3LXSA

Crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (wrr483)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzain
publication title In vitro and in vivo studies of the trypanocidal properties of WRR-483 against Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 71
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3lxsA00
1QDQA 1YK7A 2FRAA 1EWOA 3ERVA 3KSEA 3CBKA 4AXLA 1BGOA 4YYWA 4G54A 3F75A 4I07A 1PE6A 2P86A 1U9QX 5CHTA 2E01A 2NQAA 3H7DA 4X6IA 1MS6A 3KKUA 1U9WA 4W5BA 5F02A 3B79A 1SP4B 1SNKA 1JQPA 3CH2X 5PADA 2B1NA 4N8WA 2XU3A 1XKGA 2NQIA 1YK8A 2Y5BA 3LFYA 1NQCA 1AYVA 4X6HA 3RVVA 1GCBA 2DCAA 1YT7A 3DF0A 4P6EA 1YALA 1CTEA 4FJCA 2HHNA 3PDFA 1CPJA 3IHPA 3S3RA 2GFOA 1QOLA 3MHHA 2CIOA 2PBHA 1EF7A 5JA7A 3OVZA 3V6EA 3MHSA 3BPFA 4QRVA 1MHWA 3IV2A 2AYNA 4KLBA 1IWDA 4YYRA 5A24A 2ARYA 3P5VA 1O0EA 1AYWA 3LXSA 1CV8A 1AU3A 4YV8A 2AU1A 1Y08A 3PBHA 4MZOA 2PNSA 1S4VA 4X6JA 2R9FA 1NB5A 1F2AA 1YVBA 1PPNA 1PIPA 5EF4A 4OEMA 3KFQA 1TU6A 5K16A 5CVOB 2CB5A 2FYEA 2R6NA 1DEUA 3QJ3A 2DCDA 2FO5A 1KHQA 2R9CA 2F7DA 3H8BA 2AIMA 4FK5A 1AECA 1ME4A 4BQVA 3V6CA 1DF0A 4QRXA 4N79A 1KXRA 2E02A 1ZIVA 3I06A 1KFUL 1MEGA 1NL6A 2NQGA 4YVAA 1AU2A 1VJVA 3BOWA 8PCHA 6PADA 4BS6A 1ATKA 1CSBB 3HWNA 3N4CA 4I04A 1MDWA 1PPDA 1F2BA 2E03A 3C9EA 2DZZA 5FPWA 1GECE 4Q8HA 4CDDB 3QSDA 2YJ9A 3U8EA 1PCIA 3H89A 3K24A 1U9XA 4CDEB 2G7YA 3M99A 1KFXL 1F29A 4W4UA 2YJBA 3BWKA 1NPZA 3H6SA 4YYQA 3WXEA 1AU4A 4I05A 2ATOA 2OP3A 4CDCB 3IUTA 3IEJA 2FT2A 1QXPA 1K3BB 2E00A 1FH0A 1CQDA 2PADA 2FRQA 1CB5A 1THEA 4Q8GA 1F2CA 3QT4A 2DCCA 3HHAA 1CJLA 1U5IA 4PADA 1Y4HA 3K9MA 1Q6KA 1VSNA 4DMXA 2G8EA 2DC6A 1EWPA 4PI3A 3S3QA 1A6RA 2DC9A 3F5VA 3PW3A 3OF8A 4RY2A 2VHFA 1TL9A 2B1MA 2DC7A 4ZUXU 1GMYA 1PBHA 3N3GA 1POPA 2DCBA 1AYUA 1MEMA 3PNRA 3NHEA 4MZSA 1BQIA 3I3TA 2HD5A 4YYVA 2DJFB 2PREA 1STFE 1PPOA 3IOQA 2DC8A 2R9NA 4MSXA 5JH3A 1ME3A 4YYSA 5CHVA 3BC3A 3USVA 1BY8A 2R9MA 5CVNB 2H7JA 4PP1A 2P7UA 1ICFA 2JQGR 4XR7A 1CS8A 2G6DA 2WBFX 2C0YA 2AUXA 4WA6A 3KWBX 2IPPB 3KWZA 2BDZA 1PADA 4FIPA 3BPMA 3IMAA 4BPVA 4BSQA 3P5WA 3RVWA 2O6XA 1TLOA 2HXZA 3HHIA 4AXMA 2Y6EA 7PCKA 3H8CA 4K7CA 2ACTA 1ITOA 4DMYA 3BCNA 3OISA 1AU0A 2DZYA 3ZUAA 4N4ZA 3P5XA 5CVMA 2OZ2A 2OULA 3OF9A 2AS8A 1PXVA 1AIMA 1QMYA 3AI8A 3CH3X 4W5CA 2DJGB 2XU4A 4QRGA 1KHPA 4PP2E 4BS5A 4CZWA 1CVZA 1HUCB 2YJ8A 5EGWA 1X9YA 3P5UA 2FQ9A 2AVWA 4QBBA 3WXGA 4YYUA 2VHSA 2JQFR 1GLOA 4P6GA 3RVXA 3OVXA 5J94A 2IBIA 4HWYA 3KW9A 3GCBA 1NLJA 3O0UA 4XUIA 2P0RA 3D6SA 3KX1A 3TNXA 2FTDA 9PAPA 2AYOA 2YJ2A 4OELA 3WXFA 2G8JA 2AUZA 3MTNA 1EWMA 2BDLA 3MORA 2XU5A 1M6DA 1U9VA 2GHUA 1PPPA 3E1ZB 3N3KA 1EWLA 2F1GA 2NQDB 2R9OA 3CBJA 3K8UA 1MIRA 3O1GA 2YJCA 2FUDA 2XU1A 4CDFB 1NB3A 3HD3A 1ZCMA 4QH6A 1BP4A 2HH5A
chains in the Genus database with same CATH superfamily
1QDQA 1YK7A 2FRAA 1EWOA 3ERVA 3KSEA 3CBKA 4AXLA 1BGOA 4GUAA 4YYWA 4G54A 3MJ5A 3F75A 4I07A 1PE6A 2P86A 1U9QX 5CHTA 2E01A 2NQAA 3H7DA 4X6IA 1MS6A 3KKUA 1U9WA 4W5BA 5F02A 3B79A 1SP4B 4IUMA 3PHWA 1SNKA 3PRMA 4A5UA 1JQPA 3BB7A 3CH2X 5PADA 2B1NA 4N8WA 2XU3A 3E9SA 1XKGA 2HWKA 2NQIA 1YK8A 2Y5BA 4OVZA 3LFYA 1NQCA 1AYVA 4X6HA 4M0WA 3RVVA 1GCBA 2DCAA 1YT7A 3DF0A 4BOPA 4P6EA 1YALA 1CTEA 4FJCA 2HHNA 3PDFA 1CPJA 2BU3A 3IHPA 3S3RA 2GFOA 1QOLA 3MHHA 2CIOA 2PBHA 1EF7A 2UZJA 5JA7A 3TMPA 3OVZA 3V6EA 3MHSA 3BPFA 4QRVA 1MHWA 3IV2A 2AYNA 4KLBA 1IWDA 4YYRA 5A24A 2ARYA 3P5VA 4IP3A 1O0EA 1AYWA 3IFUA 3LXSA 4BOQA 1CV8A 4ZTBA 1AU3A 4YV8A 2AU1A 3MTVA 1Y08A 3PBHA 4MZOA 2PNSA 1S4VA 4X6JA 2R9FA 1NB5A 1F2AA 1YVBA 4WURA 5EZQA 3W31A 1PPNA 1PIPA 5EF4A 4OEMA 3KFQA 1TU6A 5K16A 5CVOB 2CB5A 2FYEA 4D8BA 2R6NA 1DEUA 3QJ3A 2DCDA 2FO5A 4OVZB 1KHQA 2R9CA 2F7DA 4BOSA 3H8BA 2AIMA 4FK5A 1AECA 1ME4A 4BQVA 3V6CA 1DF0A 4QRXA 4N79A 1KXRA 2E02A 2FE8A 1ZIVA 3I06A 1KFUL 1MEGA 1NL6A 2NQGA 3MP2A 4YVAA 4RKXA 1AU2A 1VJVA 3BOWA 3PSEA 8PCHA 6PADA 3PHUA 4BS6A 1ATKA 1CSBB 3HWNA 4BOUA 3N4CA 4REZA 4I04A 1MDWA 1PPDA 1F2BA 1DKIA 2E03A 3ZNHA 3C9EA 2DZZA 5FPWA 4MM3B 1GECE 4Q8HA 4CDDB 3QSDA 2YJ9A 3U8EA 1PCIA 3H89A 3K24A 1U9XA 4CDEB 2G7YA 3M99A 1KFXL 1F29A 4W4UA 2YJBA 3BWKA 1NPZA 3H6SA 4YYQA 3WXEA 1AU4A 4I05A 2ATOA 2OP3A 4CDCB 3IUTA 3IEJA 3RNVA 2FT2A 1QXPA 1K3BB 5KO3A 2E00A 1FH0A 1CQDA 2PADA 2FRQA 1CB5A 1THEA 4Q8GA 1F2CA 4R3DA 4RNAA 2BTWA 3QT4A 3B21A 2DCCA 3HHAA 1CJLA 1U5IA 4RF1A 4PADA 1Y4HA 3K9MA 1Q6KA 1VSNA 4DMXA 4D8IA 2G8EA 2DC6A 1EWPA 4PI3A 3S3QA 5JZEA 1A6RA 2DC9A 3F5VA 3PW3A 3OF8A 3O65A 4RY2A 2VHFA 1TL9A 2B1MA 2DC7A 4ZUXU 1GMYA 3PT2A 5EZSA 1PBHA 3N3GA 1POPA 3PRPA 2DCBA 1AYUA 1MEMA 3PNRA 3NHEA 4MZSA 4XZXA 1BQIA 3I3TA 2HD5A 4YYVA 2DJFB 2PREA 1STFE 1PPOA 3IOQA 2DC8A 2R9NA 4MSXA 5JH3A 1ME3A 4YYSA 5CHVA 3BC3A 3USVA 1BY8A 2R9MA 5CVNB 3TRKA 2H7JA 4PP1A 2P7UA 2BTWB 1ICFA 2JQGR 4XR7A 1CS8A 2G6DA 2WBFX 4P16A 2C0YA 2AUXA 4WA6A 3KWBX 2IPPB 3KWZA 4MI7A 2BDZA 1PADA 4FIPA 3BPMA 3IMAA 4BPVA 4BSQA 4OW0A 3P5WA 3RVWA 2O6XA 1TLOA 2HXZA 3HHIA 4AXMA 2Y6EA 7PCKA 3H8CA 4K7CA 2ACTA 1ITOA 4DMYA 2JRIA 3BCNA 3OISA 1AU0A 2DZYA 3BY4A 3ZUAA 4N4ZA 3P5XA 5CVMA 2OZ2A 2J7QA 2OULA 3OF9A 1YZBA 2AS8A 1PXVA 1AIMA 1QMYA 2JTCA 2AGAA 3AI8A 3CH3X 4W5CA 2DJGB 2XU4A 4QRGA 1KHPA 4PP2E 4PT5A 3PHXA 4BS5A 4CZWA 1CVZA 3BBAA 1HUCB 2YJ8A 5EGWA 1X9YA 3P5UA 2FQ9A 2AVWA 4QBBA 3WXGA 4YYUA 2VHSA 2JQFR 1GLOA 4P6GA 3OQCA 3RVXA 3OVXA 2DOSA 5J94A 2IBIA 4HWYA 3KW9A 3GCBA 1NLJA 3O0UA 4XUIA 2P0RA 3D6SA 3C0RA 3KX1A 3TNXA 2FTDA 9PAPA 2AYOA 2Z84A 2YJ2A 4OELA 3WXFA 2G8JA 2AUZA 3MTNA 1EWMA 2BDLA 3MORA 1UKFA 1PVJA 2XU5A 1M6DA 1U9VA 5E6JA 2GHUA 1PPPA 4RF0A 3E1ZB 3N3KA 1EWLA 2F1GA 2NQDB 4D8EA 2R9OA 3CBJA 3K8UA 1MIRA 3O1GA 2YJCA 2FUDA 4BOZA 2XU1A 4CDFB 1NB3A 3HD3A 3W30A 1ZCMA 4QH6A 1BP4A 2HH5A 2J7QC 4HXDB
chains in the Genus database with same CATH topology
1QDQA 1YK7A 2FRAA 1EWOA 3ERVA 3KSEA 3CBKA 4AXLA 1BGOA 4YYWA 4G54A 3F75A 4I07A 1PE6A 2P86A 1U9QX 5CHTA 2E01A 2NQAA 3H7DA 4X6IA 1MS6A 3KKUA 1U9WA 4W5BA 5F02A 3B79A 1SP4B 1SNKA 1JQPA 3CH2X 5PADA 2B1NA 4N8WA 2XU3A 1XKGA 2NQIA 1YK8A 2Y5BA 3LFYA 1NQCA 1AYVA 4X6HA 3RVVA 1GCBA 2DCAA 1YT7A 3DF0A 4P6EA 1YALA 1CTEA 4FJCA 2HHNA 3PDFA 1CPJA 3IHPA 3S3RA 2GFOA 1QOLA 1GX3A 3MHHA 2CIOA 2PBHA 1EF7A 5JA7A 3OVZA 3V6EA 3MHSA 3BPFA 4QRVA 1MHWA 3IV2A 2AYNA 4KLBA 1IWDA 4YYRA 5A24A 2ARYA 3P5VA 1O0EA 1AYWA 3LXSA 1CV8A 1AU3A 4YV8A 2AU1A 1Y08A 3LTWA 3PBHA 4MZOA 2PNSA 1S4VA 4X6JA 2R9FA 1NB5A 1F2AA 1YVBA 1PPNA 1PIPA 5EF4A 4OEMA 3KFQA 1TU6A 5K16A 5CVOB 2CB5A 2FYEA 2R6NA 1DEUA 3QJ3A 2DCDA 2FO5A 4NV7A 1KHQA 2R9CA 2F7DA 3H8BA 2AIMA 4FK5A 1AECA 1ME4A 4BQVA 3V6CA 1DF0A 4QRXA 4N79A 1KXRA 2E02A 4GUZA 1ZIVA 3I06A 1KFUL 1MEGA 1NL6A 2NQGA 4YVAA 1AU2A 1VJVA 3BOWA 8PCHA 6PADA 4BS6A 1ATKA 1CSBB 3HWNA 3N4CA 4I04A 1MDWA 1PPDA 1F2BA 2E03A 3C9EA 2DZZA 5FPWA 1GECE 4Q8HA 4CDDB 3QSDA 2YJ9A 3U8EA 1PCIA 3H89A 3K24A 1U9XA 4CDEB 2G7YA 4BGFA 3M99A 1KFXL 1F29A 4W4UA 2YJBA 3BWKA 1NPZA 3H6SA 4YYQA 3WXEA 1AU4A 4I05A 2ATOA 2OP3A 4CDCB 3IUTA 3IEJA 2FT2A 1QXPA 1E2TA 1K3BB 1W4TA 2E00A 1FH0A 1W6FA 1CQDA 2PADA 2FRQA 1CB5A 1THEA 4Q8GA 1F2CA 3QT4A 2DCCA 3HHAA 1CJLA 1U5IA 4PADA 1Y4HA 3K9MA 1Q6KA 1VSNA 4DMXA 2G8EA 2DC6A 1EWPA 4PI3A 3S3QA 1A6RA 2DC9A 3F5VA 3PW3A 3OF8A 4RY2A 2VHFA 1TL9A 2B1MA 2DC7A 4ZUXU 1GMYA 1W5RA 1PBHA 3N3GA 1POPA 2DCBA 1AYUA 1MEMA 3PNRA 3NHEA 4MZSA 1BQIA 3I3TA 2HD5A 4YYVA 2DJFB 2PREA 1STFE 1PPOA 4B55A 3IOQA 2DC8A 2R9NA 4MSXA 5JH3A 1ME3A 4YYSA 5CHVA 3BC3A 3USVA 1BY8A 2R9MA 5CVNB 4NV8A 2H7JA 4PP1A 2P7UA 1ICFA 2JQGR 4XR7A 1CS8A 2G6DA 2WBFX 2C0YA 2AUXA 4WA6A 3KWBX 2IPPB 3KWZA 2BDZA 1PADA 4FIPA 3BPMA 3IMAA 4BPVA 4BSQA 3P5WA 3RVWA 2O6XA 1TLOA 2HXZA 3HHIA 4AXMA 2Y6EA 7PCKA 3H8CA 4K7CA 2ACTA 1ITOA 4DMYA 2BSZA 3BCNA 3OISA 1AU0A 2DZYA 3ZUAA 4N4ZA 3P5XA 5CVMA 2OZ2A 2OULA 3OF9A 4C5PA 2AS8A 1PXVA 1AIMA 1QMYA 3AI8A 3CH3X 4W5CA 2DJGB 2XU4A 4QRGA 1KHPA 4PP2E 4BS5A 4CZWA 1CVZA 2VFCA 1HUCB 2YJ8A 5EGWA 1X9YA 3P5UA 2FQ9A 2AVWA 4QBBA 3WXGA 4YYUA 2VHSA 2JQFR 1GLOA 4P6GA 3RVXA 3OVXA 5J94A 2IBIA 4HWYA 3KW9A 3GCBA 1NLJA 3O0UA 4XUIA 2P0RA 3D6SA 3KX1A 3TNXA 2FTDA 9PAPA 2AYOA 2VFBA 2YJ2A 4OELA 3WXFA 2G8JA 2AUZA 3MTNA 1EWMA 2BDLA 3MORA 2XU5A 1M6DA 1U9VA 2GHUA 1PPPA 3E1ZB 3N3KA 1EWLA 2F1GA 2NQDB 2R9OA 3CBJA 3K8UA 1MIRA 3O1GA 2YJCA 2FUDA 2XU1A 4CDFB 1NB3A 3HD3A 1ZCMA 4QH6A 1BP4A 2HH5A 3D9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QDQ A;  1YK7 A;  2FRA A;  1EWO A;  3ERV A;  3KSE A;  3CBK A;  4AXL A;  1BGO A;  4YYW A;  4G54 A;  3F75 A;  4I07 A;  1PE6 A;  2P86 A;  1U9Q X;  5CHT A;  2E01 A;  2NQA A;  3H7D A;  4X6I A;  1MS6 A;  3KKU A;  1U9W A;  4W5B A;  5F02 A;  3B79 A;  1SP4 B;  1SNK A;  1JQP A;  3CH2 X;  5PAD A;  2B1N A;  4N8W A;  2XU3 A;  1XKG A;  2NQI A;  1YK8 A;  2Y5B A;  3LFY A;  1NQC A;  1AYV A;  4X6H A;  3RVV A;  1GCB A;  2DCA A;  1YT7 A;  3DF0 A;  4P6E A;  1YAL A;  1CTE A;  4FJC A;  2HHN A;  3PDF A;  1CPJ A;  3IHP A;  3S3R A;  2GFO A;  1QOL A;  3MHH A;  2CIO A;  2PBH A;  1EF7 A;  5JA7 A;  3OVZ A;  3V6E A;  3MHS A;  3BPF A;  4QRV A;  1MHW A;  3IV2 A;  2AYN A;  4KLB A;  1IWD A;  4YYR A;  5A24 A;  2ARY A;  3P5V A;  1O0E A;  1AYW A;  3LXS A;  1CV8 A;  1AU3 A;  4YV8 A;  2AU1 A;  1Y08 A;  3PBH A;  4MZO A;  2PNS A;  1S4V A;  4X6J A;  2R9F A;  1NB5 A;  1F2A A;  1YVB A;  1PPN A;  1PIP A;  5EF4 A;  4OEM A;  3KFQ A;  1TU6 A;  5K16 A;  5CVO B;  2CB5 A;  2FYE A;  2R6N A;  1DEU A;  3QJ3 A;  2DCD A;  2FO5 A;  1KHQ A;  2R9C A;  2F7D A;  3H8B A;  2AIM A;  4FK5 A;  1AEC A;  1ME4 A;  4BQV A;  3V6C A;  1DF0 A;  4QRX A;  4N79 A;  1KXR A;  2E02 A;  1ZIV A;  3I06 A;  1KFU L;  1MEG A;  1NL6 A;  2NQG A;  4YVA A;  1AU2 A;  1VJV A;  3BOW A;  8PCH A;  6PAD A;  4BS6 A;  1ATK A;  1CSB B;  3HWN A;  3N4C A;  4I04 A;  1MDW A;  1PPD A;  1F2B A;  2E03 A;  3C9E A;  2DZZ A;  5FPW A;  1GEC E;  4Q8H A;  4CDD B;  3QSD A;  2YJ9 A;  3U8E A;  1PCI A;  3H89 A;  3K24 A;  1U9X A;  4CDE B;  2G7Y A;  3M99 A;  1KFX L;  1F29 A;  4W4U A;  2YJB A;  3BWK A;  1NPZ A;  3H6S A;  4YYQ A;  3WXE A;  1AU4 A;  4I05 A;  2ATO A;  2OP3 A;  4CDC B;  3IUT A;  3IEJ A;  2FT2 A;  1QXP A;  1K3B B;  2E00 A;  1FH0 A;  1CQD A;  2PAD A;  2FRQ A;  1CB5 A;  1THE A;  4Q8G A;  1F2C A;  3QT4 A;  2DCC A;  3HHA A;  1CJL A;  1U5I A;  4PAD A;  1Y4H A;  3K9M A;  1Q6K A;  1VSN A;  4DMX A;  2G8E A;  2DC6 A;  1EWP A;  4PI3 A;  3S3Q A;  1A6R A;  2DC9 A;  3F5V A;  3PW3 A;  3OF8 A;  4RY2 A;  2VHF A;  1TL9 A;  2B1M A;  2DC7 A;  4ZUX U;  1GMY A;  1PBH A;  3N3G A;  1POP A;  2DCB A;  1AYU A;  1MEM A;  3PNR A;  3NHE A;  4MZS A;  1BQI A;  3I3T A;  2HD5 A;  4YYV A;  2DJF B;  2PRE A;  1STF E;  1PPO A;  3IOQ A;  2DC8 A;  2R9N A;  4MSX A;  5JH3 A;  1ME3 A;  4YYS A;  5CHV A;  3BC3 A;  3USV A;  1BY8 A;  2R9M A;  5CVN B;  2H7J A;  4PP1 A;  2P7U A;  1ICF A;  2JQG R;  4XR7 A;  1CS8 A;  2G6D A;  2WBF X;  2C0Y A;  2AUX A;  4WA6 A;  3KWB X;  2IPP B;  3KWZ A;  2BDZ A;  1PAD A;  4FIP A;  3BPM A;  3IMA A;  4BPV A;  4BSQ A;  3P5W A;  3RVW A;  2O6X A;  1TLO A;  2HXZ A;  3HHI A;  4AXM A;  2Y6E A;  7PCK A;  3H8C A;  4K7C A;  2ACT A;  1ITO A;  4DMY A;  3BCN A;  3OIS A;  1AU0 A;  2DZY A;  3ZUA A;  4N4Z A;  3P5X A;  5CVM A;  2OZ2 A;  2OUL A;  3OF9 A;  2AS8 A;  1PXV A;  1AIM A;  1QMY A;  3AI8 A;  3CH3 X;  4W5C A;  2DJG B;  2XU4 A;  4QRG A;  1KHP A;  4PP2 E;  4BS5 A;  4CZW A;  1CVZ A;  1HUC B;  2YJ8 A;  5EGW A;  1X9Y A;  3P5U A;  2FQ9 A;  2AVW A;  4QBB A;  3WXG A;  4YYU A;  2VHS A;  2JQF R;  1GLO A;  4P6G A;  3RVX A;  3OVX A;  5J94 A;  2IBI A;  4HWY A;  3KW9 A;  3GCB A;  1NLJ A;  3O0U A;  4XUI A;  2P0R A;  3D6S A;  3KX1 A;  3TNX A;  2FTD A;  9PAP A;  2AYO A;  2YJ2 A;  4OEL A;  3WXF A;  2G8J A;  2AUZ A;  3MTN A;  1EWM A;  2BDL A;  3MOR A;  2XU5 A;  1M6D A;  1U9V A;  2GHU A;  1PPP A;  3E1Z B;  3N3K A;  1EWL A;  2F1G A;  2NQD B;  2R9O A;  3CBJ A;  3K8U A;  1MIR A;  3O1G A;  2YJC A;  2FUD A;  2XU1 A;  4CDF B;  1NB3 A;  3HD3 A;  1ZCM A;  4QH6 A;  1BP4 A;  2HH5 A; 
#chains in the Genus database with same CATH topology
 1QDQ A;  1YK7 A;  2FRA A;  1EWO A;  3ERV A;  3KSE A;  3CBK A;  4AXL A;  1BGO A;  4GUA A;  4YYW A;  4G54 A;  3MJ5 A;  3F75 A;  4I07 A;  1PE6 A;  2P86 A;  1U9Q X;  5CHT A;  2E01 A;  2NQA A;  3H7D A;  4X6I A;  1MS6 A;  3KKU A;  1U9W A;  4W5B A;  5F02 A;  3B79 A;  1SP4 B;  4IUM A;  3PHW A;  1SNK A;  3PRM A;  4A5U A;  1JQP A;  3BB7 A;  3CH2 X;  5PAD A;  2B1N A;  4N8W A;  2XU3 A;  3E9S A;  1XKG A;  2HWK A;  2NQI A;  1YK8 A;  2Y5B A;  4OVZ A;  3LFY A;  1NQC A;  1AYV A;  4X6H A;  4M0W A;  3RVV A;  1GCB A;  2DCA A;  1YT7 A;  3DF0 A;  4BOP A;  4P6E A;  1YAL A;  1CTE A;  4FJC A;  2HHN A;  3PDF A;  1CPJ A;  2BU3 A;  3IHP A;  3S3R A;  2GFO A;  1QOL A;  3MHH A;  2CIO A;  2PBH A;  1EF7 A;  2UZJ A;  5JA7 A;  3TMP A;  3OVZ A;  3V6E A;  3MHS A;  3BPF A;  4QRV A;  1MHW A;  3IV2 A;  2AYN A;  4KLB A;  1IWD A;  4YYR A;  5A24 A;  2ARY A;  3P5V A;  4IP3 A;  1O0E A;  1AYW A;  3IFU A;  3LXS A;  4BOQ A;  1CV8 A;  4ZTB A;  1AU3 A;  4YV8 A;  2AU1 A;  3MTV A;  1Y08 A;  3PBH A;  4MZO A;  2PNS A;  1S4V A;  4X6J A;  2R9F A;  1NB5 A;  1F2A A;  1YVB A;  4WUR A;  5EZQ A;  3W31 A;  1PPN A;  1PIP A;  5EF4 A;  4OEM A;  3KFQ A;  1TU6 A;  5K16 A;  5CVO B;  2CB5 A;  2FYE A;  4D8B A;  2R6N A;  1DEU A;  3QJ3 A;  2DCD A;  2FO5 A;  4OVZ B;  1KHQ A;  2R9C A;  2F7D A;  4BOS A;  3H8B A;  2AIM A;  4FK5 A;  1AEC A;  1ME4 A;  4BQV A;  3V6C A;  1DF0 A;  4QRX A;  4N79 A;  1KXR A;  2E02 A;  2FE8 A;  1ZIV A;  3I06 A;  1KFU L;  1MEG A;  1NL6 A;  2NQG A;  3MP2 A;  4YVA A;  4RKX A;  1AU2 A;  1VJV A;  3BOW A;  3PSE A;  8PCH A;  6PAD A;  3PHU A;  4BS6 A;  1ATK A;  1CSB B;  3HWN A;  4BOU A;  3N4C A;  4REZ A;  4I04 A;  1MDW A;  1PPD A;  1F2B A;  1DKI A;  2E03 A;  3ZNH A;  3C9E A;  2DZZ A;  5FPW A;  4MM3 B;  1GEC E;  4Q8H A;  4CDD B;  3QSD A;  2YJ9 A;  3U8E A;  1PCI A;  3H89 A;  3K24 A;  1U9X A;  4CDE B;  2G7Y A;  3M99 A;  1KFX L;  1F29 A;  4W4U A;  2YJB A;  3BWK A;  1NPZ A;  3H6S A;  4YYQ A;  3WXE A;  1AU4 A;  4I05 A;  2ATO A;  2OP3 A;  4CDC B;  3IUT A;  3IEJ A;  3RNV A;  2FT2 A;  1QXP A;  1K3B B;  5KO3 A;  2E00 A;  1FH0 A;  1CQD A;  2PAD A;  2FRQ A;  1CB5 A;  1THE A;  4Q8G A;  1F2C A;  4R3D A;  4RNA A;  2BTW A;  3QT4 A;  3B21 A;  2DCC A;  3HHA A;  1CJL A;  1U5I A;  4RF1 A;  4PAD A;  1Y4H A;  3K9M A;  1Q6K A;  1VSN A;  4DMX A;  4D8I A;  2G8E A;  2DC6 A;  1EWP A;  4PI3 A;  3S3Q A;  5JZE A;  1A6R A;  2DC9 A;  3F5V A;  3PW3 A;  3OF8 A;  3O65 A;  4RY2 A;  2VHF A;  1TL9 A;  2B1M A;  2DC7 A;  4ZUX U;  1GMY A;  3PT2 A;  5EZS A;  1PBH A;  3N3G A;  1POP A;  3PRP A;  2DCB A;  1AYU A;  1MEM A;  3PNR A;  3NHE A;  4MZS A;  4XZX A;  1BQI A;  3I3T A;  2HD5 A;  4YYV A;  2DJF B;  2PRE A;  1STF E;  1PPO A;  3IOQ A;  2DC8 A;  2R9N A;  4MSX A;  5JH3 A;  1ME3 A;  4YYS A;  5CHV A;  3BC3 A;  3USV A;  1BY8 A;  2R9M A;  5CVN B;  3TRK A;  2H7J A;  4PP1 A;  2P7U A;  2BTW B;  1ICF A;  2JQG R;  4XR7 A;  1CS8 A;  2G6D A;  2WBF X;  4P16 A;  2C0Y A;  2AUX A;  4WA6 A;  3KWB X;  2IPP B;  3KWZ A;  4MI7 A;  2BDZ A;  1PAD A;  4FIP A;  3BPM A;  3IMA A;  4BPV A;  4BSQ A;  4OW0 A;  3P5W A;  3RVW A;  2O6X A;  1TLO A;  2HXZ A;  3HHI A;  4AXM A;  2Y6E A;  7PCK A;  3H8C A;  4K7C A;  2ACT A;  1ITO A;  4DMY A;  2JRI A;  3BCN A;  3OIS A;  1AU0 A;  2DZY A;  3BY4 A;  3ZUA A;  4N4Z A;  3P5X A;  5CVM A;  2OZ2 A;  2J7Q A;  2OUL A;  3OF9 A;  1YZB A;  2AS8 A;  1PXV A;  1AIM A;  1QMY A;  2JTC A;  2AGA A;  3AI8 A;  3CH3 X;  4W5C A;  2DJG B;  2XU4 A;  4QRG A;  1KHP A;  4PP2 E;  4PT5 A;  3PHX A;  4BS5 A;  4CZW A;  1CVZ A;  3BBA A;  1HUC B;  2YJ8 A;  5EGW A;  1X9Y A;  3P5U A;  2FQ9 A;  2AVW A;  4QBB A;  3WXG A;  4YYU A;  2VHS A;  2JQF R;  1GLO A;  4P6G A;  3OQC A;  3RVX A;  3OVX A;  2DOS A;  5J94 A;  2IBI A;  4HWY A;  3KW9 A;  3GCB A;  1NLJ A;  3O0U A;  4XUI A;  2P0R A;  3D6S A;  3C0R A;  3KX1 A;  3TNX A;  2FTD A;  9PAP A;  2AYO A;  2Z84 A;  2YJ2 A;  4OEL A;  3WXF A;  2G8J A;  2AUZ A;  3MTN A;  1EWM A;  2BDL A;  3MOR A;  1UKF A;  1PVJ A;  2XU5 A;  1M6D A;  1U9V A;  5E6J A;  2GHU A;  1PPP A;  4RF0 A;  3E1Z B;  3N3K A;  1EWL A;  2F1G A;  2NQD B;  4D8E A;  2R9O A;  3CBJ A;  3K8U A;  1MIR A;  3O1G A;  2YJC A;  2FUD A;  4BOZ A;  2XU1 A;  4CDF B;  1NB3 A;  3HD3 A;  3W30 A;  1ZCM A;  4QH6 A;  1BP4 A;  2HH5 A;  2J7Q C;  4HXD B; 
#chains in the Genus database with same CATH homology
 1QDQ A;  1YK7 A;  2FRA A;  1EWO A;  3ERV A;  3KSE A;  3CBK A;  4AXL A;  1BGO A;  4YYW A;  4G54 A;  3F75 A;  4I07 A;  1PE6 A;  2P86 A;  1U9Q X;  5CHT A;  2E01 A;  2NQA A;  3H7D A;  4X6I A;  1MS6 A;  3KKU A;  1U9W A;  4W5B A;  5F02 A;  3B79 A;  1SP4 B;  1SNK A;  1JQP A;  3CH2 X;  5PAD A;  2B1N A;  4N8W A;  2XU3 A;  1XKG A;  2NQI A;  1YK8 A;  2Y5B A;  3LFY A;  1NQC A;  1AYV A;  4X6H A;  3RVV A;  1GCB A;  2DCA A;  1YT7 A;  3DF0 A;  4P6E A;  1YAL A;  1CTE A;  4FJC A;  2HHN A;  3PDF A;  1CPJ A;  3IHP A;  3S3R A;  2GFO A;  1QOL A;  1GX3 A;  3MHH A;  2CIO A;  2PBH A;  1EF7 A;  5JA7 A;  3OVZ A;  3V6E A;  3MHS A;  3BPF A;  4QRV A;  1MHW A;  3IV2 A;  2AYN A;  4KLB A;  1IWD A;  4YYR A;  5A24 A;  2ARY A;  3P5V A;  1O0E A;  1AYW A;  3LXS A;  1CV8 A;  1AU3 A;  4YV8 A;  2AU1 A;  1Y08 A;  3LTW A;  3PBH A;  4MZO A;  2PNS A;  1S4V A;  4X6J A;  2R9F A;  1NB5 A;  1F2A A;  1YVB A;  1PPN A;  1PIP A;  5EF4 A;  4OEM A;  3KFQ A;  1TU6 A;  5K16 A;  5CVO B;  2CB5 A;  2FYE A;  2R6N A;  1DEU A;  3QJ3 A;  2DCD A;  2FO5 A;  4NV7 A;  1KHQ A;  2R9C A;  2F7D A;  3H8B A;  2AIM A;  4FK5 A;  1AEC A;  1ME4 A;  4BQV A;  3V6C A;  1DF0 A;  4QRX A;  4N79 A;  1KXR A;  2E02 A;  4GUZ A;  1ZIV A;  3I06 A;  1KFU L;  1MEG A;  1NL6 A;  2NQG A;  4YVA A;  1AU2 A;  1VJV A;  3BOW A;  8PCH A;  6PAD A;  4BS6 A;  1ATK A;  1CSB B;  3HWN A;  3N4C A;  4I04 A;  1MDW A;  1PPD A;  1F2B A;  2E03 A;  3C9E A;  2DZZ A;  5FPW A;  1GEC E;  4Q8H A;  4CDD B;  3QSD A;  2YJ9 A;  3U8E A;  1PCI A;  3H89 A;  3K24 A;  1U9X A;  4CDE B;  2G7Y A;  4BGF A;  3M99 A;  1KFX L;  1F29 A;  4W4U A;  2YJB A;  3BWK A;  1NPZ A;  3H6S A;  4YYQ A;  3WXE A;  1AU4 A;  4I05 A;  2ATO A;  2OP3 A;  4CDC B;  3IUT A;  3IEJ A;  2FT2 A;  1QXP A;  1E2T A;  1K3B B;  1W4T A;  2E00 A;  1FH0 A;  1W6F A;  1CQD A;  2PAD A;  2FRQ A;  1CB5 A;  1THE A;  4Q8G A;  1F2C A;  3QT4 A;  2DCC A;  3HHA A;  1CJL A;  1U5I A;  4PAD A;  1Y4H A;  3K9M A;  1Q6K A;  1VSN A;  4DMX A;  2G8E A;  2DC6 A;  1EWP A;  4PI3 A;  3S3Q A;  1A6R A;  2DC9 A;  3F5V A;  3PW3 A;  3OF8 A;  4RY2 A;  2VHF A;  1TL9 A;  2B1M A;  2DC7 A;  4ZUX U;  1GMY A;  1W5R A;  1PBH A;  3N3G A;  1POP A;  2DCB A;  1AYU A;  1MEM A;  3PNR A;  3NHE A;  4MZS A;  1BQI A;  3I3T A;  2HD5 A;  4YYV A;  2DJF B;  2PRE A;  1STF E;  1PPO A;  4B55 A;  3IOQ A;  2DC8 A;  2R9N A;  4MSX A;  5JH3 A;  1ME3 A;  4YYS A;  5CHV A;  3BC3 A;  3USV A;  1BY8 A;  2R9M A;  5CVN B;  4NV8 A;  2H7J A;  4PP1 A;  2P7U A;  1ICF A;  2JQG R;  4XR7 A;  1CS8 A;  2G6D A;  2WBF X;  2C0Y A;  2AUX A;  4WA6 A;  3KWB X;  2IPP B;  3KWZ A;  2BDZ A;  1PAD A;  4FIP A;  3BPM A;  3IMA A;  4BPV A;  4BSQ A;  3P5W A;  3RVW A;  2O6X A;  1TLO A;  2HXZ A;  3HHI A;  4AXM A;  2Y6E A;  7PCK A;  3H8C A;  4K7C A;  2ACT A;  1ITO A;  4DMY A;  2BSZ A;  3BCN A;  3OIS A;  1AU0 A;  2DZY A;  3ZUA A;  4N4Z A;  3P5X A;  5CVM A;  2OZ2 A;  2OUL A;  3OF9 A;  4C5P A;  2AS8 A;  1PXV A;  1AIM A;  1QMY A;  3AI8 A;  3CH3 X;  4W5C A;  2DJG B;  2XU4 A;  4QRG A;  1KHP A;  4PP2 E;  4BS5 A;  4CZW A;  1CVZ A;  2VFC A;  1HUC B;  2YJ8 A;  5EGW A;  1X9Y A;  3P5U A;  2FQ9 A;  2AVW A;  4QBB A;  3WXG A;  4YYU A;  2VHS A;  2JQF R;  1GLO A;  4P6G A;  3RVX A;  3OVX A;  5J94 A;  2IBI A;  4HWY A;  3KW9 A;  3GCB A;  1NLJ A;  3O0U A;  4XUI A;  2P0R A;  3D6S A;  3KX1 A;  3TNX A;  2FTD A;  9PAP A;  2AYO A;  2VFB A;  2YJ2 A;  4OEL A;  3WXF A;  2G8J A;  2AUZ A;  3MTN A;  1EWM A;  2BDL A;  3MOR A;  2XU5 A;  1M6D A;  1U9V A;  2GHU A;  1PPP A;  3E1Z B;  3N3K A;  1EWL A;  2F1G A;  2NQD B;  2R9O A;  3CBJ A;  3K8U A;  1MIR A;  3O1G A;  2YJC A;  2FUD A;  2XU1 A;  4CDF B;  1NB3 A;  3HD3 A;  1ZCM A;  4QH6 A;  1BP4 A;  2HH5 A;  3D9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...