3LX7A

Crystal structure of a novel tudor domain-containing protein sgf29
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
159
structure length
143
Chain Sequence
GRENLYFKPPPLCGAIPASGDYVARPGDKVAARVQWILAEVVSYSHATNKYEVDDIERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 27
structure length 143
sequence length 159
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lx7A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lx7A01
4Z02A 3OMGA 2L8DA 3P8HA 2EKOA 2F5KA 2RJDA 3PMIA 3L2UA 3S3MA 3L42A 3F70A 4N4HA 2EQKA 1OZ2A 5IAYA 3OA6A 2E5QA 3NTHA 4BD3A 5J26A 3EAEA 3S3OA 4UC4A 2VYTA 2R5MA 3OYDA 3QKJA 4BE0A 3SD4A 2XK0A 2GF7A 2HQEA 2IG0A 1MHNA 2RO0A 3META 3GOXA 4GY5A 5M9OA 3E9FA 3OYGA 3OYHA 4BE2A 5FRNA 2RI2A 5D6XA 2RI5A 2DAQA 3QBYA 2E6NA 4QQDA 4CRIA 3OYCA 3LYIA 2BKDN 2RJFA 4Q5WA 2NLUA 3OYKA 3FEOA 4RG2A 4C5HA 3CEYA 2RJCA 2QQRA 4ZTJA 2RHUA 3M9QA 4FU6A 2XDPA 3FDRA 4B9WA 2MWOA 5KH6A 2LDMA 3H8ZA 4N4IA 2D9TA 3LLRA 4IUQA 4FL6A 3MEVA 2FHDA 3LGLA 4EDUA 2EQUA 2LVMA 2R5AA 2CKKA 2RJEA 4II1A 4IUUA 2B8AA 2YRVA 2EQJA 3LX7A 3S3NA 3DB4A 4QVZA 1WGSA 2HQXA 2L89A 5IN1A 3FC3A 3C4SA 3NTIA 3MEWA 2RI3A 5D6WA 3ZEHA 2LTOA 3OYLA 4C5GA 4QW2A 3OS1A 2R58A 2LCCA 4OVAA 3UWNA 1G5VA 1WJSA 1OYXA 1XNIA 4A4FA 3LGFA 2PQWA 2JTFA 3MO8A 4L59A 4A4HA 2X35A 4PLLA 2RHIA 3BDLA 3QJ6A 3E9GA 3OYFA 4A4GA 3PFSA 3MP8A 4X34A 3MEAA 4NS5A 4PLIA 3OS2A 3OYAA 2GFAA 4QQ6A 2RHYA 3OS0A 3KUFA 1N27A 3OYMA 2RHZA 4QQGA 3S6WA 3OMCA 4BDYA 5FROA 5KCOA 3OYEA 3MEUA 3UT1A 1RI0A 2DIQA 4E7HA 2QQSA 2BUDA 3DB3A 3ME9A 3PNWC 4LD6A 3FLGA 4HCZA 4N4GA 4B9XA 3QIIA 3OYIA 3L2VA 4BDZA 4E7KA 3MP6A 3NTKA 3P8DA 1OI1A 2K3XA 3OQ5A 3OYBA 3L2RA 4A4EA 2RHXA 4PL6A 4BE1A 2MWPA 5KCHA 1OZ3A 2LRQA 3L2QA 2M16A 2EFIA 2L3RA 3OB9A 5J39A 2X4WA 2O4XB 2G3RA 5CIUA 2K3YA 2M0OA 2O4XA 4E7LA 2P0KA 4IUTA 3H6ZA 3Q1JA 1WJQA 5KE2A 3O8VA 1KHCA 2WACA 2X4YA 2EQMA 3DLMA 3MP1A 4IUVA 1SSFA 3OY9A 3PMTA 5FRMA 2R57A 5D6YA 4BACA 2DIGA 5C6SA 2M1HA 4IUPA 3ASKA 2JZ2A 4C5EA 4E7JA 2X4XA 2GFUA 3LH0A 5KE3A 4E7IA 1H3ZA 3L2WA 3OYJA 4C5IA 4ZTFA 1WJRA 2BIVA 5C0MA 3OYNA 4IKFA 4IURA
chains in the Genus database with same CATH superfamily
1KQSP 2D8HA 4MMLA 1WHHA 2F5KA 2YXYA 3NTHA 3J80E 1SRLA 4RTUA 2XMFA 2IG0A 1AVZC 4MDWA 4BI3A 2P4TA 3CCMT 4BE2A 5D6XA 4Z89A 2DAQA 4QQDA 1K73R 3A8GB 5GAOm 1MMNA 5HK0A 3UPUA 4AT1B 5GAOn 4ELYC 4OGEA 2RB6A 4RTYA 4JLIA 4ATOA 1TWBA 1NJIC 4WF2A 2L89A 2LCSA 2E6ZA 5D6WA 1S72T 1YFNA 2DTHA 4LDYA 1K76A 1Q82R 4F7UG 2V8IA 1BIBA 4CC2A 4J7FA 2AZVA 2DVJA 2JTFA 3MO8A 2K5LA 1BK2A 3JCMc 1XTDA 1ZBXA 3CCEQ 1QP2A 4QQ6A 4PJOD 2XKOC 3CCVA 4J9FA 4M7AD 3GNFB 3DB3A 1U8RA 2MF2A 1W4SA 2EYQA 3NTKA 1VQNA 2ZPFB 3CCQA 1K0XA 2X3WD 1BCOA 3QHSA 1M90C 5L8RE 1HK9A 3Q1JA 2CGHA 1WJQA 4J6WA 5EC7A 1IGQA 1R77A 2X4YA 2DM1A 4Y91A 4M77B 4OF1A 3P8BB 2EQIA 4J6YA 2EWNA 1QVFP 2LC4A 3A8MB 2BE7D 1I5OB 2DJZA 2EPDA 4J8OA 2E4HA 1VQ4T 2ZCFB 1VQ9T 3CCLT 1MNEA 4GLKA 3CCMA 4XQ3A 1GBRA 4E6RA 2E5QA 1NLPC 1YCYA 4Y28E 4M75G 1YITA 2YLCA 3SD4A 2GF7A 5M9OA 2HCKA 4RCBA 4E7SA 5GANg 2H3JA 4F16A 4C8QG 1WXUA 4Q5WA 4LDWA 1IHWA 3FEOA 5IHNA 4A54A 1SRMA 3L1AA 1S72A 1OU9A 2DL3A 2YDLA 2R5AA 5KYWB 1K4US 2VB6A 2EQJA 4PK4A 5CCAA 1RABB 2DEQA 2K6DA 1XJWB 2FL7A 4L6V5 3OYLA 4KUIA 4M78F 3FIFA 3RNJA 1ZQ1A 1OULA 3SWNB 3RKYA 1X2KA 5I22A 1PD1A 1V29B 3VKIA 4EMKA 1TH7A 4A63B 3CC4Q 4EMKC 3IQLA 1YI2Q 1JJ2A 3OYEA 4M78E 3GBQA 1I0CA 4LDUA 2DIQA 4N4GA 1Y07A 5A0GA 2DFUA 1DJ7B 2OAUA 2EJFA 1M90R 1OI1A 3OYBA 1NLOC 2ZGWA 2DTOA 2LX9A 1Y71A 1QVPA 2ATCB 3RKXA 5LJ3e 6AT1B 1AWXA 1BCMA 1QWEA 1WLPB 4RTXA 3M0RA 2QTVA 1VQ4A 2CH4W 1VQ9A 2R57A 3BW1A 3EGXA 3CCLA 2KY9A 1KD1R 3ASKA 1UGSB 1H3ZA 1UHFA 5LJ5g 1WJRA 3EGUA 1JB0E 4PJOG 2DTIA 4M7AG 2RH2A 4DBFA 2C0OA 4KGVB 1WIEA 4V2SA 2AIRB 3G1JA 3H0HA 2K2VA 2RPNA 4OB2B 2DRKA 4C92F 5KYXA 2JS0A 4M78A 1WQWA 2SEMA 5GANj 1VQLA 2QQBA 5LJ3j 4M78C 5KYYA 1E6GA 2GCXA 4K11A 4Y92A 4FU6A 3TREA 2MPXC 1SKUB 2M9UA 4HCBA 5GAMg 3H9NA 1VQMT 2KMTA 2X9HA 2DKGA 1MMGA 2CKKA 3JAME 2YUPA 2D1XA 1KQSS 3L2ZA 1RUWA 2HL5C 2PNIA 4QVZA 1JO8A 1D3BA 2RI3A 3CPWA 1M2VA 2O88A 1OPLA 1B07A 4OVAA 3JCMe 3JCMb 1GCPA 2QEXT 1UDLA 1GFDA 4N0AA 1TU0B 4LDVA 1FMWA 5KYUB 1LPLA 4KH0B 4N0AC 1YHQQ 3CC2T 3I56T 3JCMJ 3CPFA 3M59A 4Z8AA 5LJ5e 2QK0A 2KYMA 2OI3A 4M7DC 4BDZA 1IO6A 4L5GA 3CCUT 3OQ5A 2EW3A 2YRCA 2FG0A 3M58A 4J9DA 4HT9A 2OTJT 3UATA 3OB9A 3M0QA 3VS4A 2DE0X 1RAAB 4LXCA 2NUZA 5KE2A 4DQ2A 2JM8A 3GLXA 2JMAA 2LNVA 3EG1A 1FWZA 1YJ9Q 3OBWA 2RQWA 1YJWQ 1VQKQ 2JZ2A 3R6NA 1EX4A 2COZA 2V26A 4E7JA 3U23A 4E7IA 4ORZA 2V8KA 3P8HA 3OYNA 5LJ5j 4DA4A 5IXFA 2RJDA 2VXFA 4F7UF 4XTXA 3FJPA 2ZPBB 4FW2A 5J26A 4ZN1A 2P84A 1WDXA 1ZA2B 1KK7A 2L3PA 1FMKA 3G4SQ 2EYZA 3QBYA 1VQMA 1VOMA 2O9SA 1QCNA 2RJFA 1WXTA 3INZA 3HKSA 2QQRA 3CCRQ 2HQHA 2LP5A 3VUZA 2CZ7B 1GFCA 3BFMA 3OW2A 1QVFS 3H8ZA 2FHDA 1CKAA 2AKLA 1T3LA 2XDDA 1RAGB 3G6ET 1YJNT 3LX7A 2DZ9A 2QEXA 3V7RA 1VA7A 1WGSA 1Q81C 1KSWA 1M1FA 3CC2A 2OTLT 1YN8A 4J5YA 4MZTA 1M3BA 3V8LA 3I56A 2FZGB 1OX8A 1R0CB 1UG1A 4XU1A 2ZPIB 2FEIA 3M4YA 1OQKA 1GXIE 1AWOA 4CC3A 5AYFA 1M27C 3V8JA 3OS2A 2GFAA 3CCUA 1BI3A 1VQ6A 4FSXA 2Z0WA 1M5Q1 3QWYA 2A37A 4QVDA 2OTJA 1N6AA 2QYZA 3PNWC 4LD6A 2M51A 3OYIA 2COYA 4M75F 1VQPA 1N9SA 1JJ2P 1VUBA 1UTIA 1MMDA 2AKKA 1KC8U 3TU4K 2X4WA 4C8QF 2M0OA 2EGCA 4OMOA 1RAIB 1N8RC 3OY9A 1QCOA 4M75E 5C6SA 4IUPA 1G8XA 5FU7C 2H3EB 2ROLA 3OYJA 4C8QE 4ZTFA 1VQOA 2AHJB 4IURA 4J9HA 2HZYA 2JNGA 1JEGA 4D8KA 1QMCA 2GGRA 2R5MA 1GBQA 4RKUE 1K8AC 2XK0A 2DXBA 2HQEA 2CT3A 1AWJA 2OJ2A 2RI2A 1TSFA 3HFOA 2RI5A 1D09B 2QGGA 1NEBA 2E6NA 5CR2A 4PFOA 1JU5C 3OYCA 2FPFA 3RDVA 3T9NA 2EYYA 2KRNA 2MCNA 3G6EA 1YJNA 1RL2A 3KFVA 2JUFA 1D0XA 1Q81R 1BI0A 2OTLA 2GQVA 2HNIA 2NYSA 1X27A 1UJ0A 2O9VA 4PJMA 3JV3A 4JJDA 5GMKl 3TCJA 3S3NA 1EFNA 2XI9A 2M02A 2COWA 2DERA 3JB9H 2PUOB 2YUNA 3VRZA 1Z9ZA 5HY6A 4M75A 1M2OA 2ZAEA 5LJ3f 1E6HA 4M75C 3WXMB 2DILA 2DNUA 2ZPGB 3I55Q 1V76A 1ZSZB 2E64A 3EGDA 3CPWP 5CQXA 4XTYA 1X6GA 4C8QA 2LQWA 2PU9B 3CBOA 2RHYA 4PJOF 3GIBA 4C8QC 3ULRB 2RHZA 4QQGA 4OMMA 3H41A 4RUGA 4M7AF 2KNBB 3VYGA 4E7HA 2QQSA 2VWFA 4DEYA 4ZGJB 3P8DA 2DYBA 2K3BA 4LD9K 5GMKi 4A4EA 1UB4A 2CP3A 2MWPA 5GMKh 2XIDA 5CQYA 1N8RR 4PJOE 2K9GA 1ZHIA 1Q82C 3AHUA 5EG2A 3EFOA 2KGTA 4GLMA 1GCQA 5IT9E 2FRWA 1SF9A 2EQMA 5KYXB 1C1AA 1SSFA 5DLQE 1GCQC 1RADB 3RMSA 4XK8E 2F5TX 5I2SA 3CMET 2JS2A 1PKSA 2J7IA 4C5IA 2NUTA 2DD5A 2EKOA 3HHTB 2XG8D 1QVGA 1RACB 2RQRA 3EAEA 1H3HA 2ABLA 4QVCA 2JM9A 3JCMf 2LT4A 3UF4A 2ED1A 2MIOA 5GAOq 1M2VB 1LOJA 3RBBB 5GAMh 2XD0A 4XU2A 1RAHB 4KGZB 4BUGA 4EPCA 1MGQA 1K9MC 4ZTJA 4R55A 3M56A 1N5ZA 1M3AA 2DETA 1VQNQ 4JS4A 1BIAA 2EQUA 4RCCA 3ZBDA 4M7DB 4J7IA 1UHCA 4KRTA 4A4KA 3OW2P 3MEWA 4XTWA 2LTOA 2KE9A 2R58A 2QASA 4OMPA 1NG2A 4ME7A 1OYXA 3CBMA 1M1KU 1YITT 4Z88A 1I81A 2VASA 3A5ZB 1XOVA 4E7ZA 3CXCA 4JDSA 4M77G 4OMFB 1X6OA 3VS5A 2ROTA 4OMQA 3RUXA 3EG9B 1A0NB 2HL3A 3MEUA 1Y7XA 3CCMQ 5DM7R 4HCZA 1Q7YC 1W2BA 2RK1A 4LUEA 3L2RA 2KRMA 4FYVB 2QTXA 1IZ6A 3CD6T 3EG0A 5A0DA 2XICA 1BU1A 3CMEA 4LN2A 3MCAB 1QWFA 4R56A 2WACA 1T0JA 1G3SA 5A0LA 2PVDB 1S72Q 3H0FA 1PWTA 1X2QA 3CCJT 2M1HA 3UA7A 5HCKA 1ZUYA 1LNXA 1NM7A 3EFSA 1PNJA 4N4HA 3F70A 1QP3A 2QDYB 4X1VA 1OZ2A 3N5BB 2HSEB 1JJ2S 1OU8A 1YWPA 5GJVB 3TSZA 3S3OA 1TUGB 2VYTA 3EH1A 2L5QA 2JMCA 3KBGA 2H8HA 3META 1K9MR 3OYGA 2JXBA 3D7SB 4A53A 3I5SA 1MV0B 1T3SA 3LYIA 2I2LA 2KI7A 1YP5A 2NLUA 1JXOA 3GF5A 2QAZA 5LL6S 1KD1C 2XDPA 3FDRA 4B9WA 3G71Q 2LDMA 4F14A 2X3XD 2CUBA 3FRNA 3VU3C 2HQXA 3BY7A 3FC3A 5CKEA 3NTIA 2HSPA 3HP9A 3OS1A 2CUDA 2EBPA 1VQ4Q 1WJSA 3EFRA 1G3WA 1VQ9Q 2VC8A 3NPFA 4L59A 1GL5A 3BDLA 3REAB 2DBKA 2CS7A 2CREA 2VGNA 1BBZA 3OYAA 1M4ZA 3URGA 1Q7YR 1KC8R 1VQLT 5FU7B 2DBMA 4HXJA 2JT4A 3I35A 4JRQA 5FU6B 2KAFA 3CD6A 3L2VA 2AK5A 4JUVA 5FWCA 4FT2A 2PTKA 1ABOA 2LRQA 4FCYA 2M16A 2K4YA 2E12A 2EFIA 2O4XB 3CCJA 2YLBA 3CC4T 3H6ZA 2DA9A 4C0GA 1UFFA 1KHCA 1QLYA 3CPWS 2BTTA 5GAN8 1LVKA 2PUKB 1Q86C 3VS2A 2K2MA 3M5AA 3PE0A 4EMHA 3SEMA 1E7OA 4KBMB 4DBQA 5GAOp 5GANe 2QA4T 3CC7T 2WSFE 2OAWA 1FX7A 2P4RA 2J6FA 1B34A 4AFSC 2C0IA 2VGMA 1QVGP 1YNZA 1M8MA 2LJ1A 3VRYA 4J9EA 2RQTA 2DLPA 1W6XA 2NUPB 2BKDN 5GMKm 2LX7A 3GNGA 4JRIA 2QGFB 5DLOA 2RQUA 4GBQA 2K5FA 1MV3A 5KH6A 5IXBA 1SSHA 1OOTA 3LGLA 3OSSC 3E1SA 1R0BG 2KXCA 1YBYA 1WX6A 3DB4A 3JSCA 4DOVA 4ZNXA 2ZPHB 1S1NA 4ZN3A 1OEBA 1YIJQ 2LCCA 3PGGA 4AFZC 1VYTA 2E10A 4C0FA 4J6XA 3TQ7P 2FZCB 2WSEE 5I11A 3QXEB 3SDZA 3MP8A 3PIOA 1TOVA 1KFZA 1ZUKA 1WA7A 3JCMP 1NE8A 5CKHA 4C92E 2CP6A 2FB7A 1TS9A 1SEMA 3CXCP 2JW4A 3QPHA 3ME9A 3QDRB 2L2PA 2A28A 3M0SA 2QQAA 3CC4A 3OW2S 1V1CA 1D1BA 2KDSA 1H641 3M57A 1RI9A 1W2BP 2L3RA 1VQMQ 3C95A 1D0YA 1YHQT 3X25B 1Q86R 4TVRA 1IREB 1VQ8Q 4BACA 3KXTA 2DIGA 2KRSA 1Z9QA 2QA4A 2KROA 3CC7A 2X4XA 2MK5A 2QEXQ 3SHWA 1UJYA 2EGEA 5L23A 1VQ6T 2D8JA 2K7AA 3CCST 3CC2Q 2L8DA 3L2UA 4JRKA 3I56Q 1SPKA 2ED0A 3THKA 2LZ6B 1XQHA 4JZ4A 1JRIA 1VQPT 4ESRA 2YUOA 2EYWA 1AZEA 4DBHA 1K73U 2A3LA 3QJYA 1JQQA 4M77F 2YSQA 2CZ6B 3QSUA 1NPRA 5A2QE 3E9FA 3CCUQ 2FRYA 4C92A 5GMKj 1PHTA 5GAMe 3RR6A 4CRIA 1WHJA 4FT4A 4C92C 3G7ZA 1ABQA 2KYBA 3OYKA 1PM3A 4C5HA 1PC0A 2QXFA 1O75A 4AG2C 3QZ9B 1M1KR 2HD0A 2L0AA 1MMAA 4M77E 4IUUA 4NL3A 2OX7A 1VQOT 2O31A 5IN1A 3AT1B 1BYMA 1X75C 3OBYA 4YTLA 2RNAA 3G4ST 2LQKA 4JJCA 4A4FA 2DK3A 3DKMA 3M0PA 4E47A 3VV0A 4F7UE 3CCRT 2X35A 4PLLA 4JRPA 3PFSA 4WTOB 1VIFA 2CZ1B 1U5SA 4M7DD 3OS5A 5HKCA 5GAMj 4DOWA 4XU0A 3CMAQ 3FLGA 1YHQA 2DVEA 2JTEA 2I0NA 2AZSA 5LJ3d 3GPLA 4D8DA 1MNDA 1OZ3A 2DL7A 5J39A 4HT8A 2GTOA 2K3YA 4E7LA 2A36A 2KK4A 2WSCE 3CCSA 2OTLQ 4M77A 4ZGEB 3A8HB 1ZUUA 1HYOA 4M77C 1VQ5T 2X51A 3SB2A 5GAN2 3O5ZA 3L2WA 1VQ7Q 2BIVA 4RTZA 3TSWA 2EJGA 1IHVA 1EZZB 2EQKA 3HTRA 1UEBA 4BD3A 4F7UA 1PSFA 4JPBW 2CZ0B 4AMCA 2KQWA 4BE0A 2LQNA 4AG1C 1NJIU 4JS5A 2D0NA 1TUDA 3C94A 4KUDK 4LE9A 3NFCA 3JCMW 2MWOA 4KH1B 3M0TA 3G4SA 3MEVA 2RMOA 4QKUA 1WI7A 2RJEA 1M1GA 2MMPA 2DL8A 1W1FA 2SRCA 3BE3A 5KYWA 3JCMd 3CCRA 1B3QA 1FMVA 4CC7A 8ATCB 5ECAA 5IH2A 2DL4A 3UWNA 2E3IA 4B6MA 1QVGS 3LGFA 4A4HA 2RA2A 4EMKB 2MAMA 3SWNA 3JB9I 2PVGB 3SWNC 3QO3A 3MPUB 3S6WA 4XTVA 2BZYA 4F17A 1M90U 3UT1A 4OB1B 2YRDA 2CP2A 1FXXA 1NYFA 2GBQA 2X4JA 3MP6A 2K5IA 3C0CA 5GANf 1NYGA 3L2QA 1IXDA 3ZL7C 2EYXA 1AT1B 2QG9B 2LQ8A 3H0IA 1VQ5A 3RMQA 1KHIA 1B34B 1SHGA 1WFWA 5GJWB 3R6OA 2DMOA 3A8LB 3EGXB 1IRXA 5CKFA 3DLMA 3MP1A 3MJXA 3OYYA 2EJ9A 5FRMA 2EGAA 1QCFA 1IGUA 5FWBA 4C5EA 1WQ7A 3HL8A 3CXCS 1YWOA 1MUZA 4M7DG 2J05A 2DO3A 2XHCA 3L42A 1ACMB 3WVDB 4M7AE 1SHFA 3FB9A 1W2BS 3QKJA 1M3CA 2FO0A 1C6VX 4HCCA 4C0DC 4GY5A 4M78B 5FRNA 4C0ZA 3FJ5A 5KYYB 4AFQC 2C0TA 2IVWA 1C0MA 3LWHA 2CP5A 3HSBA 3HRSA 3A98A 4N4IA 2HBWA 3LLRA 1X43A 2D6FA 3I9QA 3VYHB 1D3BB 5CAIA 2ESWA 3M55A 1GRIA 3ZEHA 1KG1A 4ZGDB 3UA6A 1QKWA 4PNOA 3CCVQ 2A08A 4X9DA 4C8QD 2RHIA 4FYWB 5LJ5f 1Y96A 2HDAA 3EH2A 3OYFA 5KYUA 1PKTA 8AT1B 1KQ2A 1ZLMA 3PVQA 3KUFA 3QUIA 3CCQQ 3OYMA 2J6OA 5KYNA 2DF6A 5FROA 4LUDA 4PJOA 1UGVA 1JBMA 4HCKA 4PJOC 3VS6A 1K0SA 2KT1A 4M7AA 1UE9A 3V8KA 1AOJA 1AZGB 4M7AC 2ECZA 2K3XA 1AWWA 2KEAA 1BB9A 1H92A 4P5NA 5GAN3 1X01A 4IIMA 1G2BA 3DLLA 2P0KA 1EIFA 5GAMf 3REBB 4KT0E 4C92B 5D6YA 2CP0A 2KR3A 1PRLC 2EVRA 2VV5A 4QT7A 1KC8C 4JZ3A 1PCXA 3JCMX 1YITQ 1FYNA 3M54A 3NHNA 4Z02A 4OB3B 3EG2A 1PSEA 4FM4B 4DBRA 3VJPA 3CCET 1K1ZA 4UC4A 5J3BA 3OYDA 2HEQA 1ZX6A 1WXBA 5AT1B 2RO0A 3I5RA 1X6BA 2FYKA 4OP0A 4MZPA 3CEYA 1LJOA 2L3SA 4JJBA 3CD6Q 2LT1A 2D9TA 4IUQA 4EDUA 2D0QB 1WHGA 3QYHB 5FW9A 2A7YA 4PJJA 3E19A 2RN8A 3CCJQ 4C5GA 1CKBA 2KXDA 4RG8A 1OV3A 1I07A 5DY9A 1CSKA 3JB9D 1D1AA 1U3OA 4EIKA 4HVVA 3G71T 2RQVA 3X24B 4X34A 4XTUA 3RKWA 4NS5A 1Y0MA 2DD4A 1U06A 4E2FB 1HD3A 2JJ9A 2VVKA 2Y4XA 1RI0A 4B9XA 4PFPA 1VYUA 5CO7A 3M53A 3X20B 2LNHB 4PL6A 1Q95G 1U1TA 2RM4A 4ELZC 3CCLQ 2YT6A 2EAYA 4F7UB 5CIUA 5GAN7 1WHMA 1G3YA 1PRMC 4RMOA 3O8VA 3GP8A 1WPYA 2RK2A 2Y4YA 3PMTA 1SG5A 4OGCA 5LJ3g 2HAXA 4OMLA 3CCEA 1P92A 3RIRA 2DL5A 1M8VA 2RD1A 3LH5A 2KSSA 2LJ0A 4PFZA 1NJIR 3S3MA 5GAOr 1YCSB 3OA6A 1VQLQ 3LW5E 2CDTA 1YI2T 2YUQA 1ARKA 3A8OB 2JTMA 3UDCA 1D1CA 7AT1B 2G6FX 2F2XA 1T0HA 2KT8A 1Q81U 3HFNA 2V1RA 4FIBA 3NGPA 4RG2A 2CT4A 3ZFJA 4BY6C 1M9SA 2LVMA 3M0UA 4II1A 2YRVA 5HK3A 2V8JA 4FW1A 1F1BB 3G71A 1QW1A 4M75B 2J06A 1BKBA 2LMJA 3EGDB 1I8FA 4NOYA 4J83A 5IHKA 5GAN6 2JVVA 4C8QB 3E9GA 1ZSZA 2QA4Q 1B7TA 1RLQC 4KGXB 3CC7Q 3CQTA 4PLIA 3JCMg 1ZSZC 4M7DF 2P0QA 3SFMA 3LWIA 4BI4A 1M1KC 3PTAA 1H8KA 2DZCA 1N8RU 1YIJT 4BI8B 4ANJA 5KCHA 3VS7A 3QWXX 5CVIA 2FZKB 4M7DE 3EFOB 2DXTA 4IUTA 4C0DB 2C06A 1M30A 3CBPA 3JB9G 3BDUA 3LH0A 1K8AU 2NUTB 1D0ZA 3HRUA 1YI2A 1AEYA 1R8OB 4IKFA 2DEUA 3OMGA 1ZSGA 3PMIA 2BZXA 5GMKe 2M0YA 1W70A 4WCIA 2IIMA 3PIPA 1WNLA 4FYXB 2CSQA 2CSIA 5IHIA 1VQ8T 2QQ9A 2VUBA 4F04B 1HJDA 1Y96B 1UGPB 4PJOB 1RAEB 2JOYA 2B8AA 4M7DA 4X9CA 4M7AB 3JB9J 5GAOl 4M78D 1UUEA 1KJWA 3VS1A 4QW2A 1YJ9T 1YJWT 1VQKT 1VQ6Q 3VS3A 1TG0A 3CCSQ 2OTJQ 4BB7A 3QJ6A 2J6KA 2W10A 4MMKA 3MEAA 4JLGA 1U1SA 2FPDA 1VQPQ 1QKXA 1YIJA 2F69A 3EG9A 3NMZC 3EG3A 1Q82U 1O9SA 4J9BA 4R0KA 3QIIA 4FSSA 2QDLA 1N9RA 3V7SA 2NWMA 2Y90A 4IIOA 4MZMA 1HXDA 3A1PA 2ZPEB 4LNPA 5CKBA 2O2OA 1BI1A 3OSVA 4HVUA 1OPKA 1TXQA 1VQOQ 2F1LA 3RESA 1JXMA 4RTTA 4CI0C 1KQSA 3CMAT 4J9CA 4XU3A 2YWWA 5CKDA 2MOXA 3EHQA 5GANd 4XAXB 1WZOA 2F2WA 5C0MA 4OB0B 3X26B 1UGQB 2RF0A 1VQ8A 1G3TA 2E3HA 1K9MU 2PZ1A 2GQIA 2CH4A 3G6EQ 3C12A 1YJNQ 2DPPB 1PD0A 1RLPC 4OMNA 3V7CA 2ZZDA 2DJQA 4C92D 1UGRB 3GOXA 3OYHA 3JCMV 2HMAA 5D7UA 9ATCB 1VQ7T 1Y57A 2RHUA 3M9QA 2BZ8A 1NBEB 1KIKA 4FL6A 1YJ9A 1YJWA 1VQKA 1WYXA 2P0PA 4JJNK 2W0ZA 4HKEA 2XU8A 2O01E 3C4SA 4J9IA 3VS0A 1LCKA 1I5LA 1VQ5Q 3PT9A 2HKQB 2VKNA 2XDBA 1Q7YU 1OX9A 2PQWA 2GTJA 2DYIA 4A4GA 4O5VA 3RERA 1ZBJA 2IPOB 2VXEA 4CC4B 2E1HA 3OMCA 4BDYA 1ZA1B 5KCOA 3M4GA 1BI2A 2BUDA 3QYGB 4E7KA 2V1QA 5FU6C 2RHXA 1QQJA 4BE1A 4O6JA 3JRZA 2F2VA 4PJLA 5GANh 3CMAA 5LJ5d 2KBTA 2G3RA 5LJ3h 3J7AF 2DRMA 1VIEA 2O4XA 1QVFA 4M78G 3PVLA 2DX1A 2MI6A 5CK9A 4M77D 3X28B 3MKDA 1AHJB 2E41A 2GFUA 4DEXA 4BY6B 5FLXE 2YHTA 3WVEB 3I55T 2MYSA 3VUBA 3QDFA 3QG1A 5IAYA 3HPWA 2E5KA 4PJNA 2HBPA 5I21A 5GAN4 1I4K1 1KD1U 5I2MA 1UECA 2PVOB 5GAMd 2ENMA 2KVQG 1VQ7A 2BE9B 3TEEA 1MHNA 5GAN5 1KQ1A 3ER0A 4PKCC 2DXCA 2FVUA 1AD5A 1VYVA 2NUPA 2E70A 2RJCA 2K79A 1K73C 2QI2A 3JCMQ 4LDXA 2K57A 2EKHA 1NPPA 1TUCA 4HA8A 3JCMh 4M4ZA 4D6WA 3E2UA 1G5VA 1XNIA 1G83A 4EMGA 3TVTA 3JB9F 4FYYB 4C92G 3OS0A 1N27A 4VUBA 2JN0A 5LJ5h 1IB8A 2CP7A 2A0FB 4AFUC 2EIFA 1WHKA 4M75D 3CMEQ 4RTWA 2FPEA 3CCVT 4MDXA 1K9AA 3HRTA 4KULA 1Q86U 2B86A 1K8AR 4HVWA 2GNCA 3EHRA 3MHXA 1PG5B 1NEGA 2HKNA 1VQNT 3CCQT 2LCLA 2LJ3A 1WHLA 2L3QA 2DXUA 4IUVA 1HSQA 4NL2A 3I55A 2AT1B 3QZ5B 1X69A 4XTZA 3J81E 2E65A 5KE3A 1I1JA 1TTHB 1J3TA 1NZ9A 2CYZB 4RTVA 1RAFB 4J9GA
chains in the Genus database with same CATH topology
3CCST 4MMLA 2L8DA 3L2UA 3S3MA 2F5KA 4JRKA 5GAOr 2JNGA 3OA6A 1XQHA 3NTHA 1JRIA 3LW5E 3J80E 1VQPT 1YI2T 2R5MA 4RKUE 1K73U 3A8OB 1K8AC 2JTMA 2XK0A 2DXBA 2A3LA 2HQEA 2IG0A 3QJYA 4M77F 4MDWA 2CZ6B 3UDCA 3QSUA 1NPRA 4BI3A 2P4TA 3E9FA 5A2QE 3CCMT 4BE2A 2RI2A 3HFOA 5D6XA 4C92A 2RI5A 2DAQA 5GAMe 5GMKj 2E6NA 4QQDA 4CRIA 5CR2A 3OYCA 4FT4A 3HFNA 1Q81U 4C92C 3G7ZA 4FIBA 3T9NA 3A8GB 3OYKA 3G6EA 5GAOm 4RG2A 1YJNA 1RL2A 4C5HA 3ZFJA 5HK0A 3UPUA 2JUFA 2QXFA 5GAOn 1BI0A 4BY6C 1O75A 2OTLA 2GQVA 1M9SA 2HNIA 4OGEA 4ELYC 3QZ9B 2RB6A 4PJOD 2HD0A 2LVMA 4JLIA 4M77E 4II1A 4IUUA 4NL3A 4ATOA 2YRVA 5GMKl 3TCJA 5HK3A 4WF2A 3S3NA 2L89A 2V8JA 1VQOT 5IN1A 1NJIC 1BYMA 2XI9A 1X75C 2E6ZA 3OBYA 4YTLA 5D6WA 3G71A 1S72T 1QW1A 3G4ST 3JB9H 4M75B 2PUOB 2DTHA 4LDYA 5HY6A 4M75A 4F7UG 2LQKA 2V8IA 1BIBA 5LJ3f 4A4FA 4J7FA 2DK3A 3DKMA 1BKBA 4M75C 3WXMB 2ZPGB 4E47A 2JTFA 3MO8A 2K5LA 1I8FA 4J83A 2X35A 4NOYA 4PLLA 3VV0A 4F7UE 2E64A 3CCRT 5GAN6 4JRPA 2JVVA 3JCMc 3E9GA 4C8QB 5CQXA 4XTYA 3PFSA 4C8QA 1XTDA 4PLIA 1ZBXA 1VIFA 1QP2A 2PU9B 2CZ1B 2RHYA 3CBOA 4QQ6A 4PJOF 3JCMg 3OS5A 2XKOC 2RHZA 4C8QC 5HKCA 4QQGA 3CCVA 3GIBA 2P0QA 5GAMj 4M7DF 4M7AD 3GNFB 3SFMA 4DOWA 4M7AF 4XU0A 3VYGA 2QQSA 3DB3A 3LWIA 4E7HA 1U8RA 2MF2A 3FLGA 4BI4A 1YHQA 1M1KC 1W4SA 2DVEA 3PTAA 2DZCA 1N8RU 2EYQA 1YIJT 4ZGJB 3NTKA 3P8DA 1VQNA 4BI8B 4LD9K 2ZPFB 5GMKi 3CCQA 4A4EA 5LJ3d 3GPLA 1UB4A 2MWPA 5KCHA 1OZ3A 5GMKh 2XIDA 5CQYA 3QHSA 5J39A 4PJOE 1ZHIA 4HT8A 5CVIA 1M90C 4M7DE 1Q82C 5L8RE 3AHUA 2K3YA 1HK9A 5EG2A 2DXTA 4E7LA 4IUTA 3Q1JA 2CGHA 1WJQA 4J6WA 4C0DB 5IT9E 2KK4A 2X4YA 2EQMA 4Y91A 1SSFA 2WSCE 4M77B 5DLQE 3CCSA 4OF1A 3P8BB 3RMSA 4M77A 4J6YA 2EWNA 4XK8E 2C06A 2F5TX 3A8HB 4ZGEB 5I2SA 2LC4A 3CBPA 3CMET 3JB9G 4M77C 1VQ5T 3A8MB 3BDUA 3LH0A 2DJZA 3SB2A 1K8AU 4J8OA 5GAN2 3L2WA 3HRUA 4C5IA 1VQ4T 1YI2A 2DD5A 2BIVA 1R8OB 2ZCFB 1VQ9T 4IKFA 2EJGA 3OMGA 3CCLT 3PMIA 2EKOA 5GMKe 3HHTB 2XG8D 4GLKA 3CCMA 4XQ3A 1QVGA 2EQKA 2E5QA 1UEBA 4BD3A 4F7UA 3PIPA 1PSFA 1YCYA 4Y28E 2CZ0B 3EAEA 4QVCA 4M75G 3JCMf 1YITA 2KQWA 1WNLA 2LT4A 2YLCA 4BE0A 3SD4A 2GF7A 4M7DD 5GAOq 1VQ8T 2QQ9A 2VUBA 5M9OA 4RCBA 1LOJA 5GANg 2H3JA 5GAMh 1NJIU 4JS5A 4C8QG 2XD0A 4Q5WA 4LDWA 3C94A 4XU2A 4KUDK 3FEOA 4BUGA 4EPCA 1MGQA 1Y96B 3NFCA 4ZTJA 1K9MC 4R55A 3M56A 3JCMW 2MWOA 4A54A 3L1AA 1S72A 4JS4A 3G4SA 3MEVA 1UGPB 4PJOB 1BIAA 2EQUA 4RCCA 2R5AA 3ZBDA 2JOYA 2RJEA 4J7IA 4M7DB 2B8AA 2EQJA 4M7DA 5CCAA 4A4KA 1M1GA 2MMPA 4X9CA 4M7AB 3JB9J 3JCMd 5GAOl 3CCRA 2DEQA 3MEWA 4M78D 4XTWA 2FL7A 4L6V5 2LTOA 4KUIA 4M78F 3OYLA 4QW2A 1YJ9T 1YJWT 2R58A 3FIFA 1VQKT 3UWNA 4ME7A 1ZQ1A 1OYXA 1QVGS 3CBMA 3LGFA 1M1KU 1YITT 4A4HA 1I81A 3SWNB 2RA2A 3RKYA 4EMKB 4BB7A 3A5ZB 3QJ6A 2MAMA 1XOVA 1V29B 3SWNA 3VKIA 4JDSA 4EMKA 1TH7A 4MMKA 2PVGB 3MEAA 4JLGA 4M77G 1U1SA 1X6OA 4OMFB 3JB9I 3SWNC 1YIJA 4EMKC 3QO3A 3RUXA 3S6WA 1JJ2A 3OYEA 4XTVA 1M90U 2F69A 3MEUA 4M78E 1Q82U 3UT1A 1O9SA 1Y7XA 4OB1B 4LDUA 2DIQA 4N4GA 1Y07A 5DM7R 4HCZA 5A0GA 3QIIA 1W2BA 1Q7YC 1DJ7B 2X4JA 1FXXA 1N9RA 2OAUA 2EJFA 2RK1A 2K5IA 3MP6A 3V7SA 2Y90A 1OI1A 3OYBA 4MZMA 5GANf 2ZGWA 3L2RA 1HXDA 2DTOA 2ZPEB 2QTXA 5CKBA 3L2QA 2LX9A 1Y71A 1IZ6A 3CD6T 1QVPA 1BI1A 3OSVA 3RKXA 2LQ8A 5A0DA 5LJ3e 2XICA 3CMEA 1VQ5A 3MCAB 3RMQA 1KHIA 1B34B 4R56A 3R6OA 1VQ4A 3A8LB 2WACA 5CKFA 1G3SA 3RESA 3DLMA 3MP1A 3OYYA 5A0LA 4CI0C 2EJ9A 1VQ9A 5FRMA 2PVDB 2R57A 3BW1A 3CCLA 2KY9A 1KQSA 3CMAT 3CCJT 2M1HA 3ASKA 4XU3A 4C5EA 1WQ7A 1LNXA 1UGSB 5CKDA 1H3ZA 3HL8A 5LJ5g 5GANd 4XAXB 1WJRA 3CXCS 1JB0E 4PJOG 5C0MA 2DTIA 4OB0B 1UGQB 3X26B 4M7DG 3EFSA 2DO3A 2XHCA 1VQ8A 3L42A 3F70A 1QP3A 4N4HA 2QDYB 4M7AG 2RH2A 1OZ2A 3N5BB 1JJ2S 1G3TA 1K9MU 3WVDB 3S3OA 4V2SA 3C12A 4M7AE 2DPPB 3V7CA 2ZZDA 2VYTA 3FB9A 1W2BS 2K2VA 3QKJA 2L5QA 3KBGA 4OB2B 4C92D 1UGRB 4HCCA 4C92F 3META 3GOXA 4C0DC 4GY5A 3OYGA 3OYHA 4M78B 3JCMV 4C0ZA 5FRNA 4A53A 4M78A 1WQWA 3LYIA 2I2LA 5GANj 1VQLA 2QQBA 2NLUA 4M78C 5LJ3j 2IVWA 3GF5A 1VQ7T 2GCXA 5LL6S 3LWHA 2RHUA 3HRSA 1KD1C 3HSBA 3M9QA 4FU6A 2XDPA 3FDRA 3TREA 4B9WA 2LDMA 2M9UA 4N4IA 3LLRA 4HCBA 5GAMg 4FL6A 1VQMT 2D6FA 1YJ9A 1YJWA 2KMTA 2DKGA 1VQKA 3FRNA 3JAME 2CKKA 3VYHB 3VU3C 2P0PA 1KQSS 3L2ZA 4JJNK 4HKEA 2XU8A 2HQXA 4QVZA 3BY7A 1D3BB 5CAIA 3FC3A 2O01E 3C4SA 3NTIA 3M55A 5CKEA 1D3BA 2RI3A 3HP9A 3ZEHA 1I5LA 3PT9A 1KG1A 3CPWA 4ZGDB 3OS1A 4OVAA 3JCMe 4PNOA 1WJSA 3EFRA 1G3WA 3JCMb 2QEXT 2VC8A 4X9DA 2XDBA 1Q7YU 4N0AA 2PQWA 4L59A 4LDVA 4C8QD 2RHIA 5LJ5f 3BDLA 4N0AC 1Y96A 3CC2T 3OYFA 4A4GA 2CS7A 2VGNA 4O5VA 3I56T 3JCMJ 3OYAA 1M4ZA 1KQ2A 3URGA 3RERA 3KUFA 3QUIA 3CPFA 3OYMA 3M59A 2VXEA 1VQLT 5LJ5e 2E1HA 3OMCA 4BDYA 5FU7B 5FROA 5KCOA 4PJOA 1JBMA 3M4GA 4JRQA 1BI2A 4PJOC 5FU6B 2BUDA 2KAFA 3CD6A 3L2VA 4M7AA 4M7DC 3V8KA 3QYGB 4BDZA 4JUVA 4E7KA 4L5GA 4FT2A 3CCUT 4M7AC 5FU6C 2K3XA 3OQ5A 2RHXA 4BE1A 3M58A 2OTJT 4HT9A 2LRQA 4O6JA 2M16A 2K4YA 2E12A 2EFIA 3JRZA 3OB9A 2O4XB 5GANh 5LJ5d 4P5NA 5GAN3 1X01A 3CMAA 5LJ3h 2G3RA 3CCJA 3J7AF 2O4XA 1VIEA 2YLBA 3CC4T 3DLLA 2P0KA 1QVFA 3H6ZA 4M78G 4C0GA 1EIFA 4DQ2A 5GAMf 5KE2A 3CXCA 1KHCA 2MI6A 5CK9A 4M77D 3GLXA 2LNVA 3CPWS 4KT0E 4C92B 5GAN8 5D6YA 3X28B 1FWZA 3OBWA 2PUKB 1AHJB 1Q86C 2VV5A 2E41A 2JZ2A 1KC8C 4E7JA 2GFUA 3M5AA 4E7IA 4BY6B 3JCMX 2V8KA 4EMHA 3P8HA 3M54A 5FLXE 3OYNA 2YHTA 3WVEB 4KBMB 4Z02A 5LJ5j 3I55T 3VUBA 4DA4A 2RJDA 4OB3B 2VXFA 4F7UF 4XTXA 3FJPA 1PSEA 3QG1A 5IAYA 3HPWA 4FM4B 5GANe 5GAOp 2HBPA 5I21A 2ZPBB 5GAN4 2QA4T 3CC7T 1I4K1 2WSFE 5J26A 4ZN1A 1KD1U 3VJPA 3CCET 4UC4A 5J3BA 1FX7A 5I2MA 2PVOB 5GAMd 3OYDA 1VQ7A 2KVQG 1B34A 2VGMA 3TEEA 1MHNA 2RO0A 5GAN5 1KQ1A 3ER0A 3QBYA 4PKCC 2DXCA 1VQMA 2FVUA 2FYKA 2BKDN 2RJFA 5GMKm 4OP0A 4MZPA 2E70A 3GNGA 3INZA 3CEYA 2RJCA 4JRIA 3HKSA 1LJOA 2QQRA 5DLOA 3VUZA 2CZ7B 2K5FA 2LT1A 3BFMA 3OW2A 5KH6A 3H8ZA 1QVFS 2D9TA 1K73C 2QI2A 4IUQA 2FHDA 3LGLA 4EDUA 3OSSC 3E1SA 2D0QB 2XDDA 3QYHB 3JCMQ 3G6ET 1YJNT 4LDXA 3LX7A 2DZ9A 1YBYA 2A7YA 3V7RA 3DB4A 3JSCA 4DOVA 1WGSA 2QEXA 3E19A 1Q81C 2K57A 2ZPHB 1M1FA 1NPPA 3CC2A 2OTLT 4J5YA 4HA8A 4MZTA 4C5GA 4ZN3A 3V8LA 3I56A 2LCCA 4RG8A 3JCMh 4D6WA 3PGGA 1G5VA 1XNIA 4XU1A 2ZPIB 3M4YA 2E10A 5DY9A 4C0FA 4EMGA 4J6XA 2WSEE 3JB9D 1GXIE 3QXEB 3JB9F 3G71T 5AYFA 3SDZA 3MP8A 4X34A 4XTUA 3X24B 3RKWA 4NS5A 3V8JA 4C92G 3PIOA 3OS2A 2GFAA 3CCUA 1BI3A 2DD4A 3OS0A 1N27A 3JCMP 4VUBA 2JN0A 1NE8A 5CKHA 5LJ5h 4C92E 1VQ6A 4FSXA 2FB7A 1M5Q1 2Y4XA 4QVDA 2OTJA 1RI0A 1N6AA 3QPHA 4B9XA 3ME9A 2EIFA 3PNWC 4LD6A 3QDRB 4M75D 3OYIA 3X20B 5CO7A 3M53A 1VQ6T 4M75F 1VQPA 2QQAA 1N9SA 3CC4A 1VUBA 3CCVT 3OW2S 2KDSA 4MDXA 1H641 3HRTA 4PL6A 1U1TA 4KULA 2RM4A 1Q86U 4ELZC 3M57A 1KC8U 2EAYA 2L3RA 3TU4K 2X4WA 3C95A 4C8QF 4F7UB 1YHQT 3MHXA 3X25B 5CIUA 2KSSA 2M0OA 5GAN7 1VQNT 1G3YA 3CCQT 4RMOA 3O8VA 2LCLA 4TVRA 3GP8A 1WPYA 2RK2A 1N8RC 2DXUA 4IUVA 3OY9A 1IREB 2Y4YA 3PMTA 4M75E 4NL2A 3I55A 4BACA 3QZ5B 4OGCA 2DIGA 3KXTA 4XTZA 5C6SA 4IUPA 5LJ3g 3J81E 5FU7C 2E65A 2QA4A 2HAXA 3CC7A 2X4XA 5KE3A 3CCEA 1P92A 1NZ9A 3RIRA 3OYJA 2CYZB 4C8QE 2RD1A 4ZTFA 1VQOA 2AHJB 1M8VA 4IURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z02 A;  3OMG A;  2L8D A;  3P8H A;  2EKO A;  2F5K A;  2RJD A;  3PMI A;  3L2U A;  3S3M A;  3L42 A;  3F70 A;  4N4H A;  2EQK A;  1OZ2 A;  5IAY A;  3OA6 A;  2E5Q A;  3NTH A;  4BD3 A;  5J26 A;  3EAE A;  3S3O A;  4UC4 A;  2VYT A;  2R5M A;  3OYD A;  3QKJ A;  4BE0 A;  3SD4 A;  2XK0 A;  2GF7 A;  2HQE A;  2IG0 A;  1MHN A;  2RO0 A;  3MET A;  3GOX A;  4GY5 A;  5M9O A;  3E9F A;  3OYG A;  3OYH A;  4BE2 A;  5FRN A;  2RI2 A;  5D6X A;  2RI5 A;  2DAQ A;  3QBY A;  2E6N A;  4QQD A;  4CRI A;  3OYC A;  3LYI A;  2BKD N;  2RJF A;  4Q5W A;  2NLU A;  3OYK A;  3FEO A;  4RG2 A;  4C5H A;  3CEY A;  2RJC A;  2QQR A;  4ZTJ A;  2RHU A;  3M9Q A;  4FU6 A;  2XDP A;  3FDR A;  4B9W A;  2MWO A;  5KH6 A;  2LDM A;  3H8Z A;  4N4I A;  2D9T A;  3LLR A;  4IUQ A;  4FL6 A;  3MEV A;  2FHD A;  3LGL A;  4EDU A;  2EQU A;  2LVM A;  2R5A A;  2CKK A;  2RJE A;  4II1 A;  4IUU A;  2B8A A;  2YRV A;  2EQJ A;  3LX7 A;  3S3N A;  3DB4 A;  4QVZ A;  1WGS A;  2HQX A;  2L89 A;  5IN1 A;  3FC3 A;  3C4S A;  3NTI A;  3MEW A;  2RI3 A;  5D6W A;  3ZEH A;  2LTO A;  3OYL A;  4C5G A;  4QW2 A;  3OS1 A;  2R58 A;  2LCC A;  4OVA A;  3UWN A;  1G5V A;  1WJS A;  1OYX A;  1XNI A;  4A4F A;  3LGF A;  2PQW A;  2JTF A;  3MO8 A;  4L59 A;  4A4H A;  2X35 A;  4PLL A;  2RHI A;  3BDL A;  3QJ6 A;  3E9G A;  3OYF A;  4A4G A;  3PFS A;  3MP8 A;  4X34 A;  3MEA A;  4NS5 A;  4PLI A;  3OS2 A;  3OYA A;  2GFA A;  4QQ6 A;  2RHY A;  3OS0 A;  3KUF A;  1N27 A;  3OYM A;  2RHZ A;  4QQG A;  3S6W A;  3OMC A;  4BDY A;  5FRO A;  5KCO A;  3OYE A;  3MEU A;  3UT1 A;  1RI0 A;  2DIQ A;  4E7H A;  2QQS A;  2BUD A;  3DB3 A;  3ME9 A;  3PNW C;  4LD6 A;  3FLG A;  4HCZ A;  4N4G A;  4B9X A;  3QII A;  3OYI A;  3L2V A;  4BDZ A;  4E7K A;  3MP6 A;  3NTK A;  3P8D A;  1OI1 A;  2K3X A;  3OQ5 A;  3OYB A;  3L2R A;  4A4E A;  2RHX A;  4PL6 A;  4BE1 A;  2MWP A;  5KCH A;  1OZ3 A;  2LRQ A;  3L2Q A;  2M16 A;  2EFI A;  2L3R A;  3OB9 A;  5J39 A;  2X4W A;  2O4X B;  2G3R A;  5CIU A;  2K3Y A;  2M0O A;  2O4X A;  4E7L A;  2P0K A;  4IUT A;  3H6Z A;  3Q1J A;  1WJQ A;  5KE2 A;  3O8V A;  1KHC A;  2WAC A;  2X4Y A;  2EQM A;  3DLM A;  3MP1 A;  4IUV A;  1SSF A;  3OY9 A;  3PMT A;  5FRM A;  2R57 A;  5D6Y A;  4BAC A;  2DIG A;  5C6S A;  2M1H A;  4IUP A;  3ASK A;  2JZ2 A;  4C5E A;  4E7J A;  2X4X A;  2GFU A;  3LH0 A;  5KE3 A;  4E7I A;  1H3Z A;  3L2W A;  3OYJ A;  4C5I A;  4ZTF A;  1WJR A;  2BIV A;  5C0M A;  3OYN A;  4IKF A;  4IUR A; 
#chains in the Genus database with same CATH topology
 1KQS P;  2D8H A;  4MML A;  1WHH A;  2F5K A;  2YXY A;  3NTH A;  3J80 E;  1SRL A;  4RTU A;  2XMF A;  2IG0 A;  1AVZ C;  4MDW A;  4BI3 A;  2P4T A;  3CCM T;  4BE2 A;  5D6X A;  4Z89 A;  2DAQ A;  4QQD A;  1K73 R;  3A8G B;  5GAO m;  1MMN A;  5HK0 A;  3UPU A;  4AT1 B;  5GAO n;  4ELY C;  4OGE A;  2RB6 A;  4RTY A;  4JLI A;  4ATO A;  1TWB A;  1NJI C;  4WF2 A;  2L89 A;  2LCS A;  2E6Z A;  5D6W A;  1S72 T;  1YFN A;  2DTH A;  4LDY A;  1K76 A;  1Q82 R;  4F7U G;  2V8I A;  1BIB A;  4CC2 A;  4J7F A;  2AZV A;  2DVJ A;  2JTF A;  3MO8 A;  2K5L A;  1BK2 A;  3JCM c;  1XTD A;  1ZBX A;  3CCE Q;  1QP2 A;  4QQ6 A;  4PJO D;  2XKO C;  3CCV A;  4J9F A;  4M7A D;  3GNF B;  3DB3 A;  1U8R A;  2MF2 A;  1W4S A;  2EYQ A;  3NTK A;  1VQN A;  2ZPF B;  3CCQ A;  1K0X A;  2X3W D;  1BCO A;  3QHS A;  1M90 C;  5L8R E;  1HK9 A;  3Q1J A;  2CGH A;  1WJQ A;  4J6W A;  5EC7 A;  1IGQ A;  1R77 A;  2X4Y A;  2DM1 A;  4Y91 A;  4M77 B;  4OF1 A;  3P8B B;  2EQI A;  4J6Y A;  2EWN A;  1QVF P;  2LC4 A;  3A8M B;  2BE7 D;  1I5O B;  2DJZ A;  2EPD A;  4J8O A;  2E4H A;  1VQ4 T;  2ZCF B;  1VQ9 T;  3CCL T;  1MNE A;  4GLK A;  3CCM A;  4XQ3 A;  1GBR A;  4E6R A;  2E5Q A;  1NLP C;  1YCY A;  4Y28 E;  4M75 G;  1YIT A;  2YLC A;  3SD4 A;  2GF7 A;  5M9O A;  2HCK A;  4RCB A;  4E7S A;  5GAN g;  2H3J A;  4F16 A;  4C8Q G;  1WXU A;  4Q5W A;  4LDW A;  1IHW A;  3FEO A;  5IHN A;  4A54 A;  1SRM A;  3L1A A;  1S72 A;  1OU9 A;  2DL3 A;  2YDL A;  2R5A A;  5KYW B;  1K4U S;  2VB6 A;  2EQJ A;  4PK4 A;  5CCA A;  1RAB B;  2DEQ A;  2K6D A;  1XJW B;  2FL7 A;  4L6V 5;  3OYL A;  4KUI A;  4M78 F;  3FIF A;  3RNJ A;  1ZQ1 A;  1OUL A;  3SWN B;  3RKY A;  1X2K A;  5I22 A;  1PD1 A;  1V29 B;  3VKI A;  4EMK A;  1TH7 A;  4A63 B;  3CC4 Q;  4EMK C;  3IQL A;  1YI2 Q;  1JJ2 A;  3OYE A;  4M78 E;  3GBQ A;  1I0C A;  4LDU A;  2DIQ A;  4N4G A;  1Y07 A;  5A0G A;  2DFU A;  1DJ7 B;  2OAU A;  2EJF A;  1M90 R;  1OI1 A;  3OYB A;  1NLO C;  2ZGW A;  2DTO A;  2LX9 A;  1Y71 A;  1QVP A;  2ATC B;  3RKX A;  5LJ3 e;  6AT1 B;  1AWX A;  1BCM A;  1QWE A;  1WLP B;  4RTX A;  3M0R A;  2QTV A;  1VQ4 A;  2CH4 W;  1VQ9 A;  2R57 A;  3BW1 A;  3EGX A;  3CCL A;  2KY9 A;  1KD1 R;  3ASK A;  1UGS B;  1H3Z A;  1UHF A;  5LJ5 g;  1WJR A;  3EGU A;  1JB0 E;  4PJO G;  2DTI A;  4M7A G;  2RH2 A;  4DBF A;  2C0O A;  4KGV B;  1WIE A;  4V2S A;  2AIR B;  3G1J A;  3H0H A;  2K2V A;  2RPN A;  4OB2 B;  2DRK A;  4C92 F;  5KYX A;  2JS0 A;  4M78 A;  1WQW A;  2SEM A;  5GAN j;  1VQL A;  2QQB A;  5LJ3 j;  4M78 C;  5KYY A;  1E6G A;  2GCX A;  4K11 A;  4Y92 A;  4FU6 A;  3TRE A;  2MPX C;  1SKU B;  2M9U A;  4HCB A;  5GAM g;  3H9N A;  1VQM T;  2KMT A;  2X9H A;  2DKG A;  1MMG A;  2CKK A;  3JAM E;  2YUP A;  2D1X A;  1KQS S;  3L2Z A;  1RUW A;  2HL5 C;  2PNI A;  4QVZ A;  1JO8 A;  1D3B A;  2RI3 A;  3CPW A;  1M2V A;  2O88 A;  1OPL A;  1B07 A;  4OVA A;  3JCM e;  3JCM b;  1GCP A;  2QEX T;  1UDL A;  1GFD A;  4N0A A;  1TU0 B;  4LDV A;  1FMW A;  5KYU B;  1LPL A;  4KH0 B;  4N0A C;  1YHQ Q;  3CC2 T;  3I56 T;  3JCM J;  3CPF A;  3M59 A;  4Z8A A;  5LJ5 e;  2QK0 A;  2KYM A;  2OI3 A;  4M7D C;  4BDZ A;  1IO6 A;  4L5G A;  3CCU T;  3OQ5 A;  2EW3 A;  2YRC A;  2FG0 A;  3M58 A;  4J9D A;  4HT9 A;  2OTJ T;  3UAT A;  3OB9 A;  3M0Q A;  3VS4 A;  2DE0 X;  1RAA B;  4LXC A;  2NUZ A;  5KE2 A;  4DQ2 A;  2JM8 A;  3GLX A;  2JMA A;  2LNV A;  3EG1 A;  1FWZ A;  1YJ9 Q;  3OBW A;  2RQW A;  1YJW Q;  1VQK Q;  2JZ2 A;  3R6N A;  1EX4 A;  2COZ A;  2V26 A;  4E7J A;  3U23 A;  4E7I A;  4ORZ A;  2V8K A;  3P8H A;  3OYN A;  5LJ5 j;  4DA4 A;  5IXF A;  2RJD A;  2VXF A;  4F7U F;  4XTX A;  3FJP A;  2ZPB B;  4FW2 A;  5J26 A;  4ZN1 A;  2P84 A;  1WDX A;  1ZA2 B;  1KK7 A;  2L3P A;  1FMK A;  3G4S Q;  2EYZ A;  3QBY A;  1VQM A;  1VOM A;  2O9S A;  1QCN A;  2RJF A;  1WXT A;  3INZ A;  3HKS A;  2QQR A;  3CCR Q;  2HQH A;  2LP5 A;  3VUZ A;  2CZ7 B;  1GFC A;  3BFM A;  3OW2 A;  1QVF S;  3H8Z A;  2FHD A;  1CKA A;  2AKL A;  1T3L A;  2XDD A;  1RAG B;  3G6E T;  1YJN T;  3LX7 A;  2DZ9 A;  2QEX A;  3V7R A;  1VA7 A;  1WGS A;  1Q81 C;  1KSW A;  1M1F A;  3CC2 A;  2OTL T;  1YN8 A;  4J5Y A;  4MZT A;  1M3B A;  3V8L A;  3I56 A;  2FZG B;  1OX8 A;  1R0C B;  1UG1 A;  4XU1 A;  2ZPI B;  2FEI A;  3M4Y A;  1OQK A;  1GXI E;  1AWO A;  4CC3 A;  5AYF A;  1M27 C;  3V8J A;  3OS2 A;  2GFA A;  3CCU A;  1BI3 A;  1VQ6 A;  4FSX A;  2Z0W A;  1M5Q 1;  3QWY A;  2A37 A;  4QVD A;  2OTJ A;  1N6A A;  2QYZ A;  3PNW C;  4LD6 A;  2M51 A;  3OYI A;  2COY A;  4M75 F;  1VQP A;  1N9S A;  1JJ2 P;  1VUB A;  1UTI A;  1MMD A;  2AKK A;  1KC8 U;  3TU4 K;  2X4W A;  4C8Q F;  2M0O A;  2EGC A;  4OMO A;  1RAI B;  1N8R C;  3OY9 A;  1QCO A;  4M75 E;  5C6S A;  4IUP A;  1G8X A;  5FU7 C;  2H3E B;  2ROL A;  3OYJ A;  4C8Q E;  4ZTF A;  1VQO A;  2AHJ B;  4IUR A;  4J9H A;  2HZY A;  2JNG A;  1JEG A;  4D8K A;  1QMC A;  2GGR A;  2R5M A;  1GBQ A;  4RKU E;  1K8A C;  2XK0 A;  2DXB A;  2HQE A;  2CT3 A;  1AWJ A;  2OJ2 A;  2RI2 A;  1TSF A;  3HFO A;  2RI5 A;  1D09 B;  2QGG A;  1NEB A;  2E6N A;  5CR2 A;  4PFO A;  1JU5 C;  3OYC A;  2FPF A;  3RDV A;  3T9N A;  2EYY A;  2KRN A;  2MCN A;  3G6E A;  1YJN A;  1RL2 A;  3KFV A;  2JUF A;  1D0X A;  1Q81 R;  1BI0 A;  2OTL A;  2GQV A;  2HNI A;  2NYS A;  1X27 A;  1UJ0 A;  2O9V A;  4PJM A;  3JV3 A;  4JJD A;  5GMK l;  3TCJ A;  3S3N A;  1EFN A;  2XI9 A;  2M02 A;  2COW A;  2DER A;  3JB9 H;  2PUO B;  2YUN A;  3VRZ A;  1Z9Z A;  5HY6 A;  4M75 A;  1M2O A;  2ZAE A;  5LJ3 f;  1E6H A;  4M75 C;  3WXM B;  2DIL A;  2DNU A;  2ZPG B;  3I55 Q;  1V76 A;  1ZSZ B;  2E64 A;  3EGD A;  3CPW P;  5CQX A;  4XTY A;  1X6G A;  4C8Q A;  2LQW A;  2PU9 B;  3CBO A;  2RHY A;  4PJO F;  3GIB A;  4C8Q C;  3ULR B;  2RHZ A;  4QQG A;  4OMM A;  3H41 A;  4RUG A;  4M7A F;  2KNB B;  3VYG A;  4E7H A;  2QQS A;  2VWF A;  4DEY A;  4ZGJ B;  3P8D A;  2DYB A;  2K3B A;  4LD9 K;  5GMK i;  4A4E A;  1UB4 A;  2CP3 A;  2MWP A;  5GMK h;  2XID A;  5CQY A;  1N8R R;  4PJO E;  2K9G A;  1ZHI A;  1Q82 C;  3AHU A;  5EG2 A;  3EFO A;  2KGT A;  4GLM A;  1GCQ A;  5IT9 E;  2FRW A;  1SF9 A;  2EQM A;  5KYX B;  1C1A A;  1SSF A;  5DLQ E;  1GCQ C;  1RAD B;  3RMS A;  4XK8 E;  2F5T X;  5I2S A;  3CME T;  2JS2 A;  1PKS A;  2J7I A;  4C5I A;  2NUT A;  2DD5 A;  2EKO A;  3HHT B;  2XG8 D;  1QVG A;  1RAC B;  2RQR A;  3EAE A;  1H3H A;  2ABL A;  4QVC A;  2JM9 A;  3JCM f;  2LT4 A;  3UF4 A;  2ED1 A;  2MIO A;  5GAO q;  1M2V B;  1LOJ A;  3RBB B;  5GAM h;  2XD0 A;  4XU2 A;  1RAH B;  4KGZ B;  4BUG A;  4EPC A;  1MGQ A;  1K9M C;  4ZTJ A;  4R55 A;  3M56 A;  1N5Z A;  1M3A A;  2DET A;  1VQN Q;  4JS4 A;  1BIA A;  2EQU A;  4RCC A;  3ZBD A;  4M7D B;  4J7I A;  1UHC A;  4KRT A;  4A4K A;  3OW2 P;  3MEW A;  4XTW A;  2LTO A;  2KE9 A;  2R58 A;  2QAS A;  4OMP A;  1NG2 A;  4ME7 A;  1OYX A;  3CBM A;  1M1K U;  1YIT T;  4Z88 A;  1I81 A;  2VAS A;  3A5Z B;  1XOV A;  4E7Z A;  3CXC A;  4JDS A;  4M77 G;  4OMF B;  1X6O A;  3VS5 A;  2ROT A;  4OMQ A;  3RUX A;  3EG9 B;  1A0N B;  2HL3 A;  3MEU A;  1Y7X A;  3CCM Q;  5DM7 R;  4HCZ A;  1Q7Y C;  1W2B A;  2RK1 A;  4LUE A;  3L2R A;  2KRM A;  4FYV B;  2QTX A;  1IZ6 A;  3CD6 T;  3EG0 A;  5A0D A;  2XIC A;  1BU1 A;  3CME A;  4LN2 A;  3MCA B;  1QWF A;  4R56 A;  2WAC A;  1T0J A;  1G3S A;  5A0L A;  2PVD B;  1S72 Q;  3H0F A;  1PWT A;  1X2Q A;  3CCJ T;  2M1H A;  3UA7 A;  5HCK A;  1ZUY A;  1LNX A;  1NM7 A;  3EFS A;  1PNJ A;  4N4H A;  3F70 A;  1QP3 A;  2QDY B;  4X1V A;  1OZ2 A;  3N5B B;  2HSE B;  1JJ2 S;  1OU8 A;  1YWP A;  5GJV B;  3TSZ A;  3S3O A;  1TUG B;  2VYT A;  3EH1 A;  2L5Q A;  2JMC A;  3KBG A;  2H8H A;  3MET A;  1K9M R;  3OYG A;  2JXB A;  3D7S B;  4A53 A;  3I5S A;  1MV0 B;  1T3S A;  3LYI A;  2I2L A;  2KI7 A;  1YP5 A;  2NLU A;  1JXO A;  3GF5 A;  2QAZ A;  5LL6 S;  1KD1 C;  2XDP A;  3FDR A;  4B9W A;  3G71 Q;  2LDM A;  4F14 A;  2X3X D;  2CUB A;  3FRN A;  3VU3 C;  2HQX A;  3BY7 A;  3FC3 A;  5CKE A;  3NTI A;  2HSP A;  3HP9 A;  3OS1 A;  2CUD A;  2EBP A;  1VQ4 Q;  1WJS A;  3EFR A;  1G3W A;  1VQ9 Q;  2VC8 A;  3NPF A;  4L59 A;  1GL5 A;  3BDL A;  3REA B;  2DBK A;  2CS7 A;  2CRE A;  2VGN A;  1BBZ A;  3OYA A;  1M4Z A;  3URG A;  1Q7Y R;  1KC8 R;  1VQL T;  5FU7 B;  2DBM A;  4HXJ A;  2JT4 A;  3I35 A;  4JRQ A;  5FU6 B;  2KAF A;  3CD6 A;  3L2V A;  2AK5 A;  4JUV A;  5FWC A;  4FT2 A;  2PTK A;  1ABO A;  2LRQ A;  4FCY A;  2M16 A;  2K4Y A;  2E12 A;  2EFI A;  2O4X B;  3CCJ A;  2YLB A;  3CC4 T;  3H6Z A;  2DA9 A;  4C0G A;  1UFF A;  1KHC A;  1QLY A;  3CPW S;  2BTT A;  5GAN 8;  1LVK A;  2PUK B;  1Q86 C;  3VS2 A;  2K2M A;  3M5A A;  3PE0 A;  4EMH A;  3SEM A;  1E7O A;  4KBM B;  4DBQ A;  5GAO p;  5GAN e;  2QA4 T;  3CC7 T;  2WSF E;  2OAW A;  1FX7 A;  2P4R A;  2J6F A;  1B34 A;  4AFS C;  2C0I A;  2VGM A;  1QVG P;  1YNZ A;  1M8M A;  2LJ1 A;  3VRY A;  4J9E A;  2RQT A;  2DLP A;  1W6X A;  2NUP B;  2BKD N;  5GMK m;  2LX7 A;  3GNG A;  4JRI A;  2QGF B;  5DLO A;  2RQU A;  4GBQ A;  2K5F A;  1MV3 A;  5KH6 A;  5IXB A;  1SSH A;  1OOT A;  3LGL A;  3OSS C;  3E1S A;  1R0B G;  2KXC A;  1YBY A;  1WX6 A;  3DB4 A;  3JSC A;  4DOV A;  4ZNX A;  2ZPH B;  1S1N A;  4ZN3 A;  1OEB A;  1YIJ Q;  2LCC A;  3PGG A;  4AFZ C;  1VYT A;  2E10 A;  4C0F A;  4J6X A;  3TQ7 P;  2FZC B;  2WSE E;  5I11 A;  3QXE B;  3SDZ A;  3MP8 A;  3PIO A;  1TOV A;  1KFZ A;  1ZUK A;  1WA7 A;  3JCM P;  1NE8 A;  5CKH A;  4C92 E;  2CP6 A;  2FB7 A;  1TS9 A;  1SEM A;  3CXC P;  2JW4 A;  3QPH A;  3ME9 A;  3QDR B;  2L2P A;  2A28 A;  3M0S A;  2QQA A;  3CC4 A;  3OW2 S;  1V1C A;  1D1B A;  2KDS A;  1H64 1;  3M57 A;  1RI9 A;  1W2B P;  2L3R A;  1VQM Q;  3C95 A;  1D0Y A;  1YHQ T;  3X25 B;  1Q86 R;  4TVR A;  1IRE B;  1VQ8 Q;  4BAC A;  3KXT A;  2DIG A;  2KRS A;  1Z9Q A;  2QA4 A;  2KRO A;  3CC7 A;  2X4X A;  2MK5 A;  2QEX Q;  3SHW A;  1UJY A;  2EGE A;  5L23 A;  1VQ6 T;  2D8J A;  2K7A A;  3CCS T;  3CC2 Q;  2L8D A;  3L2U A;  4JRK A;  3I56 Q;  1SPK A;  2ED0 A;  3THK A;  2LZ6 B;  1XQH A;  4JZ4 A;  1JRI A;  1VQP T;  4ESR A;  2YUO A;  2EYW A;  1AZE A;  4DBH A;  1K73 U;  2A3L A;  3QJY A;  1JQQ A;  4M77 F;  2YSQ A;  2CZ6 B;  3QSU A;  1NPR A;  5A2Q E;  3E9F A;  3CCU Q;  2FRY A;  4C92 A;  5GMK j;  1PHT A;  5GAM e;  3RR6 A;  4CRI A;  1WHJ A;  4FT4 A;  4C92 C;  3G7Z A;  1ABQ A;  2KYB A;  3OYK A;  1PM3 A;  4C5H A;  1PC0 A;  2QXF A;  1O75 A;  4AG2 C;  3QZ9 B;  1M1K R;  2HD0 A;  2L0A A;  1MMA A;  4M77 E;  4IUU A;  4NL3 A;  2OX7 A;  1VQO T;  2O31 A;  5IN1 A;  3AT1 B;  1BYM A;  1X75 C;  3OBY A;  4YTL A;  2RNA A;  3G4S T;  2LQK A;  4JJC A;  4A4F A;  2DK3 A;  3DKM A;  3M0P A;  4E47 A;  3VV0 A;  4F7U E;  3CCR T;  2X35 A;  4PLL A;  4JRP A;  3PFS A;  4WTO B;  1VIF A;  2CZ1 B;  1U5S A;  4M7D D;  3OS5 A;  5HKC A;  5GAM j;  4DOW A;  4XU0 A;  3CMA Q;  3FLG A;  1YHQ A;  2DVE A;  2JTE A;  2I0N A;  2AZS A;  5LJ3 d;  3GPL A;  4D8D A;  1MND A;  1OZ3 A;  2DL7 A;  5J39 A;  4HT8 A;  2GTO A;  2K3Y A;  4E7L A;  2A36 A;  2KK4 A;  2WSC E;  3CCS A;  2OTL Q;  4M77 A;  4ZGE B;  3A8H B;  1ZUU A;  1HYO A;  4M77 C;  1VQ5 T;  2X51 A;  3SB2 A;  5GAN 2;  3O5Z A;  3L2W A;  1VQ7 Q;  2BIV A;  4RTZ A;  3TSW A;  2EJG A;  1IHV A;  1EZZ B;  2EQK A;  3HTR A;  1UEB A;  4BD3 A;  4F7U A;  1PSF A;  4JPB W;  2CZ0 B;  4AMC A;  2KQW A;  4BE0 A;  2LQN A;  4AG1 C;  1NJI U;  4JS5 A;  2D0N A;  1TUD A;  3C94 A;  4KUD K;  4LE9 A;  3NFC A;  3JCM W;  2MWO A;  4KH1 B;  3M0T A;  3G4S A;  3MEV A;  2RMO A;  4QKU A;  1WI7 A;  2RJE A;  1M1G A;  2MMP A;  2DL8 A;  1W1F A;  2SRC A;  3BE3 A;  5KYW A;  3JCM d;  3CCR A;  1B3Q A;  1FMV A;  4CC7 A;  8ATC B;  5ECA A;  5IH2 A;  2DL4 A;  3UWN A;  2E3I A;  4B6M A;  1QVG S;  3LGF A;  4A4H A;  2RA2 A;  4EMK B;  2MAM A;  3SWN A;  3JB9 I;  2PVG B;  3SWN C;  3QO3 A;  3MPU B;  3S6W A;  4XTV A;  2BZY A;  4F17 A;  1M90 U;  3UT1 A;  4OB1 B;  2YRD A;  2CP2 A;  1FXX A;  1NYF A;  2GBQ A;  2X4J A;  3MP6 A;  2K5I A;  3C0C A;  5GAN f;  1NYG A;  3L2Q A;  1IXD A;  3ZL7 C;  2EYX A;  1AT1 B;  2QG9 B;  2LQ8 A;  3H0I A;  1VQ5 A;  3RMQ A;  1KHI A;  1B34 B;  1SHG A;  1WFW A;  5GJW B;  3R6O A;  2DMO A;  3A8L B;  3EGX B;  1IRX A;  5CKF A;  3DLM A;  3MP1 A;  3MJX A;  3OYY A;  2EJ9 A;  5FRM A;  2EGA A;  1QCF A;  1IGU A;  5FWB A;  4C5E A;  1WQ7 A;  3HL8 A;  3CXC S;  1YWO A;  1MUZ A;  4M7D G;  2J05 A;  2DO3 A;  2XHC A;  3L42 A;  1ACM B;  3WVD B;  4M7A E;  1SHF A;  3FB9 A;  1W2B S;  3QKJ A;  1M3C A;  2FO0 A;  1C6V X;  4HCC A;  4C0D C;  4GY5 A;  4M78 B;  5FRN A;  4C0Z A;  3FJ5 A;  5KYY B;  4AFQ C;  2C0T A;  2IVW A;  1C0M A;  3LWH A;  2CP5 A;  3HSB A;  3HRS A;  3A98 A;  4N4I A;  2HBW A;  3LLR A;  1X43 A;  2D6F A;  3I9Q A;  3VYH B;  1D3B B;  5CAI A;  2ESW A;  3M55 A;  1GRI A;  3ZEH A;  1KG1 A;  4ZGD B;  3UA6 A;  1QKW A;  4PNO A;  3CCV Q;  2A08 A;  4X9D A;  4C8Q D;  2RHI A;  4FYW B;  5LJ5 f;  1Y96 A;  2HDA A;  3EH2 A;  3OYF A;  5KYU A;  1PKT A;  8AT1 B;  1KQ2 A;  1ZLM A;  3PVQ A;  3KUF A;  3QUI A;  3CCQ Q;  3OYM A;  2J6O A;  5KYN A;  2DF6 A;  5FRO A;  4LUD A;  4PJO A;  1UGV A;  1JBM A;  4HCK A;  4PJO C;  3VS6 A;  1K0S A;  2KT1 A;  4M7A A;  1UE9 A;  3V8K A;  1AOJ A;  1AZG B;  4M7A C;  2ECZ A;  2K3X A;  1AWW A;  2KEA A;  1BB9 A;  1H92 A;  4P5N A;  5GAN 3;  1X01 A;  4IIM A;  1G2B A;  3DLL A;  2P0K A;  1EIF A;  5GAM f;  3REB B;  4KT0 E;  4C92 B;  5D6Y A;  2CP0 A;  2KR3 A;  1PRL C;  2EVR A;  2VV5 A;  4QT7 A;  1KC8 C;  4JZ3 A;  1PCX A;  3JCM X;  1YIT Q;  1FYN A;  3M54 A;  3NHN A;  4Z02 A;  4OB3 B;  3EG2 A;  1PSE A;  4FM4 B;  4DBR A;  3VJP A;  3CCE T;  1K1Z A;  4UC4 A;  5J3B A;  3OYD A;  2HEQ A;  1ZX6 A;  1WXB A;  5AT1 B;  2RO0 A;  3I5R A;  1X6B A;  2FYK A;  4OP0 A;  4MZP A;  3CEY A;  1LJO A;  2L3S A;  4JJB A;  3CD6 Q;  2LT1 A;  2D9T A;  4IUQ A;  4EDU A;  2D0Q B;  1WHG A;  3QYH B;  5FW9 A;  2A7Y A;  4PJJ A;  3E19 A;  2RN8 A;  3CCJ Q;  4C5G A;  1CKB A;  2KXD A;  4RG8 A;  1OV3 A;  1I07 A;  5DY9 A;  1CSK A;  3JB9 D;  1D1A A;  1U3O A;  4EIK A;  4HVV A;  3G71 T;  2RQV A;  3X24 B;  4X34 A;  4XTU A;  3RKW A;  4NS5 A;  1Y0M A;  2DD4 A;  1U06 A;  4E2F B;  1HD3 A;  2JJ9 A;  2VVK A;  2Y4X A;  1RI0 A;  4B9X A;  4PFP A;  1VYU A;  5CO7 A;  3M53 A;  3X20 B;  2LNH B;  4PL6 A;  1Q95 G;  1U1T A;  2RM4 A;  4ELZ C;  3CCL Q;  2YT6 A;  2EAY A;  4F7U B;  5CIU A;  5GAN 7;  1WHM A;  1G3Y A;  1PRM C;  4RMO A;  3O8V A;  3GP8 A;  1WPY A;  2RK2 A;  2Y4Y A;  3PMT A;  1SG5 A;  4OGC A;  5LJ3 g;  2HAX A;  4OML A;  3CCE A;  1P92 A;  3RIR A;  2DL5 A;  1M8V A;  2RD1 A;  3LH5 A;  2KSS A;  2LJ0 A;  4PFZ A;  1NJI R;  3S3M A;  5GAO r;  1YCS B;  3OA6 A;  1VQL Q;  3LW5 E;  2CDT A;  1YI2 T;  2YUQ A;  1ARK A;  3A8O B;  2JTM A;  3UDC A;  1D1C A;  7AT1 B;  2G6F X;  2F2X A;  1T0H A;  2KT8 A;  1Q81 U;  3HFN A;  2V1R A;  4FIB A;  3NGP A;  4RG2 A;  2CT4 A;  3ZFJ A;  4BY6 C;  1M9S A;  2LVM A;  3M0U A;  4II1 A;  2YRV A;  5HK3 A;  2V8J A;  4FW1 A;  1F1B B;  3G71 A;  1QW1 A;  4M75 B;  2J06 A;  1BKB A;  2LMJ A;  3EGD B;  1I8F A;  4NOY A;  4J83 A;  5IHK A;  5GAN 6;  2JVV A;  4C8Q B;  3E9G A;  1ZSZ A;  2QA4 Q;  1B7T A;  1RLQ C;  4KGX B;  3CC7 Q;  3CQT A;  4PLI A;  3JCM g;  1ZSZ C;  4M7D F;  2P0Q A;  3SFM A;  3LWI A;  4BI4 A;  1M1K C;  3PTA A;  1H8K A;  2DZC A;  1N8R U;  1YIJ T;  4BI8 B;  4ANJ A;  5KCH A;  3VS7 A;  3QWX X;  5CVI A;  2FZK B;  4M7D E;  3EFO B;  2DXT A;  4IUT A;  4C0D B;  2C06 A;  1M30 A;  3CBP A;  3JB9 G;  3BDU A;  3LH0 A;  1K8A U;  2NUT B;  1D0Z A;  3HRU A;  1YI2 A;  1AEY A;  1R8O B;  4IKF A;  2DEU A;  3OMG A;  1ZSG A;  3PMI A;  2BZX A;  5GMK e;  2M0Y A;  1W70 A;  4WCI A;  2IIM A;  3PIP A;  1WNL A;  4FYX B;  2CSQ A;  2CSI A;  5IHI A;  1VQ8 T;  2QQ9 A;  2VUB A;  4F04 B;  1HJD A;  1Y96 B;  1UGP B;  4PJO B;  1RAE B;  2JOY A;  2B8A A;  4M7D A;  4X9C A;  4M7A B;  3JB9 J;  5GAO l;  4M78 D;  1UUE A;  1KJW A;  3VS1 A;  4QW2 A;  1YJ9 T;  1YJW T;  1VQK T;  1VQ6 Q;  3VS3 A;  1TG0 A;  3CCS Q;  2OTJ Q;  4BB7 A;  3QJ6 A;  2J6K A;  2W10 A;  4MMK A;  3MEA A;  4JLG A;  1U1S A;  2FPD A;  1VQP Q;  1QKX A;  1YIJ A;  2F69 A;  3EG9 A;  3NMZ C;  3EG3 A;  1Q82 U;  1O9S A;  4J9B A;  4R0K A;  3QII A;  4FSS A;  2QDL A;  1N9R A;  3V7S A;  2NWM A;  2Y90 A;  4IIO A;  4MZM A;  1HXD A;  3A1P A;  2ZPE B;  4LNP A;  5CKB A;  2O2O A;  1BI1 A;  3OSV A;  4HVU A;  1OPK A;  1TXQ A;  1VQO Q;  2F1L A;  3RES A;  1JXM A;  4RTT A;  4CI0 C;  1KQS A;  3CMA T;  4J9C A;  4XU3 A;  2YWW A;  5CKD A;  2MOX A;  3EHQ A;  5GAN d;  4XAX B;  1WZO A;  2F2W A;  5C0M A;  4OB0 B;  3X26 B;  1UGQ B;  2RF0 A;  1VQ8 A;  1G3T A;  2E3H A;  1K9M U;  2PZ1 A;  2GQI A;  2CH4 A;  3G6E Q;  3C12 A;  1YJN Q;  2DPP B;  1PD0 A;  1RLP C;  4OMN A;  3V7C A;  2ZZD A;  2DJQ A;  4C92 D;  1UGR B;  3GOX A;  3OYH A;  3JCM V;  2HMA A;  5D7U A;  9ATC B;  1VQ7 T;  1Y57 A;  2RHU A;  3M9Q A;  2BZ8 A;  1NBE B;  1KIK A;  4FL6 A;  1YJ9 A;  1YJW A;  1VQK A;  1WYX A;  2P0P A;  4JJN K;  2W0Z A;  4HKE A;  2XU8 A;  2O01 E;  3C4S A;  4J9I A;  3VS0 A;  1LCK A;  1I5L A;  1VQ5 Q;  3PT9 A;  2HKQ B;  2VKN A;  2XDB A;  1Q7Y U;  1OX9 A;  2PQW A;  2GTJ A;  2DYI A;  4A4G A;  4O5V A;  3RER A;  1ZBJ A;  2IPO B;  2VXE A;  4CC4 B;  2E1H A;  3OMC A;  4BDY A;  1ZA1 B;  5KCO A;  3M4G A;  1BI2 A;  2BUD A;  3QYG B;  4E7K A;  2V1Q A;  5FU6 C;  2RHX A;  1QQJ A;  4BE1 A;  4O6J A;  3JRZ A;  2F2V A;  4PJL A;  5GAN h;  3CMA A;  5LJ5 d;  2KBT A;  2G3R A;  5LJ3 h;  3J7A F;  2DRM A;  1VIE A;  2O4X A;  1QVF A;  4M78 G;  3PVL A;  2DX1 A;  2MI6 A;  5CK9 A;  4M77 D;  3X28 B;  3MKD A;  1AHJ B;  2E41 A;  2GFU A;  4DEX A;  4BY6 B;  5FLX E;  2YHT A;  3WVE B;  3I55 T;  2MYS A;  3VUB A;  3QDF A;  3QG1 A;  5IAY A;  3HPW A;  2E5K A;  4PJN A;  2HBP A;  5I21 A;  5GAN 4;  1I4K 1;  1KD1 U;  5I2M A;  1UEC A;  2PVO B;  5GAM d;  2ENM A;  2KVQ G;  1VQ7 A;  2BE9 B;  3TEE A;  1MHN A;  5GAN 5;  1KQ1 A;  3ER0 A;  4PKC C;  2DXC A;  2FVU A;  1AD5 A;  1VYV A;  2NUP A;  2E70 A;  2RJC A;  2K79 A;  1K73 C;  2QI2 A;  3JCM Q;  4LDX A;  2K57 A;  2EKH A;  1NPP A;  1TUC A;  4HA8 A;  3JCM h;  4M4Z A;  4D6W A;  3E2U A;  1G5V A;  1XNI A;  1G83 A;  4EMG A;  3TVT A;  3JB9 F;  4FYY B;  4C92 G;  3OS0 A;  1N27 A;  4VUB A;  2JN0 A;  5LJ5 h;  1IB8 A;  2CP7 A;  2A0F B;  4AFU C;  2EIF A;  1WHK A;  4M75 D;  3CME Q;  4RTW A;  2FPE A;  3CCV T;  4MDX A;  1K9A A;  3HRT A;  4KUL A;  1Q86 U;  2B86 A;  1K8A R;  4HVW A;  2GNC A;  3EHR A;  3MHX A;  1PG5 B;  1NEG A;  2HKN A;  1VQN T;  3CCQ T;  2LCL A;  2LJ3 A;  1WHL A;  2L3Q A;  2DXU A;  4IUV A;  1HSQ A;  4NL2 A;  3I55 A;  2AT1 B;  3QZ5 B;  1X69 A;  4XTZ A;  3J81 E;  2E65 A;  5KE3 A;  1I1J A;  1TTH B;  1J3T A;  1NZ9 A;  2CYZ B;  4RTV A;  1RAF B;  4J9G A; 
#chains in the Genus database with same CATH homology
 3CCS T;  4MML A;  2L8D A;  3L2U A;  3S3M A;  2F5K A;  4JRK A;  5GAO r;  2JNG A;  3OA6 A;  1XQH A;  3NTH A;  1JRI A;  3LW5 E;  3J80 E;  1VQP T;  1YI2 T;  2R5M A;  4RKU E;  1K73 U;  3A8O B;  1K8A C;  2JTM A;  2XK0 A;  2DXB A;  2A3L A;  2HQE A;  2IG0 A;  3QJY A;  4M77 F;  4MDW A;  2CZ6 B;  3UDC A;  3QSU A;  1NPR A;  4BI3 A;  2P4T A;  3E9F A;  5A2Q E;  3CCM T;  4BE2 A;  2RI2 A;  3HFO A;  5D6X A;  4C92 A;  2RI5 A;  2DAQ A;  5GAM e;  5GMK j;  2E6N A;  4QQD A;  4CRI A;  5CR2 A;  3OYC A;  4FT4 A;  3HFN A;  1Q81 U;  4C92 C;  3G7Z A;  4FIB A;  3T9N A;  3A8G B;  3OYK A;  3G6E A;  5GAO m;  4RG2 A;  1YJN A;  1RL2 A;  4C5H A;  3ZFJ A;  5HK0 A;  3UPU A;  2JUF A;  2QXF A;  5GAO n;  1BI0 A;  4BY6 C;  1O75 A;  2OTL A;  2GQV A;  1M9S A;  2HNI A;  4OGE A;  4ELY C;  3QZ9 B;  2RB6 A;  4PJO D;  2HD0 A;  2LVM A;  4JLI A;  4M77 E;  4II1 A;  4IUU A;  4NL3 A;  4ATO A;  2YRV A;  5GMK l;  3TCJ A;  5HK3 A;  4WF2 A;  3S3N A;  2L89 A;  2V8J A;  1VQO T;  5IN1 A;  1NJI C;  1BYM A;  2XI9 A;  1X75 C;  2E6Z A;  3OBY A;  4YTL A;  5D6W A;  3G71 A;  1S72 T;  1QW1 A;  3G4S T;  3JB9 H;  4M75 B;  2PUO B;  2DTH A;  4LDY A;  5HY6 A;  4M75 A;  4F7U G;  2LQK A;  2V8I A;  1BIB A;  5LJ3 f;  4A4F A;  4J7F A;  2DK3 A;  3DKM A;  1BKB A;  4M75 C;  3WXM B;  2ZPG B;  4E47 A;  2JTF A;  3MO8 A;  2K5L A;  1I8F A;  4J83 A;  2X35 A;  4NOY A;  4PLL A;  3VV0 A;  4F7U E;  2E64 A;  3CCR T;  5GAN 6;  4JRP A;  2JVV A;  3JCM c;  3E9G A;  4C8Q B;  5CQX A;  4XTY A;  3PFS A;  4C8Q A;  1XTD A;  4PLI A;  1ZBX A;  1VIF A;  1QP2 A;  2PU9 B;  2CZ1 B;  2RHY A;  3CBO A;  4QQ6 A;  4PJO F;  3JCM g;  3OS5 A;  2XKO C;  2RHZ A;  4C8Q C;  5HKC A;  4QQG A;  3CCV A;  3GIB A;  2P0Q A;  5GAM j;  4M7D F;  4M7A D;  3GNF B;  3SFM A;  4DOW A;  4M7A F;  4XU0 A;  3VYG A;  2QQS A;  3DB3 A;  3LWI A;  4E7H A;  1U8R A;  2MF2 A;  3FLG A;  4BI4 A;  1YHQ A;  1M1K C;  1W4S A;  2DVE A;  3PTA A;  2DZC A;  1N8R U;  2EYQ A;  1YIJ T;  4ZGJ B;  3NTK A;  3P8D A;  1VQN A;  4BI8 B;  4LD9 K;  2ZPF B;  5GMK i;  3CCQ A;  4A4E A;  5LJ3 d;  3GPL A;  1UB4 A;  2MWP A;  5KCH A;  1OZ3 A;  5GMK h;  2XID A;  5CQY A;  3QHS A;  5J39 A;  4PJO E;  1ZHI A;  4HT8 A;  5CVI A;  1M90 C;  4M7D E;  1Q82 C;  5L8R E;  3AHU A;  2K3Y A;  1HK9 A;  5EG2 A;  2DXT A;  4E7L A;  4IUT A;  3Q1J A;  2CGH A;  1WJQ A;  4J6W A;  4C0D B;  5IT9 E;  2KK4 A;  2X4Y A;  2EQM A;  4Y91 A;  1SSF A;  2WSC E;  4M77 B;  5DLQ E;  3CCS A;  4OF1 A;  3P8B B;  3RMS A;  4M77 A;  4J6Y A;  2EWN A;  4XK8 E;  2C06 A;  2F5T X;  3A8H B;  4ZGE B;  5I2S A;  2LC4 A;  3CBP A;  3CME T;  3JB9 G;  4M77 C;  1VQ5 T;  3A8M B;  3BDU A;  3LH0 A;  2DJZ A;  3SB2 A;  1K8A U;  4J8O A;  5GAN 2;  3L2W A;  3HRU A;  4C5I A;  1VQ4 T;  1YI2 A;  2DD5 A;  2BIV A;  1R8O B;  2ZCF B;  1VQ9 T;  4IKF A;  2EJG A;  3OMG A;  3CCL T;  3PMI A;  2EKO A;  5GMK e;  3HHT B;  2XG8 D;  4GLK A;  3CCM A;  4XQ3 A;  1QVG A;  2EQK A;  2E5Q A;  1UEB A;  4BD3 A;  4F7U A;  3PIP A;  1PSF A;  1YCY A;  4Y28 E;  2CZ0 B;  3EAE A;  4QVC A;  4M75 G;  3JCM f;  1YIT A;  2KQW A;  1WNL A;  2LT4 A;  2YLC A;  4BE0 A;  3SD4 A;  2GF7 A;  4M7D D;  5GAO q;  1VQ8 T;  2QQ9 A;  2VUB A;  5M9O A;  4RCB A;  1LOJ A;  5GAN g;  2H3J A;  5GAM h;  1NJI U;  4JS5 A;  4C8Q G;  2XD0 A;  4Q5W A;  4LDW A;  3C94 A;  4XU2 A;  4KUD K;  3FEO A;  4BUG A;  4EPC A;  1MGQ A;  1Y96 B;  3NFC A;  4ZTJ A;  1K9M C;  4R55 A;  3M56 A;  3JCM W;  2MWO A;  4A54 A;  3L1A A;  1S72 A;  4JS4 A;  3G4S A;  3MEV A;  1UGP B;  4PJO B;  1BIA A;  2EQU A;  4RCC A;  2R5A A;  3ZBD A;  2JOY A;  2RJE A;  4J7I A;  4M7D B;  2B8A A;  2EQJ A;  4M7D A;  5CCA A;  4A4K A;  1M1G A;  2MMP A;  4X9C A;  4M7A B;  3JB9 J;  3JCM d;  5GAO l;  3CCR A;  2DEQ A;  3MEW A;  4M78 D;  4XTW A;  2FL7 A;  4L6V 5;  2LTO A;  4KUI A;  4M78 F;  3OYL A;  4QW2 A;  1YJ9 T;  1YJW T;  2R58 A;  3FIF A;  1VQK T;  3UWN A;  4ME7 A;  1ZQ1 A;  1OYX A;  1QVG S;  3CBM A;  3LGF A;  1M1K U;  1YIT T;  4A4H A;  1I81 A;  3SWN B;  2RA2 A;  3RKY A;  4EMK B;  4BB7 A;  3A5Z B;  3QJ6 A;  2MAM A;  1XOV A;  1V29 B;  3SWN A;  3VKI A;  4JDS A;  4EMK A;  1TH7 A;  4MMK A;  2PVG B;  3MEA A;  4JLG A;  4M77 G;  1U1S A;  1X6O A;  4OMF B;  3JB9 I;  3SWN C;  1YIJ A;  4EMK C;  3QO3 A;  3RUX A;  3S6W A;  1JJ2 A;  3OYE A;  4XTV A;  1M90 U;  2F69 A;  3MEU A;  4M78 E;  1Q82 U;  3UT1 A;  1O9S A;  1Y7X A;  4OB1 B;  4LDU A;  2DIQ A;  4N4G A;  1Y07 A;  5DM7 R;  4HCZ A;  5A0G A;  3QII A;  1W2B A;  1Q7Y C;  1DJ7 B;  2X4J A;  1FXX A;  1N9R A;  2OAU A;  2EJF A;  2RK1 A;  2K5I A;  3MP6 A;  3V7S A;  2Y90 A;  1OI1 A;  3OYB A;  4MZM A;  5GAN f;  2ZGW A;  3L2R A;  1HXD A;  2DTO A;  2ZPE B;  2QTX A;  5CKB A;  3L2Q A;  2LX9 A;  1Y71 A;  1IZ6 A;  3CD6 T;  1QVP A;  1BI1 A;  3OSV A;  3RKX A;  2LQ8 A;  5A0D A;  5LJ3 e;  2XIC A;  3CME A;  1VQ5 A;  3MCA B;  3RMQ A;  1KHI A;  1B34 B;  4R56 A;  3R6O A;  1VQ4 A;  3A8L B;  2WAC A;  5CKF A;  1G3S A;  3RES A;  3DLM A;  3MP1 A;  3OYY A;  5A0L A;  4CI0 C;  2EJ9 A;  1VQ9 A;  5FRM A;  2PVD B;  2R57 A;  3BW1 A;  3CCL A;  2KY9 A;  1KQS A;  3CMA T;  3CCJ T;  2M1H A;  3ASK A;  4XU3 A;  4C5E A;  1WQ7 A;  1LNX A;  1UGS B;  5CKD A;  1H3Z A;  3HL8 A;  5LJ5 g;  5GAN d;  4XAX B;  1WJR A;  3CXC S;  1JB0 E;  4PJO G;  5C0M A;  2DTI A;  4OB0 B;  1UGQ B;  3X26 B;  4M7D G;  3EFS A;  2DO3 A;  2XHC A;  1VQ8 A;  3L42 A;  3F70 A;  1QP3 A;  4N4H A;  2QDY B;  4M7A G;  2RH2 A;  1OZ2 A;  3N5B B;  1JJ2 S;  1G3T A;  1K9M U;  3WVD B;  3S3O A;  4V2S A;  3C12 A;  4M7A E;  2DPP B;  3V7C A;  2ZZD A;  2VYT A;  3FB9 A;  1W2B S;  2K2V A;  3QKJ A;  2L5Q A;  3KBG A;  4OB2 B;  4C92 D;  1UGR B;  4HCC A;  4C92 F;  3MET A;  3GOX A;  4C0D C;  4GY5 A;  3OYG A;  3OYH A;  4M78 B;  3JCM V;  4C0Z A;  5FRN A;  4A53 A;  4M78 A;  1WQW A;  3LYI A;  2I2L A;  5GAN j;  1VQL A;  2QQB A;  2NLU A;  4M78 C;  5LJ3 j;  2IVW A;  3GF5 A;  1VQ7 T;  2GCX A;  5LL6 S;  3LWH A;  2RHU A;  3HRS A;  1KD1 C;  3HSB A;  3M9Q A;  4FU6 A;  2XDP A;  3FDR A;  3TRE A;  4B9W A;  2LDM A;  2M9U A;  4N4I A;  3LLR A;  4HCB A;  5GAM g;  4FL6 A;  1VQM T;  2D6F A;  1YJ9 A;  1YJW A;  2KMT A;  2DKG A;  1VQK A;  3FRN A;  3JAM E;  2CKK A;  3VYH B;  3VU3 C;  2P0P A;  1KQS S;  3L2Z A;  4JJN K;  4HKE A;  2XU8 A;  2HQX A;  4QVZ A;  3BY7 A;  1D3B B;  5CAI A;  3FC3 A;  2O01 E;  3C4S A;  3NTI A;  3M55 A;  5CKE A;  1D3B A;  2RI3 A;  3HP9 A;  3ZEH A;  1I5L A;  3PT9 A;  1KG1 A;  3CPW A;  4ZGD B;  3OS1 A;  4OVA A;  3JCM e;  4PNO A;  1WJS A;  3EFR A;  1G3W A;  3JCM b;  2QEX T;  2VC8 A;  4X9D A;  2XDB A;  1Q7Y U;  4N0A A;  2PQW A;  4L59 A;  4LDV A;  4C8Q D;  2RHI A;  5LJ5 f;  3BDL A;  4N0A C;  1Y96 A;  3CC2 T;  3OYF A;  4A4G A;  2CS7 A;  2VGN A;  4O5V A;  3I56 T;  3JCM J;  3OYA A;  1M4Z A;  1KQ2 A;  3URG A;  3RER A;  3KUF A;  3QUI A;  3CPF A;  3OYM A;  3M59 A;  2VXE A;  1VQL T;  5LJ5 e;  2E1H A;  3OMC A;  4BDY A;  5FU7 B;  5FRO A;  5KCO A;  4PJO A;  1JBM A;  3M4G A;  4JRQ A;  1BI2 A;  4PJO C;  5FU6 B;  2BUD A;  2KAF A;  3CD6 A;  3L2V A;  4M7A A;  4M7D C;  3V8K A;  3QYG B;  4BDZ A;  4JUV A;  4E7K A;  4L5G A;  4FT2 A;  3CCU T;  4M7A C;  5FU6 C;  2K3X A;  3OQ5 A;  2RHX A;  4BE1 A;  3M58 A;  2OTJ T;  4HT9 A;  2LRQ A;  4O6J A;  2M16 A;  2K4Y A;  2E12 A;  2EFI A;  3JRZ A;  3OB9 A;  2O4X B;  5GAN h;  5LJ5 d;  4P5N A;  5GAN 3;  1X01 A;  3CMA A;  5LJ3 h;  2G3R A;  3CCJ A;  3J7A F;  2O4X A;  1VIE A;  2YLB A;  3CC4 T;  3DLL A;  2P0K A;  1QVF A;  3H6Z A;  4M78 G;  4C0G A;  1EIF A;  4DQ2 A;  5GAM f;  5KE2 A;  3CXC A;  1KHC A;  2MI6 A;  5CK9 A;  4M77 D;  3GLX A;  2LNV A;  3CPW S;  4KT0 E;  4C92 B;  5GAN 8;  5D6Y A;  3X28 B;  1FWZ A;  3OBW A;  2PUK B;  1AHJ B;  1Q86 C;  2VV5 A;  2E41 A;  2JZ2 A;  1KC8 C;  4E7J A;  2GFU A;  3M5A A;  4E7I A;  4BY6 B;  3JCM X;  2V8K A;  4EMH A;  3P8H A;  3M54 A;  5FLX E;  3OYN A;  2YHT A;  3WVE B;  4KBM B;  4Z02 A;  5LJ5 j;  3I55 T;  3VUB A;  4DA4 A;  2RJD A;  4OB3 B;  2VXF A;  4F7U F;  4XTX A;  3FJP A;  1PSE A;  3QG1 A;  5IAY A;  3HPW A;  4FM4 B;  5GAN e;  5GAO p;  2HBP A;  5I21 A;  2ZPB B;  5GAN 4;  2QA4 T;  3CC7 T;  1I4K 1;  2WSF E;  5J26 A;  4ZN1 A;  1KD1 U;  3VJP A;  3CCE T;  4UC4 A;  5J3B A;  1FX7 A;  5I2M A;  2PVO B;  5GAM d;  3OYD A;  1VQ7 A;  2KVQ G;  1B34 A;  2VGM A;  3TEE A;  1MHN A;  2RO0 A;  5GAN 5;  1KQ1 A;  3ER0 A;  3QBY A;  4PKC C;  2DXC A;  1VQM A;  2FVU A;  2FYK A;  2BKD N;  2RJF A;  5GMK m;  4OP0 A;  4MZP A;  2E70 A;  3GNG A;  3INZ A;  3CEY A;  2RJC A;  4JRI A;  3HKS A;  1LJO A;  2QQR A;  5DLO A;  3VUZ A;  2CZ7 B;  2K5F A;  2LT1 A;  3BFM A;  3OW2 A;  5KH6 A;  3H8Z A;  1QVF S;  2D9T A;  1K73 C;  2QI2 A;  4IUQ A;  2FHD A;  3LGL A;  4EDU A;  3OSS C;  3E1S A;  2D0Q B;  2XDD A;  3QYH B;  3JCM Q;  3G6E T;  1YJN T;  4LDX A;  3LX7 A;  2DZ9 A;  1YBY A;  2A7Y A;  3V7R A;  3DB4 A;  3JSC A;  4DOV A;  1WGS A;  2QEX A;  3E19 A;  1Q81 C;  2K57 A;  2ZPH B;  1M1F A;  1NPP A;  3CC2 A;  2OTL T;  4J5Y A;  4HA8 A;  4MZT A;  4C5G A;  4ZN3 A;  3V8L A;  3I56 A;  2LCC A;  4RG8 A;  3JCM h;  4D6W A;  3PGG A;  1G5V A;  1XNI A;  4XU1 A;  2ZPI B;  3M4Y A;  2E10 A;  5DY9 A;  4C0F A;  4EMG A;  4J6X A;  2WSE E;  3JB9 D;  1GXI E;  3QXE B;  3JB9 F;  3G71 T;  5AYF A;  3SDZ A;  3MP8 A;  4X34 A;  4XTU A;  3X24 B;  3RKW A;  4NS5 A;  3V8J A;  4C92 G;  3PIO A;  3OS2 A;  2GFA A;  3CCU A;  1BI3 A;  2DD4 A;  3OS0 A;  1N27 A;  3JCM P;  4VUB A;  2JN0 A;  1NE8 A;  5CKH A;  5LJ5 h;  4C92 E;  1VQ6 A;  4FSX A;  2FB7 A;  1M5Q 1;  2Y4X A;  4QVD A;  2OTJ A;  1RI0 A;  1N6A A;  3QPH A;  4B9X A;  3ME9 A;  2EIF A;  3PNW C;  4LD6 A;  3QDR B;  4M75 D;  3OYI A;  3X20 B;  5CO7 A;  3M53 A;  1VQ6 T;  4M75 F;  1VQP A;  2QQA A;  1N9S A;  3CC4 A;  1VUB A;  3CCV T;  3OW2 S;  2KDS A;  4MDX A;  1H64 1;  3HRT A;  4PL6 A;  1U1T A;  4KUL A;  2RM4 A;  1Q86 U;  4ELZ C;  3M57 A;  1KC8 U;  2EAY A;  2L3R A;  3TU4 K;  2X4W A;  3C95 A;  4C8Q F;  4F7U B;  1YHQ T;  3MHX A;  3X25 B;  5CIU A;  2KSS A;  2M0O A;  5GAN 7;  1VQN T;  1G3Y A;  3CCQ T;  4RMO A;  3O8V A;  2LCL A;  4TVR A;  3GP8 A;  1WPY A;  2RK2 A;  1N8R C;  2DXU A;  4IUV A;  3OY9 A;  1IRE B;  2Y4Y A;  3PMT A;  4M75 E;  4NL2 A;  3I55 A;  4BAC A;  3QZ5 B;  4OGC A;  2DIG A;  3KXT A;  4XTZ A;  5C6S A;  4IUP A;  5LJ3 g;  3J81 E;  5FU7 C;  2E65 A;  2QA4 A;  2HAX A;  3CC7 A;  2X4X A;  5KE3 A;  3CCE A;  1P92 A;  1NZ9 A;  3RIR A;  3OYJ A;  2CYZ B;  4C8Q E;  2RD1 A;  4ZTF A;  1VQO A;  2AHJ B;  1M8V A;  4IUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...