3LXSA

Crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (wrr483)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzain
publication title In vitro and in vivo studies of the trypanocidal properties of WRR-483 against Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 71
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3lxsA00
2E00A 2YJ2A 2YJ8A 3B79A 3ERVA 2OP3A 1TU6A 2IBIA 2NQAA 4OEMA 1EWLA 3BPMA 2YJCA 3K9MA 1AU2A 3KWBX 1KFXL 2PBHA 3F75A 4WA6A 1CPJA 3BCNA 5JA7A 2FYEA 4YYVA 2R9CA 1BGOA 1THEA 3MHSA 2XU1A 2P7UA 1NL6A 4YVAA 1U9VA 4N79A 4BPVA 1PPDA 2P86A 3IHPA 1MIRA 2F7DA 1PE6A 2IPPB 1AIMA 1AU0A 1DF0A 4DMYA 3KFQA 4X6IA 4MZSA 1VSNA 2AUXA 2H7JA 1CV8A 4YYWA 4N4ZA 1U9QX 4FK5A 3RVWA 2HD5A 1PPNA 1QXPA 3NHEA 3PDFA 1M6DA 2Y5BA 2GHUA 3KW9A 2ARYA 1BQIA 2OZ2A 1NB3A 2DCAA 2R9MA 3N3GA 2AIMA 3I06A 4W5BA 4CDCB 2G6DA 2WBFX 4Q8HA 3F5VA 2DCCA 3QJ3A 3N4CA 3PNRA 2BDLA 3RVVA 3H7DA 1ZCMA 3WXGA 4G54A 4XR7A 1SNKA 4K7CA 4W4UA 3P5UA 2F1GA 4PP2E 4P6EA 1DEUA 1AYVA 2DJFB 2VHFA 1AU3A 1ICFA 3V6EA 3OVZA 1NQCA 4P6GA 3H8BA 1PBHA 3MHHA 4BS5A 4PADA 1MEGA 2DC6A 1YT7A 1PPPA 2R9OA 2AU1A 1Q6KA 2G8EA 2DC7A 2B1MA 1ME4A 2R9FA 5CVOB 3H89A 2DZZA 3O1GA 1S4VA 1AECA 4QRVA 3K24A 4CZWA 1SP4B 2PNSA 2FRAA 3BC3A 1MS6A 4CDEB 1QMYA 1NLJA 3CH2X 3DF0A 1YK7A 1IWDA 2FRQA 3S3QA 2DC8A 3U8EA 2JQFR 1FH0A 3HD3A 2DCBA 1K3BB 1CVZA 2CIOA 3HWNA 4CDDB 5EF4A 1GLOA 3AI8A 3GCBA 5CHTA 1XKGA 1EWOA 1PPOA 5EGWA 2XU3A 4X6HA 3IUTA 4I04A 2XU5A 4X6JA 7PCKA 1YK8A 2G8JA 2NQIA 2NQGA 3QT4A 1KHQA 2HH5A 4RY2A 5JH3A 2OULA 2DCDA 4ZUXU 1CS8A 2G7YA 2DC9A 3OF9A 2XU4A 3K8UA 1Y4HA 3N3KA 3KSEA 3CH3X 4BQVA 4YYUA 1AYUA 2ATOA 2P0RA 3H6SA 3TNXA 3WXEA 3LFYA 2NQDB 2FTDA 1F2BA 1QDQA 1U9XA 4PP1A 2E01A 2AYOA 5CVMA 2PREA 4HWYA 3CBKA 1GMYA 1STFE 1MHWA 3RVXA 4DMXA 1PADA 3ZUAA 4QRXA 3C9EA 4YYRA 1BP4A 4KLBA 3D6SA 3KKUA 8PCHA 2ACTA 2CB5A 2O6XA 5CHVA 1CSBB 4QRGA 1PXVA 1X9YA 4BS6A 1ATKA 4I05A 2AVWA 1CQDA 5PADA 4YYSA 3WXFA 4XUIA 5K16A 1BY8A 1NB5A 1MEMA 1PIPA 2FQ9A 3E1ZB 2HXZA 4QBBA 1ZIVA 1KXRA 1VJVA 3QSDA 1F2CA 2PADA 2AS8A 3USVA 2DJGB 3KWZA 1CJLA 5A24A 2DZYA 1JQPA 2C0YA 2YJBA 3HHIA 5FPWA 3S3RA 3M99A 1HUCB 1POPA 4I07A 2FT2A 3O0UA 4FJCA 2AYNA 9PAPA 1EWPA 3P5VA 5J94A 4MSXA 4N8WA 3HHAA 1GECE 3OF8A 5CVNB 3KX1A 2BDZA 1YVBA 4Q8GA 3P5XA 3BPFA 1ME3A 1U5IA 1EWMA 3MTNA 2B1NA 3IEJA 1KHPA 1MDWA 2GFOA 3H8CA 2Y6EA 3BWKA 1F29A 1TL9A 3CBJA 1CTEA 3I3TA 1TLOA 1NPZA 1GCBA 4YV8A 4AXLA 3V6CA 4FIPA 4YYQA 1F2AA 1EF7A 4MZOA 2E02A 2E03A 3OVXA 1CB5A 3P5WA 3IMAA 3PW3A 3BOWA 3IOQA 2HHNA 3PBHA 5F02A 2FO5A 1A6RA 1ITOA 1YALA 1QOLA 2JQGR 2R9NA 1O0EA 1U9WA 6PADA 4OELA 4QH6A 2YJ9A 1Y08A 3MORA 3IV2A 4BSQA 1KFUL 2AUZA 3OISA 1AU4A 4PI3A 2VHSA 1AYWA 2R6NA 4W5CA 4CDFB 3LXSA 4AXMA 2FUDA 1PCIA
chains in the Genus database with same CATH superfamily
2E00A 2YJ2A 2JTCA 2YJ8A 3B79A 3ERVA 2OP3A 1TU6A 2IBIA 2NQAA 4OEMA 1EWLA 3BPMA 2YJCA 3K9MA 1AU2A 3KWBX 1KFXL 4REZA 2PBHA 4HXDB 3F75A 4WA6A 1CPJA 3BCNA 5JA7A 4OVZA 2FYEA 4YYVA 2R9CA 1BGOA 1THEA 3MHSA 2XU1A 2P7UA 1NL6A 2UZJA 4YVAA 1U9VA 5KO3A 4N79A 4BPVA 2BU3A 1PPDA 2P86A 3BB7A 3PHUA 3IHPA 1MIRA 4BOQA 3BBAA 2F7DA 1PE6A 2IPPB 1AIMA 4BOZA 1AU0A 1DF0A 4DMYA 3KFQA 4X6IA 4MZSA 1VSNA 2AUXA 2H7JA 1CV8A 4IP3A 4YYWA 4N4ZA 1U9QX 3PHWA 4FK5A 3RVWA 1UKFA 2HD5A 1PPNA 1QXPA 3NHEA 3PDFA 1M6DA 2Y5BA 2GHUA 3KW9A 2ARYA 1BQIA 2OZ2A 1NB3A 2DCAA 2R9MA 1PVJA 2DOSA 4MI7A 4D8IA 3O65A 3N3GA 2AIMA 3I06A 4W5BA 3RNVA 4CDCB 2G6DA 2WBFX 4Q8HA 3F5VA 2DCCA 4D8EA 3QJ3A 3N4CA 3PNRA 2BDLA 3RVVA 3H7DA 1ZCMA 3WXGA 4G54A 4PT5A 4XR7A 1SNKA 4K7CA 4W4UA 3P5UA 3B21A 2F1GA 4PP2E 4P6EA 1DEUA 1YZBA 1AYVA 2DJFB 2VHFA 1AU3A 1ICFA 3V6EA 3OVZA 1NQCA 4P6GA 3H8BA 1PBHA 3MHHA 4BS5A 4PADA 1MEGA 2DC6A 1YT7A 1PPPA 2R9OA 2BTWB 2AU1A 1Q6KA 2G8EA 2DC7A 2B1MA 1ME4A 2R9FA 4OW0A 5CVOB 3H89A 2DZZA 3O1GA 1S4VA 1AECA 4QRVA 3K24A 4CZWA 1SP4B 2PNSA 2FRAA 3BC3A 3PHXA 4D8BA 1MS6A 4CDEB 1QMYA 4P16A 1NLJA 3CH2X 3DF0A 1YK7A 1IWDA 2FRQA 3S3QA 2DC8A 3PSEA 3U8EA 2JQFR 1FH0A 4A5UA 3HD3A 2DCBA 1K3BB 4MM3B 1CVZA 2CIOA 3HWNA 4CDDB 5EF4A 1GLOA 3AI8A 3GCBA 5CHTA 1XKGA 1EWOA 4BOSA 1PPOA 5EGWA 2XU3A 4X6HA 3IUTA 4I04A 2XU5A 4X6JA 7PCKA 1YK8A 3C0RA 2G8JA 2NQIA 2NQGA 3QT4A 1KHQA 4RF1A 3OQCA 2HH5A 4RY2A 5JH3A 2OULA 2DCDA 5JZEA 4ZUXU 2BTWA 1CS8A 2G7YA 2DC9A 3OF9A 2XU4A 3K8UA 1Y4HA 3N3KA 3KSEA 3CH3X 4BQVA 4YYUA 1AYUA 2ATOA 2P0RA 3H6SA 3TNXA 3WXEA 3MTVA 3LFYA 2NQDB 2FTDA 1F2BA 1QDQA 1U9XA 4PP1A 2E01A 2AYOA 5CVMA 2PREA 4HWYA 3CBKA 1GMYA 1STFE 3BY4A 1MHWA 5E6JA 3RVXA 4DMXA 1PADA 3ZUAA 4QRXA 3C9EA 4YYRA 1BP4A 4KLBA 3D6SA 3KKUA 3W30A 8PCHA 2ACTA 2CB5A 2O6XA 5CHVA 1CSBB 3MJ5A 4QRGA 1PXVA 1X9YA 5EZSA 4BS6A 1ATKA 2J7QC 4I05A 2AVWA 3TRKA 1CQDA 5PADA 4YYSA 3PRPA 3WXFA 4XUIA 5K16A 1BY8A 3W31A 3PRMA 1NB5A 1MEMA 1PIPA 2FQ9A 3E1ZB 2HXZA 4QBBA 1ZIVA 1KXRA 1VJVA 3QSDA 4R3DA 1F2CA 4BOPA 2PADA 2AS8A 3E9SA 3USVA 2DJGB 3KWZA 1CJLA 5A24A 2DZYA 1JQPA 2C0YA 2YJBA 3HHIA 5FPWA 3S3RA 3IFUA 3M99A 1HUCB 1POPA 2Z84A 4I07A 2FT2A 3O0UA 4FJCA 2AYNA 9PAPA 1EWPA 3P5VA 5J94A 4MSXA 4N8WA 2JRIA 3HHAA 1GECE 3OF8A 5CVNB 3KX1A 2BDZA 4ZTBA 4M0WA 1YVBA 4Q8GA 3P5XA 3BPFA 3ZNHA 1ME3A 1U5IA 1EWMA 3MTNA 2B1NA 3IEJA 1KHPA 1MDWA 2GFOA 3H8CA 2Y6EA 5EZQA 4WURA 3BWKA 1F29A 1TL9A 3CBJA 3PT2A 1CTEA 3I3TA 1TLOA 1NPZA 1GCBA 4YV8A 4AXLA 3V6CA 2FE8A 4FIPA 4YYQA 1F2AA 1EF7A 4MZOA 2E02A 4BOUA 2E03A 3OVXA 1CB5A 4OVZB 3P5WA 3IMAA 3PW3A 3BOWA 4RNAA 3IOQA 2HHNA 3PBHA 5F02A 1DKIA 2FO5A 1A6RA 1ITOA 4GUAA 1YALA 1QOLA 2JQGR 2R9NA 3MP2A 4RKXA 1O0EA 1U9WA 6PADA 2J7QA 4OELA 4QH6A 2YJ9A 1Y08A 3MORA 2HWKA 3IV2A 4BSQA 2AGAA 1KFUL 2AUZA 3OISA 1AU4A 4RF0A 4PI3A 2VHSA 1AYWA 3TMPA 2R6NA 4W5CA 4IUMA 4CDFB 3LXSA 4AXMA 2FUDA 4XZXA 1PCIA
chains in the Genus database with same CATH topology
2E00A 2YJ2A 1W6FA 2YJ8A 3B79A 3ERVA 2OP3A 1TU6A 2IBIA 2NQAA 4OEMA 1EWLA 3BPMA 2YJCA 3K9MA 1AU2A 3KWBX 1KFXL 2PBHA 3F75A 4WA6A 1CPJA 1E2TA 3BCNA 5JA7A 2FYEA 4YYVA 2R9CA 1BGOA 1THEA 3MHSA 2XU1A 2P7UA 1NL6A 4YVAA 1U9VA 4N79A 4BPVA 1PPDA 2P86A 3IHPA 1MIRA 4BGFA 2F7DA 1PE6A 2IPPB 1AIMA 1AU0A 1DF0A 4DMYA 3KFQA 4X6IA 4MZSA 1VSNA 2AUXA 2H7JA 1CV8A 4YYWA 4N4ZA 1U9QX 4FK5A 3RVWA 2HD5A 1PPNA 1QXPA 3NHEA 3PDFA 1M6DA 2Y5BA 2GHUA 3KW9A 2ARYA 1BQIA 2OZ2A 1NB3A 2DCAA 2R9MA 3N3GA 2AIMA 3I06A 4W5BA 4CDCB 2G6DA 2WBFX 4Q8HA 3F5VA 2DCCA 3QJ3A 3N4CA 3PNRA 2BDLA 3RVVA 3H7DA 1ZCMA 3WXGA 4G54A 4XR7A 1SNKA 4K7CA 4W4UA 3P5UA 4NV8A 2F1GA 4PP2E 4P6EA 1DEUA 1AYVA 3LTWA 2DJFB 2VHFA 1AU3A 1ICFA 3V6EA 3OVZA 1NQCA 4P6GA 3H8BA 1PBHA 3MHHA 4BS5A 4PADA 1MEGA 2DC6A 1YT7A 1PPPA 1W4TA 2R9OA 4B55A 2AU1A 1Q6KA 2G8EA 2VFCA 2DC7A 2B1MA 1ME4A 2R9FA 5CVOB 3H89A 2DZZA 3O1GA 1S4VA 3D9WA 1AECA 4QRVA 3K24A 4CZWA 1SP4B 2PNSA 2FRAA 3BC3A 1MS6A 4CDEB 1QMYA 1NLJA 3CH2X 3DF0A 1YK7A 1IWDA 2FRQA 3S3QA 2DC8A 3U8EA 2JQFR 1FH0A 3HD3A 2DCBA 1K3BB 1CVZA 2CIOA 3HWNA 4CDDB 5EF4A 1GLOA 3AI8A 3GCBA 5CHTA 1XKGA 1EWOA 1PPOA 5EGWA 2XU3A 4X6HA 3IUTA 4I04A 2XU5A 4X6JA 7PCKA 1YK8A 2G8JA 2NQIA 2NQGA 4C5PA 3QT4A 1KHQA 2HH5A 4RY2A 5JH3A 2OULA 2DCDA 4ZUXU 1CS8A 2G7YA 2DC9A 3OF9A 2XU4A 3K8UA 1Y4HA 3N3KA 3KSEA 3CH3X 4BQVA 4YYUA 1AYUA 2ATOA 2P0RA 3H6SA 3TNXA 3WXEA 3LFYA 2NQDB 2FTDA 1F2BA 1QDQA 1U9XA 4PP1A 2E01A 2AYOA 5CVMA 2PREA 4HWYA 3CBKA 1GMYA 1STFE 1MHWA 3RVXA 4DMXA 1PADA 3ZUAA 4QRXA 3C9EA 4YYRA 1BP4A 4KLBA 3D6SA 3KKUA 8PCHA 2ACTA 2CB5A 2O6XA 5CHVA 1CSBB 4QRGA 1PXVA 1X9YA 4BS6A 1ATKA 4I05A 2AVWA 1CQDA 5PADA 4YYSA 3WXFA 4XUIA 5K16A 1BY8A 1NB5A 1MEMA 4NV7A 1PIPA 2FQ9A 3E1ZB 2HXZA 4QBBA 1ZIVA 1KXRA 1VJVA 3QSDA 1F2CA 2PADA 2AS8A 3USVA 2DJGB 3KWZA 1CJLA 5A24A 2VFBA 2DZYA 1JQPA 2C0YA 2YJBA 3HHIA 5FPWA 3S3RA 3M99A 1HUCB 1POPA 4I07A 2FT2A 3O0UA 4FJCA 2AYNA 9PAPA 1EWPA 3P5VA 5J94A 4MSXA 4N8WA 3HHAA 1GECE 3OF8A 5CVNB 3KX1A 2BDZA 1YVBA 4Q8GA 3P5XA 3BPFA 1ME3A 1U5IA 1GX3A 1EWMA 3MTNA 2B1NA 3IEJA 1KHPA 1MDWA 2GFOA 3H8CA 2Y6EA 3BWKA 4GUZA 1F29A 1TL9A 3CBJA 1CTEA 3I3TA 1TLOA 1NPZA 1GCBA 4YV8A 4AXLA 3V6CA 2BSZA 4FIPA 4YYQA 1F2AA 1EF7A 4MZOA 2E02A 2E03A 3OVXA 1CB5A 3P5WA 3IMAA 3PW3A 3BOWA 3IOQA 2HHNA 3PBHA 5F02A 2FO5A 1A6RA 1ITOA 1YALA 1QOLA 2JQGR 2R9NA 1O0EA 1U9WA 6PADA 4OELA 4QH6A 2YJ9A 1Y08A 3MORA 3IV2A 4BSQA 1KFUL 2AUZA 3OISA 1AU4A 4PI3A 2VHSA 1AYWA 2R6NA 4W5CA 4CDFB 3LXSA 4AXMA 1W5RA 2FUDA 1PCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E00 A;  2YJ2 A;  2YJ8 A;  3B79 A;  3ERV A;  2OP3 A;  1TU6 A;  2IBI A;  2NQA A;  4OEM A;  1EWL A;  3BPM A;  2YJC A;  3K9M A;  1AU2 A;  3KWB X;  1KFX L;  2PBH A;  3F75 A;  4WA6 A;  1CPJ A;  3BCN A;  5JA7 A;  2FYE A;  4YYV A;  2R9C A;  1BGO A;  1THE A;  3MHS A;  2XU1 A;  2P7U A;  1NL6 A;  4YVA A;  1U9V A;  4N79 A;  4BPV A;  1PPD A;  2P86 A;  3IHP A;  1MIR A;  2F7D A;  1PE6 A;  2IPP B;  1AIM A;  1AU0 A;  1DF0 A;  4DMY A;  3KFQ A;  4X6I A;  4MZS A;  1VSN A;  2AUX A;  2H7J A;  1CV8 A;  4YYW A;  4N4Z A;  1U9Q X;  4FK5 A;  3RVW A;  2HD5 A;  1PPN A;  1QXP A;  3NHE A;  3PDF A;  1M6D A;  2Y5B A;  2GHU A;  3KW9 A;  2ARY A;  1BQI A;  2OZ2 A;  1NB3 A;  2DCA A;  2R9M A;  3N3G A;  2AIM A;  3I06 A;  4W5B A;  4CDC B;  2G6D A;  2WBF X;  4Q8H A;  3F5V A;  2DCC A;  3QJ3 A;  3N4C A;  3PNR A;  2BDL A;  3RVV A;  3H7D A;  1ZCM A;  3WXG A;  4G54 A;  4XR7 A;  1SNK A;  4K7C A;  4W4U A;  3P5U A;  2F1G A;  4PP2 E;  4P6E A;  1DEU A;  1AYV A;  2DJF B;  2VHF A;  1AU3 A;  1ICF A;  3V6E A;  3OVZ A;  1NQC A;  4P6G A;  3H8B A;  1PBH A;  3MHH A;  4BS5 A;  4PAD A;  1MEG A;  2DC6 A;  1YT7 A;  1PPP A;  2R9O A;  2AU1 A;  1Q6K A;  2G8E A;  2DC7 A;  2B1M A;  1ME4 A;  2R9F A;  5CVO B;  3H89 A;  2DZZ A;  3O1G A;  1S4V A;  1AEC A;  4QRV A;  3K24 A;  4CZW A;  1SP4 B;  2PNS A;  2FRA A;  3BC3 A;  1MS6 A;  4CDE B;  1QMY A;  1NLJ A;  3CH2 X;  3DF0 A;  1YK7 A;  1IWD A;  2FRQ A;  3S3Q A;  2DC8 A;  3U8E A;  2JQF R;  1FH0 A;  3HD3 A;  2DCB A;  1K3B B;  1CVZ A;  2CIO A;  3HWN A;  4CDD B;  5EF4 A;  1GLO A;  3AI8 A;  3GCB A;  5CHT A;  1XKG A;  1EWO A;  1PPO A;  5EGW A;  2XU3 A;  4X6H A;  3IUT A;  4I04 A;  2XU5 A;  4X6J A;  7PCK A;  1YK8 A;  2G8J A;  2NQI A;  2NQG A;  3QT4 A;  1KHQ A;  2HH5 A;  4RY2 A;  5JH3 A;  2OUL A;  2DCD A;  4ZUX U;  1CS8 A;  2G7Y A;  2DC9 A;  3OF9 A;  2XU4 A;  3K8U A;  1Y4H A;  3N3K A;  3KSE A;  3CH3 X;  4BQV A;  4YYU A;  1AYU A;  2ATO A;  2P0R A;  3H6S A;  3TNX A;  3WXE A;  3LFY A;  2NQD B;  2FTD A;  1F2B A;  1QDQ A;  1U9X A;  4PP1 A;  2E01 A;  2AYO A;  5CVM A;  2PRE A;  4HWY A;  3CBK A;  1GMY A;  1STF E;  1MHW A;  3RVX A;  4DMX A;  1PAD A;  3ZUA A;  4QRX A;  3C9E A;  4YYR A;  1BP4 A;  4KLB A;  3D6S A;  3KKU A;  8PCH A;  2ACT A;  2CB5 A;  2O6X A;  5CHV A;  1CSB B;  4QRG A;  1PXV A;  1X9Y A;  4BS6 A;  1ATK A;  4I05 A;  2AVW A;  1CQD A;  5PAD A;  4YYS A;  3WXF A;  4XUI A;  5K16 A;  1BY8 A;  1NB5 A;  1MEM A;  1PIP A;  2FQ9 A;  3E1Z B;  2HXZ A;  4QBB A;  1ZIV A;  1KXR A;  1VJV A;  3QSD A;  1F2C A;  2PAD A;  2AS8 A;  3USV A;  2DJG B;  3KWZ A;  1CJL A;  5A24 A;  2DZY A;  1JQP A;  2C0Y A;  2YJB A;  3HHI A;  5FPW A;  3S3R A;  3M99 A;  1HUC B;  1POP A;  4I07 A;  2FT2 A;  3O0U A;  4FJC A;  2AYN A;  9PAP A;  1EWP A;  3P5V A;  5J94 A;  4MSX A;  4N8W A;  3HHA A;  1GEC E;  3OF8 A;  5CVN B;  3KX1 A;  2BDZ A;  1YVB A;  4Q8G A;  3P5X A;  3BPF A;  1ME3 A;  1U5I A;  1EWM A;  3MTN A;  2B1N A;  3IEJ A;  1KHP A;  1MDW A;  2GFO A;  3H8C A;  2Y6E A;  3BWK A;  1F29 A;  1TL9 A;  3CBJ A;  1CTE A;  3I3T A;  1TLO A;  1NPZ A;  1GCB A;  4YV8 A;  4AXL A;  3V6C A;  4FIP A;  4YYQ A;  1F2A A;  1EF7 A;  4MZO A;  2E02 A;  2E03 A;  3OVX A;  1CB5 A;  3P5W A;  3IMA A;  3PW3 A;  3BOW A;  3IOQ A;  2HHN A;  3PBH A;  5F02 A;  2FO5 A;  1A6R A;  1ITO A;  1YAL A;  1QOL A;  2JQG R;  2R9N A;  1O0E A;  1U9W A;  6PAD A;  4OEL A;  4QH6 A;  2YJ9 A;  1Y08 A;  3MOR A;  3IV2 A;  4BSQ A;  1KFU L;  2AUZ A;  3OIS A;  1AU4 A;  4PI3 A;  2VHS A;  1AYW A;  2R6N A;  4W5C A;  4CDF B;  3LXS A;  4AXM A;  2FUD A;  1PCI A; 
#chains in the Genus database with same CATH topology
 2E00 A;  2YJ2 A;  2JTC A;  2YJ8 A;  3B79 A;  3ERV A;  2OP3 A;  1TU6 A;  2IBI A;  2NQA A;  4OEM A;  1EWL A;  3BPM A;  2YJC A;  3K9M A;  1AU2 A;  3KWB X;  1KFX L;  4REZ A;  2PBH A;  4HXD B;  3F75 A;  4WA6 A;  1CPJ A;  3BCN A;  5JA7 A;  4OVZ A;  2FYE A;  4YYV A;  2R9C A;  1BGO A;  1THE A;  3MHS A;  2XU1 A;  2P7U A;  1NL6 A;  2UZJ A;  4YVA A;  1U9V A;  5KO3 A;  4N79 A;  4BPV A;  2BU3 A;  1PPD A;  2P86 A;  3BB7 A;  3PHU A;  3IHP A;  1MIR A;  4BOQ A;  3BBA A;  2F7D A;  1PE6 A;  2IPP B;  1AIM A;  4BOZ A;  1AU0 A;  1DF0 A;  4DMY A;  3KFQ A;  4X6I A;  4MZS A;  1VSN A;  2AUX A;  2H7J A;  1CV8 A;  4IP3 A;  4YYW A;  4N4Z A;  1U9Q X;  3PHW A;  4FK5 A;  3RVW A;  1UKF A;  2HD5 A;  1PPN A;  1QXP A;  3NHE A;  3PDF A;  1M6D A;  2Y5B A;  2GHU A;  3KW9 A;  2ARY A;  1BQI A;  2OZ2 A;  1NB3 A;  2DCA A;  2R9M A;  1PVJ A;  2DOS A;  4MI7 A;  4D8I A;  3O65 A;  3N3G A;  2AIM A;  3I06 A;  4W5B A;  3RNV A;  4CDC B;  2G6D A;  2WBF X;  4Q8H A;  3F5V A;  2DCC A;  4D8E A;  3QJ3 A;  3N4C A;  3PNR A;  2BDL A;  3RVV A;  3H7D A;  1ZCM A;  3WXG A;  4G54 A;  4PT5 A;  4XR7 A;  1SNK A;  4K7C A;  4W4U A;  3P5U A;  3B21 A;  2F1G A;  4PP2 E;  4P6E A;  1DEU A;  1YZB A;  1AYV A;  2DJF B;  2VHF A;  1AU3 A;  1ICF A;  3V6E A;  3OVZ A;  1NQC A;  4P6G A;  3H8B A;  1PBH A;  3MHH A;  4BS5 A;  4PAD A;  1MEG A;  2DC6 A;  1YT7 A;  1PPP A;  2R9O A;  2BTW B;  2AU1 A;  1Q6K A;  2G8E A;  2DC7 A;  2B1M A;  1ME4 A;  2R9F A;  4OW0 A;  5CVO B;  3H89 A;  2DZZ A;  3O1G A;  1S4V A;  1AEC A;  4QRV A;  3K24 A;  4CZW A;  1SP4 B;  2PNS A;  2FRA A;  3BC3 A;  3PHX A;  4D8B A;  1MS6 A;  4CDE B;  1QMY A;  4P16 A;  1NLJ A;  3CH2 X;  3DF0 A;  1YK7 A;  1IWD A;  2FRQ A;  3S3Q A;  2DC8 A;  3PSE A;  3U8E A;  2JQF R;  1FH0 A;  4A5U A;  3HD3 A;  2DCB A;  1K3B B;  4MM3 B;  1CVZ A;  2CIO A;  3HWN A;  4CDD B;  5EF4 A;  1GLO A;  3AI8 A;  3GCB A;  5CHT A;  1XKG A;  1EWO A;  4BOS A;  1PPO A;  5EGW A;  2XU3 A;  4X6H A;  3IUT A;  4I04 A;  2XU5 A;  4X6J A;  7PCK A;  1YK8 A;  3C0R A;  2G8J A;  2NQI A;  2NQG A;  3QT4 A;  1KHQ A;  4RF1 A;  3OQC A;  2HH5 A;  4RY2 A;  5JH3 A;  2OUL A;  2DCD A;  5JZE A;  4ZUX U;  2BTW A;  1CS8 A;  2G7Y A;  2DC9 A;  3OF9 A;  2XU4 A;  3K8U A;  1Y4H A;  3N3K A;  3KSE A;  3CH3 X;  4BQV A;  4YYU A;  1AYU A;  2ATO A;  2P0R A;  3H6S A;  3TNX A;  3WXE A;  3MTV A;  3LFY A;  2NQD B;  2FTD A;  1F2B A;  1QDQ A;  1U9X A;  4PP1 A;  2E01 A;  2AYO A;  5CVM A;  2PRE A;  4HWY A;  3CBK A;  1GMY A;  1STF E;  3BY4 A;  1MHW A;  5E6J A;  3RVX A;  4DMX A;  1PAD A;  3ZUA A;  4QRX A;  3C9E A;  4YYR A;  1BP4 A;  4KLB A;  3D6S A;  3KKU A;  3W30 A;  8PCH A;  2ACT A;  2CB5 A;  2O6X A;  5CHV A;  1CSB B;  3MJ5 A;  4QRG A;  1PXV A;  1X9Y A;  5EZS A;  4BS6 A;  1ATK A;  2J7Q C;  4I05 A;  2AVW A;  3TRK A;  1CQD A;  5PAD A;  4YYS A;  3PRP A;  3WXF A;  4XUI A;  5K16 A;  1BY8 A;  3W31 A;  3PRM A;  1NB5 A;  1MEM A;  1PIP A;  2FQ9 A;  3E1Z B;  2HXZ A;  4QBB A;  1ZIV A;  1KXR A;  1VJV A;  3QSD A;  4R3D A;  1F2C A;  4BOP A;  2PAD A;  2AS8 A;  3E9S A;  3USV A;  2DJG B;  3KWZ A;  1CJL A;  5A24 A;  2DZY A;  1JQP A;  2C0Y A;  2YJB A;  3HHI A;  5FPW A;  3S3R A;  3IFU A;  3M99 A;  1HUC B;  1POP A;  2Z84 A;  4I07 A;  2FT2 A;  3O0U A;  4FJC A;  2AYN A;  9PAP A;  1EWP A;  3P5V A;  5J94 A;  4MSX A;  4N8W A;  2JRI A;  3HHA A;  1GEC E;  3OF8 A;  5CVN B;  3KX1 A;  2BDZ A;  4ZTB A;  4M0W A;  1YVB A;  4Q8G A;  3P5X A;  3BPF A;  3ZNH A;  1ME3 A;  1U5I A;  1EWM A;  3MTN A;  2B1N A;  3IEJ A;  1KHP A;  1MDW A;  2GFO A;  3H8C A;  2Y6E A;  5EZQ A;  4WUR A;  3BWK A;  1F29 A;  1TL9 A;  3CBJ A;  3PT2 A;  1CTE A;  3I3T A;  1TLO A;  1NPZ A;  1GCB A;  4YV8 A;  4AXL A;  3V6C A;  2FE8 A;  4FIP A;  4YYQ A;  1F2A A;  1EF7 A;  4MZO A;  2E02 A;  4BOU A;  2E03 A;  3OVX A;  1CB5 A;  4OVZ B;  3P5W A;  3IMA A;  3PW3 A;  3BOW A;  4RNA A;  3IOQ A;  2HHN A;  3PBH A;  5F02 A;  1DKI A;  2FO5 A;  1A6R A;  1ITO A;  4GUA A;  1YAL A;  1QOL A;  2JQG R;  2R9N A;  3MP2 A;  4RKX A;  1O0E A;  1U9W A;  6PAD A;  2J7Q A;  4OEL A;  4QH6 A;  2YJ9 A;  1Y08 A;  3MOR A;  2HWK A;  3IV2 A;  4BSQ A;  2AGA A;  1KFU L;  2AUZ A;  3OIS A;  1AU4 A;  4RF0 A;  4PI3 A;  2VHS A;  1AYW A;  3TMP A;  2R6N A;  4W5C A;  4IUM A;  4CDF B;  3LXS A;  4AXM A;  2FUD A;  4XZX A;  1PCI A; 
#chains in the Genus database with same CATH homology
 2E00 A;  2YJ2 A;  1W6F A;  2YJ8 A;  3B79 A;  3ERV A;  2OP3 A;  1TU6 A;  2IBI A;  2NQA A;  4OEM A;  1EWL A;  3BPM A;  2YJC A;  3K9M A;  1AU2 A;  3KWB X;  1KFX L;  2PBH A;  3F75 A;  4WA6 A;  1CPJ A;  1E2T A;  3BCN A;  5JA7 A;  2FYE A;  4YYV A;  2R9C A;  1BGO A;  1THE A;  3MHS A;  2XU1 A;  2P7U A;  1NL6 A;  4YVA A;  1U9V A;  4N79 A;  4BPV A;  1PPD A;  2P86 A;  3IHP A;  1MIR A;  4BGF A;  2F7D A;  1PE6 A;  2IPP B;  1AIM A;  1AU0 A;  1DF0 A;  4DMY A;  3KFQ A;  4X6I A;  4MZS A;  1VSN A;  2AUX A;  2H7J A;  1CV8 A;  4YYW A;  4N4Z A;  1U9Q X;  4FK5 A;  3RVW A;  2HD5 A;  1PPN A;  1QXP A;  3NHE A;  3PDF A;  1M6D A;  2Y5B A;  2GHU A;  3KW9 A;  2ARY A;  1BQI A;  2OZ2 A;  1NB3 A;  2DCA A;  2R9M A;  3N3G A;  2AIM A;  3I06 A;  4W5B A;  4CDC B;  2G6D A;  2WBF X;  4Q8H A;  3F5V A;  2DCC A;  3QJ3 A;  3N4C A;  3PNR A;  2BDL A;  3RVV A;  3H7D A;  1ZCM A;  3WXG A;  4G54 A;  4XR7 A;  1SNK A;  4K7C A;  4W4U A;  3P5U A;  4NV8 A;  2F1G A;  4PP2 E;  4P6E A;  1DEU A;  1AYV A;  3LTW A;  2DJF B;  2VHF A;  1AU3 A;  1ICF A;  3V6E A;  3OVZ A;  1NQC A;  4P6G A;  3H8B A;  1PBH A;  3MHH A;  4BS5 A;  4PAD A;  1MEG A;  2DC6 A;  1YT7 A;  1PPP A;  1W4T A;  2R9O A;  4B55 A;  2AU1 A;  1Q6K A;  2G8E A;  2VFC A;  2DC7 A;  2B1M A;  1ME4 A;  2R9F A;  5CVO B;  3H89 A;  2DZZ A;  3O1G A;  1S4V A;  3D9W A;  1AEC A;  4QRV A;  3K24 A;  4CZW A;  1SP4 B;  2PNS A;  2FRA A;  3BC3 A;  1MS6 A;  4CDE B;  1QMY A;  1NLJ A;  3CH2 X;  3DF0 A;  1YK7 A;  1IWD A;  2FRQ A;  3S3Q A;  2DC8 A;  3U8E A;  2JQF R;  1FH0 A;  3HD3 A;  2DCB A;  1K3B B;  1CVZ A;  2CIO A;  3HWN A;  4CDD B;  5EF4 A;  1GLO A;  3AI8 A;  3GCB A;  5CHT A;  1XKG A;  1EWO A;  1PPO A;  5EGW A;  2XU3 A;  4X6H A;  3IUT A;  4I04 A;  2XU5 A;  4X6J A;  7PCK A;  1YK8 A;  2G8J A;  2NQI A;  2NQG A;  4C5P A;  3QT4 A;  1KHQ A;  2HH5 A;  4RY2 A;  5JH3 A;  2OUL A;  2DCD A;  4ZUX U;  1CS8 A;  2G7Y A;  2DC9 A;  3OF9 A;  2XU4 A;  3K8U A;  1Y4H A;  3N3K A;  3KSE A;  3CH3 X;  4BQV A;  4YYU A;  1AYU A;  2ATO A;  2P0R A;  3H6S A;  3TNX A;  3WXE A;  3LFY A;  2NQD B;  2FTD A;  1F2B A;  1QDQ A;  1U9X A;  4PP1 A;  2E01 A;  2AYO A;  5CVM A;  2PRE A;  4HWY A;  3CBK A;  1GMY A;  1STF E;  1MHW A;  3RVX A;  4DMX A;  1PAD A;  3ZUA A;  4QRX A;  3C9E A;  4YYR A;  1BP4 A;  4KLB A;  3D6S A;  3KKU A;  8PCH A;  2ACT A;  2CB5 A;  2O6X A;  5CHV A;  1CSB B;  4QRG A;  1PXV A;  1X9Y A;  4BS6 A;  1ATK A;  4I05 A;  2AVW A;  1CQD A;  5PAD A;  4YYS A;  3WXF A;  4XUI A;  5K16 A;  1BY8 A;  1NB5 A;  1MEM A;  4NV7 A;  1PIP A;  2FQ9 A;  3E1Z B;  2HXZ A;  4QBB A;  1ZIV A;  1KXR A;  1VJV A;  3QSD A;  1F2C A;  2PAD A;  2AS8 A;  3USV A;  2DJG B;  3KWZ A;  1CJL A;  5A24 A;  2VFB A;  2DZY A;  1JQP A;  2C0Y A;  2YJB A;  3HHI A;  5FPW A;  3S3R A;  3M99 A;  1HUC B;  1POP A;  4I07 A;  2FT2 A;  3O0U A;  4FJC A;  2AYN A;  9PAP A;  1EWP A;  3P5V A;  5J94 A;  4MSX A;  4N8W A;  3HHA A;  1GEC E;  3OF8 A;  5CVN B;  3KX1 A;  2BDZ A;  1YVB A;  4Q8G A;  3P5X A;  3BPF A;  1ME3 A;  1U5I A;  1GX3 A;  1EWM A;  3MTN A;  2B1N A;  3IEJ A;  1KHP A;  1MDW A;  2GFO A;  3H8C A;  2Y6E A;  3BWK A;  4GUZ A;  1F29 A;  1TL9 A;  3CBJ A;  1CTE A;  3I3T A;  1TLO A;  1NPZ A;  1GCB A;  4YV8 A;  4AXL A;  3V6C A;  2BSZ A;  4FIP A;  4YYQ A;  1F2A A;  1EF7 A;  4MZO A;  2E02 A;  2E03 A;  3OVX A;  1CB5 A;  3P5W A;  3IMA A;  3PW3 A;  3BOW A;  3IOQ A;  2HHN A;  3PBH A;  5F02 A;  2FO5 A;  1A6R A;  1ITO A;  1YAL A;  1QOL A;  2JQG R;  2R9N A;  1O0E A;  1U9W A;  6PAD A;  4OEL A;  4QH6 A;  2YJ9 A;  1Y08 A;  3MOR A;  3IV2 A;  4BSQ A;  1KFU L;  2AUZ A;  3OIS A;  1AU4 A;  4PI3 A;  2VHS A;  1AYW A;  2R6N A;  4W5C A;  4CDF B;  3LXS A;  4AXM A;  1W5R A;  2FUD A;  1PCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...