3LX7A

Crystal structure of a novel tudor domain-containing protein sgf29
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
159
structure length
143
Chain Sequence
GRENLYFKPPPLCGAIPASGDYVARPGDKVAARVQWILAEVVSYSHATNKYEVDDIERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords SAGA-associated factor 29 homolog
total genus 27
structure length 143
sequence length 159
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lx7A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lx7A01
4UC4A 4IKFA 2DIQA 4RG2A 1WJRA 5FRMA 4E7JA 2RO0A 4N4GA 3OMGA 3OYHA 2X4XA 4BACA 3DB3A 4E7HA 4PL6A 1RI0A 5KE3A 4II1A 2MWPA 4OVAA 4QW2A 2R57A 1H3ZA 2X4YA 2G3RA 2R5MA 5J39A 3GOXA 3E9FA 3UWNA 4E7LA 2E5QA 2IG0A 3E9GA 5D6WA 5IAYA 3S3NA 2RJFA 3MP8A 3L2WA 4B9XA 3M9QA 2L8DA 2F5KA 5C6SA 3MEVA 2O4XB 3FC3A 3P8HA 2XDPA 3OYBA 3L42A 3NTHA 4BE1A 4C5EA 2QQSA 4BE2A 2B8AA 3MEUA 2HQEA 4IUVA 3OA6A 2NLUA 3OYGA 1WJSA 3MO8A 3OYMA 5J26A 4E7IA 2L3RA 4ZTFA 4X34A 2X4WA 2EFIA 2X35A 3O8VA 4QVZA 2LVMA 2O4XA 3C4SA 3PNWC 1WJQA 4N4IA 4C5IA 5D6YA 3OYCA 3CEYA 3OB9A 3OYKA 3OYDA 3OYNA 3MP1A 1N27A 3FEOA 3PMIA 3FDRA 2JTFA 2GFAA 2BUDA 2GFUA 3ZEHA 3P8DA 4QQDA 3OYEA 2CKKA 2PQWA 1OI1A 2HQXA 3BDLA 3QJ6A 2VYTA 4IURA 4IUPA 3PFSA 2RI3A 5KCOA 4E7KA 2EQMA 5IN1A 2BIVA 2DAQA 2QQRA 2JZ2A 2RI5A 2LCCA 4PLLA 3OS2A 5CIUA 4C5GA 5KH6A 4HCZA 2DIGA 3OYIA 3F70A 4GY5A 3LX7A 3SD4A 4BDYA 4QQ6A 4Q5WA 3L2VA 3LH0A 2EKOA 2RHZA 3QBYA 1WGSA 1G5VA 3ASKA 4QQGA 3S6WA 1OYXA 2M0OA 3OYLA 3LGLA 4IUUA 2XK0A 4IUTA 2MWOA 2RJCA 3OMCA 5KE2A 3OYFA 4A4EA 3EAEA 4B9WA 4N4HA 5D6XA 2RHYA 1MHNA 3FLGA 2R5AA 2EQKA 4BDZA 1XNIA 2L89A 3Q1JA 2RHXA 2EQJA 2BKDN 3KUFA 3LLRA 4Z02A 3L2QA 3OYJA 3META 3OS0A 2RJDA 3MP6A 4NS5A 3QKJA 3H6ZA 3S3MA 3H8ZA 3OQ5A 2RJEA 2RHUA 2M16A 2GF7A 3OYAA 4BE0A 2P0KA 5C0MA 5M9OA 3ME9A 3MEAA 4A4HA 4CRIA 4C5HA 3OY9A 4A4GA 3NTIA 2EQUA 4IUQA 1OZ2A 4FL6A 3LYIA 3DB4A 4FU6A 4EDUA 3L2RA 3S3OA 5FRNA 4PLIA 2LDMA 2K3XA 2WACA 3UT1A 4LD6A 3NTKA 2YRVA 5FROA 3QIIA 1KHCA 3PMTA 2M1HA 4L59A 2R58A 2E6NA 2D9TA 2LRQA 1OZ3A 2K3YA 4A4FA 3LGFA 4BD3A 2LTOA 2FHDA 3MEWA 5KCHA 3DLMA 1SSFA 3L2UA 4ZTJA 3OS1A 2RI2A 2RHIA
chains in the Genus database with same CATH superfamily
1X2KA 1AZEA 1UGVA 3L2ZA 5D7UA 4M77E 2RO0A 3MCAB 2DD5A 2P4TA 1WA7A 4XQ3A 1YI2A 1F1BB 4QW2A 5HK3A 2VV5A 2BE9B 2CZ6B 1SSHA 2IIMA 3H0HA 1QCOA 2DEUA 1S72A 4BE2A 5GAOr 1S72T 1QKWA 2HQEA 3OA6A 2KMTA 2NLUA 1LPLA 2JXBA 2W10A 1WHLA 4RTWA 1WIEA 4ZGDB 5L23A 2E3IA 2XG8D 1VIFA 2K2VA 2QYZA 3CCLQ 3QYHB 5GAN3 3MP1A 4LNPA 4MMLA 2V1RA 3R6OA 4XTVA 3M5AA 2NUPB 4PJJA 2VXEA 1JB0E 4CC4B 1WYXA 2LNVA 1ZUKA 4F7UF 3CBMA 4XTYA 4RG8A 1K9MU 4F7UB 4KUIA 3L2VA 2EKOA 2YUPA 2D8JA 4KGZB 2CSQA 2KBTA 2ZPFB 4RCBA 3CQTA 1QW1A 2YXYA 2MWOA 4AFUC 4AT1B 1UE9A 4LXCA 3NGPA 3V7CA 1NJIU 2KROA 4JRIA 2VXFA 2RB6A 3H6ZA 2RJEA 1LOJA 1RACB 1U06A 2M51A 5M9OA 2DD4A 1QVGS 4WTOB 1G3WA 4OP0A 1NEBA 2WACA 3V8KA 4C92F 2KDSA 2CP5A 1ZLMA 3TU4K 3CCRT 1M90C 3ZFJA 3JB9G 3V8LA 3RIRA 2C0IA 1VQ6A 2ZZDA 1W1FA 1K0XA 2I0NA 2CGHA 3QPHA 1HK9A 1QVGA 3E9FA 4ZN3A 4KUDK 4M78B 3CCUT 1WXBA 3CMET 3M9QA 2L3QA 4M78F 1HYOA 1K9AA 4QVCA 3I55Q 1Q7YC 2HAXA 2SRCA 1LJOA 3CCVA 3M0UA 2QTVA 3EG9B 4J6WA 5LJ5d 3C0CA 3EFOB 3C4SA 4N4IA 2ZPGB 1VQ4A 5GAN8 3OYNA 1ZSGA 4LD9K 1VQLT 2OTJA 1RAAB 1YJ9T 2VC8A 1OEBA 1IZ6A 4IUPA 1G3YA 2FB7A 2L3SA 4ZGEB 3I5SA 2CREA 5HCKA 2JZ2A 2RI5A 3CCJA 1V29B 4EPCA 2DVJA 4JZ4A 2L0AA 4D6WA 4E6RA 1AZGB 1RAGB 4Y28E 1KK7A 2QQAA 3EAEA 1W70A 2FL7A 4PJOB 4M75A 4C92D 2EQIA 1WFWA 2ESWA 4DBFA 1GCQA 1EX4A 4ELZC 4AG1C 2COYA 3VRZA 3VV0A 4ATOA 1J3TA 1XOVA 1VQKT 2D0QB 4HKEA 3CCLT 2MI6A 1Y07A 3JCMd 4CRIA 4C0DC 4JJNK 3OW2S 3LYIA 1QQJA 3UA6A 1FXXA 3BY7A 4JLIA 2FEIA 2DLPA 3DLMA 2CZ7B 1FX7A 2RHIA 1N8RU 4PFPA 1G3TA 1VYUA 2BE7D 3TEEA 2AK5A 1WXUA 3P8BB 4O5VA 1BCOA 3V7SA 1MMNA 2CH4W 5CQXA 2L3PA 1JJ2S 2R57A 4RTZA 3OSSC 3S3NA 4PFOA 2L2PA 2A0FB 3HL8A 3LW5E 1BYMA 4AFQC 1B34B 2YUQA 3GLXA 5LJ3d 4JRQA 2O4XA 3A5ZB 1U3OA 3CEYA 3OYCA 1M90U 3LH5A 4FYYB 5LJ5j 4R55A 3HRUA 3JCMb 1YJWT 1CKAA 1YJWA 3RKYA 3G71A 2EGCA 1KQ1A 2LCSA 5IXBA 5AYFA 1VA7A 1UJYA 3OYIA 3CCRA 3EGDB 2KXCA 1FMVA 5GJVB 3QO3A 1VUBA 3N5BB 3HPWA 3M0QA 1Y96B 1SF9A 1I0CA 2DXCA 4M75G 4DA4A 5D6XA 4QVDA 5CAIA 1PRLC 3QHSA 5GAN7 1MHNA 5KYUA 2XICA 3CC2T 1VYTA 3U23A 2KI7A 4FT4A 3BDUA 3OS0A 1TUDA 2FVUA 3WXMB 2P0KA 4PK4A 1D1CA 4A4GA 1KQ2A 2BZXA 4EDUA 2LDMA 3OBYA 1D09B 4C92C 3PVLA 2LRQA 4BD3A 1OULA 1VQ4Q 5LJ3g 3MKDA 1VOMA 5GMKj 1QP3A 4RG2A 5HY6A 5FRMA 1TG0A 2HBWA 4E7HA 2LJ3A 3DKMA 1MV3A 1UGSB 4II1A 2VGNA 5LJ5e 4M7DA 2H3JA 1Q81C 3E9GA 4KBMB 2HL5C 3VS4A 4PNOA 4F7UG 4OMFB 3OYBA 1K73R 8AT1B 1OU9A 3JCMW 1WJSA 2MYSA 5J26A 4X34A 5IHKA 3TCJA 3URGA 1U8RA 2LVMA 3M0TA 1Y71A 2DO3A 3PGGA 3PMIA 4M78E 2AZSA 4E7SA 4N0AC 2DL3A 3TSZA 4D8KA 2CKKA 3OS5A 1KD1R 4M7DD 3PFSA 2RI3A 3I56T 1Q7YU 1E6GA 2K6DA 1VQ4T 2RA2A 3SD4A 3JB9I 4QQ6A 1U1SA 1MNDA 2RHZA 4JJBA 1VQ6T 2L5QA 5GAN4 3EFRA 2E41A 5KYUB 1YN8A 2YUOA 2JOYA 1TWBA 3G6ET 1I81A 1M3CA 1SRMA 1YWOA 3V8JA 1O9SA 1UHFA 2FRYA 4C92E 1OX8A 3H0IA 2X3WD 1XNIA 2YHTA 1IHVA 1VQNA 5EG2A 3VRYA 3C12A 3OYJA 3JCMP 3JCMV 3M0PA 2EPDA 4CC3A 1OQKA 2QQ9A 1KG1A 4JDSA 5CKFA 1JEGA 5DLQE 4C8QB 5C0MA 1BI2A 3JB9F 1PD0A 5GAN6 3WVDB 1N5ZA 1N9SA 4LN2A 4OB1B 1ZUUA 1PC0A 2K3YA 1UEBA 3LGFA 4BY6C 3CCSA 4ZTJA 1SSFA 4OF1A 2DRKA 2DZCA 2DIQA 2E3HA 4M7AC 1M8VA 1MMAA 5DY9A 1GL5A 4N4GA 2JUFA 1VIEA 4M77C 1UTIA 4DOVA 4KGXB 2A08A 4OMNA 3A8MB 4OVAA 1H3ZA 3GIBA 1WI7A 2A28A 3EG3A 4J9FA 1W2BP 1QWEA 3RUXA 3CC2A 3HKSA 1YI2Q 3MEVA 2J6FA 4OB2B 3HSBA 3L42A 2KT8A 1SRLA 5CVIA 1G2BA 3PT9A 4J9CA 2CZ1B 5D6YA 2CP3A 3SFMA 2E1HA 3CD6Q 5GAMf 5GMKm 1QMCA 1I8FA 2GFUA 2DXTA 3P8DA 1D0YA 4M7AG 1RAFB 4J6YA 4E7KA 1K9MR 3JCMf 5GAMj 4HVUA 4HVWA 1TUCA 2RH2A 1YHQT 2O88A 3LH0A 1TU0B 3ASKA 3X20B 1HXDA 2LQWA 1X6BA 1H641 1M8MA 4A54A 5GAOp 4A4KA 1PSFA 2HEQA 3CCEQ 4AMCA 2KAFA 1UB4A 3KUFA 1YI2T 1HJDA 2RHUA 1K1ZA 2GF7A 1BIBA 3M0RA 4A4HA 2RM4A 4FYWB 4HT9A 4IUQA 2WSCE 2QAZA 1YITA 4J8OA 2ED1A 3NFCA 1B3QA 2D9TA 1ABQA 1W6XA 1WQ7A 4A4FA 2LTOA 1PSEA 3RR6A 4XTWA 1P92A 3A1PA 2QGFB 4J5YA 3CCMT 3OMGA 3CC4A 2PZ1A 2ED0A 3FRNA 5LL6S 4PL6A 4JS4A 4RCCA 4DBHA 2R5MA 2CT3A 2JM9A 4M7DG 1KD1U 1IRXA 2F2WA 4C92A 1HD3A 2ZPEB 4KT0E 2EVRA 2XDPA 2K5FA 3MEUA 2F5TX 4IUVA 1QVGP 2XHCA 3CPWP 2DA9A 2X4WA 2DL4A 1I5OB 2JS0A 2P84A 1K9MC 1UG1A 2YRCA 3HHTB 1X27A 2DX1A 2DYIA 3M4GA 4NL3A 3EFSA 3FDRA 3D7SB 3BE3A 2HSEB 3EH1A 3CCQQ 2PUKB 2XDDA 1Q86U 2XMFA 2BIVA 3NPFA 2ZPHB 3C95A 4HVVA 2EYZA 3NHNA 1AD5A 4FSXA 2K79A 2MAMA 1YBYA 2VUBA 4QQGA 3G4SQ 5IT9E 3PIOA 1E6HA 2V8KA 3HRTA 3LGLA 4IUUA 3OMCA 4BUGA 4B9WA 3JCMX 3INZA 1QKXA 2H3EB 2XI9A 2PVDB 1I1JA 1M2OA 3EG2A 5HKCA 2QDYB 2VKNA 2DTHA 5GAOn 3H8ZA 3CC7T 2FO0A 5KYYB 2LQNA 4BE0A 4M7AE 2V1QA 2KQWA 3NTIA 4V2SA 3DB4A 4EMKB 2KEAA 2BTTA 3UT1A 4LD6A 2K3BA 3PMTA 2A7YA 2XIDA 3T9NA 3CCUQ 3H9NA 3J7AF 1PCXA 2JM8A 3OS1A 2CDTA 1RAIB 4FYVB 1NE8A 2E6ZA 5FWBA 4FCYA 3VS3A 2RK2A 5KYWB 1BBZA 1T3SA 2K4YA 1SHFA 1Q7YR 3PE0A 1K8AU 2QK0A 4J7IA 2E5QA 2JN0A 2RJFA 2ZPIB 3QSUA 2NYSA 1H8KA 4J9GA 2WSFE 2OTLQ 4RTVA 1UGPB 1KQSP 3CBOA 3CMEQ 2QDLA 2FYKA 2EFIA 1UFFA 1IGUA 1WQWA 2DPPB 3EH2A 4ME7A 3ZBDA 1K73U 1VQ8Q 3OYDA 1YP5A 1M9SA 2EW3A 2HQXA 1VQ9Q 1YITT 2JW4A 1ABOA 2EYWA 2KYBA 4QT7A 4XK8E 3OS2A 1YITQ 4PJNA 2ROTA 3LX7A 5CKDA 4Q5WA 3LWIA 1M1FA 2KGTA 4AFZC 3S6WA 3OYLA 2K5LA 5GAMg 2XU8A 2B86A 3EGUA 2LX7A 4KGVB 2R5AA 5I2SA 4M77D 4HCBA 3SWNB 1X6OA 1VQ9A 1AWJA 4PFZA 1QCFA 1W4SA 3CMAQ 4EIKA 3AHUA 2HKNA 1AEYA 3CC7A 1GRIA 3A8GB 1HSQA 2FZCB 4KULA 2HNIA 1WZOA 2Y90A 2HL3A 3GF5A 5FW9A 4FL6A 1GCPA 4LDYA 1R77A 2YRVA 1G3SA 2A3LA 1X2QA 3SDZA 5KYXB 1YFNA 4C0ZA 1WX6A 3EHQA 1UECA 4IKFA 5GANe 2A37A 1AVZC 2Y4YA 1LVKA 3GOXA 2DKGA 4RMOA 1Y96A 1AWWA 3CCJQ 2K9GA 2PVGB 4E47A 3M55A 3CCJT 2L3RA 3OW2P 1Q82R 1NLPC 2OTJQ 1FMKA 1O75A 1OX9A 1M3AA 1ZHIA 3RKWA 2LJ1A 2YRDA 1VQOQ 1D1AA 2PVOB 3JCMQ 3E19A 3VS1A 1A0NB 1XTDA 2X3XD 4C92G 4M78C 3JCMg 2LC4A 3OYEA 3RMSA 1AWXA 1OI1A 5FU7B 1ACMB 5GAOq 2KXDA 1WHKA 2ZAEA 2CS7A 4LDXA 2F1LA 2PU9B 1X01A 2F2XA 2EGEA 1U1TA 1WHGA 2QGGA 1QLYA 2XK0A 4RKUE 4F17A 3QZ9B 3EG0A 4M75E 1NZ9A 1I07A 5LJ3f 3C94A 4F16A 5AT1B 3JCMJ 2QA4T 1PM3A 3MP6A 2CH4A 3S3MA 2O01E 1JRIA 2J06A 1VQNQ 2GTOA 3TREA 1X43A 1KQSS 2EIFA 1ZBJA 3L2RA 5GANh 4XTXA 2DJQA 3GNGA 3NTKA 1KHCA 4C8QG 1OZ3A 4M77A 2JTEA 2DTIA 5CR2A 1Q95G 4HCKA 2RI2A 1BI0A 4UC4A 2LQKA 2J6OA 4E7ZA 2AT1B 1W2BS 3CCSQ 3HFNA 2JMAA 2X4XA 2OJ2A 5KE3A 4FYXB 2VASA 2KR3A 5D6WA 5IAYA 1KIKA 1Q81U 3CPWA 1B07A 2C06A 4M7DC 2JVVA 2QEXA 1IHWA 4PKCC 3FJPA 3FB9A 2E12A 3GNFB 2DEQA 4F7UA 3CPFA 3JRZA 3OYGA 4M78A 2RN8A 1MMGA 2W0ZA 3CXCP 1YHQA 1XJWB 2DNUA 1V76A 1YNZA 2MIOA 2YWWA 2AKLA 1M1KC 4CC7A 1CSKA 5GAOl 1VQKQ 4CI0C 4M7DB 1S72Q 3ZEHA 3BDLA 3VS7A 3ER0A 1R8OB 3HFOA 4ZNXA 2AKKA 4HCZA 1AHJB 2CP6A 2EJ9A 2X51A 1BIAA 3CCST 2DVEA 4K11A 2LT4A 2RJCA 2D0NA 2ROLA 4XU0A 3I35A 1KD1C 4EMKC 3VUBA 5J3BA 2ENMA 1M90R 3I9QA 1GBQA 5I11A 5GAMh 5GAN2 4BY6B 3EGXB 5LJ5f 3OY9A 4OB0B 1IXDA 3MHXA 2DL7A 2K3XA 3G4ST 3L1AA 1MNEA 3QIIA 3I55T 3JV3A 1V1CA 2FHDA 5IHNA 4RUGA 4XU1A 1OOTA 3CD6A 3G71T 3CXCA 4HT8A 3I55A 2E65A 3OYHA 3BFMA 2MMPA 1MV0B 1N8RR 1VQ8A 2V26A 2VB6A 4R0KA 4C8QE 4GBQA 2BZ8A 1PNJA 5FU7C 5J39A 2EYQA 5LJ3j 2IG0A 3CBPA 2HBPA 5I21A 5GANg 2LMJA 2JT4A 3L2WA 1WHMA 4B9XA 1VQKA 2P0PA 2FZGB 5C6SA 4M7AA 2WSEE 4JPBW 1S1NA 1VQMT 1VQ9T 2EAYA 4E7IA 4Y91A 1YIJA 3H41A 2M0YA 2RNAA 2YLBA 4NOYA 1QP2A 3PNWC 4BI3A 1IB8A 2KSSA 1GFDA 4PJOA 2QEXT 1IO6A 3MJXA 3EHRA 2KT1A 1M2VB 2PQWA 2DL8A 3M56A 3VU3C 2O2OA 4DEYA 3M54A 2QQRA 1C1AA 4PLLA 1QVPA 2AHJB 3I56A 3M59A 4M77F 4MZPA 2LX9A 1IGQA 1VQ7T 5GAMe 3CMAT 2OAUA 3EFOA 3CCVQ 4M75C 1UDLA 3TQ7P 3VYHB 2VWFA 3JB9D 3R6NA 1M3BA 3META 4J7FA 2MPXC 4DBQA 1SG5A 2GTJA 3OQ5A 2SEMA 5I22A 3RESA 2M16A 1K4US 4J83A 4C5HA 3SWNC 4C92B 1OZ2A 4PJOD 3JCMh 4FU6A 1EZZB 3WVEB 4E2FB 3IQLA 2XD0A 1Q86R 2M1HA 4NL2A 1PWTA 3SHWA 4Z89A 9ATCB 1D3BA 3MEWA 5CO7A 1ZBXA 1BI3A 1X75C 4J9IA 4M77G 3VS5A 4TVRA 3TVTA 1YJNQ 1JJ2P 2CT4A 4OGCA 2CUDA 2K57A 4BACA 4FW2A 1SHGA 3GPLA 2KRNA 1M1KR 1QVFS 1BK2A 2MWPA 2H8HA 2V8JA 3H0FA 1KQSA 3CCET 4M7AD 4KH0B 4M75F 1JQQA 3M53A 2LJ0A 6AT1B 2KYMA 2MF2A 1MUZA 1R0CB 4N0AA 4HA8A 5FU6C 4BE1A 4C5EA 1YJWQ 1YWPA 5CK9A 4HCCA 4JRKA 3HRSA 2QG9B 3VJPA 1TXQA 3EGXA 2VVKA 3FIFA 1M2VA 3OBWA 4ZN1A 1NEGA 2OTLT 2FZKB 2CP7A 3CD6T 5IN1A 1YIJT 2DAQA 5KYYA 3QWYA 3M4YA 2D1XA 2YSQA 2JNGA 2BZYA 4OB3B 4C5GA 2RPNA 5FU6B 3F70A 1M30A 2QXFA 4JLGA 3QBYA 1WGSA 4JS5A 3CCUA 3DLLA 2RQVA 5KYWA 4O6JA 1RI9A 2GBQA 4A4EA 2CUBA 1FMWA 2RHYA 3GBQA 1RLQC 4LDWA 4M7AB 1UJ0A 1Y57A 4LDVA 2O9VA 1T3LA 5LJ5g 1VQPA 3J81E 3QKJA 3CCQA 2DETA 1UGQB 5A0GA 3HP9A 1VQ5T 5GAOm 5CKBA 2C0OA 4L6V5 2QASA 3QUIA 4Z8AA 2E6NA 4C8QC 3G4SA 2DBKA 2O31A 2GGRA 4X9CA 1T0JA 1VQ7A 3AT1B 2E5KA 2DRMA 2DE0X 1WJRA 2NUTB 4OMQA 1Q82C 2RF0A 4DQ2A 2P4RA 2NUZA 4PJOC 2EJGA 1B7TA 3QXEB 1AT1B 1FYNA 1G8XA 1LNXA 3TSWA 1B34A 1NM7A 3RDVA 3CPWS 3JB9H 2L8DA 2HSPA 4DEXA 2O4XB 1WXTA 4BB7A 2RQRA 2QQSA 1D0ZA 2LZ6B 3O5ZA 2LP5A 3QJYA 1VQ6Q 3VYGA 1JXMA 3CXCS 3UPUA 2RMOA 2A36A 3OYKA 1K73C 3E2UA 1TUGB 5GJWB 2E64A 4GLMA 2RQUA 1EFNA 4MZTA 2DXBA 3PTAA 2M9UA 2QQBA 2EQMA 2P0QA 2PTKA 3ZL7C 4RTUA 4PJOE 1BKBA 2YT6A 1IREB 1JO8A 5CIUA 1RABB 2QI2A 2DIGA 3I5RA 2O9SA 3QDRB 4PJOG 1TTHB 1OYXA 2M0OA 3OSVA 3OYFA 4LUEA 2EYXA 3J80E 4ELYC 1G83A 4F04B 5IHIA 1NPPA 2EQKA 1N8RC 2JTMA 2CP2A 5GMKi 2IVWA 2BKDN 5HK0A 4F14A 1VQPT 2RJDA 2RQTA 3CC2Q 2I2LA 3RNJA 1VQMA 3OYAA 1GFCA 4ZGJB 3EG1A 3MEAA 3ME9A 4IIMA 2EQUA 3ULRB 4LE9A 4A63B 1OPLA 3SB2A 1WHHA 1OU8A 5GAN5 2ABLA 1D0XA 3THKA 4EMHA 1SPKA 1YIJQ 5A0DA 2FG0A 3EG9A 1NYFA 2LT1A 4E7JA 1D3BB 4ESRA 1RI0A 2COZA 3M57A 2X4YA 4LUDA 2HMAA 4EMGA 1TH7A 3CMEA 2JMCA 3FC3A 1Q82U 1YJ9Q 3I56Q 1PHTA 1UHCA 1BU1A 2DM1A 2X4JA 2Y4XA 2X35A 2DMOA 2DF6A 3CCEA 2F2VA 4C5IA 4FIBA 2HD0A 3FEOA 4J9DA 1YHQQ 2KE9A 4D8DA 3G1JA 4M4ZA 4IURA 3G6EA 1KC8R 4YTLA 4JZ3A 1D1BA 4MZMA 4PJMA 2J05A 2LCCA 4M77B 2OX7A 5KH6A 4BDYA 4M7DE 2CZ0B 3HTRA 1ZUYA 1OV3A 1TSFA 1G5VA 4M78D 5IXFA 5CCAA 5KE2A 1M1GA 2RD1A 2RQWA 1PRMC 4OMOA 1VQ5Q 1VQ7Q 4N4HA 2MK5A 4C8QA 2HQHA 3G6EQ 4PJOF 3Q1JA 3JAME 2CSIA 2EQJA 2XDBA 4C8QF 2HCKA 2RK1A 1KJWA 4XU2A 5GANj 4OMLA 2QEXQ 4J9BA 5CKEA 4OGEA 2PUOB 3A8HB 2ZCFB 2OI3A 3UATA 3X28B 4C0DB 1VQPQ 4M75D 2LNHB 4L59A 1ZA1B 1NJIC 2KY9A 1PD1A 3L2UA 1CKBA 4WF2A 1RAEB 4RTTA 2EGAA 4AFSC 2HZYA 4OMPA 1YJNT 2ZGWA 4C0FA 2IPOB 4BI8B 4M75B 2D6FA 3UWNA 3BW1A 2GQIA 2FPDA 4P5NA 2NUTA 2Z0WA 1AOJA 4ANJA 1NYGA 2DBMA 8ATCB 2FPEA 3UF4A 2HKQB 4VUBA 4QVZA 3CCMA 4M78G 5A0LA 3LWHA 1WJQA 3VS6A 3QDFA 1M1KU 5I2MA 2X9HA 1VQLA 2OTJT 2J7IA 1K8AR 2XKOC 3REAB 2C0TA 2K7AA 4QQDA 2JS2A 3QJ6A 5CQYA 1U5SA 4GY5A 1XQHA 1ZSZC 1W2BA 1BI1A 2DFUA 1JJ2A 1BB9A 1ZQ1A 2GCXA 5CKHA 2PNIA 4C8QD 1K0SA 3QYGB 2AIRB 3JCMe 1ZSZA 4JJCA 4BDZA 1DJ7B 2FRWA 3REBB 3M58A 4C0GA 1H3HA 1R0BG 1KC8U 3G71Q 1PKTA 4FM4B 3SWNA 5DM7R 1YCSB 3OW2A 3EGDA 1QVFA 3JSCA 4FT2A 3SEMA 3S3OA 4PLIA 3CCRQ 2QTXA 3QG1A 1ZX6A 2CYZB 2KRSA 5KYNA 4FW1A 4X9DA 3OYYA 2YDLA 4MDWA 3FJ5A 1E7OA 4J9HA 4OMMA 1JXOA 2FPFA 2K5IA 2LQ8A 3VS2A 3DB3A 2KNBB 4LDUA 3CCMQ 2G3RA 4XU3A 1Z9QA 4JUVA 4E7LA 1X6GA 3MP8A 3UA7A 4L5GA 5FWCA 4EMKA 3A8OB 3CCLA 2KK4A 5EC7A 2F5KA 4ORZA 3JB9J 3NTHA 3X26B 3VS0A 1QCNA 2B8AA 1KSWA 2G6FX 5DLOA 1T0HA 4CC2A 3OYMA 4ZTFA 2EKHA 5FLXE 1MGQA 2QA4A 4QKUA 1JBMA 4PJLA 1M5Q1 4M7DF 2AZVA 5GMKl 4WCIA 1N27A 1TOVA 3V7RA 2GFAA 3CMAA 1UUEA 2COWA 3GP8A 2DL5A 2GQVA 3X24B 2VYTA 4X1VA 4GLKA 4RTXA 1Z9ZA 1PG5B 3RMQA 1GBRA 3A98A 5LJ3e 5GMKe 3CC4T 1ARKA 2GNCA 1WPYA 1N9RA 1VQOT 2EWNA 1WHJA 3RKXA 3CC7Q 2E70A 2YUNA 4IUTA 5GANd 2M02A 1YJNA 1I4K1 3FLGA 2CP0A 1NJIR 4BI4A 3CCVT 1C0MA 2DJZA 3LLRA 2KVQG 4Z02A 1NLOC 2RHXA 3L2QA 1RUWA 1K8AC 1LCKA 2DERA 4MDXA 4NS5A 1H92A 4XTUA 4M7AF 4JJDA 2ECZA 4KH1B 1Y0MA 2ATCB 3VKIA 3RBBB 1C6VX 4JRPA 2MCNA 1NG2A 4AG2C 4Y92A 1ZA2B 2E4HA 2D8HA 3KXTA 1NPRA 1KHIA 1X69A 5FRNA 2DXUA 2NUPA 1WLPB 1QVFP 1RL2A 3PIPA 1RADB 1GXIE 5ECAA 1YJ9A 1VYVA 3M0SA 1WDXA 4HXJA 3RERA 2DILA 5L8RE 4FSSA 1M27C 1VQMQ 5GANf 1GCQC 3MPUB 1YCYA 2LCLA 1I5LA 3UDCA 3JCMc 2OTLA 3E1SA 4R56A 1Q86C 2V8IA 4J9EA 1QWFA 1KC8C 1ZSZB 4Z88A 2OAWA 1WNLA 3P8HA 4F7UE 3MO8A 2NWMA 2DK3A 1Q81R 3QWXX 1VQ8T 3X25B 3O8VA 5IH2A 5LJ3h 3A8LB 1K76A 5GMKh 4XAXB 5GAMd 5LJ5h 3PVQA 3VUZA 4DOWA 1JU5C 3OB9A 4KRTA 4B6MA 2JTFA 2BUDA 2DZ9A 1SKUB 2F69A 5KCOA 1AWOA 2JJ9A 4A53A 2VGMA 7AT1B 4IIOA 5A2QE 1KFZA 3QZ5B 2E10A 3KBGA 1VQOA 3KFVA 2EBPA 1VQ5A 1VQLQ 2EJFA 1PKSA 2EYYA 1Y7XA 4MMKA 2DYBA 3CCQT 1RAHB 1VQNT 1UGRB 2YLCA 1SEMA 4XTZA 2DTOA 1MMDA 3CC4Q 2L89A 2J6KA 2HDAA 3NMZC 2KRMA 4RTYA 1BCMA 5KYXA 1OPKA 1EIFA 2MOXA 2K2MA 1RLPC 3G7ZA 4J6XA 1TS9A 1NBEB 2ZPBB 5FROA 2R58A 1M4ZA 1N6AA 2QA4Q 4DBRA 1FWZA 5KCHA
chains in the Genus database with same CATH topology
1BI0A 2DZCA 2LQKA 4UC4A 4EMHA 2DIQA 5A0DA 3L2ZA 4M7AC 1M8VA 2LT1A 5DY9A 4M77E 4E7JA 2RO0A 3MCAB 2JUFA 4N4GA 3HFNA 2DD5A 2X4XA 1D3BB 1VIEA 2P4TA 4M77C 4DOVA 3A8MB 1RI0A 4XQ3A 5KE3A 4OVAA 1YI2A 3M57A 4QW2A 3GIBA 1H3ZA 2X4YA 5HK3A 2VV5A 2CZ6B 3RUXA 5D6WA 3CC2A 3HKSA 5IAYA 1Q81U 4EMGA 1TH7A 3CMEA 3CPWA 4M7DC 2C06A 2JVVA 2QEXA 4PKCC 3MEVA 3FJPA 3FB9A 2E12A 4OB2B 3FC3A 1Q82U 3GNFB 3HSBA 3L42A 1S72A 2DEQA 4BE2A 4F7UA 5GAOr 1S72T 2HQEA 3OA6A 2KMTA 2NLUA 3CPFA 3JRZA 3OYGA 2X4JA 5CVIA 4M78A 4ZGDB 2Y4XA 2X35A 3PT9A 2XG8D 1YHQA 1VIFA 2K2VA 3CCEA 4C5IA 1M1KC 2CZ1B 5D6YA 4M7DD 5GAOl 3QYHB 4FIBA 3SFMA 2E1HA 2HD0A 4CI0C 3MP1A 5GAN3 3FEOA 4MMLA 3R6OA 4M7DB 4XTVA 5GAMf 3M5AA 5GMKm 1I8FA 2GFUA 3ZEHA 2DXTA 3P8DA 4M7AG 3BDLA 4IURA 4J6YA 4E7KA 3G6EA 3ER0A 2VXEA 1JB0E 1R8OB 4YTLA 2LNVA 4MZMA 3JCMf 3HFOA 5GAMj 4F7UF 2LCCA 4M77B 3CBMA 4XTYA 5KH6A 4HCZA 4BDYA 4RG8A 4M7DE 2CZ0B 2RH2A 1K9MU 4F7UB 4KUIA 1AHJB 3L2VA 1YHQT 3LH0A 2EKOA 2EJ9A 1G5VA 4M78D 3ASKA 3X20B 2ZPFB 1HXDA 1BIAA 3CCST 4RCBA 2DVEA 1H641 5CCAA 1QW1A 1M1GA 2LT4A 2MWOA 2RD1A 2RJCA 5KE2A 4XU0A 4N4HA 4A54A 5GAOp 4A4KA 3V7CA 1NJIU 1KD1C 1PSFA 4EMKC 3VUBA 4C8QA 5J3BA 4JRIA 4PJOF 2KAFA 3Q1JA 1UB4A 2VXFA 3JAME 2EQJA 3KUFA 1YI2T 2XDBA 2RB6A 3H6ZA 4C8QF 5GAMh 5GAN2 2RK1A 2RJEA 1LOJA 4BY6B 2RHUA 4XU2A 5GANj 2GF7A 1BIBA 5M9OA 2DD4A 4A4HA 5LJ5f 2RM4A 5CKEA 3OY9A 4HT9A 4OB0B 4OGEA 2PUOB 4IUQA 2WSCE 1QVGS 3A8HB 2ZCFB 3MHXA 1G3WA 2K3XA 4OP0A 2WACA 3X28B 4J8OA 3G4ST 3V8KA 4C0DB 4C92F 1YITA 2KDSA 3L1AA 3QIIA 4M75D 4L59A 3NFCA 3I55T 2D9TA 1WQ7A 4A4FA 1NJIC 3TU4K 2KY9A 2FHDA 2LTOA 3CCRT 3ZFJA 3JB9G 1M90C 3L2UA 1PSEA 4XTWA 1P92A 3V8LA 4XU1A 3RIRA 1VQ6A 2ZZDA 3CD6A 4WF2A 3G71T 3CXCA 2CGHA 4J5YA 3CCMT 4HT8A 3I55A 3OMGA 2E65A 3OYHA 3BFMA 2MMPA 1VQ8A 3CC4A 3QPHA 3FRNA 2ZGWA 4PL6A 5LL6S 4C8QE 4RCCA 1HK9A 4C0FA 4JS4A 1YJNT 4BI8B 4M75B 2R5MA 5FU7C 5J39A 1QVGA 3E9FA 2EYQA 3BW1A 3UWNA 4ZN3A 2IG0A 4P5NA 3CBPA 2HBPA 5I21A 5LJ3j 4M78B 5GANg 4KUDK 3CCUT 3L2WA 1KD1U 4B9XA 3CMET 3M9QA 2P0PA 1VQKA 4M7DG 4C92A 5C6SA 4M78F 4M7AA 2ZPEB 4KT0E 4QVCA 2XDPA 1Q7YC 2HAXA 2K5FA 3MEUA 2WSEE 2F5TX 1LJOA 4IUVA 1VQMT 3CCVA 1VQ9T 2XHCA 2EAYA 4E7IA 4Y91A 1YIJA 2X4WA 4J6WA 4VUBA 4QVZA 3CCMA 2YLBA 5LJ5d 4M78G 5A0LA 4NOYA 1QP2A 3C4SA 3PNWC 1WJQA 2ZPGB 4N4IA 4BI3A 3LWHA 1VQ4A 1K9MC 3HHTB 1M1KU 5I2MA 5GAN8 3OYNA 2KSSA 1VQLA 2OTJT 3M4GA 4NL3A 2QEXT 4LD9K 1VQLT 4PJOA 3EFSA 2OTJA 3FDRA 2XKOC 1YJ9T 2VC8A 4QQDA 2PUKB 1IZ6A 2PQWA 3QJ6A 2XDDA 3M56A 4IUPA 3VU3C 1G3YA 1Q86U 2FB7A 3M54A 2BIVA 4ZGEB 2QQRA 2JZ2A 2RI5A 2ZPHB 3C95A 5CQYA 3CCJA 4PLLA 1QVPA 2AHJB 3I56A 1V29B 4FSXA 4GY5A 4EPCA 3M59A 4M77F 2MAMA 4MZPA 1XQHA 4D6WA 1W2BA 2LX9A 1VQ7T 1YBYA 2VUBA 4QQGA 1BI1A 2OAUA 5GAMe 5IT9E 3CMAT 3PIOA 2D6FA 4Y28E 1JJ2A 1ZQ1A 2V8KA 2GCXA 3HRTA 3LGLA 4IUUA 5CKHA 3OMCA 4M75C 2QQAA 3EAEA 4BUGA 4B9WA 4C8QD 3QYGB 3JCMX 2FL7A 3INZA 3VYHB 4PJOB 4M75A 4C92D 3JCMe 4BDZA 1DJ7B 3JB9D 2XI9A 2PVDB 3META 4J7FA 4ELZC 3M58A 2QDYB 5HKCA 3VV0A 2DTHA 4C0GA 5GAOn 4ATOA 3H8ZA 3OQ5A 3CC7T 1XOVA 3RESA 1VQKT 2D0QB 2M16A 4HKEA 3CCLT 1KC8U 4BE0A 4M7AE 4J83A 2MI6A 1Y07A 4FM4B 3SWNA 3JCMd 4CRIA 4C5HA 5DM7R 2KQWA 4C0DC 3SWNC 3NTIA 4C92B 4JJNK 3OW2A 3OW2S 1QVFA 1OZ2A 4V2SA 3JSCA 3DB4A 3LYIA 4FU6A 4FT2A 3JCMh 3WVEB 4PLIA 4EMKB 3S3OA 3UT1A 2QTXA 4LD6A 1FXXA 3QG1A 2XD0A 3PMTA 2CYZB 2M1HA 4NL2A 3BY7A 2A7YA 4JLIA 2XIDA 4X9DA 3OYYA 3T9NA 5KCHA 1D3BA 3MEWA 4MDWA 3J7AF 4M77G 1ZBXA 1BI3A 1X75C 3DLMA 5CO7A 3OS1A 2RHIA 1FX7A 2CZ7B 4TVRA 1N8RU 1NE8A 2E6ZA 1G3TA 3TEEA 2K5IA 4OGCA 2RK2A 2K57A 2LQ8A 3P8BB 4O5VA 4BACA 3V7SA 3DB3A 3GPLA 4LDUA 1QVFS 2K4YA 5CQXA 1K8AU 1JJ2S 2MWPA 2V8JA 2R57A 2G3RA 4XU3A 3OSSC 1KQSA 4J7IA 4JUVA 2E5QA 4E7LA 2JN0A 3CCET 4M7AD 3S3NA 2RJFA 3MP8A 4L5GA 2ZPIB 4M75F 3A8OB 4EMKA 3M53A 3CCLA 3QSUA 2KK4A 2F5KA 2MF2A 3HL8A 3JB9J 3LW5E 1BYMA 2WSFE 4N0AA 3NTHA 4HA8A 5FU6C 3X26B 4C5EA 4BE1A 2B8AA 1UGPB 1B34B 3CBOA 5CK9A 5DLOA 4HCCA 4JRKA 3HRSA 3OYMA 4ZTFA 2FYKA 2EFIA 3GLXA 3VJPA 1MGQA 5LJ3d 5FLXE 4JRQA 1WQWA 2DPPB 2O4XA 4ME7A 2QA4A 3ZBDA 1JBMA 1M5Q1 1K73U 3A5ZB 3CEYA 3OYCA 1M90U 4M7DF 5GMKl 3OYDA 3FIFA 1N27A 5LJ5j 4R55A 1M9SA 3V7RA 2GFAA 3CMAA 3HRUA 3OBWA 3JCMb 4ZN1A 1YJWT 2OTLT 1YJWA 3GP8A 2HQXA 2GQVA 3X24B 2VYTA 3RKYA 4GLKA 3G71A 1YITT 3RMQA 3CD6T 5IN1A 1YIJT 2DAQA 1KQ1A 3M4YA 5LJ3e 5AYFA 2JNGA 5GMKe 3CC4T 4XK8E 3OS2A 4OB3B 4C5GA 3OYIA 5FU6B 1WPYA 1N9RA 3F70A 3CCRA 3LX7A 1VQOT 2EWNA 5CKDA 4Q5WA 3LWIA 3QO3A 1M1FA 2QXFA 4JLGA 1VUBA 3QBYA 1WGSA 3RKXA 4JS5A 3N5BB 3CCUA 3DLLA 3S6WA 3HPWA 4O6JA 1Y96B 3OYLA 2E70A 4IUTA 2K5LA 4A4EA 2DXCA 2XU8A 5GAMg 4M75G 5GANd 4DA4A 5D6XA 4QVDA 1YJNA 5CAIA 1I4K1 2RHYA 3QHSA 5GAN7 1MHNA 3FLGA 2XICA 2R5AA 5I2SA 4LDWA 4M77D 3CC2T 4HCBA 3SWNB 1X6OA 4BI4A 3CCVT 1VQ9A 4M7AB 5LJ5g 2DJZA 4LDVA 2RHXA 2KVQG 3LLRA 4Z02A 4FT4A 3J81E 3L2QA 1VQPA 3BDUA 3OS0A 1K8AC 1W4SA 4NS5A 3QKJA 3CCQA 3AHUA 4XTUA 4M7AF 1UGQB 2FVUA 3CC7A 3WXMB 3A8GB 5A0GA 3VKIA 3HP9A 4KULA 1VQ5T 2HNIA 4JRPA 2P0KA 2Y90A 5GAOm 5CKBA 3GF5A 4A4GA 1KQ2A 3KXTA 1NPRA 1KHIA 4FL6A 4EDUA 5FRNA 2DXUA 4LDYA 2LDMA 3OBYA 1RL2A 4C92C 3PIPA 4L6V5 2YRVA 3QUIA 1G3SA 2E6NA 2LRQA 4C8QC 1GXIE 2A3LA 3SDZA 4BD3A 3G4SA 1YJ9A 4C0ZA 5LJ3g 3RERA 4X9CA 4IKFA 5L8RE 5GMKj 1VQ7A 1QP3A 4RG2A 1WJRA 5HY6A 1Q82C 5FRMA 4DQ2A 5GANe 4E7HA 4PJOC 2EJGA 3DKMA 3QXEB 5GANf 2Y4YA 1UGSB 4II1A 2VGNA 1LNXA 5LJ5e 3GOXA 1B34A 1YCYA 2H3JA 2LCLA 1I5LA 4M7DA 2DKGA 3E9GA 3JCMc 3UDCA 4RMOA 4KBMB 1Q81C 3E1SA 4R56A 2OTLA 1Q86C 1Y96A 2V8IA 3CPWS 3JB9H 2L8DA 4PJOD 4MDXA 4PNOA 2O4XB 1KC8C 2PVGB 4BB7A 4OMFB 4F7UG 1WNLA 3P8HA 3OYBA 2QQSA 4E47A 3JCMW 4F7UE 3QJYA 3M55A 1WJSA 3MO8A 5J26A 2DK3A 2L3RA 3CCJT 3VYGA 4X34A 1VQ8T 3TCJA 3O8VA 3URGA 3X25B 5LJ3h 3A8LB 5GMKh 3CXCS 1U8RA 4XAXB 5GAMd 2LVMA 3VUZA 5LJ5h 3UPUA 1O75A 4DOWA 1ZHIA 3OYKA 3OB9A 3RKWA 1K73C 3JCMQ 1Y71A 2PVOB 2DO3A 3E19A 3PGGA 1XTDA 3PMIA 4M78E 2E64A 2JTFA 2BUDA 2DZ9A 4N0AC 4C92G 4M78C 3JCMg 2LC4A 3OYEA 3RMSA 2F69A 2CKKA 1OI1A 5FU7B 3OS5A 4MZTA 5GAOq 2DXBA 3PFSA 2M9UA 2RI3A 5KCOA 3I56T 3PTAA 2QQBA 2EQMA 2P0QA 1Q7YU 4PJOE 1BKBA 1IREB 2VGMA 4A53A 5CIUA 5A2QE 1VQ4T 2QI2A 2RA2A 3QZ5B 2DIGA 3SD4A 2E10A 3JB9I 3KBGA 4QQ6A 2CS7A 1VQOA 1U1SA 1W2BS 1VQ5A 3QDRB 2EJFA 4LDXA 2RHZA 2PU9B 1X01A 1Y7XA 4MMKA 1VQ6T 3CCQT 2L5QA 5GAN4 4PJOG 3EFRA 1U1TA 1OYXA 2E41A 2M0OA 1VQNT 3OSVA 2JOYA 2XK0A 4RKUE 3OYFA 1I81A 3QZ9B 1UGRB 3G6ET 2YLCA 3V8JA 1O9SA 3J80E 4M75E 1NZ9A 4ELYC 4C92E 4XTZA 5LJ3f 1NPPA 2EQKA 2DTOA 3C94A 1N8RC 2JTMA 1XNIA 3JCMJ 2YHTA 2L89A 5GMKi 2IVWA 1VQNA 2BKDN 5HK0A 5EG2A 1VQPT 3C12A 3OYJA 2QA4T 2RJDA 3MP6A 3JCMP 3JCMV 3S3MA 2O01E 2QQ9A 2I2LA 1KG1A 4JDSA 5CKFA 1VQMA 1JRIA 3OYAA 5DLQE 4C8QB 3TREA 4ZGJB 3ME9A 3MEAA 5C0MA 1BI2A 1EIFA 3JB9F 1KQSS 2EQUA 5GAN6 2EIFA 3L2RA 5GANh 3WVDB 4XTXA 1N9SA 3G7ZA 4J6XA 4OB1B 2ZPBB 3GNGA 3NTKA 5FROA 1KHCA 3SB2A 4C8QG 2R58A 1M4ZA 1OZ3A 2K3YA 4M77A 5GAN5 1UEBA 1N6AA 3LGFA 2DTIA 5CR2A 4BY6C 3CCSA 4ZTJA 1SSFA 4OF1A 1FWZA 2RI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UC4 A;  4IKF A;  2DIQ A;  4RG2 A;  1WJR A;  5FRM A;  4E7J A;  2RO0 A;  4N4G A;  3OMG A;  3OYH A;  2X4X A;  4BAC A;  3DB3 A;  4E7H A;  4PL6 A;  1RI0 A;  5KE3 A;  4II1 A;  2MWP A;  4OVA A;  4QW2 A;  2R57 A;  1H3Z A;  2X4Y A;  2G3R A;  2R5M A;  5J39 A;  3GOX A;  3E9F A;  3UWN A;  4E7L A;  2E5Q A;  2IG0 A;  3E9G A;  5D6W A;  5IAY A;  3S3N A;  2RJF A;  3MP8 A;  3L2W A;  4B9X A;  3M9Q A;  2L8D A;  2F5K A;  5C6S A;  3MEV A;  2O4X B;  3FC3 A;  3P8H A;  2XDP A;  3OYB A;  3L42 A;  3NTH A;  4BE1 A;  4C5E A;  2QQS A;  4BE2 A;  2B8A A;  3MEU A;  2HQE A;  4IUV A;  3OA6 A;  2NLU A;  3OYG A;  1WJS A;  3MO8 A;  3OYM A;  5J26 A;  4E7I A;  2L3R A;  4ZTF A;  4X34 A;  2X4W A;  2EFI A;  2X35 A;  3O8V A;  4QVZ A;  2LVM A;  2O4X A;  3C4S A;  3PNW C;  1WJQ A;  4N4I A;  4C5I A;  5D6Y A;  3OYC A;  3CEY A;  3OB9 A;  3OYK A;  3OYD A;  3OYN A;  3MP1 A;  1N27 A;  3FEO A;  3PMI A;  3FDR A;  2JTF A;  2GFA A;  2BUD A;  2GFU A;  3ZEH A;  3P8D A;  4QQD A;  3OYE A;  2CKK A;  2PQW A;  1OI1 A;  2HQX A;  3BDL A;  3QJ6 A;  2VYT A;  4IUR A;  4IUP A;  3PFS A;  2RI3 A;  5KCO A;  4E7K A;  2EQM A;  5IN1 A;  2BIV A;  2DAQ A;  2QQR A;  2JZ2 A;  2RI5 A;  2LCC A;  4PLL A;  3OS2 A;  5CIU A;  4C5G A;  5KH6 A;  4HCZ A;  2DIG A;  3OYI A;  3F70 A;  4GY5 A;  3LX7 A;  3SD4 A;  4BDY A;  4QQ6 A;  4Q5W A;  3L2V A;  3LH0 A;  2EKO A;  2RHZ A;  3QBY A;  1WGS A;  1G5V A;  3ASK A;  4QQG A;  3S6W A;  1OYX A;  2M0O A;  3OYL A;  3LGL A;  4IUU A;  2XK0 A;  4IUT A;  2MWO A;  2RJC A;  3OMC A;  5KE2 A;  3OYF A;  4A4E A;  3EAE A;  4B9W A;  4N4H A;  5D6X A;  2RHY A;  1MHN A;  3FLG A;  2R5A A;  2EQK A;  4BDZ A;  1XNI A;  2L89 A;  3Q1J A;  2RHX A;  2EQJ A;  2BKD N;  3KUF A;  3LLR A;  4Z02 A;  3L2Q A;  3OYJ A;  3MET A;  3OS0 A;  2RJD A;  3MP6 A;  4NS5 A;  3QKJ A;  3H6Z A;  3S3M A;  3H8Z A;  3OQ5 A;  2RJE A;  2RHU A;  2M16 A;  2GF7 A;  3OYA A;  4BE0 A;  2P0K A;  5C0M A;  5M9O A;  3ME9 A;  3MEA A;  4A4H A;  4CRI A;  4C5H A;  3OY9 A;  4A4G A;  3NTI A;  2EQU A;  4IUQ A;  1OZ2 A;  4FL6 A;  3LYI A;  3DB4 A;  4FU6 A;  4EDU A;  3L2R A;  3S3O A;  5FRN A;  4PLI A;  2LDM A;  2K3X A;  2WAC A;  3UT1 A;  4LD6 A;  3NTK A;  2YRV A;  5FRO A;  3QII A;  1KHC A;  3PMT A;  2M1H A;  4L59 A;  2R58 A;  2E6N A;  2D9T A;  2LRQ A;  1OZ3 A;  2K3Y A;  4A4F A;  3LGF A;  4BD3 A;  2LTO A;  2FHD A;  3MEW A;  5KCH A;  3DLM A;  1SSF A;  3L2U A;  4ZTJ A;  3OS1 A;  2RI2 A;  2RHI A; 
#chains in the Genus database with same CATH topology
 1X2K A;  1AZE A;  1UGV A;  3L2Z A;  5D7U A;  4M77 E;  2RO0 A;  3MCA B;  2DD5 A;  2P4T A;  1WA7 A;  4XQ3 A;  1YI2 A;  1F1B B;  4QW2 A;  5HK3 A;  2VV5 A;  2BE9 B;  2CZ6 B;  1SSH A;  2IIM A;  3H0H A;  1QCO A;  2DEU A;  1S72 A;  4BE2 A;  5GAO r;  1S72 T;  1QKW A;  2HQE A;  3OA6 A;  2KMT A;  2NLU A;  1LPL A;  2JXB A;  2W10 A;  1WHL A;  4RTW A;  1WIE A;  4ZGD B;  5L23 A;  2E3I A;  2XG8 D;  1VIF A;  2K2V A;  2QYZ A;  3CCL Q;  3QYH B;  5GAN 3;  3MP1 A;  4LNP A;  4MML A;  2V1R A;  3R6O A;  4XTV A;  3M5A A;  2NUP B;  4PJJ A;  2VXE A;  1JB0 E;  4CC4 B;  1WYX A;  2LNV A;  1ZUK A;  4F7U F;  3CBM A;  4XTY A;  4RG8 A;  1K9M U;  4F7U B;  4KUI A;  3L2V A;  2EKO A;  2YUP A;  2D8J A;  4KGZ B;  2CSQ A;  2KBT A;  2ZPF B;  4RCB A;  3CQT A;  1QW1 A;  2YXY A;  2MWO A;  4AFU C;  4AT1 B;  1UE9 A;  4LXC A;  3NGP A;  3V7C A;  1NJI U;  2KRO A;  4JRI A;  2VXF A;  2RB6 A;  3H6Z A;  2RJE A;  1LOJ A;  1RAC B;  1U06 A;  2M51 A;  5M9O A;  2DD4 A;  1QVG S;  4WTO B;  1G3W A;  4OP0 A;  1NEB A;  2WAC A;  3V8K A;  4C92 F;  2KDS A;  2CP5 A;  1ZLM A;  3TU4 K;  3CCR T;  1M90 C;  3ZFJ A;  3JB9 G;  3V8L A;  3RIR A;  2C0I A;  1VQ6 A;  2ZZD A;  1W1F A;  1K0X A;  2I0N A;  2CGH A;  3QPH A;  1HK9 A;  1QVG A;  3E9F A;  4ZN3 A;  4KUD K;  4M78 B;  3CCU T;  1WXB A;  3CME T;  3M9Q A;  2L3Q A;  4M78 F;  1HYO A;  1K9A A;  4QVC A;  3I55 Q;  1Q7Y C;  2HAX A;  2SRC A;  1LJO A;  3CCV A;  3M0U A;  2QTV A;  3EG9 B;  4J6W A;  5LJ5 d;  3C0C A;  3EFO B;  3C4S A;  4N4I A;  2ZPG B;  1VQ4 A;  5GAN 8;  3OYN A;  1ZSG A;  4LD9 K;  1VQL T;  2OTJ A;  1RAA B;  1YJ9 T;  2VC8 A;  1OEB A;  1IZ6 A;  4IUP A;  1G3Y A;  2FB7 A;  2L3S A;  4ZGE B;  3I5S A;  2CRE A;  5HCK A;  2JZ2 A;  2RI5 A;  3CCJ A;  1V29 B;  4EPC A;  2DVJ A;  4JZ4 A;  2L0A A;  4D6W A;  4E6R A;  1AZG B;  1RAG B;  4Y28 E;  1KK7 A;  2QQA A;  3EAE A;  1W70 A;  2FL7 A;  4PJO B;  4M75 A;  4C92 D;  2EQI A;  1WFW A;  2ESW A;  4DBF A;  1GCQ A;  1EX4 A;  4ELZ C;  4AG1 C;  2COY A;  3VRZ A;  3VV0 A;  4ATO A;  1J3T A;  1XOV A;  1VQK T;  2D0Q B;  4HKE A;  3CCL T;  2MI6 A;  1Y07 A;  3JCM d;  4CRI A;  4C0D C;  4JJN K;  3OW2 S;  3LYI A;  1QQJ A;  3UA6 A;  1FXX A;  3BY7 A;  4JLI A;  2FEI A;  2DLP A;  3DLM A;  2CZ7 B;  1FX7 A;  2RHI A;  1N8R U;  4PFP A;  1G3T A;  1VYU A;  2BE7 D;  3TEE A;  2AK5 A;  1WXU A;  3P8B B;  4O5V A;  1BCO A;  3V7S A;  1MMN A;  2CH4 W;  5CQX A;  2L3P A;  1JJ2 S;  2R57 A;  4RTZ A;  3OSS C;  3S3N A;  4PFO A;  2L2P A;  2A0F B;  3HL8 A;  3LW5 E;  1BYM A;  4AFQ C;  1B34 B;  2YUQ A;  3GLX A;  5LJ3 d;  4JRQ A;  2O4X A;  3A5Z B;  1U3O A;  3CEY A;  3OYC A;  1M90 U;  3LH5 A;  4FYY B;  5LJ5 j;  4R55 A;  3HRU A;  3JCM b;  1YJW T;  1CKA A;  1YJW A;  3RKY A;  3G71 A;  2EGC A;  1KQ1 A;  2LCS A;  5IXB A;  5AYF A;  1VA7 A;  1UJY A;  3OYI A;  3CCR A;  3EGD B;  2KXC A;  1FMV A;  5GJV B;  3QO3 A;  1VUB A;  3N5B B;  3HPW A;  3M0Q A;  1Y96 B;  1SF9 A;  1I0C A;  2DXC A;  4M75 G;  4DA4 A;  5D6X A;  4QVD A;  5CAI A;  1PRL C;  3QHS A;  5GAN 7;  1MHN A;  5KYU A;  2XIC A;  3CC2 T;  1VYT A;  3U23 A;  2KI7 A;  4FT4 A;  3BDU A;  3OS0 A;  1TUD A;  2FVU A;  3WXM B;  2P0K A;  4PK4 A;  1D1C A;  4A4G A;  1KQ2 A;  2BZX A;  4EDU A;  2LDM A;  3OBY A;  1D09 B;  4C92 C;  3PVL A;  2LRQ A;  4BD3 A;  1OUL A;  1VQ4 Q;  5LJ3 g;  3MKD A;  1VOM A;  5GMK j;  1QP3 A;  4RG2 A;  5HY6 A;  5FRM A;  1TG0 A;  2HBW A;  4E7H A;  2LJ3 A;  3DKM A;  1MV3 A;  1UGS B;  4II1 A;  2VGN A;  5LJ5 e;  4M7D A;  2H3J A;  1Q81 C;  3E9G A;  4KBM B;  2HL5 C;  3VS4 A;  4PNO A;  4F7U G;  4OMF B;  3OYB A;  1K73 R;  8AT1 B;  1OU9 A;  3JCM W;  1WJS A;  2MYS A;  5J26 A;  4X34 A;  5IHK A;  3TCJ A;  3URG A;  1U8R A;  2LVM A;  3M0T A;  1Y71 A;  2DO3 A;  3PGG A;  3PMI A;  4M78 E;  2AZS A;  4E7S A;  4N0A C;  2DL3 A;  3TSZ A;  4D8K A;  2CKK A;  3OS5 A;  1KD1 R;  4M7D D;  3PFS A;  2RI3 A;  3I56 T;  1Q7Y U;  1E6G A;  2K6D A;  1VQ4 T;  2RA2 A;  3SD4 A;  3JB9 I;  4QQ6 A;  1U1S A;  1MND A;  2RHZ A;  4JJB A;  1VQ6 T;  2L5Q A;  5GAN 4;  3EFR A;  2E41 A;  5KYU B;  1YN8 A;  2YUO A;  2JOY A;  1TWB A;  3G6E T;  1I81 A;  1M3C A;  1SRM A;  1YWO A;  3V8J A;  1O9S A;  1UHF A;  2FRY A;  4C92 E;  1OX8 A;  3H0I A;  2X3W D;  1XNI A;  2YHT A;  1IHV A;  1VQN A;  5EG2 A;  3VRY A;  3C12 A;  3OYJ A;  3JCM P;  3JCM V;  3M0P A;  2EPD A;  4CC3 A;  1OQK A;  2QQ9 A;  1KG1 A;  4JDS A;  5CKF A;  1JEG A;  5DLQ E;  4C8Q B;  5C0M A;  1BI2 A;  3JB9 F;  1PD0 A;  5GAN 6;  3WVD B;  1N5Z A;  1N9S A;  4LN2 A;  4OB1 B;  1ZUU A;  1PC0 A;  2K3Y A;  1UEB A;  3LGF A;  4BY6 C;  3CCS A;  4ZTJ A;  1SSF A;  4OF1 A;  2DRK A;  2DZC A;  2DIQ A;  2E3H A;  4M7A C;  1M8V A;  1MMA A;  5DY9 A;  1GL5 A;  4N4G A;  2JUF A;  1VIE A;  4M77 C;  1UTI A;  4DOV A;  4KGX B;  2A08 A;  4OMN A;  3A8M B;  4OVA A;  1H3Z A;  3GIB A;  1WI7 A;  2A28 A;  3EG3 A;  4J9F A;  1W2B P;  1QWE A;  3RUX A;  3CC2 A;  3HKS A;  1YI2 Q;  3MEV A;  2J6F A;  4OB2 B;  3HSB A;  3L42 A;  2KT8 A;  1SRL A;  5CVI A;  1G2B A;  3PT9 A;  4J9C A;  2CZ1 B;  5D6Y A;  2CP3 A;  3SFM A;  2E1H A;  3CD6 Q;  5GAM f;  5GMK m;  1QMC A;  1I8F A;  2GFU A;  2DXT A;  3P8D A;  1D0Y A;  4M7A G;  1RAF B;  4J6Y A;  4E7K A;  1K9M R;  3JCM f;  5GAM j;  4HVU A;  4HVW A;  1TUC A;  2RH2 A;  1YHQ T;  2O88 A;  3LH0 A;  1TU0 B;  3ASK A;  3X20 B;  1HXD A;  2LQW A;  1X6B A;  1H64 1;  1M8M A;  4A54 A;  5GAO p;  4A4K A;  1PSF A;  2HEQ A;  3CCE Q;  4AMC A;  2KAF A;  1UB4 A;  3KUF A;  1YI2 T;  1HJD A;  2RHU A;  1K1Z A;  2GF7 A;  1BIB A;  3M0R A;  4A4H A;  2RM4 A;  4FYW B;  4HT9 A;  4IUQ A;  2WSC E;  2QAZ A;  1YIT A;  4J8O A;  2ED1 A;  3NFC A;  1B3Q A;  2D9T A;  1ABQ A;  1W6X A;  1WQ7 A;  4A4F A;  2LTO A;  1PSE A;  3RR6 A;  4XTW A;  1P92 A;  3A1P A;  2QGF B;  4J5Y A;  3CCM T;  3OMG A;  3CC4 A;  2PZ1 A;  2ED0 A;  3FRN A;  5LL6 S;  4PL6 A;  4JS4 A;  4RCC A;  4DBH A;  2R5M A;  2CT3 A;  2JM9 A;  4M7D G;  1KD1 U;  1IRX A;  2F2W A;  4C92 A;  1HD3 A;  2ZPE B;  4KT0 E;  2EVR A;  2XDP A;  2K5F A;  3MEU A;  2F5T X;  4IUV A;  1QVG P;  2XHC A;  3CPW P;  2DA9 A;  2X4W A;  2DL4 A;  1I5O B;  2JS0 A;  2P84 A;  1K9M C;  1UG1 A;  2YRC A;  3HHT B;  1X27 A;  2DX1 A;  2DYI A;  3M4G A;  4NL3 A;  3EFS A;  3FDR A;  3D7S B;  3BE3 A;  2HSE B;  3EH1 A;  3CCQ Q;  2PUK B;  2XDD A;  1Q86 U;  2XMF A;  2BIV A;  3NPF A;  2ZPH B;  3C95 A;  4HVV A;  2EYZ A;  3NHN A;  1AD5 A;  4FSX A;  2K79 A;  2MAM A;  1YBY A;  2VUB A;  4QQG A;  3G4S Q;  5IT9 E;  3PIO A;  1E6H A;  2V8K A;  3HRT A;  3LGL A;  4IUU A;  3OMC A;  4BUG A;  4B9W A;  3JCM X;  3INZ A;  1QKX A;  2H3E B;  2XI9 A;  2PVD B;  1I1J A;  1M2O A;  3EG2 A;  5HKC A;  2QDY B;  2VKN A;  2DTH A;  5GAO n;  3H8Z A;  3CC7 T;  2FO0 A;  5KYY B;  2LQN A;  4BE0 A;  4M7A E;  2V1Q A;  2KQW A;  3NTI A;  4V2S A;  3DB4 A;  4EMK B;  2KEA A;  2BTT A;  3UT1 A;  4LD6 A;  2K3B A;  3PMT A;  2A7Y A;  2XID A;  3T9N A;  3CCU Q;  3H9N A;  3J7A F;  1PCX A;  2JM8 A;  3OS1 A;  2CDT A;  1RAI B;  4FYV B;  1NE8 A;  2E6Z A;  5FWB A;  4FCY A;  3VS3 A;  2RK2 A;  5KYW B;  1BBZ A;  1T3S A;  2K4Y A;  1SHF A;  1Q7Y R;  3PE0 A;  1K8A U;  2QK0 A;  4J7I A;  2E5Q A;  2JN0 A;  2RJF A;  2ZPI B;  3QSU A;  2NYS A;  1H8K A;  4J9G A;  2WSF E;  2OTL Q;  4RTV A;  1UGP B;  1KQS P;  3CBO A;  3CME Q;  2QDL A;  2FYK A;  2EFI A;  1UFF A;  1IGU A;  1WQW A;  2DPP B;  3EH2 A;  4ME7 A;  3ZBD A;  1K73 U;  1VQ8 Q;  3OYD A;  1YP5 A;  1M9S A;  2EW3 A;  2HQX A;  1VQ9 Q;  1YIT T;  2JW4 A;  1ABO A;  2EYW A;  2KYB A;  4QT7 A;  4XK8 E;  3OS2 A;  1YIT Q;  4PJN A;  2ROT A;  3LX7 A;  5CKD A;  4Q5W A;  3LWI A;  1M1F A;  2KGT A;  4AFZ C;  3S6W A;  3OYL A;  2K5L A;  5GAM g;  2XU8 A;  2B86 A;  3EGU A;  2LX7 A;  4KGV B;  2R5A A;  5I2S A;  4M77 D;  4HCB A;  3SWN B;  1X6O A;  1VQ9 A;  1AWJ A;  4PFZ A;  1QCF A;  1W4S A;  3CMA Q;  4EIK A;  3AHU A;  2HKN A;  1AEY A;  3CC7 A;  1GRI A;  3A8G B;  1HSQ A;  2FZC B;  4KUL A;  2HNI A;  1WZO A;  2Y90 A;  2HL3 A;  3GF5 A;  5FW9 A;  4FL6 A;  1GCP A;  4LDY A;  1R77 A;  2YRV A;  1G3S A;  2A3L A;  1X2Q A;  3SDZ A;  5KYX B;  1YFN A;  4C0Z A;  1WX6 A;  3EHQ A;  1UEC A;  4IKF A;  5GAN e;  2A37 A;  1AVZ C;  2Y4Y A;  1LVK A;  3GOX A;  2DKG A;  4RMO A;  1Y96 A;  1AWW A;  3CCJ Q;  2K9G A;  2PVG B;  4E47 A;  3M55 A;  3CCJ T;  2L3R A;  3OW2 P;  1Q82 R;  1NLP C;  2OTJ Q;  1FMK A;  1O75 A;  1OX9 A;  1M3A A;  1ZHI A;  3RKW A;  2LJ1 A;  2YRD A;  1VQO Q;  1D1A A;  2PVO B;  3JCM Q;  3E19 A;  3VS1 A;  1A0N B;  1XTD A;  2X3X D;  4C92 G;  4M78 C;  3JCM g;  2LC4 A;  3OYE A;  3RMS A;  1AWX A;  1OI1 A;  5FU7 B;  1ACM B;  5GAO q;  2KXD A;  1WHK A;  2ZAE A;  2CS7 A;  4LDX A;  2F1L A;  2PU9 B;  1X01 A;  2F2X A;  2EGE A;  1U1T A;  1WHG A;  2QGG A;  1QLY A;  2XK0 A;  4RKU E;  4F17 A;  3QZ9 B;  3EG0 A;  4M75 E;  1NZ9 A;  1I07 A;  5LJ3 f;  3C94 A;  4F16 A;  5AT1 B;  3JCM J;  2QA4 T;  1PM3 A;  3MP6 A;  2CH4 A;  3S3M A;  2O01 E;  1JRI A;  2J06 A;  1VQN Q;  2GTO A;  3TRE A;  1X43 A;  1KQS S;  2EIF A;  1ZBJ A;  3L2R A;  5GAN h;  4XTX A;  2DJQ A;  3GNG A;  3NTK A;  1KHC A;  4C8Q G;  1OZ3 A;  4M77 A;  2JTE A;  2DTI A;  5CR2 A;  1Q95 G;  4HCK A;  2RI2 A;  1BI0 A;  4UC4 A;  2LQK A;  2J6O A;  4E7Z A;  2AT1 B;  1W2B S;  3CCS Q;  3HFN A;  2JMA A;  2X4X A;  2OJ2 A;  5KE3 A;  4FYX B;  2VAS A;  2KR3 A;  5D6W A;  5IAY A;  1KIK A;  1Q81 U;  3CPW A;  1B07 A;  2C06 A;  4M7D C;  2JVV A;  2QEX A;  1IHW A;  4PKC C;  3FJP A;  3FB9 A;  2E12 A;  3GNF B;  2DEQ A;  4F7U A;  3CPF A;  3JRZ A;  3OYG A;  4M78 A;  2RN8 A;  1MMG A;  2W0Z A;  3CXC P;  1YHQ A;  1XJW B;  2DNU A;  1V76 A;  1YNZ A;  2MIO A;  2YWW A;  2AKL A;  1M1K C;  4CC7 A;  1CSK A;  5GAO l;  1VQK Q;  4CI0 C;  4M7D B;  1S72 Q;  3ZEH A;  3BDL A;  3VS7 A;  3ER0 A;  1R8O B;  3HFO A;  4ZNX A;  2AKK A;  4HCZ A;  1AHJ B;  2CP6 A;  2EJ9 A;  2X51 A;  1BIA A;  3CCS T;  2DVE A;  4K11 A;  2LT4 A;  2RJC A;  2D0N A;  2ROL A;  4XU0 A;  3I35 A;  1KD1 C;  4EMK C;  3VUB A;  5J3B A;  2ENM A;  1M90 R;  3I9Q A;  1GBQ A;  5I11 A;  5GAM h;  5GAN 2;  4BY6 B;  3EGX B;  5LJ5 f;  3OY9 A;  4OB0 B;  1IXD A;  3MHX A;  2DL7 A;  2K3X A;  3G4S T;  3L1A A;  1MNE A;  3QII A;  3I55 T;  3JV3 A;  1V1C A;  2FHD A;  5IHN A;  4RUG A;  4XU1 A;  1OOT A;  3CD6 A;  3G71 T;  3CXC A;  4HT8 A;  3I55 A;  2E65 A;  3OYH A;  3BFM A;  2MMP A;  1MV0 B;  1N8R R;  1VQ8 A;  2V26 A;  2VB6 A;  4R0K A;  4C8Q E;  4GBQ A;  2BZ8 A;  1PNJ A;  5FU7 C;  5J39 A;  2EYQ A;  5LJ3 j;  2IG0 A;  3CBP A;  2HBP A;  5I21 A;  5GAN g;  2LMJ A;  2JT4 A;  3L2W A;  1WHM A;  4B9X A;  1VQK A;  2P0P A;  2FZG B;  5C6S A;  4M7A A;  2WSE E;  4JPB W;  1S1N A;  1VQM T;  1VQ9 T;  2EAY A;  4E7I A;  4Y91 A;  1YIJ A;  3H41 A;  2M0Y A;  2RNA A;  2YLB A;  4NOY A;  1QP2 A;  3PNW C;  4BI3 A;  1IB8 A;  2KSS A;  1GFD A;  4PJO A;  2QEX T;  1IO6 A;  3MJX A;  3EHR A;  2KT1 A;  1M2V B;  2PQW A;  2DL8 A;  3M56 A;  3VU3 C;  2O2O A;  4DEY A;  3M54 A;  2QQR A;  1C1A A;  4PLL A;  1QVP A;  2AHJ B;  3I56 A;  3M59 A;  4M77 F;  4MZP A;  2LX9 A;  1IGQ A;  1VQ7 T;  5GAM e;  3CMA T;  2OAU A;  3EFO A;  3CCV Q;  4M75 C;  1UDL A;  3TQ7 P;  3VYH B;  2VWF A;  3JB9 D;  3R6N A;  1M3B A;  3MET A;  4J7F A;  2MPX C;  4DBQ A;  1SG5 A;  2GTJ A;  3OQ5 A;  2SEM A;  5I22 A;  3RES A;  2M16 A;  1K4U S;  4J83 A;  4C5H A;  3SWN C;  4C92 B;  1OZ2 A;  4PJO D;  3JCM h;  4FU6 A;  1EZZ B;  3WVE B;  4E2F B;  3IQL A;  2XD0 A;  1Q86 R;  2M1H A;  4NL2 A;  1PWT A;  3SHW A;  4Z89 A;  9ATC B;  1D3B A;  3MEW A;  5CO7 A;  1ZBX A;  1BI3 A;  1X75 C;  4J9I A;  4M77 G;  3VS5 A;  4TVR A;  3TVT A;  1YJN Q;  1JJ2 P;  2CT4 A;  4OGC A;  2CUD A;  2K57 A;  4BAC A;  4FW2 A;  1SHG A;  3GPL A;  2KRN A;  1M1K R;  1QVF S;  1BK2 A;  2MWP A;  2H8H A;  2V8J A;  3H0F A;  1KQS A;  3CCE T;  4M7A D;  4KH0 B;  4M75 F;  1JQQ A;  3M53 A;  2LJ0 A;  6AT1 B;  2KYM A;  2MF2 A;  1MUZ A;  1R0C B;  4N0A A;  4HA8 A;  5FU6 C;  4BE1 A;  4C5E A;  1YJW Q;  1YWP A;  5CK9 A;  4HCC A;  4JRK A;  3HRS A;  2QG9 B;  3VJP A;  1TXQ A;  3EGX A;  2VVK A;  3FIF A;  1M2V A;  3OBW A;  4ZN1 A;  1NEG A;  2OTL T;  2FZK B;  2CP7 A;  3CD6 T;  5IN1 A;  1YIJ T;  2DAQ A;  5KYY A;  3QWY A;  3M4Y A;  2D1X A;  2YSQ A;  2JNG A;  2BZY A;  4OB3 B;  4C5G A;  2RPN A;  5FU6 B;  3F70 A;  1M30 A;  2QXF A;  4JLG A;  3QBY A;  1WGS A;  4JS5 A;  3CCU A;  3DLL A;  2RQV A;  5KYW A;  4O6J A;  1RI9 A;  2GBQ A;  4A4E A;  2CUB A;  1FMW A;  2RHY A;  3GBQ A;  1RLQ C;  4LDW A;  4M7A B;  1UJ0 A;  1Y57 A;  4LDV A;  2O9V A;  1T3L A;  5LJ5 g;  1VQP A;  3J81 E;  3QKJ A;  3CCQ A;  2DET A;  1UGQ B;  5A0G A;  3HP9 A;  1VQ5 T;  5GAO m;  5CKB A;  2C0O A;  4L6V 5;  2QAS A;  3QUI A;  4Z8A A;  2E6N A;  4C8Q C;  3G4S A;  2DBK A;  2O31 A;  2GGR A;  4X9C A;  1T0J A;  1VQ7 A;  3AT1 B;  2E5K A;  2DRM A;  2DE0 X;  1WJR A;  2NUT B;  4OMQ A;  1Q82 C;  2RF0 A;  4DQ2 A;  2P4R A;  2NUZ A;  4PJO C;  2EJG A;  1B7T A;  3QXE B;  1AT1 B;  1FYN A;  1G8X A;  1LNX A;  3TSW A;  1B34 A;  1NM7 A;  3RDV A;  3CPW S;  3JB9 H;  2L8D A;  2HSP A;  4DEX A;  2O4X B;  1WXT A;  4BB7 A;  2RQR A;  2QQS A;  1D0Z A;  2LZ6 B;  3O5Z A;  2LP5 A;  3QJY A;  1VQ6 Q;  3VYG A;  1JXM A;  3CXC S;  3UPU A;  2RMO A;  2A36 A;  3OYK A;  1K73 C;  3E2U A;  1TUG B;  5GJW B;  2E64 A;  4GLM A;  2RQU A;  1EFN A;  4MZT A;  2DXB A;  3PTA A;  2M9U A;  2QQB A;  2EQM A;  2P0Q A;  2PTK A;  3ZL7 C;  4RTU A;  4PJO E;  1BKB A;  2YT6 A;  1IRE B;  1JO8 A;  5CIU A;  1RAB B;  2QI2 A;  2DIG A;  3I5R A;  2O9S A;  3QDR B;  4PJO G;  1TTH B;  1OYX A;  2M0O A;  3OSV A;  3OYF A;  4LUE A;  2EYX A;  3J80 E;  4ELY C;  1G83 A;  4F04 B;  5IHI A;  1NPP A;  2EQK A;  1N8R C;  2JTM A;  2CP2 A;  5GMK i;  2IVW A;  2BKD N;  5HK0 A;  4F14 A;  1VQP T;  2RJD A;  2RQT A;  3CC2 Q;  2I2L A;  3RNJ A;  1VQM A;  3OYA A;  1GFC A;  4ZGJ B;  3EG1 A;  3MEA A;  3ME9 A;  4IIM A;  2EQU A;  3ULR B;  4LE9 A;  4A63 B;  1OPL A;  3SB2 A;  1WHH A;  1OU8 A;  5GAN 5;  2ABL A;  1D0X A;  3THK A;  4EMH A;  1SPK A;  1YIJ Q;  5A0D A;  2FG0 A;  3EG9 A;  1NYF A;  2LT1 A;  4E7J A;  1D3B B;  4ESR A;  1RI0 A;  2COZ A;  3M57 A;  2X4Y A;  4LUD A;  2HMA A;  4EMG A;  1TH7 A;  3CME A;  2JMC A;  3FC3 A;  1Q82 U;  1YJ9 Q;  3I56 Q;  1PHT A;  1UHC A;  1BU1 A;  2DM1 A;  2X4J A;  2Y4X A;  2X35 A;  2DMO A;  2DF6 A;  3CCE A;  2F2V A;  4C5I A;  4FIB A;  2HD0 A;  3FEO A;  4J9D A;  1YHQ Q;  2KE9 A;  4D8D A;  3G1J A;  4M4Z A;  4IUR A;  3G6E A;  1KC8 R;  4YTL A;  4JZ3 A;  1D1B A;  4MZM A;  4PJM A;  2J05 A;  2LCC A;  4M77 B;  2OX7 A;  5KH6 A;  4BDY A;  4M7D E;  2CZ0 B;  3HTR A;  1ZUY A;  1OV3 A;  1TSF A;  1G5V A;  4M78 D;  5IXF A;  5CCA A;  5KE2 A;  1M1G A;  2RD1 A;  2RQW A;  1PRM C;  4OMO A;  1VQ5 Q;  1VQ7 Q;  4N4H A;  2MK5 A;  4C8Q A;  2HQH A;  3G6E Q;  4PJO F;  3Q1J A;  3JAM E;  2CSI A;  2EQJ A;  2XDB A;  4C8Q F;  2HCK A;  2RK1 A;  1KJW A;  4XU2 A;  5GAN j;  4OML A;  2QEX Q;  4J9B A;  5CKE A;  4OGE A;  2PUO B;  3A8H B;  2ZCF B;  2OI3 A;  3UAT A;  3X28 B;  4C0D B;  1VQP Q;  4M75 D;  2LNH B;  4L59 A;  1ZA1 B;  1NJI C;  2KY9 A;  1PD1 A;  3L2U A;  1CKB A;  4WF2 A;  1RAE B;  4RTT A;  2EGA A;  4AFS C;  2HZY A;  4OMP A;  1YJN T;  2ZGW A;  4C0F A;  2IPO B;  4BI8 B;  4M75 B;  2D6F A;  3UWN A;  3BW1 A;  2GQI A;  2FPD A;  4P5N A;  2NUT A;  2Z0W A;  1AOJ A;  4ANJ A;  1NYG A;  2DBM A;  8ATC B;  2FPE A;  3UF4 A;  2HKQ B;  4VUB A;  4QVZ A;  3CCM A;  4M78 G;  5A0L A;  3LWH A;  1WJQ A;  3VS6 A;  3QDF A;  1M1K U;  5I2M A;  2X9H A;  1VQL A;  2OTJ T;  2J7I A;  1K8A R;  2XKO C;  3REA B;  2C0T A;  2K7A A;  4QQD A;  2JS2 A;  3QJ6 A;  5CQY A;  1U5S A;  4GY5 A;  1XQH A;  1ZSZ C;  1W2B A;  1BI1 A;  2DFU A;  1JJ2 A;  1BB9 A;  1ZQ1 A;  2GCX A;  5CKH A;  2PNI A;  4C8Q D;  1K0S A;  3QYG B;  2AIR B;  3JCM e;  1ZSZ A;  4JJC A;  4BDZ A;  1DJ7 B;  2FRW A;  3REB B;  3M58 A;  4C0G A;  1H3H A;  1R0B G;  1KC8 U;  3G71 Q;  1PKT A;  4FM4 B;  3SWN A;  5DM7 R;  1YCS B;  3OW2 A;  3EGD A;  1QVF A;  3JSC A;  4FT2 A;  3SEM A;  3S3O A;  4PLI A;  3CCR Q;  2QTX A;  3QG1 A;  1ZX6 A;  2CYZ B;  2KRS A;  5KYN A;  4FW1 A;  4X9D A;  3OYY A;  2YDL A;  4MDW A;  3FJ5 A;  1E7O A;  4J9H A;  4OMM A;  1JXO A;  2FPF A;  2K5I A;  2LQ8 A;  3VS2 A;  3DB3 A;  2KNB B;  4LDU A;  3CCM Q;  2G3R A;  4XU3 A;  1Z9Q A;  4JUV A;  4E7L A;  1X6G A;  3MP8 A;  3UA7 A;  4L5G A;  5FWC A;  4EMK A;  3A8O B;  3CCL A;  2KK4 A;  5EC7 A;  2F5K A;  4ORZ A;  3JB9 J;  3NTH A;  3X26 B;  3VS0 A;  1QCN A;  2B8A A;  1KSW A;  2G6F X;  5DLO A;  1T0H A;  4CC2 A;  3OYM A;  4ZTF A;  2EKH A;  5FLX E;  1MGQ A;  2QA4 A;  4QKU A;  1JBM A;  4PJL A;  1M5Q 1;  4M7D F;  2AZV A;  5GMK l;  4WCI A;  1N27 A;  1TOV A;  3V7R A;  2GFA A;  3CMA A;  1UUE A;  2COW A;  3GP8 A;  2DL5 A;  2GQV A;  3X24 B;  2VYT A;  4X1V A;  4GLK A;  4RTX A;  1Z9Z A;  1PG5 B;  3RMQ A;  1GBR A;  3A98 A;  5LJ3 e;  5GMK e;  3CC4 T;  1ARK A;  2GNC A;  1WPY A;  1N9R A;  1VQO T;  2EWN A;  1WHJ A;  3RKX A;  3CC7 Q;  2E70 A;  2YUN A;  4IUT A;  5GAN d;  2M02 A;  1YJN A;  1I4K 1;  3FLG A;  2CP0 A;  1NJI R;  4BI4 A;  3CCV T;  1C0M A;  2DJZ A;  3LLR A;  2KVQ G;  4Z02 A;  1NLO C;  2RHX A;  3L2Q A;  1RUW A;  1K8A C;  1LCK A;  2DER A;  4MDX A;  4NS5 A;  1H92 A;  4XTU A;  4M7A F;  4JJD A;  2ECZ A;  4KH1 B;  1Y0M A;  2ATC B;  3VKI A;  3RBB B;  1C6V X;  4JRP A;  2MCN A;  1NG2 A;  4AG2 C;  4Y92 A;  1ZA2 B;  2E4H A;  2D8H A;  3KXT A;  1NPR A;  1KHI A;  1X69 A;  5FRN A;  2DXU A;  2NUP A;  1WLP B;  1QVF P;  1RL2 A;  3PIP A;  1RAD B;  1GXI E;  5ECA A;  1YJ9 A;  1VYV A;  3M0S A;  1WDX A;  4HXJ A;  3RER A;  2DIL A;  5L8R E;  4FSS A;  1M27 C;  1VQM Q;  5GAN f;  1GCQ C;  3MPU B;  1YCY A;  2LCL A;  1I5L A;  3UDC A;  3JCM c;  2OTL A;  3E1S A;  4R56 A;  1Q86 C;  2V8I A;  4J9E A;  1QWF A;  1KC8 C;  1ZSZ B;  4Z88 A;  2OAW A;  1WNL A;  3P8H A;  4F7U E;  3MO8 A;  2NWM A;  2DK3 A;  1Q81 R;  3QWX X;  1VQ8 T;  3X25 B;  3O8V A;  5IH2 A;  5LJ3 h;  3A8L B;  1K76 A;  5GMK h;  4XAX B;  5GAM d;  5LJ5 h;  3PVQ A;  3VUZ A;  4DOW A;  1JU5 C;  3OB9 A;  4KRT A;  4B6M A;  2JTF A;  2BUD A;  2DZ9 A;  1SKU B;  2F69 A;  5KCO A;  1AWO A;  2JJ9 A;  4A53 A;  2VGM A;  7AT1 B;  4IIO A;  5A2Q E;  1KFZ A;  3QZ5 B;  2E10 A;  3KBG A;  1VQO A;  3KFV A;  2EBP A;  1VQ5 A;  1VQL Q;  2EJF A;  1PKS A;  2EYY A;  1Y7X A;  4MMK A;  2DYB A;  3CCQ T;  1RAH B;  1VQN T;  1UGR B;  2YLC A;  1SEM A;  4XTZ A;  2DTO A;  1MMD A;  3CC4 Q;  2L89 A;  2J6K A;  2HDA A;  3NMZ C;  2KRM A;  4RTY A;  1BCM A;  5KYX A;  1OPK A;  1EIF A;  2MOX A;  2K2M A;  1RLP C;  3G7Z A;  4J6X A;  1TS9 A;  1NBE B;  2ZPB B;  5FRO A;  2R58 A;  1M4Z A;  1N6A A;  2QA4 Q;  4DBR A;  1FWZ A;  5KCH A; 
#chains in the Genus database with same CATH homology
 1BI0 A;  2DZC A;  2LQK A;  4UC4 A;  4EMH A;  2DIQ A;  5A0D A;  3L2Z A;  4M7A C;  1M8V A;  2LT1 A;  5DY9 A;  4M77 E;  4E7J A;  2RO0 A;  3MCA B;  2JUF A;  4N4G A;  3HFN A;  2DD5 A;  2X4X A;  1D3B B;  1VIE A;  2P4T A;  4M77 C;  4DOV A;  3A8M B;  1RI0 A;  4XQ3 A;  5KE3 A;  4OVA A;  1YI2 A;  3M57 A;  4QW2 A;  3GIB A;  1H3Z A;  2X4Y A;  5HK3 A;  2VV5 A;  2CZ6 B;  3RUX A;  5D6W A;  3CC2 A;  3HKS A;  5IAY A;  1Q81 U;  4EMG A;  1TH7 A;  3CME A;  3CPW A;  4M7D C;  2C06 A;  2JVV A;  2QEX A;  4PKC C;  3MEV A;  3FJP A;  3FB9 A;  2E12 A;  4OB2 B;  3FC3 A;  1Q82 U;  3GNF B;  3HSB A;  3L42 A;  1S72 A;  2DEQ A;  4BE2 A;  4F7U A;  5GAO r;  1S72 T;  2HQE A;  3OA6 A;  2KMT A;  2NLU A;  3CPF A;  3JRZ A;  3OYG A;  2X4J A;  5CVI A;  4M78 A;  4ZGD B;  2Y4X A;  2X35 A;  3PT9 A;  2XG8 D;  1YHQ A;  1VIF A;  2K2V A;  3CCE A;  4C5I A;  1M1K C;  2CZ1 B;  5D6Y A;  4M7D D;  5GAO l;  3QYH B;  4FIB A;  3SFM A;  2E1H A;  2HD0 A;  4CI0 C;  3MP1 A;  5GAN 3;  3FEO A;  4MML A;  3R6O A;  4M7D B;  4XTV A;  5GAM f;  3M5A A;  5GMK m;  1I8F A;  2GFU A;  3ZEH A;  2DXT A;  3P8D A;  4M7A G;  3BDL A;  4IUR A;  4J6Y A;  4E7K A;  3G6E A;  3ER0 A;  2VXE A;  1JB0 E;  1R8O B;  4YTL A;  2LNV A;  4MZM A;  3JCM f;  3HFO A;  5GAM j;  4F7U F;  2LCC A;  4M77 B;  3CBM A;  4XTY A;  5KH6 A;  4HCZ A;  4BDY A;  4RG8 A;  4M7D E;  2CZ0 B;  2RH2 A;  1K9M U;  4F7U B;  4KUI A;  1AHJ B;  3L2V A;  1YHQ T;  3LH0 A;  2EKO A;  2EJ9 A;  1G5V A;  4M78 D;  3ASK A;  3X20 B;  2ZPF B;  1HXD A;  1BIA A;  3CCS T;  4RCB A;  2DVE A;  1H64 1;  5CCA A;  1QW1 A;  1M1G A;  2LT4 A;  2MWO A;  2RD1 A;  2RJC A;  5KE2 A;  4XU0 A;  4N4H A;  4A54 A;  5GAO p;  4A4K A;  3V7C A;  1NJI U;  1KD1 C;  1PSF A;  4EMK C;  3VUB A;  4C8Q A;  5J3B A;  4JRI A;  4PJO F;  2KAF A;  3Q1J A;  1UB4 A;  2VXF A;  3JAM E;  2EQJ A;  3KUF A;  1YI2 T;  2XDB A;  2RB6 A;  3H6Z A;  4C8Q F;  5GAM h;  5GAN 2;  2RK1 A;  2RJE A;  1LOJ A;  4BY6 B;  2RHU A;  4XU2 A;  5GAN j;  2GF7 A;  1BIB A;  5M9O A;  2DD4 A;  4A4H A;  5LJ5 f;  2RM4 A;  5CKE A;  3OY9 A;  4HT9 A;  4OB0 B;  4OGE A;  2PUO B;  4IUQ A;  2WSC E;  1QVG S;  3A8H B;  2ZCF B;  3MHX A;  1G3W A;  2K3X A;  4OP0 A;  2WAC A;  3X28 B;  4J8O A;  3G4S T;  3V8K A;  4C0D B;  4C92 F;  1YIT A;  2KDS A;  3L1A A;  3QII A;  4M75 D;  4L59 A;  3NFC A;  3I55 T;  2D9T A;  1WQ7 A;  4A4F A;  1NJI C;  3TU4 K;  2KY9 A;  2FHD A;  2LTO A;  3CCR T;  3ZFJ A;  3JB9 G;  1M90 C;  3L2U A;  1PSE A;  4XTW A;  1P92 A;  3V8L A;  4XU1 A;  3RIR A;  1VQ6 A;  2ZZD A;  3CD6 A;  4WF2 A;  3G71 T;  3CXC A;  2CGH A;  4J5Y A;  3CCM T;  4HT8 A;  3I55 A;  3OMG A;  2E65 A;  3OYH A;  3BFM A;  2MMP A;  1VQ8 A;  3CC4 A;  3QPH A;  3FRN A;  2ZGW A;  4PL6 A;  5LL6 S;  4C8Q E;  4RCC A;  1HK9 A;  4C0F A;  4JS4 A;  1YJN T;  4BI8 B;  4M75 B;  2R5M A;  5FU7 C;  5J39 A;  1QVG A;  3E9F A;  2EYQ A;  3BW1 A;  3UWN A;  4ZN3 A;  2IG0 A;  4P5N A;  3CBP A;  2HBP A;  5I21 A;  5LJ3 j;  4M78 B;  5GAN g;  4KUD K;  3CCU T;  3L2W A;  1KD1 U;  4B9X A;  3CME T;  3M9Q A;  2P0P A;  1VQK A;  4M7D G;  4C92 A;  5C6S A;  4M78 F;  4M7A A;  2ZPE B;  4KT0 E;  4QVC A;  2XDP A;  1Q7Y C;  2HAX A;  2K5F A;  3MEU A;  2WSE E;  2F5T X;  1LJO A;  4IUV A;  1VQM T;  3CCV A;  1VQ9 T;  2XHC A;  2EAY A;  4E7I A;  4Y91 A;  1YIJ A;  2X4W A;  4J6W A;  4VUB A;  4QVZ A;  3CCM A;  2YLB A;  5LJ5 d;  4M78 G;  5A0L A;  4NOY A;  1QP2 A;  3C4S A;  3PNW C;  1WJQ A;  2ZPG B;  4N4I A;  4BI3 A;  3LWH A;  1VQ4 A;  1K9M C;  3HHT B;  1M1K U;  5I2M A;  5GAN 8;  3OYN A;  2KSS A;  1VQL A;  2OTJ T;  3M4G A;  4NL3 A;  2QEX T;  4LD9 K;  1VQL T;  4PJO A;  3EFS A;  2OTJ A;  3FDR A;  2XKO C;  1YJ9 T;  2VC8 A;  4QQD A;  2PUK B;  1IZ6 A;  2PQW A;  3QJ6 A;  2XDD A;  3M56 A;  4IUP A;  3VU3 C;  1G3Y A;  1Q86 U;  2FB7 A;  3M54 A;  2BIV A;  4ZGE B;  2QQR A;  2JZ2 A;  2RI5 A;  2ZPH B;  3C95 A;  5CQY A;  3CCJ A;  4PLL A;  1QVP A;  2AHJ B;  3I56 A;  1V29 B;  4FSX A;  4GY5 A;  4EPC A;  3M59 A;  4M77 F;  2MAM A;  4MZP A;  1XQH A;  4D6W A;  1W2B A;  2LX9 A;  1VQ7 T;  1YBY A;  2VUB A;  4QQG A;  1BI1 A;  2OAU A;  5GAM e;  5IT9 E;  3CMA T;  3PIO A;  2D6F A;  4Y28 E;  1JJ2 A;  1ZQ1 A;  2V8K A;  2GCX A;  3HRT A;  3LGL A;  4IUU A;  5CKH A;  3OMC A;  4M75 C;  2QQA A;  3EAE A;  4BUG A;  4B9W A;  4C8Q D;  3QYG B;  3JCM X;  2FL7 A;  3INZ A;  3VYH B;  4PJO B;  4M75 A;  4C92 D;  3JCM e;  4BDZ A;  1DJ7 B;  3JB9 D;  2XI9 A;  2PVD B;  3MET A;  4J7F A;  4ELZ C;  3M58 A;  2QDY B;  5HKC A;  3VV0 A;  2DTH A;  4C0G A;  5GAO n;  4ATO A;  3H8Z A;  3OQ5 A;  3CC7 T;  1XOV A;  3RES A;  1VQK T;  2D0Q B;  2M16 A;  4HKE A;  3CCL T;  1KC8 U;  4BE0 A;  4M7A E;  4J83 A;  2MI6 A;  1Y07 A;  4FM4 B;  3SWN A;  3JCM d;  4CRI A;  4C5H A;  5DM7 R;  2KQW A;  4C0D C;  3SWN C;  3NTI A;  4C92 B;  4JJN K;  3OW2 A;  3OW2 S;  1QVF A;  1OZ2 A;  4V2S A;  3JSC A;  3DB4 A;  3LYI A;  4FU6 A;  4FT2 A;  3JCM h;  3WVE B;  4PLI A;  4EMK B;  3S3O A;  3UT1 A;  2QTX A;  4LD6 A;  1FXX A;  3QG1 A;  2XD0 A;  3PMT A;  2CYZ B;  2M1H A;  4NL2 A;  3BY7 A;  2A7Y A;  4JLI A;  2XID A;  4X9D A;  3OYY A;  3T9N A;  5KCH A;  1D3B A;  3MEW A;  4MDW A;  3J7A F;  4M77 G;  1ZBX A;  1BI3 A;  1X75 C;  3DLM A;  5CO7 A;  3OS1 A;  2RHI A;  1FX7 A;  2CZ7 B;  4TVR A;  1N8R U;  1NE8 A;  2E6Z A;  1G3T A;  3TEE A;  2K5I A;  4OGC A;  2RK2 A;  2K57 A;  2LQ8 A;  3P8B B;  4O5V A;  4BAC A;  3V7S A;  3DB3 A;  3GPL A;  4LDU A;  1QVF S;  2K4Y A;  5CQX A;  1K8A U;  1JJ2 S;  2MWP A;  2V8J A;  2R57 A;  2G3R A;  4XU3 A;  3OSS C;  1KQS A;  4J7I A;  4JUV A;  2E5Q A;  4E7L A;  2JN0 A;  3CCE T;  4M7A D;  3S3N A;  2RJF A;  3MP8 A;  4L5G A;  2ZPI B;  4M75 F;  3A8O B;  4EMK A;  3M53 A;  3CCL A;  3QSU A;  2KK4 A;  2F5K A;  2MF2 A;  3HL8 A;  3JB9 J;  3LW5 E;  1BYM A;  2WSF E;  4N0A A;  3NTH A;  4HA8 A;  5FU6 C;  3X26 B;  4C5E A;  4BE1 A;  2B8A A;  1UGP B;  1B34 B;  3CBO A;  5CK9 A;  5DLO A;  4HCC A;  4JRK A;  3HRS A;  3OYM A;  4ZTF A;  2FYK A;  2EFI A;  3GLX A;  3VJP A;  1MGQ A;  5LJ3 d;  5FLX E;  4JRQ A;  1WQW A;  2DPP B;  2O4X A;  4ME7 A;  2QA4 A;  3ZBD A;  1JBM A;  1M5Q 1;  1K73 U;  3A5Z B;  3CEY A;  3OYC A;  1M90 U;  4M7D F;  5GMK l;  3OYD A;  3FIF A;  1N27 A;  5LJ5 j;  4R55 A;  1M9S A;  3V7R A;  2GFA A;  3CMA A;  3HRU A;  3OBW A;  3JCM b;  4ZN1 A;  1YJW T;  2OTL T;  1YJW A;  3GP8 A;  2HQX A;  2GQV A;  3X24 B;  2VYT A;  3RKY A;  4GLK A;  3G71 A;  1YIT T;  3RMQ A;  3CD6 T;  5IN1 A;  1YIJ T;  2DAQ A;  1KQ1 A;  3M4Y A;  5LJ3 e;  5AYF A;  2JNG A;  5GMK e;  3CC4 T;  4XK8 E;  3OS2 A;  4OB3 B;  4C5G A;  3OYI A;  5FU6 B;  1WPY A;  1N9R A;  3F70 A;  3CCR A;  3LX7 A;  1VQO T;  2EWN A;  5CKD A;  4Q5W A;  3LWI A;  3QO3 A;  1M1F A;  2QXF A;  4JLG A;  1VUB A;  3QBY A;  1WGS A;  3RKX A;  4JS5 A;  3N5B B;  3CCU A;  3DLL A;  3S6W A;  3HPW A;  4O6J A;  1Y96 B;  3OYL A;  2E70 A;  4IUT A;  2K5L A;  4A4E A;  2DXC A;  2XU8 A;  5GAM g;  4M75 G;  5GAN d;  4DA4 A;  5D6X A;  4QVD A;  1YJN A;  5CAI A;  1I4K 1;  2RHY A;  3QHS A;  5GAN 7;  1MHN A;  3FLG A;  2XIC A;  2R5A A;  5I2S A;  4LDW A;  4M77 D;  3CC2 T;  4HCB A;  3SWN B;  1X6O A;  4BI4 A;  3CCV T;  1VQ9 A;  4M7A B;  5LJ5 g;  2DJZ A;  4LDV A;  2RHX A;  2KVQ G;  3LLR A;  4Z02 A;  4FT4 A;  3J81 E;  3L2Q A;  1VQP A;  3BDU A;  3OS0 A;  1K8A C;  1W4S A;  4NS5 A;  3QKJ A;  3CCQ A;  3AHU A;  4XTU A;  4M7A F;  1UGQ B;  2FVU A;  3CC7 A;  3WXM B;  3A8G B;  5A0G A;  3VKI A;  3HP9 A;  4KUL A;  1VQ5 T;  2HNI A;  4JRP A;  2P0K A;  2Y90 A;  5GAO m;  5CKB A;  3GF5 A;  4A4G A;  1KQ2 A;  3KXT A;  1NPR A;  1KHI A;  4FL6 A;  4EDU A;  5FRN A;  2DXU A;  4LDY A;  2LDM A;  3OBY A;  1RL2 A;  4C92 C;  3PIP A;  4L6V 5;  2YRV A;  3QUI A;  1G3S A;  2E6N A;  2LRQ A;  4C8Q C;  1GXI E;  2A3L A;  3SDZ A;  4BD3 A;  3G4S A;  1YJ9 A;  4C0Z A;  5LJ3 g;  3RER A;  4X9C A;  4IKF A;  5L8R E;  5GMK j;  1VQ7 A;  1QP3 A;  4RG2 A;  1WJR A;  5HY6 A;  1Q82 C;  5FRM A;  4DQ2 A;  5GAN e;  4E7H A;  4PJO C;  2EJG A;  3DKM A;  3QXE B;  5GAN f;  2Y4Y A;  1UGS B;  4II1 A;  2VGN A;  1LNX A;  5LJ5 e;  3GOX A;  1B34 A;  1YCY A;  2H3J A;  2LCL A;  1I5L A;  4M7D A;  2DKG A;  3E9G A;  3JCM c;  3UDC A;  4RMO A;  4KBM B;  1Q81 C;  3E1S A;  4R56 A;  2OTL A;  1Q86 C;  1Y96 A;  2V8I A;  3CPW S;  3JB9 H;  2L8D A;  4PJO D;  4MDX A;  4PNO A;  2O4X B;  1KC8 C;  2PVG B;  4BB7 A;  4OMF B;  4F7U G;  1WNL A;  3P8H A;  3OYB A;  2QQS A;  4E47 A;  3JCM W;  4F7U E;  3QJY A;  3M55 A;  1WJS A;  3MO8 A;  5J26 A;  2DK3 A;  2L3R A;  3CCJ T;  3VYG A;  4X34 A;  1VQ8 T;  3TCJ A;  3O8V A;  3URG A;  3X25 B;  5LJ3 h;  3A8L B;  5GMK h;  3CXC S;  1U8R A;  4XAX B;  5GAM d;  2LVM A;  3VUZ A;  5LJ5 h;  3UPU A;  1O75 A;  4DOW A;  1ZHI A;  3OYK A;  3OB9 A;  3RKW A;  1K73 C;  3JCM Q;  1Y71 A;  2PVO B;  2DO3 A;  3E19 A;  3PGG A;  1XTD A;  3PMI A;  4M78 E;  2E64 A;  2JTF A;  2BUD A;  2DZ9 A;  4N0A C;  4C92 G;  4M78 C;  3JCM g;  2LC4 A;  3OYE A;  3RMS A;  2F69 A;  2CKK A;  1OI1 A;  5FU7 B;  3OS5 A;  4MZT A;  5GAO q;  2DXB A;  3PFS A;  2M9U A;  2RI3 A;  5KCO A;  3I56 T;  3PTA A;  2QQB A;  2EQM A;  2P0Q A;  1Q7Y U;  4PJO E;  1BKB A;  1IRE B;  2VGM A;  4A53 A;  5CIU A;  5A2Q E;  1VQ4 T;  2QI2 A;  2RA2 A;  3QZ5 B;  2DIG A;  3SD4 A;  2E10 A;  3JB9 I;  3KBG A;  4QQ6 A;  2CS7 A;  1VQO A;  1U1S A;  1W2B S;  1VQ5 A;  3QDR B;  2EJF A;  4LDX A;  2RHZ A;  2PU9 B;  1X01 A;  1Y7X A;  4MMK A;  1VQ6 T;  3CCQ T;  2L5Q A;  5GAN 4;  4PJO G;  3EFR A;  1U1T A;  1OYX A;  2E41 A;  2M0O A;  1VQN T;  3OSV A;  2JOY A;  2XK0 A;  4RKU E;  3OYF A;  1I81 A;  3QZ9 B;  1UGR B;  3G6E T;  2YLC A;  3V8J A;  1O9S A;  3J80 E;  4M75 E;  1NZ9 A;  4ELY C;  4C92 E;  4XTZ A;  5LJ3 f;  1NPP A;  2EQK A;  2DTO A;  3C94 A;  1N8R C;  2JTM A;  1XNI A;  3JCM J;  2YHT A;  2L89 A;  5GMK i;  2IVW A;  1VQN A;  2BKD N;  5HK0 A;  5EG2 A;  1VQP T;  3C12 A;  3OYJ A;  2QA4 T;  2RJD A;  3MP6 A;  3JCM P;  3JCM V;  3S3M A;  2O01 E;  2QQ9 A;  2I2L A;  1KG1 A;  4JDS A;  5CKF A;  1VQM A;  1JRI A;  3OYA A;  5DLQ E;  4C8Q B;  3TRE A;  4ZGJ B;  3ME9 A;  3MEA A;  5C0M A;  1BI2 A;  1EIF A;  3JB9 F;  1KQS S;  2EQU A;  5GAN 6;  2EIF A;  3L2R A;  5GAN h;  3WVD B;  4XTX A;  1N9S A;  3G7Z A;  4J6X A;  4OB1 B;  2ZPB B;  3GNG A;  3NTK A;  5FRO A;  1KHC A;  3SB2 A;  4C8Q G;  2R58 A;  1M4Z A;  1OZ3 A;  2K3Y A;  4M77 A;  5GAN 5;  1UEB A;  1N6A A;  3LGF A;  2DTI A;  5CR2 A;  4BY6 C;  3CCS A;  4ZTJ A;  1SSF A;  4OF1 A;  1FWZ A;  2RI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...