3LXSA

Crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (wrr483)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitro and in vivo studies of the trypanocidal properties of WRR-483 against Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
molecule keywords Cruzain
total genus 71
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3lxsA00
1X9YA 4YYVA 2P0RA 4RY2A 4CDEB 4FIPA 2AYOA 5F02A 1VJVA 2E03A 3N4CA 2R6NA 5JA7A 3I06A 2NQDB 1IWDA 3O1GA 3WXGA 2G8EA 4X6HA 3KFQA 2AVWA 4OELA 1ME4A 3HHIA 3S3RA 1NB3A 3BPMA 4X6IA 4I04A 4QRVA 2IBIA 1NLJA 1SP4B 1PCIA 2DCAA 1EWLA 2DCDA 3WXEA 4DMYA 3P5WA 1GECE 1TL9A 4N79A 1ITOA 1EWMA 1CJLA 1JQPA 1PIPA 2B1NA 4XUIA 2BDZA 2Y5BA 1CTEA 2FTDA 2F7DA 3AI8A 3H89A 2VHFA 1QDQA 2DZZA 2ARYA 1AU3A 2AIMA 3O0UA 2R9OA 1MIRA 3CH2X 4ZUXU 4BSQA 3PW3A 4YV8A 2JQFR 4YYUA 3WXFA 1U5IA 4DMXA 2FQ9A 3I3TA 1QOLA 3QT4A 3USVA 3F75A 4CDDB 2R9MA 4MZOA 5JH3A 2DZYA 2FRAA 2ATOA 1U9QX 4Q8GA 3MHSA 4YVAA 2E00A 1PPPA 2YJBA 4MZSA 3HWNA 2GFOA 1AU0A 2PADA 2PNSA 1S4VA 2NQAA 2NQIA 2B1MA 2Y6EA 2NQGA 2DCCA 1EWPA 5K16A 2ACTA 2P7UA 2DCBA 3GCBA 4PP2E 1CVZA 3M99A 3PNRA 3RVWA 1VSNA 3H7DA 1YK8A 4MSXA 1BP4A 1PE6A 5CHVA 7PCKA 4WA6A 1NB5A 2AUXA 2WBFX 4HWYA 1M6DA 1F2BA 1TLOA 1MHWA 3E1ZB 4FK5A 4CZWA 1NQCA 1AECA 3P5XA 2CB5A 1QXPA 2DJFB 2XU4A 4YYQA 2XU1A 2G8JA 3PDFA 4Q8HA 1CQDA 1YT7A 2YJ9A 3OVXA 4W5CA 9PAPA 6PADA 1ICFA 1POPA 2FT2A 4N8WA 5EGWA 1CV8A 2R9NA 1TU6A 1PPDA 3QSDA 4W5BA 8PCHA 4QRXA 4KLBA 1BQIA 4YYRA 1AYVA 2OULA 1NL6A 2AUZA 2DC9A 1F2AA 1AYWA 4FJCA 1ATKA 2H7JA 2YJ2A 3DF0A 1AYUA 2HHNA 3BCNA 3K9MA 4BS6A 4G54A 1GMYA 2DC7A 3QJ3A 3OVZA 1KHPA 1QMYA 1YVBA 1NPZA 3OISA 1DEUA 4CDCB 5CVNB 1Y08A 4YYSA 3U8EA 3MTNA 2GHUA 1ZCMA 1CPJA 1A6RA 4N4ZA 1BGOA 1Y4HA 1ME3A 2DC8A 2IPPB 1U9VA 3MHHA 3H6SA 4CDFB 4PI3A 2C0YA 4BQVA 4AXLA 1F29A 1PPOA 5J94A 3V6CA 3MORA 3KWBX 3H8CA 3BOWA 2FUDA 3K24A 3HD3A 1PBHA 2R9CA 5FPWA 1AU2A 3V6EA 5CHTA 4OEMA 4I05A 1BY8A 2XU5A 3BPFA 2YJ8A 1SNKA 1ZIVA 2E02A 1YALA 5CVOB 2YJCA 1MDWA 3ERVA 4BPVA 1DF0A 3NHEA 2FYEA 1THEA 3IUTA 2JQGR 4QBBA 3ZUAA 1AIMA 1MEGA 2P86A 3IOQA 1EF7A 2HD5A 3KSEA 1GCBA 5EF4A 1PXVA 2OZ2A 3IMAA 3PBHA 1PPNA 2BDLA 3KX1A 1MEMA 1CB5A 3HHAA 1XKGA 3IEJA 4P6EA 2HH5A 2XU3A 2G6DA 1HUCB 4QH6A 2R9FA 3B79A 3IV2A 5PADA 4YYWA 2DC6A 1PADA 4PP1A 2F1GA 2G7YA 2AS8A 2PREA 4X6JA 1KXRA 2CIOA 2AYNA 4BS5A 1U9XA 1STFE 1KHQA 1CS8A 1Q6KA 2DJGB 3F5VA 4W4UA 5CVMA 1U9WA 3TNXA 3RVVA 2FO5A 3S3QA 3BC3A 2AU1A 3H8BA 3D6SA 2E01A 4P6GA 1F2CA 3KWZA 4PADA 3N3GA 4AXMA 3CH3X 1K3BB 3KKUA 3IHPA 3LFYA 1AU4A 3KW9A 3C9EA 1KFUL 2FRQA 2O6XA 3LXSA 5A24A 1EWOA 1O0EA 4XR7A 1KFXL 2OP3A 3OF9A 3CBJA 2PBHA 4K7CA 3RVXA 1MS6A 3CBKA 1FH0A 3P5VA 3OF8A 3BWKA 3P5UA 1GLOA 3K8UA 3N3KA 4QRGA 1YK7A 2VHSA 2HXZA 1CSBB 4I07A
chains in the Genus database with same CATH superfamily
1X9YA 1UKFA 4YYVA 2P0RA 4ZTBA 4RY2A 4CDEB 4FIPA 2AYOA 5F02A 1VJVA 2E03A 3N4CA 2R6NA 5JA7A 3I06A 2NQDB 1IWDA 3O1GA 1PVJA 3E9SA 3WXGA 2G8EA 4BOSA 4X6HA 3KFQA 2AVWA 4OELA 1ME4A 3B21A 3PRMA 3HHIA 3S3RA 1NB3A 3BPMA 3PHXA 4X6IA 4I04A 4QRVA 2IBIA 1NLJA 1SP4B 2J7QC 1PCIA 2DCAA 1EWLA 2DCDA 3WXEA 4DMYA 3P5WA 1GECE 1TL9A 4N79A 1ITOA 1EWMA 1CJLA 1JQPA 1PIPA 2B1NA 4XUIA 2BDZA 2Y5BA 1CTEA 4HXDB 2FTDA 2F7DA 3AI8A 3H89A 2VHFA 1QDQA 2AGAA 5EZQA 2DZZA 2ARYA 4BOUA 4BOQA 1AU3A 4RKXA 2AIMA 3O0UA 2R9OA 1MIRA 3CH2X 4ZUXU 4BSQA 3PW3A 4YV8A 2JQFR 4RF1A 4YYUA 3WXFA 1U5IA 4DMXA 2FQ9A 3I3TA 1DKIA 1QOLA 3QT4A 3USVA 3F75A 4CDDB 2R9MA 2BU3A 4MZOA 5JH3A 4MI7A 3TMPA 2DZYA 2FRAA 2ATOA 1U9QX 4Q8GA 3MHSA 4YVAA 2E00A 4RNAA 1PPPA 2YJBA 4MZSA 3ZNHA 3HWNA 2GFOA 1AU0A 2PADA 2PNSA 1S4VA 2NQAA 2NQIA 2B1MA 4BOPA 2Y6EA 4OVZB 2NQGA 2DCCA 1EWPA 4XZXA 5K16A 2ACTA 2P7UA 2DCBA 3GCBA 4PP2E 1CVZA 3M99A 3PNRA 3RVWA 4OVZA 3TRKA 1VSNA 3H7DA 1YK8A 4MSXA 5JZEA 1BP4A 5KO3A 1PE6A 5CHVA 7PCKA 3W30A 4WA6A 1NB5A 2AUXA 2WBFX 4HWYA 1M6DA 1F2BA 4GUAA 1TLOA 1MHWA 3E1ZB 4FK5A 4CZWA 1NQCA 1AECA 3P5XA 2CB5A 1QXPA 2DJFB 3IFUA 2XU4A 4YYQA 2XU1A 2G8JA 3PDFA 4Q8HA 1CQDA 1YT7A 2YJ9A 3OVXA 4W5CA 9PAPA 2UZJA 4M0WA 6PADA 1ICFA 1POPA 2FT2A 4N8WA 5EGWA 1CV8A 2R9NA 1TU6A 1PPDA 3QSDA 4W5BA 8PCHA 4QRXA 4KLBA 1BQIA 3PHUA 4YYRA 1AYVA 2OULA 1NL6A 2AUZA 2DC9A 1F2AA 1AYWA 4FJCA 1YZBA 1ATKA 2H7JA 2YJ2A 3BB7A 3DF0A 1AYUA 2HHNA 3BCNA 3K9MA 4BS6A 4G54A 1GMYA 2DC7A 3QJ3A 3PHWA 3OVZA 1KHPA 1QMYA 1YVBA 1NPZA 3OISA 1DEUA 4CDCB 5CVNB 1Y08A 4YYSA 3U8EA 3MTNA 2GHUA 1ZCMA 1CPJA 1A6RA 4N4ZA 5EZSA 1BGOA 1Y4HA 1ME3A 2DC8A 2IPPB 3PRPA 3MP2A 1U9VA 4IUMA 2JTCA 3MHHA 3H6SA 4CDFB 3MTVA 4PI3A 2C0YA 4BQVA 4AXLA 1F29A 1PPOA 5J94A 3V6CA 4IP3A 3MORA 3KWBX 3H8CA 4OW0A 3BOWA 2FUDA 3K24A 3PSEA 2FE8A 3HD3A 1PBHA 2R9CA 2JRIA 5FPWA 1AU2A 3V6EA 5CHTA 4OEMA 4I05A 1BY8A 2XU5A 3BPFA 2YJ8A 1SNKA 1ZIVA 2E02A 4D8IA 1YALA 5CVOB 2YJCA 4WURA 1MDWA 4D8BA 3ERVA 4BPVA 3RNVA 1DF0A 3NHEA 2BTWA 2FYEA 1THEA 3IUTA 2JQGR 4QBBA 3ZUAA 1AIMA 1MEGA 2P86A 3IOQA 1EF7A 4REZA 2HD5A 3KSEA 1GCBA 5EF4A 1PXVA 2OZ2A 3IMAA 3BBAA 3PBHA 1PPNA 2BDLA 3KX1A 1MEMA 1CB5A 5E6JA 3HHAA 1XKGA 3IEJA 4P6EA 2HH5A 2XU3A 2G6DA 1HUCB 4QH6A 2R9FA 3B79A 3IV2A 4A5UA 5PADA 4YYWA 2DC6A 4BOZA 1PADA 3MJ5A 4PP1A 2F1GA 2G7YA 3PT2A 2AS8A 2PREA 4X6JA 1KXRA 2CIOA 2Z84A 2AYNA 2HWKA 4BS5A 1U9XA 1STFE 4MM3B 4D8EA 1KHQA 1CS8A 1Q6KA 3BY4A 2DJGB 3F5VA 4W4UA 5CVMA 1U9WA 3TNXA 3W31A 3RVVA 2FO5A 3S3QA 3BC3A 2AU1A 3OQCA 3H8BA 3D6SA 2E01A 4P6GA 1F2CA 4PT5A 3KWZA 4PADA 3N3GA 4AXMA 3CH3X 1K3BB 3KKUA 3IHPA 3O65A 3LFYA 1AU4A 3KW9A 3C9EA 1KFUL 2FRQA 3C0RA 4P16A 2O6XA 3LXSA 5A24A 1EWOA 1O0EA 4XR7A 1KFXL 2OP3A 3OF9A 3CBJA 2PBHA 4K7CA 3RVXA 1MS6A 3CBKA 2DOSA 1FH0A 3P5VA 3OF8A 3BWKA 3P5UA 1GLOA 2J7QA 3K8UA 4R3DA 2BTWB 3N3KA 4QRGA 1YK7A 2VHSA 2HXZA 1CSBB 4I07A 4RF0A
chains in the Genus database with same CATH topology
1X9YA 4YYVA 2P0RA 4RY2A 4CDEB 4FIPA 2AYOA 5F02A 1VJVA 2E03A 3N4CA 2R6NA 5JA7A 3I06A 2NQDB 1IWDA 3O1GA 3WXGA 2G8EA 4X6HA 3KFQA 2AVWA 4OELA 1ME4A 2VFBA 1GX3A 3HHIA 3S3RA 1NB3A 3BPMA 4B55A 3LTWA 4X6IA 4I04A 4QRVA 2IBIA 1NLJA 1W4TA 1SP4B 1PCIA 2DCAA 1EWLA 2DCDA 3WXEA 4DMYA 3P5WA 1GECE 1TL9A 4N79A 1ITOA 1EWMA 1CJLA 1JQPA 1PIPA 2B1NA 4XUIA 2BDZA 2Y5BA 1CTEA 2FTDA 2F7DA 3AI8A 3H89A 2VHFA 1QDQA 2DZZA 2ARYA 1AU3A 2AIMA 3O0UA 2R9OA 1MIRA 3CH2X 4ZUXU 4BSQA 3PW3A 4YV8A 2JQFR 4YYUA 3WXFA 1U5IA 4DMXA 2FQ9A 3I3TA 1QOLA 3QT4A 3USVA 3F75A 4CDDB 2R9MA 4MZOA 5JH3A 2DZYA 2FRAA 2ATOA 1U9QX 4Q8GA 3MHSA 4YVAA 2E00A 1PPPA 2YJBA 4MZSA 3HWNA 2GFOA 1AU0A 2PADA 2PNSA 1S4VA 2NQAA 2NQIA 2B1MA 2Y6EA 2NQGA 2DCCA 1EWPA 5K16A 2ACTA 2P7UA 2DCBA 3GCBA 4PP2E 1CVZA 3M99A 3PNRA 3RVWA 1VSNA 3H7DA 1YK8A 4MSXA 1BP4A 1PE6A 5CHVA 7PCKA 4WA6A 1NB5A 2AUXA 2WBFX 4HWYA 1M6DA 1F2BA 1TLOA 1MHWA 3E1ZB 4FK5A 4CZWA 1NQCA 1AECA 3P5XA 2CB5A 1W6FA 1QXPA 2DJFB 2XU4A 4YYQA 2XU1A 4BGFA 2G8JA 3PDFA 4Q8HA 1CQDA 1YT7A 2YJ9A 3OVXA 4W5CA 9PAPA 6PADA 1ICFA 1POPA 2FT2A 4N8WA 5EGWA 1CV8A 2R9NA 1TU6A 1PPDA 3QSDA 4W5BA 8PCHA 4QRXA 4KLBA 1BQIA 4YYRA 1AYVA 2OULA 1NL6A 2AUZA 2BSZA 2DC9A 1F2AA 1AYWA 4FJCA 1ATKA 4C5PA 2H7JA 2YJ2A 3DF0A 1AYUA 2HHNA 3BCNA 3K9MA 4BS6A 4G54A 1GMYA 2DC7A 3QJ3A 3OVZA 1KHPA 1QMYA 1YVBA 1NPZA 3OISA 1DEUA 4CDCB 5CVNB 1Y08A 4YYSA 3U8EA 3MTNA 2GHUA 1ZCMA 1CPJA 1A6RA 4N4ZA 1BGOA 1Y4HA 1ME3A 4NV8A 2DC8A 2IPPB 3D9WA 1U9VA 3MHHA 3H6SA 4CDFB 4PI3A 2C0YA 4BQVA 4AXLA 1F29A 1PPOA 5J94A 3V6CA 3MORA 3KWBX 3H8CA 3BOWA 1E2TA 2FUDA 3K24A 3HD3A 1PBHA 2R9CA 5FPWA 1AU2A 4NV7A 3V6EA 5CHTA 4OEMA 4I05A 1BY8A 2XU5A 3BPFA 2YJ8A 1SNKA 1ZIVA 2E02A 1YALA 5CVOB 2YJCA 1MDWA 3ERVA 4BPVA 1DF0A 3NHEA 2FYEA 1THEA 3IUTA 2JQGR 4QBBA 3ZUAA 1AIMA 1MEGA 2P86A 3IOQA 1EF7A 2HD5A 3KSEA 1GCBA 4GUZA 5EF4A 1PXVA 2OZ2A 3IMAA 3PBHA 1PPNA 2BDLA 3KX1A 1MEMA 1CB5A 3HHAA 1XKGA 3IEJA 4P6EA 2HH5A 2XU3A 2G6DA 1HUCB 4QH6A 2R9FA 3B79A 3IV2A 5PADA 4YYWA 2DC6A 1PADA 4PP1A 2F1GA 2G7YA 2AS8A 2PREA 4X6JA 1KXRA 2CIOA 2AYNA 4BS5A 1U9XA 2VFCA 1STFE 1W5RA 1KHQA 1CS8A 1Q6KA 2DJGB 3F5VA 4W4UA 5CVMA 1U9WA 3TNXA 3RVVA 2FO5A 3S3QA 3BC3A 2AU1A 3H8BA 3D6SA 2E01A 4P6GA 1F2CA 3KWZA 4PADA 3N3GA 4AXMA 3CH3X 1K3BB 3KKUA 3IHPA 3LFYA 1AU4A 3KW9A 3C9EA 1KFUL 2FRQA 2O6XA 3LXSA 5A24A 1EWOA 1O0EA 4XR7A 1KFXL 2OP3A 3OF9A 3CBJA 2PBHA 4K7CA 3RVXA 1MS6A 3CBKA 1FH0A 3P5VA 3OF8A 3BWKA 3P5UA 1GLOA 3K8UA 3N3KA 4QRGA 1YK7A 2VHSA 2HXZA 1CSBB 4I07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9Y A;  4YYV A;  2P0R A;  4RY2 A;  4CDE B;  4FIP A;  2AYO A;  5F02 A;  1VJV A;  2E03 A;  3N4C A;  2R6N A;  5JA7 A;  3I06 A;  2NQD B;  1IWD A;  3O1G A;  3WXG A;  2G8E A;  4X6H A;  3KFQ A;  2AVW A;  4OEL A;  1ME4 A;  3HHI A;  3S3R A;  1NB3 A;  3BPM A;  4X6I A;  4I04 A;  4QRV A;  2IBI A;  1NLJ A;  1SP4 B;  1PCI A;  2DCA A;  1EWL A;  2DCD A;  3WXE A;  4DMY A;  3P5W A;  1GEC E;  1TL9 A;  4N79 A;  1ITO A;  1EWM A;  1CJL A;  1JQP A;  1PIP A;  2B1N A;  4XUI A;  2BDZ A;  2Y5B A;  1CTE A;  2FTD A;  2F7D A;  3AI8 A;  3H89 A;  2VHF A;  1QDQ A;  2DZZ A;  2ARY A;  1AU3 A;  2AIM A;  3O0U A;  2R9O A;  1MIR A;  3CH2 X;  4ZUX U;  4BSQ A;  3PW3 A;  4YV8 A;  2JQF R;  4YYU A;  3WXF A;  1U5I A;  4DMX A;  2FQ9 A;  3I3T A;  1QOL A;  3QT4 A;  3USV A;  3F75 A;  4CDD B;  2R9M A;  4MZO A;  5JH3 A;  2DZY A;  2FRA A;  2ATO A;  1U9Q X;  4Q8G A;  3MHS A;  4YVA A;  2E00 A;  1PPP A;  2YJB A;  4MZS A;  3HWN A;  2GFO A;  1AU0 A;  2PAD A;  2PNS A;  1S4V A;  2NQA A;  2NQI A;  2B1M A;  2Y6E A;  2NQG A;  2DCC A;  1EWP A;  5K16 A;  2ACT A;  2P7U A;  2DCB A;  3GCB A;  4PP2 E;  1CVZ A;  3M99 A;  3PNR A;  3RVW A;  1VSN A;  3H7D A;  1YK8 A;  4MSX A;  1BP4 A;  1PE6 A;  5CHV A;  7PCK A;  4WA6 A;  1NB5 A;  2AUX A;  2WBF X;  4HWY A;  1M6D A;  1F2B A;  1TLO A;  1MHW A;  3E1Z B;  4FK5 A;  4CZW A;  1NQC A;  1AEC A;  3P5X A;  2CB5 A;  1QXP A;  2DJF B;  2XU4 A;  4YYQ A;  2XU1 A;  2G8J A;  3PDF A;  4Q8H A;  1CQD A;  1YT7 A;  2YJ9 A;  3OVX A;  4W5C A;  9PAP A;  6PAD A;  1ICF A;  1POP A;  2FT2 A;  4N8W A;  5EGW A;  1CV8 A;  2R9N A;  1TU6 A;  1PPD A;  3QSD A;  4W5B A;  8PCH A;  4QRX A;  4KLB A;  1BQI A;  4YYR A;  1AYV A;  2OUL A;  1NL6 A;  2AUZ A;  2DC9 A;  1F2A A;  1AYW A;  4FJC A;  1ATK A;  2H7J A;  2YJ2 A;  3DF0 A;  1AYU A;  2HHN A;  3BCN A;  3K9M A;  4BS6 A;  4G54 A;  1GMY A;  2DC7 A;  3QJ3 A;  3OVZ A;  1KHP A;  1QMY A;  1YVB A;  1NPZ A;  3OIS A;  1DEU A;  4CDC B;  5CVN B;  1Y08 A;  4YYS A;  3U8E A;  3MTN A;  2GHU A;  1ZCM A;  1CPJ A;  1A6R A;  4N4Z A;  1BGO A;  1Y4H A;  1ME3 A;  2DC8 A;  2IPP B;  1U9V A;  3MHH A;  3H6S A;  4CDF B;  4PI3 A;  2C0Y A;  4BQV A;  4AXL A;  1F29 A;  1PPO A;  5J94 A;  3V6C A;  3MOR A;  3KWB X;  3H8C A;  3BOW A;  2FUD A;  3K24 A;  3HD3 A;  1PBH A;  2R9C A;  5FPW A;  1AU2 A;  3V6E A;  5CHT A;  4OEM A;  4I05 A;  1BY8 A;  2XU5 A;  3BPF A;  2YJ8 A;  1SNK A;  1ZIV A;  2E02 A;  1YAL A;  5CVO B;  2YJC A;  1MDW A;  3ERV A;  4BPV A;  1DF0 A;  3NHE A;  2FYE A;  1THE A;  3IUT A;  2JQG R;  4QBB A;  3ZUA A;  1AIM A;  1MEG A;  2P86 A;  3IOQ A;  1EF7 A;  2HD5 A;  3KSE A;  1GCB A;  5EF4 A;  1PXV A;  2OZ2 A;  3IMA A;  3PBH A;  1PPN A;  2BDL A;  3KX1 A;  1MEM A;  1CB5 A;  3HHA A;  1XKG A;  3IEJ A;  4P6E A;  2HH5 A;  2XU3 A;  2G6D A;  1HUC B;  4QH6 A;  2R9F A;  3B79 A;  3IV2 A;  5PAD A;  4YYW A;  2DC6 A;  1PAD A;  4PP1 A;  2F1G A;  2G7Y A;  2AS8 A;  2PRE A;  4X6J A;  1KXR A;  2CIO A;  2AYN A;  4BS5 A;  1U9X A;  1STF E;  1KHQ A;  1CS8 A;  1Q6K A;  2DJG B;  3F5V A;  4W4U A;  5CVM A;  1U9W A;  3TNX A;  3RVV A;  2FO5 A;  3S3Q A;  3BC3 A;  2AU1 A;  3H8B A;  3D6S A;  2E01 A;  4P6G A;  1F2C A;  3KWZ A;  4PAD A;  3N3G A;  4AXM A;  3CH3 X;  1K3B B;  3KKU A;  3IHP A;  3LFY A;  1AU4 A;  3KW9 A;  3C9E A;  1KFU L;  2FRQ A;  2O6X A;  3LXS A;  5A24 A;  1EWO A;  1O0E A;  4XR7 A;  1KFX L;  2OP3 A;  3OF9 A;  3CBJ A;  2PBH A;  4K7C A;  3RVX A;  1MS6 A;  3CBK A;  1FH0 A;  3P5V A;  3OF8 A;  3BWK A;  3P5U A;  1GLO A;  3K8U A;  3N3K A;  4QRG A;  1YK7 A;  2VHS A;  2HXZ A;  1CSB B;  4I07 A; 
#chains in the Genus database with same CATH topology
 1X9Y A;  1UKF A;  4YYV A;  2P0R A;  4ZTB A;  4RY2 A;  4CDE B;  4FIP A;  2AYO A;  5F02 A;  1VJV A;  2E03 A;  3N4C A;  2R6N A;  5JA7 A;  3I06 A;  2NQD B;  1IWD A;  3O1G A;  1PVJ A;  3E9S A;  3WXG A;  2G8E A;  4BOS A;  4X6H A;  3KFQ A;  2AVW A;  4OEL A;  1ME4 A;  3B21 A;  3PRM A;  3HHI A;  3S3R A;  1NB3 A;  3BPM A;  3PHX A;  4X6I A;  4I04 A;  4QRV A;  2IBI A;  1NLJ A;  1SP4 B;  2J7Q C;  1PCI A;  2DCA A;  1EWL A;  2DCD A;  3WXE A;  4DMY A;  3P5W A;  1GEC E;  1TL9 A;  4N79 A;  1ITO A;  1EWM A;  1CJL A;  1JQP A;  1PIP A;  2B1N A;  4XUI A;  2BDZ A;  2Y5B A;  1CTE A;  4HXD B;  2FTD A;  2F7D A;  3AI8 A;  3H89 A;  2VHF A;  1QDQ A;  2AGA A;  5EZQ A;  2DZZ A;  2ARY A;  4BOU A;  4BOQ A;  1AU3 A;  4RKX A;  2AIM A;  3O0U A;  2R9O A;  1MIR A;  3CH2 X;  4ZUX U;  4BSQ A;  3PW3 A;  4YV8 A;  2JQF R;  4RF1 A;  4YYU A;  3WXF A;  1U5I A;  4DMX A;  2FQ9 A;  3I3T A;  1DKI A;  1QOL A;  3QT4 A;  3USV A;  3F75 A;  4CDD B;  2R9M A;  2BU3 A;  4MZO A;  5JH3 A;  4MI7 A;  3TMP A;  2DZY A;  2FRA A;  2ATO A;  1U9Q X;  4Q8G A;  3MHS A;  4YVA A;  2E00 A;  4RNA A;  1PPP A;  2YJB A;  4MZS A;  3ZNH A;  3HWN A;  2GFO A;  1AU0 A;  2PAD A;  2PNS A;  1S4V A;  2NQA A;  2NQI A;  2B1M A;  4BOP A;  2Y6E A;  4OVZ B;  2NQG A;  2DCC A;  1EWP A;  4XZX A;  5K16 A;  2ACT A;  2P7U A;  2DCB A;  3GCB A;  4PP2 E;  1CVZ A;  3M99 A;  3PNR A;  3RVW A;  4OVZ A;  3TRK A;  1VSN A;  3H7D A;  1YK8 A;  4MSX A;  5JZE A;  1BP4 A;  5KO3 A;  1PE6 A;  5CHV A;  7PCK A;  3W30 A;  4WA6 A;  1NB5 A;  2AUX A;  2WBF X;  4HWY A;  1M6D A;  1F2B A;  4GUA A;  1TLO A;  1MHW A;  3E1Z B;  4FK5 A;  4CZW A;  1NQC A;  1AEC A;  3P5X A;  2CB5 A;  1QXP A;  2DJF B;  3IFU A;  2XU4 A;  4YYQ A;  2XU1 A;  2G8J A;  3PDF A;  4Q8H A;  1CQD A;  1YT7 A;  2YJ9 A;  3OVX A;  4W5C A;  9PAP A;  2UZJ A;  4M0W A;  6PAD A;  1ICF A;  1POP A;  2FT2 A;  4N8W A;  5EGW A;  1CV8 A;  2R9N A;  1TU6 A;  1PPD A;  3QSD A;  4W5B A;  8PCH A;  4QRX A;  4KLB A;  1BQI A;  3PHU A;  4YYR A;  1AYV A;  2OUL A;  1NL6 A;  2AUZ A;  2DC9 A;  1F2A A;  1AYW A;  4FJC A;  1YZB A;  1ATK A;  2H7J A;  2YJ2 A;  3BB7 A;  3DF0 A;  1AYU A;  2HHN A;  3BCN A;  3K9M A;  4BS6 A;  4G54 A;  1GMY A;  2DC7 A;  3QJ3 A;  3PHW A;  3OVZ A;  1KHP A;  1QMY A;  1YVB A;  1NPZ A;  3OIS A;  1DEU A;  4CDC B;  5CVN B;  1Y08 A;  4YYS A;  3U8E A;  3MTN A;  2GHU A;  1ZCM A;  1CPJ A;  1A6R A;  4N4Z A;  5EZS A;  1BGO A;  1Y4H A;  1ME3 A;  2DC8 A;  2IPP B;  3PRP A;  3MP2 A;  1U9V A;  4IUM A;  2JTC A;  3MHH A;  3H6S A;  4CDF B;  3MTV A;  4PI3 A;  2C0Y A;  4BQV A;  4AXL A;  1F29 A;  1PPO A;  5J94 A;  3V6C A;  4IP3 A;  3MOR A;  3KWB X;  3H8C A;  4OW0 A;  3BOW A;  2FUD A;  3K24 A;  3PSE A;  2FE8 A;  3HD3 A;  1PBH A;  2R9C A;  2JRI A;  5FPW A;  1AU2 A;  3V6E A;  5CHT A;  4OEM A;  4I05 A;  1BY8 A;  2XU5 A;  3BPF A;  2YJ8 A;  1SNK A;  1ZIV A;  2E02 A;  4D8I A;  1YAL A;  5CVO B;  2YJC A;  4WUR A;  1MDW A;  4D8B A;  3ERV A;  4BPV A;  3RNV A;  1DF0 A;  3NHE A;  2BTW A;  2FYE A;  1THE A;  3IUT A;  2JQG R;  4QBB A;  3ZUA A;  1AIM A;  1MEG A;  2P86 A;  3IOQ A;  1EF7 A;  4REZ A;  2HD5 A;  3KSE A;  1GCB A;  5EF4 A;  1PXV A;  2OZ2 A;  3IMA A;  3BBA A;  3PBH A;  1PPN A;  2BDL A;  3KX1 A;  1MEM A;  1CB5 A;  5E6J A;  3HHA A;  1XKG A;  3IEJ A;  4P6E A;  2HH5 A;  2XU3 A;  2G6D A;  1HUC B;  4QH6 A;  2R9F A;  3B79 A;  3IV2 A;  4A5U A;  5PAD A;  4YYW A;  2DC6 A;  4BOZ A;  1PAD A;  3MJ5 A;  4PP1 A;  2F1G A;  2G7Y A;  3PT2 A;  2AS8 A;  2PRE A;  4X6J A;  1KXR A;  2CIO A;  2Z84 A;  2AYN A;  2HWK A;  4BS5 A;  1U9X A;  1STF E;  4MM3 B;  4D8E A;  1KHQ A;  1CS8 A;  1Q6K A;  3BY4 A;  2DJG B;  3F5V A;  4W4U A;  5CVM A;  1U9W A;  3TNX A;  3W31 A;  3RVV A;  2FO5 A;  3S3Q A;  3BC3 A;  2AU1 A;  3OQC A;  3H8B A;  3D6S A;  2E01 A;  4P6G A;  1F2C A;  4PT5 A;  3KWZ A;  4PAD A;  3N3G A;  4AXM A;  3CH3 X;  1K3B B;  3KKU A;  3IHP A;  3O65 A;  3LFY A;  1AU4 A;  3KW9 A;  3C9E A;  1KFU L;  2FRQ A;  3C0R A;  4P16 A;  2O6X A;  3LXS A;  5A24 A;  1EWO A;  1O0E A;  4XR7 A;  1KFX L;  2OP3 A;  3OF9 A;  3CBJ A;  2PBH A;  4K7C A;  3RVX A;  1MS6 A;  3CBK A;  2DOS A;  1FH0 A;  3P5V A;  3OF8 A;  3BWK A;  3P5U A;  1GLO A;  2J7Q A;  3K8U A;  4R3D A;  2BTW B;  3N3K A;  4QRG A;  1YK7 A;  2VHS A;  2HXZ A;  1CSB B;  4I07 A;  4RF0 A; 
#chains in the Genus database with same CATH homology
 1X9Y A;  4YYV A;  2P0R A;  4RY2 A;  4CDE B;  4FIP A;  2AYO A;  5F02 A;  1VJV A;  2E03 A;  3N4C A;  2R6N A;  5JA7 A;  3I06 A;  2NQD B;  1IWD A;  3O1G A;  3WXG A;  2G8E A;  4X6H A;  3KFQ A;  2AVW A;  4OEL A;  1ME4 A;  2VFB A;  1GX3 A;  3HHI A;  3S3R A;  1NB3 A;  3BPM A;  4B55 A;  3LTW A;  4X6I A;  4I04 A;  4QRV A;  2IBI A;  1NLJ A;  1W4T A;  1SP4 B;  1PCI A;  2DCA A;  1EWL A;  2DCD A;  3WXE A;  4DMY A;  3P5W A;  1GEC E;  1TL9 A;  4N79 A;  1ITO A;  1EWM A;  1CJL A;  1JQP A;  1PIP A;  2B1N A;  4XUI A;  2BDZ A;  2Y5B A;  1CTE A;  2FTD A;  2F7D A;  3AI8 A;  3H89 A;  2VHF A;  1QDQ A;  2DZZ A;  2ARY A;  1AU3 A;  2AIM A;  3O0U A;  2R9O A;  1MIR A;  3CH2 X;  4ZUX U;  4BSQ A;  3PW3 A;  4YV8 A;  2JQF R;  4YYU A;  3WXF A;  1U5I A;  4DMX A;  2FQ9 A;  3I3T A;  1QOL A;  3QT4 A;  3USV A;  3F75 A;  4CDD B;  2R9M A;  4MZO A;  5JH3 A;  2DZY A;  2FRA A;  2ATO A;  1U9Q X;  4Q8G A;  3MHS A;  4YVA A;  2E00 A;  1PPP A;  2YJB A;  4MZS A;  3HWN A;  2GFO A;  1AU0 A;  2PAD A;  2PNS A;  1S4V A;  2NQA A;  2NQI A;  2B1M A;  2Y6E A;  2NQG A;  2DCC A;  1EWP A;  5K16 A;  2ACT A;  2P7U A;  2DCB A;  3GCB A;  4PP2 E;  1CVZ A;  3M99 A;  3PNR A;  3RVW A;  1VSN A;  3H7D A;  1YK8 A;  4MSX A;  1BP4 A;  1PE6 A;  5CHV A;  7PCK A;  4WA6 A;  1NB5 A;  2AUX A;  2WBF X;  4HWY A;  1M6D A;  1F2B A;  1TLO A;  1MHW A;  3E1Z B;  4FK5 A;  4CZW A;  1NQC A;  1AEC A;  3P5X A;  2CB5 A;  1W6F A;  1QXP A;  2DJF B;  2XU4 A;  4YYQ A;  2XU1 A;  4BGF A;  2G8J A;  3PDF A;  4Q8H A;  1CQD A;  1YT7 A;  2YJ9 A;  3OVX A;  4W5C A;  9PAP A;  6PAD A;  1ICF A;  1POP A;  2FT2 A;  4N8W A;  5EGW A;  1CV8 A;  2R9N A;  1TU6 A;  1PPD A;  3QSD A;  4W5B A;  8PCH A;  4QRX A;  4KLB A;  1BQI A;  4YYR A;  1AYV A;  2OUL A;  1NL6 A;  2AUZ A;  2BSZ A;  2DC9 A;  1F2A A;  1AYW A;  4FJC A;  1ATK A;  4C5P A;  2H7J A;  2YJ2 A;  3DF0 A;  1AYU A;  2HHN A;  3BCN A;  3K9M A;  4BS6 A;  4G54 A;  1GMY A;  2DC7 A;  3QJ3 A;  3OVZ A;  1KHP A;  1QMY A;  1YVB A;  1NPZ A;  3OIS A;  1DEU A;  4CDC B;  5CVN B;  1Y08 A;  4YYS A;  3U8E A;  3MTN A;  2GHU A;  1ZCM A;  1CPJ A;  1A6R A;  4N4Z A;  1BGO A;  1Y4H A;  1ME3 A;  4NV8 A;  2DC8 A;  2IPP B;  3D9W A;  1U9V A;  3MHH A;  3H6S A;  4CDF B;  4PI3 A;  2C0Y A;  4BQV A;  4AXL A;  1F29 A;  1PPO A;  5J94 A;  3V6C A;  3MOR A;  3KWB X;  3H8C A;  3BOW A;  1E2T A;  2FUD A;  3K24 A;  3HD3 A;  1PBH A;  2R9C A;  5FPW A;  1AU2 A;  4NV7 A;  3V6E A;  5CHT A;  4OEM A;  4I05 A;  1BY8 A;  2XU5 A;  3BPF A;  2YJ8 A;  1SNK A;  1ZIV A;  2E02 A;  1YAL A;  5CVO B;  2YJC A;  1MDW A;  3ERV A;  4BPV A;  1DF0 A;  3NHE A;  2FYE A;  1THE A;  3IUT A;  2JQG R;  4QBB A;  3ZUA A;  1AIM A;  1MEG A;  2P86 A;  3IOQ A;  1EF7 A;  2HD5 A;  3KSE A;  1GCB A;  4GUZ A;  5EF4 A;  1PXV A;  2OZ2 A;  3IMA A;  3PBH A;  1PPN A;  2BDL A;  3KX1 A;  1MEM A;  1CB5 A;  3HHA A;  1XKG A;  3IEJ A;  4P6E A;  2HH5 A;  2XU3 A;  2G6D A;  1HUC B;  4QH6 A;  2R9F A;  3B79 A;  3IV2 A;  5PAD A;  4YYW A;  2DC6 A;  1PAD A;  4PP1 A;  2F1G A;  2G7Y A;  2AS8 A;  2PRE A;  4X6J A;  1KXR A;  2CIO A;  2AYN A;  4BS5 A;  1U9X A;  2VFC A;  1STF E;  1W5R A;  1KHQ A;  1CS8 A;  1Q6K A;  2DJG B;  3F5V A;  4W4U A;  5CVM A;  1U9W A;  3TNX A;  3RVV A;  2FO5 A;  3S3Q A;  3BC3 A;  2AU1 A;  3H8B A;  3D6S A;  2E01 A;  4P6G A;  1F2C A;  3KWZ A;  4PAD A;  3N3G A;  4AXM A;  3CH3 X;  1K3B B;  3KKU A;  3IHP A;  3LFY A;  1AU4 A;  3KW9 A;  3C9E A;  1KFU L;  2FRQ A;  2O6X A;  3LXS A;  5A24 A;  1EWO A;  1O0E A;  4XR7 A;  1KFX L;  2OP3 A;  3OF9 A;  3CBJ A;  2PBH A;  4K7C A;  3RVX A;  1MS6 A;  3CBK A;  1FH0 A;  3P5V A;  3OF8 A;  3BWK A;  3P5U A;  1GLO A;  3K8U A;  3N3K A;  4QRG A;  1YK7 A;  2VHS A;  2HXZ A;  1CSB B;  4I07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...