DD1A 3B1JA 5D3QA 4DIUA 1UDCA 1FJXA 2WD7B 3WJ2A 5LC1A 4AS2A 5K4HA 5LOVF 2PGJA 4MKIA 1Y8ZA 4EB3A 1KI9A 4QG3A 3UF0A 5LQAA 4Z54A 5A4MS 2VSFA 1NVFA 3F6SA 3LPDA 4AYXA 2DHEA 1UJ6A 3R23A 4O25A 1YQQA 3C6XA 4CM9D 1FMFA 1RRKA 4EF4A 2PK3A 1PT8A 1U1FA 3LIIA 1OHHD 4ER7A 1XVLA 5AXDA 3ML1A 5SY9A 4D42A 1T6ZA 1XIVA 2Y1WA 3NAZA 3TBFA 5BORA 5B2ZA 2LDBA 3BRWD 3W9SA 4B4VA 1GA4A 1YB6A 4F1KA 3CLTD 2GM4A 3PC7A 5K0BA 1E5LA 1TF2A 5I7VA 2DP4E 4Q1DA 5C4GB 3DOJA 1XX6A 3IEVA 1CUIA 4A26A 1C2TA 1P62B 1CB0A 3D5QA 3P9RA 5C7IO 2RHLA 1SULA 4MJLA 4YEDA 2IYLD 3AZPA 1QDEA 2V6FA 2CXQA 1DT5A 3GNTA 3GPIA 3GJXC 5K0FA 2YWGA 3THRA 3M3PA 4BP3A 1ZOSA 2ACKA 2Q0SA 3IKTA 1QOZA 4PXAA 4RJLA 1JSZA 1NI4B 3H5LA 4ZODA 4C0JA 5BPHA 4C4OA 2JLUA 3RYHB 3A2NA 2CYBA 3VO2A 5F78A 1A5AB 3UICA 1NVAA 3B12A 4QTUB 721PA 1RYMA 2X2OA 3FTPA 4NH4A 3DV0A 3RDPA 1WXDA 1C0IA 3JASA 4JP3A 4WK6A 3X1WA 2QS9A 1EDZA 2C7PA 1CR4A 3PEVA 3H1BA 3ORFA 4IRXA 2NXJA 5ALIA 1BWSA 2V59A 1CJUC 4YPOA 4E70A 4BB0A 5MGNA 1A4UA 5CEEA 5ER6A 4YP0A 1EFHA 4W9NC 4A2CA 1YOVB 4P6VF 4ZGBA 4MAAA 2HOQA 2O23A 5EYPB 1CPYA 4R9SA 4PQRA 2H2HA 2ZYVX 5B58T 2GZSA 3CZMA 3JWEA 3W5CA 4XCVA 3HCCA 2LW7A 2XIJA 2R8EA 4BMZA 4Q6BA 2PKCA 4QO7A 4QASA 3SM9A 5D2CA 1VP9A 5I4IA 2NTEA 3EPRA 4JKIA 4KIJA 3EWIA 3N39C 4Q01A 1I32A 5LVAA 1HE5A 3E4DA 4P3KA 2WJ3A 4E07A 4NDZA 1EDDA 4YQZA 4F8EA 3QMPA 3D2CA 2V1XA 1FFEA 1UBCA 4IOJA 1T3SA 3LC7O 4F5DA 4GEKA 3PFKA 1P73A 1PJCA 1NN0A 4ZZ1A 5IAKA 3WGJA 1H4SA 1YRHA 5KOJB 5D6NA 3NWOA 5EC8A 5CX1A 2XUDA 3X0DA 4DT1A 4ZYYA 4DWOA 3K16A 1QQ5A 3ZKWB 5EUQB 4DMKA 3A9TA 4EW2A 2NPFA 3OLCX 1AS2A 2CUTA 2FSVC 3IVMA 4NR0A 5YASA 1JH8A 1PR6A 5K8IA 1WNFA 3SEQA 2PLAA 4IDEA 1NMXA 1QZXA 3PA6A 3FKSA 1ODSA 2FETA 3RIHA 4YJDA 2CCJA 5CCDA 3TSCA 3USZA 4KQ6A 2O5RA 4XE5A 1U80A 4O63O 4L8FA 2XUQA 4UE3S 4B6FA 3PQDA 3FTDA 5BMVB 3GLIB 1UMDA 2IHVA 3P2YA 2QM8A 1B2RA 3X2EA 2WIBA 2W58A 3I28A 3CBGA 1HZJA 5DULA 1EJBA 4W1RA 4K9NA 3WYGA 1QP7A 2AGVA 2X77A 3CSSA 5L53A 4AKHA 1E1CB 2ONJA 2PWYA 2IXGA 1Q22A 2VRNA 2C9OA 1YOBA 2W2NA 2WHYA 2VDWA 3TLYA 4CKXA 4F2DA 1JKMA 1FPMA 2FMFA 1NRWA 1SCNE 3UH0A 3VSEA 1MUUA 2QTAA 2WTEA 2YZNA 3JX9A 3TAXA 2BF7A 1JU9A 1ZJ6A 2IDKA 2YVLA 3LY5A 3QUTA 4LV5B 4IQGA 1V26A 4RDCA 4AURA 2HO5A 4BVLA 1V41E 2IE0A 3NHJA 1MNAA 2D00A 2WUVA 4DV3B 1F2UA 4KUGA 1LS1A 4LX8A 2H3HA 1L7DA 1N5JA 3T12A 3X1DA 4HPWA 4MRAA 3UBMA 2I7XA 1G3MA 3IAS1 3UK7A 3VDQA 4N5DA 4PC6A 3DZJA 2IKSA 2Y1EA 3CN9A 3L8HA 4OCZA 3ON5A 1NQUA 4HLDA 4DUGA 1TMKA 2R25B 2FAXA 1Y9JA 2YMMA 3B78A 2XXAA 4R40A 2ODBA 1GNPA 1L4YA 1A88A 4KXWA 3GBPA 2RSLA 5EWLA 1OXXK 1KC1A 4D8WA 1NX6A 4YJGA 5L7WA 2HSJA 1SUIA 3C3WA 2G08A 1V7CA 3OO1A 5AW4A 2XUIA 2NX2A 1WKCA 2Q28A 1Y0BA 1RC8A 1SB9A 1H0HA 2IBMA 5J5CA 1GQSA 3P0FA 3LQYA 3R3HA 1B26A 4INZA 3KUUA 1Y63A 2EP8A 3FIJA 5FA8A 3ZY3A 5BO5A 3JYHA 3ZDQA 4RSMA 1SK8A 3ZCSA 2JLXA 3CEMA 1L4BA 1CJBA 1X15A 2A9VA 2P8JA 3DLIA 3UWKA 1HFJA 1VG1A 4JBLA 2CE7A 3WV5A 1BKDR 1P0IA 1VA5A 1DFGA 2DERA 3MXOA 1KEEB 2WLTA 3A36A 1IRXA 1P4HA 3GD5A 1BAPA 1QCCA 4BUJA 1KO7A 2DFTA 2NNWB 2XUPA 3FPHA 1XGKA 1T6YA 3TN7A 5B3KA 3EASA 4DJ5X 4GOND 2VF5X 4G4GA 4H35A 2D5BA 2R751 2IQ5A 4JELA 3ZGLA 3V8VA 4HAYA 3GIWA 4CDRA 2YXNA 1XQVA 3A6EA 3UAXA 4Z9FA 1KOGA 4NDNE 2MR6A 5BW6B 3DVLA 3AY7A 4MVYA 1DO0A 3KQYA 5BSEA 5DP2A 1JWBB 1X14A 1E1MA 3ADDA 1HETA 1O96B 1YCDA 1JQDA 1CB7A 1SCUA 1AE1A 1DAGA 4FKZA 4GI5A 4IOLA 1MQAA 4X9XA 1XQWA 3SSAA 2V96A 4INJA 3UWSA 3ZNOA 1S89A 1E1KA 4E15A 1W36B 4N9WA 4CM3A 1PW7A 2FF7A 2E4WA 3QXXA 4TTAA 4KZPA 3UHFA 3GT0A 3HNPA 4LPKA 4UNQA 5DBHX 5E3IA 4KK3A 5A05A 1CZUA 3VMMA 2X6TA 3LRXA 4UOEA 4KKXB 4DDWA 4O2BB 3USES 4BVGA 4KIFA 3ZY5A 3RB8A 4NE2A 1Z7YA 1AOXA 2RHRA 4HGRA 3R74A 3NONA 4HVTA 2MSCB 1T13A 1U9IA 4TMWA 3UJDA 4CLRA 4I1PA 3LY9A 5TT1A 4NPAA 1USIA 1GNVA 1KZ4A 4FCVA 4G1UC 1SUDA 4PAGA 3VUEA 4GW3A 3LPAA 4HPJB 4D46A 3T9BA 5I3CA 4PTLA 2G71A 4FCTA 4DXHA 2C03A 4N7JA 5IWCA 1NIPA 3MJFA 3D0OA 2M9MA 1EGMB 3IP3A 2XMQA 3CPJB 2EQBA 5EINA 5DX8A 2B8NA 4Z99A 2WU1A 2R7MA 3GYGA 1G20E 1LSJA 2C95A 3MOIA 4L3OA 2PT7A 4QARA 3HUDA 4Z8XA 2P9QA 1GU7A 1XTSA 2O2GA 2OXRA 5L3RA 1FNNA 3PGLA 1SQ6A 4OQDA 3PDUA 2PQ2A 2ZVQX 2G4LA 3D59A 10MHA 2Q3HA 1JHVA 2WIGA 3K0HA 3A1UA 1BOOA 4RY0A 4JVMA 2ZCJA 4B09A 4I8IA 4EA9A 1F2VA 1KVRA 1XXLA 2E4VA 3EMKA 2HRQA 2JJ2D 3C7AA 4JEUA 5C18A 1LBHA 2JFZA 2ZM5A 1GCIA 2CXSA 5CIWA 5HZHA 4JP1A 4D45A 4I3GA 1Z82A 3IDSA 3IP8A 3DQPA 3A04A 2VJYA 3LUGA 3LQ1A 1CKEA 4AWXA 1QTIA 1SJ9A 3GUCA 3SLRA 5MN4A 4AC9A 1F8YA 1CEYA 4K0KB 3TIXB 4JI3B 3F7NA 2OCYC 4RCVA 3D6MA 2C8VA 2JFNA 1O58A 1SVNA 4FMDB 3OQNA 3VA7A 2JI4A 5I7WA 3EPKA 4AF6A 3ZBPA 3HBFA 1QK4A 4KK4A 1GZ6A 2BCJQ 2IV7A 4G97A 3DNMA 3M83A 4YRBA 1TKBA 3SC2A 1TK3A 5IEBA 2DWUA 2VPIA 4J2TA 5G0VA 3VQTA 1BHSA 2WUFA 3W5VA 2Y2VA 4JSYA 5I8PA 4DARA 1EQ2A 3U0BA 4D74A 2OAGA 4F4JA 3N3AC 4KXNA 3EVNA 2Q4RA 5HMMA 2GZ1A 1NUPA 1PJ8A 3F4LA 3I45A 4WLUA 2HD4A 3WTCA 2IYSA 2PWAA 2QMEA 2Z9BA 1AX9A 2VYVD 3CRQA 3M9LA 1XKXA 3EW9A 3PC2A 5C8YF 3VSAA 5GOZA 1BS9A 2Y0DA 3IKVA 1CZOA 4NENA 1COWA 2GZMA 1CUDA 3O8NA 1GYQA 5AI9A 2FZVA 4I5EA 3BIWA 4R0NA 1AUPA 1Y8QA 3KLPX 5D86A 3KOMA 3NTLA 4NV1A 4Y6OA 1WW8A 3LBIA 3GW8A 3JY6A 3B1XA 1KIMA 1X1EA 3OFVA 1OA1A 1XVUA 1TDJA 1CHNA 5J63A 3SLGA 3VH2A 1NY6A 2IYXA 4DTCA 3BXGA 5IPFA 2ZG6A 3Q3JB 1WPGA 3GUHA 4ZAXA 3IOBA 5IMSA 3R6LA 2GPTA 3OM8A 1OI7A 4IJ6A 4LXYA 4MA5A 4MUJA 4ETNA 2WJZB 5B2FA 3RV3A 3IUJA 1LBEA 4E03A 1V0JA 2OZKA 5IUKC 5A02A 2CFRA 1MFPA 4LZNA 1LPOA 4FYWA 4TSKA 4U6NA 3HYSA 2H7YA 4HNAB 4QD3A 3TSAA 3ZV7A 4D98A 3IDOA 4UTXA 3A1DA 3H9JA 4RY2A 5ELLA 4FI3C 3L7JA 1W1WA 1XLTC 3UMBA 4RF2A 1JFFB 2NZ2A 3OKAA 1UBNA 2FPIA 4CIWA 4EVRA 4QT0A 2QRLA 1ZSVA 3FUXA 4KV9A 4EHBA 1XPOA 3IA2A 3KWLA 2O8EB 1NJGA 4B6SA 2H59A 3BMOA 5K05A 2QQEA 4M4SA 1D1QA 1U04A 3RD5A 3ICVA 5IASA 1CJTC 2PKEA 3LC0A 2R84A 2XYQA 1PGPA 1FLDA 3MTJA 4LY9A 5KQLA 3K71B 2BV3A 4KFUA 9MHTA 5LB2A 3MLBA 2FEMA 5KWSA 3A14A 4NJEA 4R81A 1EM8B 1BCSA 3G82C 1CQZA 3OZRA 1KE2A 2PQ0A 1ZCBA 2HRBA 4L5CA 4EP1A 4HAOA 1THTA 2FHPA 2YJNA 1ZRHA 1HDCA 3AUUA 1FDRA 1JR3A 2Q1WA 3NHUA 4RZ2A 4Y1EA 4Z6KA 4YCSA 4D02A 5LYJA 1Y6GA 1Z4IA 3AVXA 2CDAA 3NNSA 2G80A 2E21A 2CDCA 3AOEA 4EY4A 1P4AA 3FCAA 2B98A 5AH0A 1U0EA 3AILA 2E5FA 4N6NA 6ADHA 3U62A 1RHRA 3LU1A 1M2KA 2ID9A 1I1OA 3LX5A 2RFLA 2XMPA 3FVQA 1HH4A 3N58A 4FOLA 3W8DA 5HFAA 1W0KA 1T2UA 2IYFA 1VCMA 5T6MA 4IMIB 4UEQA 4B4OA 4B48A 2ZB3A 3LJKA 1I6KA 5LYJF 2AI1A 1JR6A 1ZN2A 4WINA 1W4LA 1RJWA 2GD6A 5EWJA 3WL8A 2H1SA 1K7XB 1LJLA 5K9ZA 2DWQA 2CHUA 4TUYB 4GLOA 3COWA 1F0PA 1GGKA 3E0XA 1G60A 1EP9A 2FDRA 2F1HA 3I2KA 4OAQA 3I5AA 1PD0A 4LJKA 5REQB 4JI2B 1M8PA 2AG5A 5AW5A 1XEXB 3FPCA 4HQNA 3AF0A 1SG9A 1GNSA 2EGUA 3CYFA 4LC0A 2QLLA 3GEMA 2CSXA 1H2RS 1N0WA 3K0KA 3IKJA 3KKEA 4KXMA 4RABA 1Y9AA 2PCLA 2JCYA 3QNWA 2UYHA 1U1DA 3HN6A 3N5CA 3H4VA 3GFQA 5F4BA 4KWTA 3EXG1 4C01A 3HYRA 3HKCB 3IAAA 3OPYA 1G9SA 3CGWA 3DVSX 3HACA 4IEFB 1PX0A 4RADA 4AF8A 4YYZA 1D4FA 2AFRA 4CM4B 5AM0A 1QZ3A 4ZXPA 1J9GA 1GLNA 1UXIA 2HNBA 3G3EA 4MUBA 1E3DA 1WHSB 3RO7A 2FFBA 2J0EA 2GTIA 2WFZA 4DMGA 3OIGA 3ZWMA 2QTVB 1Z56C 3PHLA 4RPGA 5DKFA 5TGZA 5IX8A 2HMVA 3R5HA 4NBNA 1DRVA 2W4IA 4UXJA 2CJFA 5TLSA 2B9EA 5DGIA 2IYYA 4KR3A 1E79A 5AQ1A 1QHNA 2VPYA 4ETIA 4YUVA 2QORA 2VF7A 3K6RA 1MB2A 3U3JA 4NNJA 4N40A 1DAHA 4MITA 1ID1A 2BKEA 3ZKWA 4BQQA 2YV4A 4IQ4A 1EFCA 2ABWA 3LCUA 3OZEA 2B8WA 4XDGA 1P91A 1RP1A 3H0KA 4AJ4A 1CF2O 1DG1G 1AQYA 3GOQA 3TAHA 2HH9A 2C84A 4X90A 1YL5A 2OB1A 2YQ4A 3IXMA 4UARA 5TC4A 3X1JA 5HM6A 5DNEA 4BLQA 1TM7E 2CNLA 2NUAA 4FYKA 5DI3A 4DG8A 2GHTA 2Y1KA 3N53A 2A67A 5ADWA 1U0BB 5C80A 1T1EA 3FPAA 3FFTA 3OQHA 4EQ6A 3KVYA 2PPLA 1IMJA 2VVTA 4DV6B 5EE1A 1OXMA 2DBZA 2PIDA 3RVKA 4QKQA 4MKRA 1UIRA 5SZIA 2H5JA 2FPRA 5G53C 2H8GA 2JEZA 2PY6A 4ESOA 1NM5C 6AT1A 4I3HA 3HE3A 1SC3A 4Y6LA 1JDTA 4DNQA 3R7NA 1FFGA 3RJ9A 2ZM6B 5ITSA 2AIRA 1WDKA 1XU7A 1HTTA 1NBIA 4CU2A 2B1JA 5C81A 4TPKA 4F0JA 1ZN9A 3PNOA 2BL4A 1A98A 3O8QB 2N3ZA 1JRLA 3DCIA 3EB9A 1F38A 4OREX 3VZBA 3MMXA 3NVMB 1Q11A 4GL4A 5F7ZA 2HHCA 2VCEA 5KYKA 5BV8A 1H66A 4H7FA 4I9HA 3TQFA 1HKHA 4Y2JA 2ISSD 2P3OA 5HCIA 5A5VA 1M8JA 2F9FA 2Q1XA 3C7TA 4Q48A 4EECA 1EGHA 4EWLA 1Q0HA 1UBOS 2PR2A 2RK6A 5U4QA 1QTNA 1UDWA 1UBTS 1V9CA 2JAHA 3GVHA 5HM8A 2FPPB 2WJAA 1SOAA 2PL9A 4QEKA 1ZC3A 3FCEA 1N2BA 4CCYB 3I1IA 4DOMA 2GXAA 1DXOA 3GGOA 3GEGA 1H2XA 2VJPA 3OBBA 4KQHA 2VF8A 3NYIA 4N8EA 5JXWA 3J7AC 3EH2A 2IV3A 4IHAA 3AUAA 2A86A 2MT9A 5FLYA 3WLTA 2ZDGA 3NTUA 1AKMA 2PUWA 3EEQA 4XYMA 2EW2A 3O93A 3W2TA 3FCUB 4ANFA 5B2EA 3L92A 1IHPA 3OESA 3EX7C 1TYEB 1ZA1A 4YIHA 2I6FA 1NI3A 4PM4A 2I8CA 3KOWA 2GBLA 3LHFA 5J2UB 4BHTA 1YKSA 1OYYA 2Q5OA 4REOA 3C4VA 2P40A 3Q0TA 4YP9A 2GR9A 1RZUA 1K8ZB 2XA9A 1EWRA 3B5JA 3HUFA 4MVWA 4ZA2A 3T3PB 5EHZA 3H3JA 3M81A 5KQSA 3BL8A 3EZGA 2I4RA 5EPOA 3SQOA 7REQB 3HPRA 5JARA 1SOVA 1QZTA 3ED5A 3S55A 4QJ5A 3IBCA 3KVVA 3R3YA 1E2EA 1UMDB 4L0CA 5KTOA 3GLIA 3ECSA 2H00A 3P8ZA 5FO1A 1TO1E 4DM7A 4XVCA 3PNLA 3RJTA 5GTDA 2PGDA 2PZAA 5G3ZA 3V8PA 1ZD9A 4BX0A 2C5AA 2Z2JA 1ZVQA 3FWPA 3WGHA 4DW8A 4ZJZA 5LMCA 3ZI4A 2RH5A 2D6FA 1N7GA 4PO1A 2PKQP 3ZOKA 4AQYB 1GQRA 1GXSB 1ISHA 1BQEA 2ZETA 2BTQA 1KSHA 1RAEA 3R5XA 3UXHA 2F00A 1BJTA 2FLKA 2VHTA 4GX5A 1KERA 1LV7A 4KKVA 1NPDA 4Z1MA 5C3UA 3EWNA 1R0ZA 4OK3A 3EUEA 2UUAB 2VQSA 4UE6A 4RK6A 2HBRA 4RQBA 5L6MB 5BN5B 4MP6A 3OOJA 4OLHA 4TLDA 3GDFA 2DR0A 2H07A 3LQ2A 4ND7A 4NK4A 4GZLA 2YHBA 4F6CA 4IZOA 3WL6A 2VP0A 3D43A 5BSVA 4BIMA 1AK1A 3QXJA 4ZV9A 1TJPB 1D9ZA 1WIWA 2Y9MB 1T6BY 4WJZA 2PLNA 3HCBA 2HK7A 4X92A 4DILA 3ZS9A 5K03A 1MAAA 4J4TA 6REQB 4P54A 1QU3A 4D4LA 1ZQ1A 3NUGA 1ABBA 2DPYA 4PO3X 1U28C 3HYNA 2H7CA 2NQTA 5TR9A 5LWHA 1YUMA 4UCFA 4UJ5A 3F67A 1SXJC 2QVCA 3S70A 3JVIA 2LZ0A 4M8IA 3RYIA 3VV2A 4C21A 4KIWA 2DKNA 2IC5A 5KYXB 5LU9A 4HYEA 1ZGBA 4LRUA 2J0QA 5KYWA 4F9FA 4Z4HA 1LC3A 3ZZNA 5DU2A 3OOYA 3WHIA 3GEDA 5ALZA 1XVIA 4AXBA 4BQRA 2WDZA 1JVSA 1NP6A 1QYVA 3RI3A 1PNVA 4N47A 3WK5A 1SVLA 1TK9A 2HHLA 3BFJA 3RAPR 1UPTA 5DTMA 1AMUA 1F7UA 1RWNA 2Y1LA 4TN5A 4KEAA 1NYRA 4TXHA 5AJHA 3VFDA 1W85B 4WV3A 1TYZA 1BKSB 2ZIAA 1YRQA 1GT6A 3L0BA 2GN1A 3JR3A 4QOHA 4DC9A 4L5BA 4YCMA 3OQPA 1VLQA 6CHYA 3NBAA 5BSRA 3KQPA 5BW4A 4HPXB 1L5SA 2FPPA 3BX1A 3I9FA 4DYHA 1LPNA 1VB3A 3A0UA 3BFXA 4G4SP 4YMHA 3DTVD 5T4FA 5G2OA 4A16A 4IYRA 4URUR 2BEUA 2RH4A 3DDZX 4J6EA 3OEHA 3TB6A 4AN4A 2IIQA 3DMGA 3DUWA 2IXBA 1QUEA 4LJ5A 3NU1A 5H5JA 2DAPA 4HJXA 4WH0A 5K20A 1Y48E 4BO3A 4X84A 4RTOA 1XVTA 1LBSA 1Z26A 3ZD6A 3HA3A 4HEQA 5AXAA 2Q7XA 2FSVA 2FW0A 4IIJF 1P1FA 3N07A 3QWFA 1JHUA 4BCBA 2YN2A 1BYUA 3OTQA 4EY5A 2CCGA 3MM4A 3ONNA 1QX3A 3OZWA 5LLTA 1NVBA 1H9BA 3B1FA 3KTOA 3DQQA 1F0YA 5C7LO 3HG7A 1ISPA 3I83A 3VR0A 4XLTA 2NTNA 5FXMA 5BSKA 5HJ7A 2HMWA 4ML3A 1HC7A 1BXZA 5JQWA 3K09A 2PYIA 2HJSA 3ETGA 3GMSA 1JLLB 1MC5A 1Z4JA 4D9EA 4ZHQF 5C4MA 1FBTA 5JISA 2EFHB 1OTHA 4K6GA 4NBWA 3KSBC 3A0RB 4J2OA 1H6AA 1JSLA 1OIXA 2X42A 2A0WA 2AN4A 2PZEA 2X2PA 3KNZA 4L8YA 1DIRA 1DLJA 1T29A 5CG1A 2NTVA 5MDHA 2OG1A 3SSMA 1C9MA 1J2RA 4PONA 2O19A 3IIIA 4DR6B 1RJEA 3SC3A 4F3YA 4WZBA 1E1LA 2OWDA 2XW6A 4Q9IA 4P8RA 1T5SA 3E18A 1RC1A 3ZWWA 4B7AA 2CFCA 1SUSA 3CRNA 3I9NA 4X1KB 1T9ZA 3RS4A 4DLKA 3LF2A 4D97A 5L4SA 1PT7A 3NIDB 1KY5A 3RANA 3IHKA 3IQDB 1G291 3BFPA 4PG7A 5E7IA 2FVYA 2WAYA 2NXWA 3UTCA 2EV9A 5CAEB 3ZU5A 2VT3A 4RIIA 1GGMA 1Z39A 4YHHB 4JMLA 3KKNA 5E1OA 4D8XA 1RVDA 3MCAA 2ZPAA 3NALA 5GMOA 4B87A 4CKEA 1Q3HA 1OVGA 2L19A 3C3DA 1MB0A 3OCYA 1PEYA 2PVPA 4CHGA 1JLKA 2ANBA 1DJNA 3H87A 5HNKA 1GKUB 3V4VB 4RESA 1UWCA 4MVJH 2JANA 1WHSA 3V1LA 2G70A 3OJEA 5B6PA 2P2DA 1ZJYA 2R5NA 4XB6B 4DSTA 3L01A 1OZ0A 5DBGA 1A8IA 1ARZA 1Q91A 4LGCA 1XEWX 1FSSA 3NHMA 4GMXA 4BO9A 4ADSG 4E3WA 5BNZA 2X0EA 1WB4A 4IRUB 3WGTA 1W5FA 1I7SB 3DDWA 1NBOA 2E48A 2YN0A 1X7ZA 3KKLA 3N0VA 3CU5A 5BSHA 2JH3A 4URHA 4GMFA 4IHQA 3M4NA 1ZM9A 2WG2A 1PS8A 4MAMA 3MELA 2RGXA 4MW6A 2E55A 2VIIA 2WWTA 2O8EA 3HCOA 5KKNB 5CB8A 5BXYA 4KXUA 4MV9A 4KE8A 2G07A 4YRFA 3L1KA 3M2PA 1SOUA 2X6QA 3BS4A 3MMPA 1XEXA 4HQRA 3AINA 4BFYA 5I9LA 1ODKA 3IL2A 5EERA 2YKGA 4IDAA 5TMDA 4UMEA 1PV1A 1TQ8A 3GFSA 4WEQA 4MGYR 4TXLA 3VR5D 1YC2A 3PVZA 4YRDA 1NUSA 3GX1A 4FYYA 4TUYA 1RKUA 5A4FS 4RFVA 3BMQB 3UT5B 1EHYA 3RWMB 2FW6A 3OI7A 2J48A 4BQEA 4IHJA 3HNOA 4NU8X 2PUDA 3BD9A 4PYNA 5DXFA 3RUCA 3VNVA 5B3LA 5E2IA 3WP0A 5ALVA 2ZSUA 3WTBA 1G3QA 4PVCA 5B7GA 1NU6A 2E4XA 4RLQA 2FSUA 5A1TA 3ZG6A 1O2DA 1AXEA 4DV1B 2C82A 1VJDA 4G8DA 3I01M 4FSHA 4AG5A 3TLGB 1Q21A 3N7AA 2GN9A 2VEOA 3OPQA 3KDSE 1Q7RA 3QG5A 1L8OA 2R8RA 3WAKA 1T6XA 3A6PC 2J08A 2JFWA 2WRZA 3GNQA 3K4QA 3R0VA 4RHFA 5CLJA 4KBYA 1XTVA 2D2VA 3R5SA 4E5DA 2I7DA 3PGXA 3RK1A 4JB2A 4BFTA 1GUBA 1XU9A 5BRAA 4ZQCB 4HYYA 4U7HA 4UZFA 4Z51A 1O8CA 3HKDB 2G9UA 4YRTA 5I7EA 5JNUA 1WMSA 1RYZA 3C8HA 3H4TA 5H0IA 4AKTA 1BCSB 1ZK3A 4BOYA 1YRYE 1P45A 1G8MA 3OX4A 3PQ6A 4CEHB 1RWMA 2WD9A 4GXQA 1A77A 4IFIA 2WMNB 1E9RA 1JYEA 2OR3A 1AH2A 3AJ9A 1FS4A 2HCJB 5E8RA 4JLPA 4ZARA 1D0SA 1X77A 3CR8A 3GARA 1VBNA 4NV0A 3TX6A 4DIDA 4RTKA 3CRVA 3AOGA 4PC1A 4EPWA 1TKRA 4YMIA 3NG1A 5DHSA 3Q6MA 3SF0A 3QOWA 4JWKA 4HNSA 5JMTA 1T9AA 1C1YA 3S7ZA 4XR4A 1GTZA 1E96A 4LDNA 1A7JA 4FHZA 2ZBRA 4WQMA 5AOVA 3G23A 3ZE7A 1VMDA 2O4UX 3UUFA 3IAEA 3TLJA 2I9KA 3DM9B 3F9IA 4X66B 2AE1A 3E9QA 2NSHA 1S8OA 1ZSNA 5E4JA 3HPQA 5KYNA 2C5FA 2JZNA 1DCMA 3SZOA 5B12A 5JJBA 4L4XA 4S04A 1LWOA 3WWPA 1HNZB 7MHTA 1AGXA 2ASVA 2X9QA 3ADPA 4JSTA 4PIMA 5BOVA 3A31A 4RY9A 3UYLA 1KS2A 3LUCA 4MEJA 5C53B 3TRDA 3HVHA 1E6CA 1QIDA 1SBQA 5IH3A 3T0IA 2XPCA 4IILA 2BKLA 1IB6A 4BQOA 5AVTA 3GJ0A 4MJXA 1W48A 3PUZA 3WXMA 2RCNA 5B1YA 3HH8A 1RQRA 4TYNA 2EHDA 4MR7B 4E4RA 4IDGA 3S2FA 1R50A 3UWOA 2FMHA 3OZDA 1VFPA 4AB1A 2ZI5A 1TZJA 1ZX1A 4EBBA 2QT9A 1KZYC 2JDIA 4OXRA 3IQGX 3AIMA 3A6GA 3C0KA 1JAYA 5I4CA 4NZOA 1CFZA 1QSGA 4HZUB 2JD2A 2BBWA 1ZUNA 1JB1A 1E5XA 2FWMX 4YLEA 3H16A 1CJMA 3ZZTA 1ZZGA 1ZEMA 2VLBA 1RQLA 4WBNB 1E9EA 4QUKA 2Q29A 1G8GA 3GJYA 1BA3A 3N8KA 1YFZA 4QOGA 3AM1A 2WVHA 5HCUA 3NPAA 4CW7A 3ETHA 1E1YA 1UL1X 3H6KA 2VDQB 5AICA 1AB6A 1MZVA 221PA 4TT8A 4KJZA 4TV8B 5F76A 4FM9A 1N8KA 1W36C 2WT4A 5ESRA 5IM4A 3H9UA 2WYIA 1TCVA 1CQIA 3AI2A 4G86A 2CUKA 3L77A 4J16A 3WC4A 1YZTA 4C4AA 2EKZA 1RE0A 2BF4A 3UGJA 4TVKA 4I9FA 4M9QA 3K1AA 4JJ8A 1KI4A 2BIFA 3RRXA 1E2GA 5B4UA 4ESVA 1RPJA 2ATXA 4UBJA 9ABPA 2O7RA 1SURA 4FCWA 1M5RA 1IDN1 4P0TA 4KB5A 3D7LA 5AHXA 1FLNA 4MUFA 2MSNA 2X0IA 3VKVA 1JPNA 5EMHA 1W2WB 4FLEA 3TECE 2RARA 3BA6A 2GLUA 4MVJA 4Q3BA 4GXTA 4RH0A 5JJKA 2X15A 3G2PA 1L7NA 4X1OA 1S2LA 3G7SA 4GSKA 5TQ0A 1NLZA 4I1YA 2H1RA 3GVCA 4GYYA 1YKFA 5M29A 1VPEA 3RYCB 3H2IA 1XVVA 2L69A 3L40A 8ADHA 1NVVR 1KZGB 1N2CE 3INTA 1W5TA 2XUZA 2X3YA 3JWGA 4I2VA 4ND1A 4R9RA 4Q9LA 3BK2A 4MUAA 4KLAA 1A04A 2Q50A 2OMEA 1BRTA 1X38A 1J2EA 3MJ4A 2DOKA 1ZUD1 4LDJA 4WCVA 5P8WA 3SY8A 4R9VA 1CVIA 1P7ZA 2F8MA 1QE3A 2PWPA 4NESA 4X7PA 4MDFA 2VSYA 3CT6A 1B41A 1JJAA 3G7UA 3ICWA 5IS2A 1RDFA 2W6MA 2WJYA 5A3JA 2ZRGA 3L7BA 2ZWAA 5DTQA 3WJ1A 2PUAA 2OA0A 3WGZA 4QUEA 2E87A 2IYOA 3P7MA 2WWVD 1P3DA 4UAJA 3ZH2A 3SFTA 2I0FA 5JQGF 1KQGA 2GAJA 2IE8A 3CMMA 3U4CA 2JGEA 4FINA 4QRIA 2O2SA 5F98A 1JKIA 4OY3A 1RYDA 2E82A 3HZRA 4GOJA 3L3BA 1V4BA 3H99A 4YN3A 3CZQA 4MYUA 3L7OA 5IVPA 3GLFB 4LF8B 2FFJA 3A05A 1SOMA 1M2OA 3I39X 1TEVA 4N9QA 3MIIA 1YDWA 4LTNA 4D9NA 3NVKI 3LGAA 4WD3A 4BZQA 1GKKA 1Y1TA 2J3IA 3T34A 4GX2A 5DTEA 1QBGA 3WRYA 1A0OA 4DFDA 3K05A 4RKFA 2V0GA 1FRNA 3C1UA 1XD9A 4MUNA 5GV7A 3DBIA 2HCFA 1HF3A 1YB7A 3X1XA 4HWPA 4PZDA 3HRIA 3TQTA 1OF1A 4Y7CA 3I8SA 1RW4A 4PS1A 4XWGA 4YACA 1OXVA 1IU9A 2JD1A 2RC6A 4N3GA 4ZAZA 3M1LA 3Q8KA 4YMGA 1AQJA 3DG9A 2REXB 4YLYA 3F5MA 3IAXA 4DGQA 4LWOA 2YHUA 4KQFA 4KO8A 4YA6A 3TXXA 1YMVA 1HDEA 3EMVA 1FXWF 4H6PA 3L93A 3BJMA 2OC9A 4W7HA 4E12A 1RWPA 2EW1A 5LA6A 3UKDA 3MQFA 3E9YA 1AUOA 3JQCA 4QTZA 1NP3A 1JEQB 4XAQA 1EH5A 4DMLA 1AF7A 2WBLC 1I8TA 2EZ8A 5KCZA 2Q6VA 3O03A 2QZ9A 3REQA 1YB2A 2YWBA 3D1VA 2PKYX 3ROFA 4DA6A 3RYTC 2K7ZA 1MIOB 2YVKA 4PX9A 2JCSA 1LLQA 2ONYA 1BHO1 1Z8NA 5H9VA 3SXUA 4IZIA 2J09A 3E35A 3L6BA 5FPSA 3NKVA 4IJVA 5GONA 2QRUA 3R4CA 1X7XA 3CG4A 3LOUA 4HHEA 1VXRA 3IR6A 3RWBA 4XWWA 2W2MA 4JBHA 4QFCA 1S2OA 4GKVA 1YZUA 1GZUA 3MFYA 4WY8A 4RGVA 1X8KA 3D0QA 4MWCA 3IFSA 4JLWA 1Q0QA 4XIGS 4K9LA 1N36B 3WLFA 2OZPA 2IUYA 5JH7B 3S6JA 2WA2A 3EGDB 2D62A 2WU4A 1W5EA 1SA0B 2ZXEA 3FRJA 1LS6A 3MTGA 4FYXA 4UAGA 4ER6A 1QIFA 3L41A 5K4AA 3T7DA 2R0QC 3CN7A 3G5UA 2M2IA 2VHUA 3A4VA 3QFRA 5F35A 4JI8B 4AZ0A 1T1SA 2OXFA 3AF5A 1QGYA 3TB4A 1PDWA 2JGRA 3CPHA 3ZD9A 1X39A 3U3OA 4PANA 3ABRB 5ARCA 2O20A 4JLSA 5BUQA 1AK2A 4HVCA 3WVNA 1H4QA 3PWTA 3W3AD 4RMNA 1LBTA 2GUGA 2QM7A 1ISJA 4RD6A 1TUBB 3U0VA 1DBPA 3PRYA 3NXKA 3NYWA 4PQYA 3WIDA 2QV7A 3GV0A 4ZQGA 2WTBA 2A58A 2WABA 5E6UB 3JD2A 4TKZA 1FIUA 3ZXYA 1SU7A 2IY8A 1ZD1A 4G23A 2BGJA 1SMKA 1LWNA 5I8WA 1IUKA 4D99A 1E6LA 2BEUB 1FVHA 1OXKB 2QVBA 2R00C 1FSFA 4FYMA 4HBGA 1DKUA 5BYJA 2P6RA 2RHMA 4RAOA 1LLFA 4YCJA 1T26A 2BGUA 3DBRA 1EDBA 1JJVA 2X9VA 1DC4A 1E7MA 2IEZA 3DHNA 4JT4A 2X4DA 4Q4JB 5FHRA 5JC8A 3G2LA 4LWPA 4JJ4A 1L1FA 1OLSA 4HKTA 3V7FA 2BH9A 3KG2A 4WCDA 1NAHA 5F3DA 5JMOA 3A10A 3T61A 3HKEB 1DADA 1ISSA 1U8AA 2QQ5A 2VPQA 4EPVA 4LJSA 5EPEA 2WSMA 2GA8A 4HDKB 4BLRA 2GAOA 4RF5A 3HBNA 1PQWA 2MHCA 4AROA 3VNAA 4AZVA 4IQ0A 1N2CA 1U02A 5KU7A 3EXEA 3UK0A 3VJKA 4FIDA 5HDQA 5ABPA 2VWPA 3JQFC 2RMKA 4GOKA 5GINE 3NWJA 3T38A 3SSNA 5JSHA 4OM8A 4UMFA 1PWZA 4FWBA 4HFMA 4YR7A 5HILA 3A6DA 4FXPA 8ATCA 2V4MA 2ZE8A 1W0KD 1P3Y1 2X22A 4N5LA 3TSWA 1YQ9A 1IEVA 4O4IF 4HG2A 4MPPA 1TMOA 3HL4A 2R6R1 1IHUA 1CDZA 3AXTA 2NUPB 1FC0A 2Y99A 2YICA 2IYPA 3L0IB 3K6SB 2G5TA 4R8KA 1QYDA 2J30A 3N2EA 2JGAA 1U7WA 1X9GA 2NVWA 4FUQA 1I13A 3TLXA 1BD4A 4N12A 2X5NA 4R05A 1O0BA 5ED4A 1NSFA 3K70C 3TLBA 1FQKA 4KYUA 3RK4A 2FN7A 2AZ4A 2PX0A 4ND8A 1DAEA 2CL0X 3RFTA 4G5YA 3F73A 4LNUB 1YK1A 4N6GA 5DM0A 3FSGD 3PTAA 1P31A 5ELXA 2PTHA 4BFLA 5JTUA 3U7RA 1R0XA 3SS9X 1IXZA 2XH8A 3HXMA 5BN3B 2Q6OA 3G9UA 4LJLA 1GG9A 3ZHCA 3RH0A 2DULA 2NOAA 3NBUA 3ZQKA 5HQ3A 1TA0A 2AZTA 4PR0A 2JJMA 2V6JA 4CQLA 3UV3A 4LJ6A 4WNYA 1DWUA 3CR7A 2WHRA 2I71A 3VOTA 1TAQA 3AL0C 4BNTA 3RTAA 1RRCA 1ISGA 4WKCA 5IM4F 4W5QA 4K1XA 4M49A 2I6UA 4QNMA 2I6SA 4W1QA 2C2GA 5CYFA 5IAJA 3K5PA 1Z33A 4JNCA 2F62A 5E9JA 4DQKA 7GPBA 2X2EA 2H2IA 1VG0B 3ANXA 1XFDA 3KZ1E 2ZB4A 3QI2A 4R1PA 5A5GA 1B00A 1YQWA 1UT6A 4DLUA 1C1DA 2G25A 1N2ZA 1GAQA 5HKBA 2IX9A 5HJ5A 3NEJA 3OPYB 1V43A 3FBGA 2GM3A 4KN5A 3ETJA 1PGOA 1MNQA 1VE7A 2Q4DA 4W99A 1GARA 1II8A 1RBZA 1JF8A 2CVFA 1DKRA 5GVSA 1VRWA 4D57A 1SXJA 5A0TA 1TM3E 3UC9A 2ZQYA 5FI0B 2JBAB 5CLGA 4E5KA 2Q5JA 3FXAA 4YPFA 4YRLA 1D2MA 3ZI0A 1U63A 4HY3A 1N9ZA 3KT6A 3N2GB 5F64A 3NBXX 3ZHBA 3FN4A 2AQ8A 4DR1B 3T1YB 4B34A 1IUOA 4BC1A 5HPYB 4U2GA 3EZ9A 4UU0A 3VNRA 1PZNA 1JG7A 1QQTA 3Q0IA 5IT9A 2ZRBA 1TYDE 1HLFA 1XQYA 1ZYUA 5I9SA 3HO6A 1CWUA 4JYPA 1GP2A 3IHTA 4TYYA 4NPCA 4BNHA 2IJGX 5CHYA 2C94A 4FOSA 1TVKA 1U9JA 5HBGA 1KZ1A 1X19A 5KVAA 1IN1A 2H4YA 2Q4TA 1MXFA 3JQ7A 3HFSA 4TV9B 1K3TA 5C32A 4A91A 4ALMA 3GT3A 5BMOA 3NWPA 3VC1A 1QOPB 3UAWA 3JZIA 3NTXA 4BO8A 2V6BA 4CLXA 1QKJA 2R00A 1T1JA 3MWEA 4CZ2A 5LYJB 3QJGA 4BO4A 3MCVA 1ECPA 3AUTA 4IHJF 3P19A 1Q7BA 4ND6A 4MYCA 2RONA 1BA2A 1QFJA 3U16A 1C7EA 4RL6A 2O3SA 1Z06A 1A9ZA 1RHQA 1CDDA 4LHYA 4EPXA 1PNTA 3PYLA 5CEFA 3C43A 4KAFA 1S9HA 2GZ2A 2W8BB 2V6MA 2WIFA 5AJVB 3EA0A 1EFRD 4B5KA 3WNCA 3K35A 3IUYA 4MWTA 1Y3CE 3D8NA 4PX5A 1QPZA 3KKKA 3S0JA 1SVOA 2ZANA 1WB6A 1RQNA 3I72A 1Z6YA 4FFSA 4ZFNA 2K4MA 3ZYCA 3TNFA 4DLVA 2Q62A 4YAUA 3WA6A 1ULTA 3T5PA 3D4BA 2I4OA 1BMFD 1THMA 2D0IA 2UUCB 1M2VA 2IUUA 2PMBA 4A0GA 5AK0A 1DRJA 4M98A 3PPIA 1J2JA 4HMQA 1RRVA 2AI3A 4LC9A 1QYIA 1Z0ZA 1H8ED 4PFQA 1EVZA 5CH8A 2I2FA 1FY2A 5CPFA 5DX0A 1B93A 4LXHA 4LI0A 1CRLA 1PZHA 2WKPA 4BQIA 4IV0A 4BEBA 1HQKA 5LD2C 2FP3A 2CYAA 3V1YA 2ONKA 5TSDA 4UUAA 3FOAA 2QTVA 1WABA 1R9NA 2W98A 3QPBA 4F1WA 4MQLA 5F7JA 3HDVA 1JJBA 2AC7A 1FMJA 4KQCA 3RABA 1UK7A 1NXWA 1OLXB 4X3CA 1F2DA 3VHXB 3WWOA 3ZDAA 3O7WA 3O75A 2KLBA 3EXIB 1Z0IA 3KO8A 1OH6A 2OHXA 2FRDC 3DHVA 2PS9A 1SHKA 2KE5A 3CINA 5KJ1A 1C1HA 5DGHA 4PLZA 4MWOA 1XCGB 1KI1A 3A37A 4MQEA 2OLEA 3EHDA 4DWWA 2HV8A 1XI2A 1TTPB 3N5KA 4GDMA 5IAAA 2WTXA 5JSYA 5EN4A 2DXIA 4IMPA 3HCRA 2FSSA 3LUBA 3QVSA 5JSQA 2H6EA 2F4VB 5BV1A 2AYYA 2RHOA 3GVPA 1GLVA 1M3SA 3EEYA 4H18A 4BNVA 4UCWA 3OJWA 3OJCA 4K05A 1RR6A 1V39A 3HWRA 2B3TA 2D0DA 2OORA 2HQSA 2WIJA 2WM9B 3DSRA 3I8XA 4LMAA 1UC9A 1U2GA 3WKEA 3OSZA 1ZNXA 4KQWA 4X91A 4EHAA 1FW6A 2AFHA 2GM9A 2OHIA 1KY3A 2OFPA 4S2UA 2J6HA 2PRZA 2HPAA 4HB4A 4NBVA 3QHPA 3ENQA 1Q2UA 3CVVA 1ZK1A 2CF5A 1SPXA 1VPTA 2WC1A 4FDUA 4S3MA 2FKAA 4TL9A 4I3FA 3O47A 4FX2A 4I1IA 4B7UA 3PF8A 1F3LA 2HPZA 3M5WA 3QUQA 5BN3A 1JIJA 1P72A 3FSJX 5L4NA 2XUOA 3IS3A 3IMKA 4TKVB 3U3ZA 4NMXB 4AT1A 4CF6A 4ZAWA 4ONEA 2F43A 1AQLA 3WLJA 3N74A 1CUCA 3TIVA 1T0IA 3KAPA 1W19A 5JYCA 3W2EA 3OQIA 4CF4A 3Q10A 5CTAA 2Q2QA 5DNAA 1W30A 1G4UR 3GJTA 2J8ZA 2F9MA 3SE0A 5U1PA 2JFOA 3V46A 4NABA 4KR6A 4L16A 4M1YA 5AVZA 4QHSA 5KOIA 2A8YA 5DLYA 1ES9A 3I6ZA 2W8ZA 3EVTA 2GNAA 1VHJA 5ALMA 1J24A 2QP3A 3ZZMA 1M1ZA 1Z16A 1S8NA 4WKNA 1JLLA 5ESXA 3V2IA 4BNKA 4RK1A 4FZJA 1DQNA 2EL9A 3O73A 1TQDA 5IANA 1RZRA 4G26A 3EIQA 3UKJA 1QGDA 1ZGJA 1AD2A 2G6TA 3PTZA 4M0DA 5AKHA 1HR0B 4YX9A 4F92B 3BD7A 4W8HA 2VJBA 4M89A 4HXFB 4GPBA 2YX1A 2EGHA 1DX4A 3UMFA 1XEAA 2VL7A 4FK8A 1ZM7A 3GZNB 4TM8A 4ZT2A 3DKVA 3JQRA 3NRJA 5DHFA 4E2YA 1MOPA 5HKAA 1ISMA 3TRIA 4ZCSA 4F6LA 4BVJA 2CVPA 5ESWA 1WHTB 1Q20A 3ETDA 3G8BA 2VDUE 1NVUQ 5LQRA 1JMVA 2IOQA 3NHAA 3BGDA 1DKPA 3DE0X 4CV0A 3FDFA 1O9BA 2WW8A 3W6ZA 3MNFA 5C4IA 3DO6A 1Q0ZA 4E1AA 1GUAA 3ONVA 2FI1A 3HZOA 5TMBA 2VZLA 2RGWA 1ID8A 3C98A 3ZTTA 1G5PA 3BERA 3LP6A 4S1NA 2ECKA 5FWYA 3C8ZA 1PL7A 3QPCA 5J2TB 2E9SA 1SNYA 3MCZA 5KOYA 5CMLA 2C4WA 4FGLA 3L7AA 2JLZA 4TZTA 2DKFA 5D01A 2RI1A 3STUA 3WK9A 2XQIA 3QV1A 1U8TA 2CXPA 1X0XA 4W5OA 4DCGA 1F17A 4OL0A 3PI6A 3NBFA 5I45A 1NBAA 1F0KA 1KP9A 1HO3A 2CXOA 3O26A 3GCZA 3UFBA 3AEKA 3UGTA 2JARA 3DLHA 1Z5WA 1C8KA 1G18A 1S3GA 4JYCA 2C0CA 3T15A 4BECA 2XDQA 4AUMA 2HU2A 2A92A 2XE8A 5FKJA 3MF4A 5TS2A 4RULA 3FVVA 2XUJA 2QM0A 3MFQA 4X94A 3EBLA 3UCEA 5ALSA 2GPAA 5AVVA 2GCEA 1T8RA 1P29A 2GJ4A 4D8TA 2PX8A 4YR9A 3VV3A 3LC2O 1E7QA 3VKUA 2OO5C 4GMGA 1MJ5A 3LFHA 2G63A 1EBFA 2AVNA 5AI8A 4KN6A 5JDIC 2YW2A 1S6YA 2ODWA 4YRJA 1BMQA 1M6NA 1AURA 1IN4A 3EFHA 3E3LA 5IZ4A 1W9HA 2P7HA 3EF3A 4HC4A 4OG2A 4UQOA 5DSXA 4COOA 4XD7A 2NW6A 1D4ZA 1XVAA 3I23A 3PDIB 4HZGA 4PLYA 2QLBA 4QG7A 3W7VA 4AZTA 1DKOA 1I51A 2QENA 3HDGA 1KKMA 1YZKA 3W6OA 3WIBA 5L6LB 5DGXA 3EOZA 5BNWA 4DEXA 1HSOA 3ONFA 2AOTA 4F3KA 2X5KO 5AI4A 4YXWA 3TZBA 3NTQA 3FPJA 1S1CA 5HRCA 3JYOA 1I7DA 3KVNA 3JD0A 1YASA 1YONA 2JPDA 1E2FA 3M6UA 3P94A 4Q02A 3FJYA 2R6GA 5JWRA 2GESA 3IKMB 2H1FA 3K20A 3H3XA 2C8LA 4V1CB 4J9VA 4BNZA 3ASYA 1SCIA 4EVIA 4C29A 3HBMA 1R0BA 1SKAA 4RFLA 2WY2D 3OUZA 2HDNB 2MMGA 4RVDA 5FV4A 2QTLA 1K63A 1IJEA 4MHOA 1V11A 5JAIA 1JEQA 2XCIA 2OK7A 4FDLA 4D82A 3HXPA 3O4JA 1BXRB 1IONA 3U48A 4KSYA 4M0PA 4ZAVA 2ZBDA 4OXQA 2XI4A 4XM2A 3WYEA 5EJ8A 3I52A 3T6KA 2HAEA 2W2LD 3IQXA 3LAWA 4Z3OA 5KJ6A 3WWEA 4RXTA 2CHGA 4DEVA 2F90A 4EFNA 5ICEA 2CDBA 3CW2A 4OQZA 5DMXA 4NEHB 4MLZA 5GONF 1GNLA 4X62B 2JBWA 4AG6A 4QDTA 3RG2A 1LFAA 5FULA 4E2ZA 1DTWA 3BHIA 4Z0TA 3GLGA 2X0DA 4MW1A 4WVLA 1Y4AE 5E4YA 4ZCPA 1GTMA 1VSTA 1H2HA 1UZMA 3N2LA 2E7ZA 2JVIA 1D1SA 3F5QA 3GQVA 1ONBA 1XFAA 2QBYA 2RHWA 1Z36A 1J20A 3C1OA 1CQWA 2C5GA 3R9IA 3EDMA 1NMYA 5G0TA 3LY7A 1YFLA 4YQEA 4QRDA 3EWSA 1NR1A 2WHPB 3IALA 3PUJA 3B2NA 4IUCS 4TRNA 4R2KA 5SZKB 3G9TA 4RNCA 4YJHA 3UJ3X 4B6PA 3DZ8A 4DLTA 2V3WA 1NQOA 1NULA 1J2UA 2YH2A 3L9WA 4J91A 4ZAGA 3UOAB 4UM7A 1FQJA 1C9YA 3QX9A 5L51A 1KAMA 1MEJA 5GJWC 1WB5A 1Y89A 4JXJA 3TTYA 4KWHA 1ZNYA 3OD1A 1QGAA 4AJNA 3O8OB 2Z1NA 3HCAA 4JS0A 4GM4A 2ODAA 3ZK7A 1G3IA 2X1MA 3YASA 4B0PA 1C80A 1T2VA 3W5JA 3WL4A 1FB5A 2DFVA 1HL3A 3B1WA 3EMBA 4G36A 5JD6A 2AH5A 4BBZA 1RXUA 3OE1A 4GC5A 3ZBQA 4ARSA 4TLLB 1KFJB 2H65A 3C8DA 3ZLUA 4YP5A 5B6JA 1G16A 1LDNA 3PE6A 4MI6A 1PL8A 1WSDA 3U61B 3K4PA 2BFFA 4WXRA 4HQ0A 1VRCA 3R9XA 1GCOA 2PS3A 2ZIWB 3D7NA 4PW0A 2FMUA 4LG1A 4EL5A 4Z4QA 4U7TB 3O8QA 2WWXA 3WMWA 6PFKA 1XJQA 4DR3B 2HCRA 4E22A 4B6JA 1NTOA 1TJNA 3G0CA 4FZ5A 4RM3A 4C03A 2PYDA 4YCLA 4YY3B 3ER8A 3E8SA 4U1RA 4I1UA 4TT3D 3A1FA 3U4HA 4XFDA 5MGBA 1Z0AA 3DB1A 3T94A 1E5QA 3AY3A 5FBWB 3EY4A 3TLAA 3EZ7A 2JGKA 3LK6A 2W00A 2WP8J 2GH1A 4RZSA 4F4UA 3F8SA 1FLVA 4ARUA 2RGUA 4BNFA 1U3CA 4YUAA 1RYNA 4U0JA 1E8NA 1T0HB 1U3UA 3P9IA 4ZHSA 3JQDA 1FUYB 5AHRA 1PV2A 2ZYSA 5ERGB 5FOXA 3ECCA 4KDRA 3INYA 5FFMA 3WY9A 2HM7A 1IQRA 1NFRA 4PFSA 4PG8A 3DL0A 3DYIA 4QOSA 3FNQA 3WGLA 4JYZA 3A6FA 2DFPA 2HQ1A