3LXTA

Crystal structure of glutathione s transferase from pseudomonas fluorescens
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
204
structure length
204
Chain Sequence
b'SLKLIGMLDSPYVRRVAISLKSLGLPFEHHSLSVFSTFEQFKAINPVVKAPTLVCEGGEVLMDSSLIIDYLETLAGPQRSLMPTALPQRLRELRLVGLALAACEKSVQIVYERNLRPAEKQHGPWLERVGGQLQAAYGELEQELQKQPLPRDGSLGQAGISLAVAWSFSQMMVADQFNPGQFPAVRGFAEYAEQLPVFLATPAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S Transferase
publication title Crystal structure of Glutathione S Transferase from Pseudomonas fluorescens
rcsb
source organism Pseudomonas fluorescens
molecule tags Transferase
total genus 69
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3lxtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lxtA01
1J0FA 4HJ2A 2OE1A 1IYHA 4AJ7A 4EVMA 3TKSA 4K0NA 5CRHA 5B7CA 4O7HA 2L5LA 3FRCA 2H70A 3KCMA 3C1SA 3TJKA 5ELAA 2MMAA 5CNWA 2DMMA 4LL4B 4K6XA 4OFNA 2LSTA 5EVOA 5B8AA 2AUVA 2YCDA 2O89A 4FH8A 2VL2A 1FG4A 1QQ2A 2BTOT 4TKYA 1YJ6A 1Z7PA 2R2JA 3F0IA 3O6TA 4BWSA 4L5LA 1G6WA 4O92A 5IMFA 2HRAA 4KSMA 4X0XA 4XRDA 1M2AA 3HYPA 2XHFA 3GMFA 1WE0A 2MBSA 2AHEA 2OJLA 3ZFBA 3IC4A 3IHQA 1TRVA 2VIMA 3CSIA 2R6KA 3C7MA 4GSNA 4Q5QA 2HNLA 3R3EA 2KLXA 5HFGA 1OC9A 3UBLA 4N10A 5IMZA 4HU9A 1M9AA 1PD21 1JFUA 4N11A 1G7EA 4F9ZA 3CRTA 3IOSA 2E0QA 3QPMA 2GVPA 2ON7A 1XCCA 3TJBA 2HZFA 3DMLA 3N9JA 1G0TA 1X5CA 3HDCA 4OFTA 2CAIA 1TP9A 1EOHA 1JLWA 2H1AA 4WBJA 4GWRA 5AIXA 1BYEA 2XC2A 5F07A 3GIXA 3APOA 3G7JA 1EP7A 2MMOA 1SKRB 2KUCA 1OKTA 4MP4A 2HRKA 1VRSD 4MCUA 4EF0A 3TRQA 1IYIA 6GSWA 2QSIA 3EYTA 2HSMA 4IQAA 1XWGA 2B1LA 1PKWA 2XBQA 3QMXA 1KTEA 5ECNB 1F2EA 2JU5A 3F6DA 4PX1A 4RI7A 2K18A 1SENA 2CZ3A 2IN3A 16GSA 1W4VA 5JCUA 2F9SA 3TKQA 5JCGA 2Z9SA 4ULXA 4BVXB 2CVKA 4G0IA 3QAVA 5B8BA 1A2LA 5JWRB 1XVWA 2IPAA 1XIYA 1GNWA 3M1GA 1F6MC 5C00A 1SK1A 2KOKA 3EVIA 3ZRDA 3PH9A 5GSSA 4ZL9A 3ME8A 1GNEA 1PKZA 4IP1A 4KE3A 4POBA 5ECMB 1OC3A 4RQRA 4K7NA 2GQMA 1T8EB 1R4WA 3IAS2 3VPQA 3UEMA 1GP1A 2IFQB 4ZBAA 3M3MA 3KJYA 2CX4A 1F3BA 5DALB 1SL1B 4KSOA 5KN2A 2V32A 2HXKA 3R2QA 3RDWA 2PUKC 1BEDA 2BMXA 1PRXA 2ON5A 5DJLA 1JZRA 3FYGA 2VM1A 5AGYA 4POMA 1H75A 4PXOA 3A2VA 2PN8A 2YWOA 4ZL7A 3MDKA 1YY7A 1ERVA 1LJRA 2WCIA 3UJ1A 2K9FA 3TOUA 2RM6A 1THXA 1X5DA 4OFMA 5GSTA 2I3YA 6GSXA 3I69A 5IPGA 2GQLA 4ZIJA 3QAGA 2L57A 2DIZA 3IAM2 1Z5YE 2O85A 4MA9A 3TKSE 5LD0A 3L78A 4H86A 3H1NA 2L6DA 4F0BA 4NAXA 2YPMA 1SJZA 1X0RA 1ERWA 2X8HA 3LWAA 2P31A 3Q6OA 3TJFA 1XOBA 1V57A 1XZOA 1S3CA 4DSRA 4O5RA 4NV2A 4J56E 1O81A 3QFBC 5HFKA 5IOXA 1VF4A 5G1KA 5J3RA 3L4NA 4IELA 2GZYA 4BVXA 3UMAA 2KP2A 3ZTLA 2VL2C 2GSQA 4I97A 4EDYA 4ZILA 1PX6A 1JZWA 4NXIA 4L8EA 3GSTA 2HE3A 2K8VA 2R5GA 2JSYA 1GULA 5AN1A 2I9HA 2RIIA 4QL9A 2DJ2A 5B6MA 4XS6A 3P90A 4ML1A 4J2FA 3FKFA 2R4VA 1PL2A 2IMEA 3Q74A 2IFQA 1AW9A 2RUFA 2FA4A 3LEFA 5DALA 4NWYA 3HXSA 1YEXA 2LNSA 4MZWA 3F4TA 3TKRA 1NW2A 3HKRA 3EU4A 4PQIA 3F3RA 2V1MA 4TR1A 2VLUA 5EL8A 5IPHA 3DYRA 5HQPA 2TIRA 1EGRA 2WB9A 4WETA 5GAPD 1HYUA 5IMCA 2H1DA 4K8MA 4PUFC 2PVOC 3FW2A 3GTUB 2LTKA 5IMAA 1HQOA 1ZOFA 3TKPA 2E7PA 3IXRA 3P8WA 2YWIA 1GUHA 2H19A 4X1UA 5C04A 4DSQA 4IS0A 1R7HA 1QFNA 5CYYA 2FUG2 1M99A 2DSAA 1Z6NA 4FQUA 1XWCA 1C72A 1O73A 3UARA 5D9WA 5LNKe 2VD0A 2RLIA 4I6XA 1GTUA 3LORA 2B7JA 3K8NA 3KP9A 1SD9A 3F6FA 2P0GA 2LV3A 3I9V2 1DUGA 2D2ZA 3IRAA 1R26A 3GH9A 1G7OA 8GSSA 3H8QA 3VWWA 4Q5FA 3GKXA 1KBNA 2H71A 1QK8A 2GQKA 1N8JA 5JWQB 2ES7A 2GT6A 1FO5A 1VF1A 1YKCA 1AQWA 4AF2A 3KH7A 4IGJA 3ZZXA 4XS4B 1K0NA 1TRUA 1TI3A 3A2WA 2OACA 1PQNA 2OBIA 3A3TA 4TR3A 3O3TA 3FHKA 1TI1A 2H75A 4HOJA 2IMDA 2EIOA 4KH7A 1A2MA 2F8AA 4NV5A 2J9HA 2MBTA 3NZNA 4ILFA 2L59A 3GH6A 2DC5A 4MJBA 4TRXA 3ED3A 3HHVA 2PERA 1SD8A 1TW9A 4GCIA 4EKZA 1XW5A 1FOVA 2C0DA 4MJCA 1G6YA 1WRYA 4RI6A 3RBTA 1LU4A 4WF4A 1CQGA 3UOMA 4NHZA 18GSA 4TXVA 2HSHA 4DEJA 5CRWA 3VWUA 2NVLA 2AB6A 1YKAA 2IMIA 1GH2A 2C3NA 5DVBA 3ZMLA 4IBPA 4ZXGA 4XCSA 2PU9C 1V2AA 1GSEA 5JWOB 3C73A 2H66A 1Z6MA 4WR5A 4E8HA 4TR4A 4F0CA 1Y6EA 3CSJA 3VPTA 2B6MA 4HU7A 5HR0A 1S3AA 2VD1A 2CQ9A 2YP6A 3F9UA 3GTUA 1XW6A 4F2IA 4ECBA 3QAWA 4MPFA 3P2AA 4LMVA 2YV7A 2H76A 3ERFA 1TKDB 3RPPA 1TOFA 4ID0A 3DIEA 2V6KA 3IR4A 2MMZA 5LCZA 3UIWA 2DJ0A 3IA1A 2JSZA 4XHMA 1T00A 4NPBA 4FYBA 2C3QA 5ECIB 1OYJA 1U3AA 3H79A 1U6TA 3F8UA 1MD3A 4GSTA 5KEJA 2O7KA 3KMNA 4MH3A 4JRRA 2FY6A 3MAKA 3E9JB 5L71A 2MMNA 4K7OA 3ZIJA 2LKUA 5A4VA 4CW9A 1GTBA 1PMTA 5IMDA 4G0LA 4F82A 1H4OA 3I6AA 1QUWA 2G2QA 2WFCA 1A8YA 3L9UA 2N5FA 4Z7XA 2JACA 4CDOA 4RUVA 3W6GA 1QMVA 3EINA 1GSYA 2O8VB 1USBA 2OE0A 3DWVA 4XS4A 2M46A 3WT1A 3D4TA 3BD2A 5HR2A 3N5OA 2BJXA 4K2DA 3WGDA 3Q19A 19GSA 1GTAA 3MSZA 3VFIA 2LJRA 1I5GA 4ZB6A 3TJGA 2GSTA 3J7Yb 1U3IA 2PPTA 1YZXA 3WT2A 1SK0A 4BVYB 2HQTA 2VCTA 4QL7A 3UAPA 1XFLA 1LBKA 1FVJA 4YAPA 3BCIA 3DVXA 1GUMA 4KW6A 1ERTA 1B8XA 1V40A 2FNOA 4MF5A 4AGSA 4MDCA 1OC8A 1NHOA 3HVSA 1E2YA 22GSA 1TU8A 2PWJA 2KHPA 1PL1A 3HA9A 3KXOA 1GSFA 2LS5A 4L5OA 3DEXA 1J9BA 2GZZA 3QOUA 3LGCA 1M9BA 5EPFA 4IJIA 2GSSA 2CT6A 5G2ZA 1ACVA 4N0VA 1NM3A 2R3XA 5DQSA 1TXXA 1KNGA 1RK4A 1ZGNA 1UVZA 1ERUA 1O8XA 3GKNA 1F3AA 3GKKA 5F0GA 5J5NA 2X8GA 3UBKA 3KP8A 1YEPA 5ECOB 1U88A 1AAZA 5A4WA 4LL1B 3HZ4A 4EUYA 2HT9A 2OKAA 1YQ1A 4POLA 4GLTA 1PN9A 2H6YA 2FHEA 5CRDA 1FHEA 4ZB9A 3LQ7A 3ZLPA 3KMOA 2AJQB 4MH2A 4V1Ap 3VWVA 5A5KA 5F8BA 2HSYA 3GA4A 4F03A 2NDOA 2GT5A 2WULA 1K0AA 4YH2A 3IV4A 2P5RA 3KD0A 3UVTA 3DKSA 2LJAA 3GV1A 4V2LA 3M9JA 3E3EA 4L0WA 2IIYA 1EGOA 4FIWA 4IKHA 3US3A 4Q5NA 20GSA 4FO5A 4HDEA 4OMVA 2VL3A 4MJEA 3ME7A 2A2SA 1FVKA 3A5WA 4HJMA 3EU3A 14GSA 3PINA 2FA8A 2JADA 4HQZA 10GSA 5DCGA 5A4UA 1Z9HA 4WKWA 1JZOA 3VI5A 1SYRA 2VCQA 3TGZA 1R5PA 4EXJA 4BVYA 4IHUA 5CREA 1O6JA 1DE2A 1HNCA 4KAEA 1XOAA 2DJKA 4WXTA 3TKSC 3TCOA 1TK0B 3Q18A 2ZUPA 4PTSA 3IK7A 2JZRA 2E2GA 5B6NA 3FZ9A 2H01A 3L9SA 4I5QA 5J4UA 2IMFA 3HVXA 3KM6A 2ALBA 4POKA 5D9VA 3DRNA 4J57E 1TDIA 4KDXA 4MF6A 1T7PB 2L5OA 4YQMA 4AJ8A 4ISDA 1MDKA 5ELGA 1NSWA 2GTUA 3EMXA 4MPGA 1URMA 3DD3A 2I4AA 5FT3A 1K3YA 1RQMA 1B9XC 1K0OA 3FR9A 2E2MA 1PA3A 3ISOA 2GGTA 1O7UA 4HQSA 3O76A 2VCXA 2FCHA 4IP6A 3EE2A 4IW9A 2H74A 4BPYA 3LJRA 4XIHA 2XPEA 5IM9A 2LJKA 3RPNA 4LMWA 3D4MA 3ZITA 2GLRA 1S3DA 3GN3A 5F05A 1A2JA 4FYUA 3GYKA 5ID2B 1O8WA 1M2BA 1ST9A 3HZ8A 3GKMA 3GNJA 1GUKA 4ECCA 2HLSA 3HD5A 4USSA 3GX0A 3M8NA 3ERWA 5DDLA 3APSA 1F37A 1QXHA 3IBHA 1PSQA 3H4KA 1HD2A 3G7YA 1MD4A 5G31A 2LRTA 4ECJA 2C0EA 1ABAA 2A2RA 3CXGA 1EEMA 4WBRD 2G0FA 2OE3A 3GX8A 2F8FA 1VF3A 2F51A 2QGVA 4PNFA 2X8CA 1GWCA 2WDUA 3CTFA 1SKSB 5F06A 1FW1A 4KGIA 4CHSA 1TK5B 4PGTA 2NTOA 2HZEB 2H73A 2RUEA 3TRPA 1B4QA 3PR8A 3FR3A 2M80A 1T4ZA 2HFDA 2N5AA 2LQOA 1X9MB 4MLYA 2WRTA 2LUSA 1EV4A 2H72A 3TJJA 2RM5A 3WYWA 4MMMA 2GS3A 4LA1A 4GF0A 1GSUA 1K0DA 4MABA 1DSBA 3EMPA 2WGRA 1M2DA 4JEDA 1A0RP 3U6VA 3M0FA 1RW1A 2DJJA 3VK9A 3E0UA 1A24A 1KEBA 3F4SA 4HZ4A 1X5EA 2B5YA 2V2GA 2I81A 4JBBA 3GRXA 2CVBA 2A4VA 5FHIA 1R5AA 4EE0A 4YQVA 5HFIA 4BWQA 1YF1A 1TK8B 2WS2A 1XWBA 3QDNA 3QR6A 5DQYA 4JR4A 1T1VA 5KN3A 1ILOA 3LXTA 3BOAA 2C4JA 1EOGA 2LRNA 2M72A 2WZ9A 3FR6A 1WIKA 1UN2A 5INYA 2TRCP 5KN1A 2YOIA 2CX3A 2VCZA 3BBYA 4OCFA 2OADA 5CRGA 4DSSB 2JL4A 4BL7B 2AAWA 2PGTA 5H5QA 2X99A 1EV9A 2HRKB 4ZL8A 2MZCA 3RHBA 5ID2A 1N2AA 4N0ZA 3IE3A 4TN8A 2YZUA 4XRAA 4OO5A 1ZZYA 5ECRB 4G10A 4ACSA 2YJHA 1UC7A 1FAAA 4I8BA 2H0IA 3CMIA 5ENUA 1SJ6A 4GTUA 2HRNA 4KX4A 1AQVA 1PX7A 3ERGA 2H0HA 2PBJA 2VLVA 3JCML 1THOA 3UVHA 4MZCA 2H8LA 2FLSA 3FZAA 1K0MA 3HJOA 3CYNA 2DJ3A 1GLQA 3U5RE 1OVNA 4OO4A 1V58A 2C1YA 2OA7A 1GSDA 2HZEA 4KNDA 5JCWA 5IIZA 4XS1A 3NOFA 2R37A 4GQFA 1XWAA 5D8IA 4OD7A 1SL2B 2VOCA 1BG5A 1EZKA 1EP8A 3HVVA 4GXZA 3EC3A 2H30A 3S9FA 2L4CA 2XBIA 5DJMA 1BJXA 4P3YB 3KTLA 3DVWA 3WD6A 4OCEA 3PGTA 1T4YA 5COHA 5CO3A 3HCZA 1AIUA 2EIQA 2FGXA 1GL8A 4I2UA 2V6OA 2ZCTA 2IMKA 3F63A 2UZ8A 3VI7A 4X43A 5ECQB 4ECIA 3TRXA 1SYXA 5ECPB 3ZVJA 2K8SA 2P5QA 4EDZA 4PNGA 4PQ1A 3KZQA 2GDRA 2FWHA 3TDGA 5E59A 1BX9A 1JZDA 4MZBA 2VCVA 3IDVA 12GSA 4JU5A 3L0HA 4TXOB 5IMVA 3I43A 4MF7A 1WJKA 4KDYA 5D96A 3GL3A 5G5EA 1JLVA 2KP1A 4IVFA 3C1RA 4G2EA 4GQCA 1A23A 2J23A 4N30A 4DSSA 5AIVA 4BL7A 1TU7A 2FWFA 4K9ZA 1Y25A 2L6CA 1XW9A 4V1Ag 3GL5A 5HR3A 5D9TA 2IWTA 4AJ6A 4PQHA 2YZHA 3FEUA 2B1KA 4MJAA 1XWKA 2GZPA 4WR4A 3IC8A 1PGTA 3ZREA 3H93A 5J9CA 1SL0B 3G9BA 2FWGA 3J7Yk 2C3TA 11GSA 1XBSA 3SBCA 1OE7A 2H6ZA 2XPDA 1TRSA 3D5JA 2VLTA 5ECKB 5H5RA 2H1GA 2QC7A 2YN1A 2AV4A 2VAFA 1E6BA 1Q4JA 3HY2A 4JZQA 4KCEA 5G30A 3QD9A 3MNGA 4OWYA 3D22A 2YANA 5E4WA 4KDUA 4LLRA 4HI7A 3TUEA 5GAND 1FB6A 2YWMA 3G7IA 3KIJA 4FYCA 1MDJA 4KF9A 4NMUA 5D73A 3GSSA 7GSSA 3KEBA 3HJPA 4TR1B 5H5SA 2H6XA 4PURA 3BJ5A 4O32A 3KTBA 3WGEA 3GURA 4V2MA 1GLPA 5AISA 1B9YC 1XPVA 3TOTA 1DE1A 4ZBDA 2I1UA 4IJ3A 5G5FA 1TTZA 1YF0A 1VF2A 2QKEA 6GSVA 2NPBA 2VCWA 3QCPA 1GRXA 3D0ZA 2V41A 5IOWA 1A0FA 5DBQA 3KGKA 1ZMAA 2CVDA 3VWXA 4JE1A 1AUCA 4TXOA 1HNAA 1K3LA 4HZ2A 4YAVA 3CBUA 5BMUA 2HI7A 1M0UA 3IK9A 3NIVA 1AQXA 4GRFA 3LG6A 4G9HA 1F9MA 2LRCA 1SK2A 3ZFLA 2YWNA 5D93A 1SU9A 4GSSA 2GSRA 1ZL9A 1SKWB 2LNTA 4G19A 2ZNMA 5G1LA 3EURA 5ABRA 4DVCA 2EC4A 1K0BA 2C0GA 1OKDA 2PVQA 3F3QA 2NBSA 1O85A 3W8SA 2IJYA 3D21A 5D9XA 1VGLA 2PMTA 5FWGA 2X64A 1B4PA 1OE8A 3D6IA 5HR1A 4JR6A 6GSTA 4G0KA 3ZIVA 5KN0A 4KUNA 5ECHB 2EIRA 2MYGA 1J08A 3TB2A 3UL3A 1ML6A 2N5BA 2FD3A 3CTGA 3HJMA 2C80A 4EO3A 3FY7A 5DAKB 2C8UA 3LFLA 5GZZB 2IL3A 5J41A 2F3MA 1WMJA 4ML6A 1X9WB 4RQXA 3ZMKA 4KCAA 1MDIA 2FWEA 2CA8A 3MWHA 1K3OA 4KB3A 2B7KA 1ZYEA 3GHAA 6GSUA 2WJUA 1A8LA 4K1FA 1XVQA 2LQQA 3VLNA 3VURA 4HEA2 3C71A 1FB0A 1AC1A 3L9VA 4PUAA 3WGXA 4D73B 5CAXA 2VL9A 2DMLA 1UA5A 1ZCPA 3RAZA 4WF5A 3IPZA 5DCHA 4EC0A 2C0FA 1GSSA 3CSHA 4L0UA 4TOPA 4EL1A 3C8EA 3LYPA 1YDKA 2YV9A 3P7XA 4IQ1A 5IO0A 3DXBA 3ZL5A 2O87A 2DLXA 1CQHA 3F4RA 3KH9A 3V1WA 1U87A 3FZ5A 1EWXA 1TRWA 1GTIA 4E8EA 1AXDA 5EY6A 1X9SB 1ON4A 4ZB8A 4MK3A 4I2TA 1WWJA 1QGVA 3QFAC 13GSA 3EWLA 2OBKA 17GSA 2JZSA 1TJDA 4TR0A 1Q98A 2B5EA 4TW5A 1BAYA 4ZBBA 1Z7RA 2B5XA 2JZTA 3LXZA 2H1BA 5ECSA 3GFKA 2CV4A 1V9WA 5ECLB 3LYKA 4K0GA 1OC9B 5CP1A 1W89A 2VUPA 4HUAA 3ZVJD 3W8JA 4K7IA 4Q5RA 3AY8A 2CAQA 4XTSA 1JHBA 3DGQA 3FZ4A 3PPUA 1M7TA 1OAZA 1SJIA 1WP0A 5IQYA 2K6VA 4YQUA 4BA7A 2VO4A 1K0CA 4KA0A 1ZYQB 2DBCA 1V98A 2AYTA 3BCKA 3ZYWA 1MTCA 1MEKA 1T3BA 1EEJA 1WOUA 1GSQA 5J9BA 2LEGA 3APQA 5DAKA 4HS1A 3FK8A 3A2XA 4V2NA 4NHWA 2YJ7A 2HSNB 2HYXA 2HSMB 2H0GA 1WPIA 3M9KA 1Z3EA 2DJ1A 3GUSA 2REMA 1B48A 1HNBA 2DIYA 6GSSA 1DBYA 4IN0A 9GSSA 4QQ7A 2TRXA 1XXUA 2HRFA 2B3SA 6GSYA 1I9DA 2YNXA 2VM2A 2CZ2A 4D73A 3OR5A 3LSZA 4TVEA 1BQ7A 2L4QA 1NHYA 4WEYA 3CRUA 3RHCA 5IO2A 3SWLA
chains in the Genus database with same CATH superfamily
1J0FA 4HJ2A 2OE1A 1IYHA 1BF5A 4AJ7A 4EVMA 3TKSA 4K0NA 5CRHA 5B7CA 4K5SA 4O7HA 2L5LA 3FRCA 2H70A 3KCMA 3C1SA 3TJKA 5ELAA 4AI6A 2MMAA 5CNWA 2DMMA 4LL4B 4K6XA 4OFNA 2LSTA 5EVOA 5B8AA 2AUVA 2YCDA 2O89A 1FOHA 4FH8A 2VL2A 1FG4A 1QQ2A 2BTOT 4TKYA 1YJ6A 1Z7PA 2R2JA 3F0IA 4HSCX 3O6TA 4BWSA 1ZYPA 4L5LA 1G6WA 4O92A 5IMFA 2HRAA 4KSMA 4X0XA 4XRDA 1M2AA 3HYPA 2XHFA 3GMFA 1WE0A 3CWGA 2MBSA 2AHEA 2OJLA 3ZFBA 3IC4A 3IHQA 4A5PA 1TRVA 2VIMA 3CSIA 2R6KA 3C7MA 4GSNA 4Q5QA 2HNLA 3R3EA 2KLXA 5HFGA 1OC9A 3UBLA 4N10A 5IMZA 4HU9A 1M9AA 1PD21 1JFUA 4N11A 1G7EA 4F9ZA 3CRTA 3IOSA 2E0QA 3QPMA 2GVPA 2ON7A 1XCCA 3TJBA 2HZFA 3DMLA 3N9JA 1G0TA 1X5CA 3HDCA 4OFTA 2CAIA 1TP9A 1EOHA 1JLWA 2H1AA 4WBJA 4GWRA 5AIXA 1BYEA 2XC2A 5F07A 3GIXA 2O5VA 3APOA 3G7JA 1EP7A 2MMOA 1SKRB 2KUCA 1OKTA 4MP4A 2HRKA 1VRSD 4MCUA 4EF0A 3TRQA 2HSNA 2QSIA 1IYIA 6GSWA 3EYTA 2HSMA 4IQAA 1XWGA 2B1LA 1PKWA 2XBQA 3QMXA 1KTEA 5ECNB 1F2EA 2JU5A 3F6DA 4PX1A 4RI7A 2K18A 1SENA 2CZ3A 2IN3A 16GSA 1W4VA 5JCUA 3LW9A 2F9SA 3TKQA 5JCGA 2Z9SA 4ULXA 4BVXB 2CVKA 4G0IA 3QAVA 5B8BA 1A2LA 5JWRB 1XVWA 2IPAA 1XIYA 1M3JA 1GNWA 3M1GA 1F6MC 5C00A 1SK1A 2KOKA 3EVIA 3ZRDA 3PH9A 5GSSA 4ZL9A 3ME8A 1GNEA 1PKZA 4IP1A 4KE3A 4POBA 5ECMB 1OC3A 4RQRA 2WW3A 4K7NA 5J4YA 2GQMA 1T8EB 1R4WA 3IAS2 3VPQA 3UEMA 1GP1A 2IFQB 4ZBAA 3M3MA 3KJYA 2CX4A 1F3BA 5DALB 1SL1B 4KSOA 5KN2A 2V32A 4CY6A 2HXKA 3R2QA 3RDWA 2PUKC 1BEDA 2BMXA 1PRXA 2ON5A 5DJLA 1JZRA 3FYGA 2VM1A 5AGYA 4POMA 1H75A 4PXOA 3A2VA 2PN8A 2YWOA 4ZL7A 1YEWC 3MDKA 1YY7A 1ERVA 1LJRA 2WCIA 3UJ1A 2K9FA 3TOUA 2RM6A 1THXA 1X5DA 4OFMA 5GSTA 2I3YA 6GSXA 3I69A 4ICYA 5IPGA 2GQLA 4ZIJA 3QAGA 2L57A 2DIZA 3IAM2 4N3ZA 1Z5YE 2O85A 4MA9A 3TKSE 5LD0A 3L78A 4H86A 3H1NA 2L6DA 4F0BA 4NAXA 2YPMA 1SJZA 1X0RA 1ERWA 2X8HA 3LWAA 2P31A 3Q6OA 3TJFA 1XOBA 1V57A 4BIKA 1XZOA 1S3CA 4DSRA 4O5RA 4NV2A 4J56E 1YVLA 1O81A 3QFBC 5HFKA 5IOXA 1VF4A 5G1KA 5J3RA 3L4NA 4IELA 2GZYA 4BVXA 4EIQA 3UMAA 2KP2A 3ZTLA 2VL2C 2GSQA 4I97A 4EDYA 4ZILA 1PX6A 1JZWA 4NXIA 4L8EA 3GSTA 2HE3A 2K8VA 2EFCA 2R5GA 2JSYA 1GULA 5AN1A 2I9HA 2RIIA 4QL9A 2DJ2A 5B6MA 2X4AA 4XS6A 3P90A 4ML1A 4J2FA 3FKFA 2R4VA 1PL2A 2IMEA 3Q74A 2IFQA 1AW9A 2RUFA 4Z2TA 2FA4A 3LEFA 3FMWA 5DALA 4NWYA 3HXSA 1YEXA 2LNSA 4MZWA 3F4TA 3TKRA 5A34B 1NW2A 3HKRA 3EU4A 4PQIA 3F3RA 2V1MA 4TR1A 2VLUA 5EL8A 5IPHA 3DYRA 5HQPA 2TIRA 1EGRA 4AKGA 2WB9A 4WETA 3EPTA 2WVZA 5GAPD 1HYUA 4K5RA 5IMCA 2H1DA 4K8MA 4PUFC 2PVOC 3FW2A 3GTUB 2LTKA 5IMAA 1HQOA 1ZOFA 3TKPA 2E7PA 2EFEA 3IXRA 3P8WA 2YWIA 1GUHA 2H19A 4X1UA 5C04A 4DSQA 4IS0A 1R7HA 4YKGA 1QFNA 5CYYA 2FUG2 1M99A 2DSAA 4FXYP 1Z6NA 4FQUA 1XWCA 2DKHA 1C72A 1O73A 3UARA 5D9WA 5LNKe 2VD0A 2RLIA 2DKIA 4I6XA 1GTUA 3LORA 2B7JA 3K8NA 3KP9A 1SD9A 2WZSA 3F6FA 2P0GA 2LV3A 3I9V2 1DUGA 2D2ZA 3IRAA 1R26A 3GH9A 1G7OA 8GSSA 3H8QA 3VWWA 4Q5FA 3GKXA 1KBNA 1SVLA 2H71A 1QK8A 2GQKA 1N8JA 5JWQB 2ES7A 2R0PA 2GT6A 1FO5A 1VF1A 1YKCA 1AQWA 4AF2A 3KH7A 4IGJA 3CQFA 3ZZXA 4XS4B 1K0NA 1TRUA 1TI3A 3A2WA 2OACA 1PQNA 2OBIA 3A3TA 4TR3A 3O3TA 3FHKA 1TI1A 2H75A 4HOJA 2IMDA 2EIOA 4KH7A 1A2MA 2F8AA 4NV5A 2J9HA 2MBTA 3NZNA 4ILFA 2L59A 3GH6A 2DC5A 4MJBA 4TRXA 3ED3A 3HHVA 2PERA 1SD8A 1TW9A 4GCIA 4EKZA 1XW5A 1FOVA 2C0DA 4MJCA 1G6YA 1WRYA 4RI6A 3RBTA 1LU4A 4WF4A 1CQGA 1TXUA 3UOMA 5A34A 4NHZA 18GSA 4TXVA 2HSHA 4DEJA 5CRWA 3VWUA 2NVLA 2AB6A 1YKAA 2IMIA 1GH2A 2C3NA 5DVBA 3ZMLA 4IBPA 4ZXGA 4XCSA 2PU9C 1V2AA 1GSEA 5JWOB 3C73A 2H66A 1Z6MA 4WR5A 4E8HA 4TR4A 4F0CA 1Y6EA 3CSJA 3VPTA 2B6MA 4PHZC 4HU7A 5HR0A 1S3AA 2VD1A 1S4BP 2CQ9A 2YP6A 3F9UA 3GTUA 1XW6A 4F2IA 4ECBA 3QAWA 4MPFA 3P2AA 4LMVA 2YV7A 3HVNA 2H76A 3ERFA 1TKDB 3RPPA 1TOFA 4ID0A 3DIEA 2V6KA 3IR4A 2MMZA 5LCZA 3UIWA 2DJ0A 3IA1A 2JSZA 4XHMA 1T00A 4NPBA 4FYBA 2C3QA 5ECIB 1OYJA 1U3AA 3H79A 1U6TA 3F8UA 1MD3A 4GSTA 1SVOA 5KEJA 2O7KA 4Z2RA 3KMNA 4MH3A 4JRRA 2FY6A 3MAKA 4W66A 3E9JB 5L71A 2MMNA 4K7OA 3ZIJA 2LKUA 5A4VA 4CW9A 1GTBA 1PMTA 5IMDA 4G0LA 4F82A 1H4OA 3I6AA 1QUWA 2G2QA 2WFCA 1A8YA 3L9UA 2N5FA 4Z7XA 2JACA 4CDOA 4RUVA 3W6GA 1QMVA 3EINA 1GSYA 2O8VB 1USBA 2VKZG 2OE0A 3DWVA 4XS4A 2M46A 3WT1A 3D4TA 3BD2A 5HR2A 3N5OA 2BJXA 4K2DA 3WGDA 3HMJG 3Q19A 19GSA 1GTAA 3MSZA 3VFIA 2LJRA 1I5GA 4ZB6A 3TJGA 2GSTA 3J7Yb 1U3IA 2PPTA 4PI0C 4AKIA 1YZXA 3WT2A 1SK0A 4BVYB 2HQTA 2VCTA 4QL7A 3UAPA 1XFLA 1LBKA 1FVJA 4YAPA 3BCIA 3DVXA 1GUMA 4KW6A 1ERTA 1B8XA 1V40A 2FNOA 4MF5A 4AGSA 4MDCA 1OC8A 1NHOA 3HVSA 1PN0A 1E2YA 22GSA 1TU8A 2PWJA 2KHPA 1PL1A 3HA9A 3KXOA 1GSFA 2LS5A 4L5OA 3DEXA 1J9BA 2GZZA 3QOUA 3LGCA 1M9BA 5EPFA 4IJIA 2GSSA 2CT6A 5G2ZA 1ACVA 4N0VA 1Y1UA 1NM3A 2R3XA 5DQSA 1TXXA 1KNGA 1RK4A 1ZGNA 1UVZA 1ERUA 1O8XA 3GKNA 1F3AA 3GKKA 5F0GA 5J5NA 2X8GA 4PI2C 3UBKA 3KP8A 1YEPA 5ECOB 1U88A 1AAZA 5A4WA 4LL1B 3HZ4A 4EUYA 2HT9A 2OKAA 1YQ1A 4POLA 4GLTA 1PN9A 2H6YA 2FHEA 5CRDA 1FHEA 4ZB9A 3LQ7A 3ZLPA 3KMOA 2AJQB 4MH2A 4V1Ap 3VWVA 5A5KA 5F8BA 2HSYA 3GA4A 4F03A 2NDOA 2GT5A 2WULA 1K0AA 2WVYA 4YH2A 3IV4A 2P5RA 3KD0A 3UVTA 3DKSA 2LJAA 3GV1A 4V2LA 3M9JA 3E3EA 4L0WA 2IIYA 1EGOA 4FIWA 4IKHA 3US3A 4Q5NA 20GSA 4FO5A 4HDEA 4OMVA 2VL3A 4MJEA 3ME7A 2A2SA 1FVKA 3A5WA 4HJMA 3EU3A 14GSA 3PINA 2FA8A 2JADA 4HQZA 10GSA 5DCGA 5A4UA 1Z9HA 4WKWA 1JZOA 3VI5A 1SYRA 2VCQA 3TGZA 1R5PA 4EXJA 4BVYA 4IHUA 5CREA 1O6JA 1DE2A 1HNCA 4KAEA 1XOAA 2DJKA 4WXTA 3TKSC 3TCOA 1TK0B 3Q18A 2ZUPA 4PTSA 3IK7A 2JZRA 2E2GA 5B6NA 3FZ9A 2H01A 3L9SA 4I5QA 5J4UA 2IMFA 1M3IA 3HVXA 3KM6A 2ALBA 4POKA 5D9VA 3DRNA 4J57E 1TDIA 4KDXA 4MF6A 1T7PB 2L5OA 4YQMA 4AJ8A 4ISDA 1MDKA 5ELGA 1NSWA 2GTUA 3EMXA 4MPGA 1URMA 3DD3A 2I4AA 2QA2A 5FT3A 1K3YA 1RQMA 1B9XC 1K0OA 3FR9A 2E2MA 1PA3A 3ISOA 2GGTA 1O7UA 4HQSA 3O76A 2VCXA 2O3EA 2FCHA 4IP6A 3EE2A 4IW9A 2H74A 4BPYA 3LJRA 4XIHA 2XPEA 5IM9A 2LJKA 3RPNA 4LMWA 3D4MA 3ZITA 2GLRA 1S3DA 3GN3A 5F05A 1A2JA 4FYUA 3GYKA 5ID2B 1O8WA 4YKFA 1M2BA 1ST9A 3HZ8A 3GKMA 3GNJA 1GUKA 4ECCA 2HLSA 3HD5A 4USSA 3GX0A 3M8NA 3ERWA 5DDLA 3APSA 1F37A 1QXHA 3IBHA 1PSQA 3H4KA 3TU3B 1HD2A 3G7YA 1MD4A 5G31A 2LRTA 4ECJA 2C0EA 1ABAA 2A2RA 3CXGA 5J40A 1EEMA 4WBRD 2G0FA 2OE3A 3GX8A 2F8FA 1VF3A 2F51A 2QGVA 4PNFA 2X8CA 1GWCA 2WDUA 3CTFA 3IHGA 1SKSB 5F06A 1FW1A 4KGIA 4CHSA 1TK5B 2WW1A 4PGTA 2NTOA 2HZEB 2H73A 2RUEA 3TRPA 1B4QA 3FR3A 3PR8A 2M80A 1T4ZA 2HFDA 2N5AA 2LQOA 1X9MB 4MLYA 2WRTA 2LUSA 1EV4A 2WVXB 2H72A 3TJJA 2RM5A 3WYWA 4MMMA 2GS3A 4LA1A 4GF0A 1GSUA 1K0DA 4MABA 1DSBA 3EMPA 2WGRA 3A5IA 1M2DA 4JEDA 1A0RP 3U6VA 3M0FA 1RW1A 2DJJA 3VK9A 3E0UA 1A24A 1KEBA 3F4SA 4HZ4A 1X5EA 2B5YA 2V2GA 2I81A 4JBBA 3GRXA 2CVBA 2A4VA 5FHIA 1R5AA 4EE0A 4YQVA 5HFIA 4BWQA 1YF1A 4EIPA 1TK8B 2WS2A 1PFOA 1XWBA 3QDNA 3QR6A 5DQYA 4JR4A 1T1VA 5KN3A 1ILOA 3LXTA 3BOAA 2C4JA 2QA1A 1EOGA 2LRNA 2M72A 2WZ9A 3FR6A 1WIKA 1UN2A 4ZB7A 5INYA 5KOWA 2TRCP 5KN1A 2YOIA 2CX3A 4K2XA 2VCZA 3BBYA 4OCFA 2OADA 5CRGA 4DSSB 2JL4A 4BL7B 2AAWA 2PGTA 5H5QA 2X99A 1EV9A 2HRKB 2WW2A 4ZL8A 2MZCA 3RHBA 5ID2A 1N2AA 4N0ZA 3IE3A 4TN8A 2YZUA 4XRAA 4OO5A 1ZZYA 5ECRB 4G10A 4ACSA 2YJHA 1UC7A 1FAAA 4I8BA 2H0IA 3CMIA 5ENUA 1SJ6A 4GTUA 2HRNA 4KX4A 1AQVA 1PX7A 3ERGA 2H0HA 2PBJA 2VLVA 3JCML 1THOA 3UVHA 4MZCA 2H8LA 2FLSA 3FZAA 1K0MA 3HJOA 3CYNA 4Z2UA 2DJ3A 1GLQA 3U5RE 1OVNA 4OO4A 1V58A 2C1YA 2OA7A 1GSDA 2HZEA 4KNDA 5JCWA 5IIZA 4QMKA 4XS1A 3NOFA 2R37A 4GQFA 1XWAA 5D8IA 4OD7A 1SL2B 2VOCA 2WVXA 1BG5A 1EZKA 1EP8A 2H1LA 3HVVA 4GXZA 1ZYNA 3EC3A 2H30A 3S9FA 2L4CA 2XBIA 5DJMA 1BJXA 4P3YB 3KTLA 3DVWA 3WD6A 4OCEA 5BRTA 3PGTA 1T4YA 5COHA 5CO3A 3HCZA 1AIUA 2EIQA 2FGXA 1GL8A 4I2UA 2V6OA 2ZCTA 2IMKA 3F63A 2UZ8A 3VI7A 4X43A 5ECQB 4ECIA 3TRXA 1SYXA 5ECPB 5KOXA 3ZVJA 2K8SA 2P5QA 5J47A 4EDZA 4PNGA 4PQ1A 3KZQA 2GDRA 2FWHA 3TDGA 5E59A 1BX9A 1JZDA 4MZBA 2VCVA 3IDVA 2O36A 12GSA 4JU5A 3L0HA 4TXOB 5IMVA 3I43A 4MF7A 1WJKA 5BMUB 4KDYA 5D96A 3GL3A 5G5EA 1JLVA 2KP1A 4IVFA 3C1RA 4G2EA 4GQCA 1A23A 2J23A 4N30A 4DSSA 5AIVA 4BL7A 1TU7A 2FWFA 4K9ZA 1Y25A 2L6CA 1XW9A 2X49A 4V1Ag 3GL5A 5HR3A 5D9TA 3MYDA 2IWTA 4AJ6A 4PQHA 2YZHA 4AKXB 3FEUA 2B1KA 4MJAA 4AKHA 1XWKA 2GZPA 4WR4A 3IC8A 1PGTA 1S3RA 3ZREA 3H93A 5J9CA 1SL0B 4E68A 3G9BA 2FWGA 3J7Yk 2C3TA 11GSA 1XBSA 3SBCA 1I1IP 1OE7A 2H6ZA 2XPDA 1TRSA 3D5JA 2VLTA 5ECKB 5H5RA 2H1GA 2QC7A 2YN1A 2AV4A 4O5QA 2VAFA 1E6BA 1BG1A 1Q4JA 3HY2A 4JZQA 4KCEA 5G30A 2A2PA 3MNGA 3QD9A 4OWYA 3D22A 2YANA 5E4WA 4KDUA 4LLRA 4HI7A 3TUEA 5GAND 1FB6A 2YWMA 3G7IA 3KIJA 4FYCA 1MDJA 5A1NB 4KF9A 4NMUA 5D73A 3GSSA 7GSSA 3KEBA 3HJPA 4TR1B 5H5SA 2H6XA 4PURA 2A4HA 3BJ5A 4O32A 3KTBA 1N25A 3WGEA 3GURA 4V2MA 1GLPA 5AISA 1B9YC 1XPVA 3TOTA 1DE1A 4ZBDA 2I1UA 4IJ3A 5G5FA 1TTZA 1YF0A 1VF2A 2QKEA 6GSVA 2NPBA 2VCWA 3QCPA 1GRXA 3D0ZA 2V41A 5IOWA 1SVMA 5J4VA 1A0FA 5DBQA 3KGKA 1ZMAA 2CVDA 3VWXA 4JE1A 1AUCA 4TXOA 1HNAA 1K3LA 4HZ2A 2EFDA 4YAVA 3CBUA 5BMUA 2R0CA 2HI7A 1M0UA 3IK9A 3NIVA 1AQXA 4GRFA 3LG6A 4G9HA 1F9MA 2LRCA 1SK2A 3ZFLA 2YWNA 5D93A 1SU9A 4GSSA 2GSRA 1ZL9A 1SKWB 2LNTA 4G19A 2ZNMA 5G1LA 3EURA 5ABRA 4DVCA 2EC4A 1K0BA 2C0GA 1OKDA 2PVQA 3F3QA 2NBSA 1O85A 3W8SA 2EFHA 2IJYA 3D21A 5D9XA 1VGLA 2PMTA 5FWGA 2X64A 1B4PA 1OE8A 3D6IA 5HR1A 4JR6A 6GSTA 4G0KA 4G01A 3ZIVA 5KN0A 4KUNA 5ECHB 2EIRA 2MYGA 1J08A 3TB2A 3UL3A 1ML6A 2N5BA 2FD3A 3CTGA 3HJMA 2C80A 2WW0A 4EO3A 3FY7A 5DAKB 3LFLA 2C8UA 5GZZB 3RGBC 2IL3A 5J41A 2F3MA 1WMJA 4ML6A 4O5UA 1X9WB 4RQXA 3ZMKA 4KCAA 1MDIA 2FWEA 2CA8A 3MWHA 1K3OA 5A5HB 2R0GA 4KB3A 2B7KA 1ZYEA 3GHAA 3RFRC 5A1NA 6GSUA 2WJUA 1A8LA 4K1FA 3CHXC 3MIXA 1XVQA 2LQQA 2UV8G 3VLNA 3VURA 4HEA2 3C71A 1FB0A 1AC1A 3L9VA 4PUAA 3WGXA 4D73B 5CAXA 2VL9A 2DMLA 1UA5A 1ZCPA 3RAZA 4WF5A 3IPZA 5DCHA 4EC0A 2C0FA 1GSSA 3CSHA 4L0UA 4TOPA 4EL1A 3C8EA 3LYPA 1YDKA 2YV9A 3P7XA 4IQ1A 5IO0A 3DXBA 3ZL5A 2O87A 2DLXA 1CQHA 3F4RA 3KH9A 3V1WA 1XG8A 1U87A 3FZ5A 1EWXA 1TRWA 1GTIA 4E8EA 1AXDA 5EY6A 1X9SB 1ON4A 4ZB8A 4MK3A 4I2TA 1WWJA 1QGVA 3QFAC 13GSA 3EWLA 2OBKA 17GSA 4GDFA 2JZSA 1TJDA 4TR0A 1Q98A 2B5EA 4TW5A 1BAYA 4ZBBA 1Z7RA 2B5XA 2JZTA 3LXZA 2H1BA 5ECSA 3GFKA 2CV4A 1V9WA 5ECLB 3LYKA 4K0GA 1OC9B 5CP1A 1W89A 2VUPA 4HUAA 3ZVJD 3W8JA 4K7IA 4Q5RA 3AY8A 2CAQA 4XTSA 1JHBA 3DGQA 3FZ4A 3PPUA 1M7TA 1OAZA 1SJIA 1WP0A 5IQYA 2K6VA 4YQUA 4BA7A 2VO4A 1K0CA 4KA0A 1ZYQB 2DBCA 1V98A 2AYTA 3BCKA 3ZYWA 1MTCA 1MEKA 1T3BA 1EEJA 1WOUA 1GSQA 4X4JA 5J9BA 2LEGA 3APQA 5DAKA 4HS1A 3FK8A 3A2XA 4V2NA 4NHWA 2YJ7A 2HSNB 2HYXA 2HSMB 2H0GA 1WPIA 3M9KA 5A5HA 1Z3EA 2DJ1A 3GUSA 2REMA 1B48A 1HNBA 2DIYA 6GSSA 1DBYA 4IN0A 2OT3A 9GSSA 4QQ7A 2TRXA 4CY8A 1XXUA 2HRFA 2B3SA 4MNNA 6GSYA 1I9DA 2YNXA 2VM2A 2CZ2A 4D73A 3OR5A 3LSZA 4TVEA 1BQ7A 2L4QA 1NHYA 4WEYA 3CRUA 3RHCA 5IO2A 3SWLA
chains in the Genus database with same CATH topology
1J0FA 4HJ2A 2OE1A 1IYHA 1BF5A 4AJ7A 4EVMA 3TKSA 4K0NA 5CRHA 5B7CA 4K5SA 4O7HA 2L5LA 3FRCA 2H70A 3KCMA 3C1SA 3TJKA 5ELAA 4AI6A 2MMAA 5CNWA 2DMMA 4LL4B 4K6XA 4OFNA 2LSTA 5EVOA 5B8AA 2AUVA 2YCDA 2O89A 1FOHA 4FH8A 2VL2A 1FG4A 1QQ2A 2BTOT 4TKYA 1YJ6A 1Z7PA 2R2JA 3F0IA 3O6TA 4BWSA 1ZYPA 4L5LA 1G6WA 4O92A 5IMFA 2HRAA 4KSMA 4X0XA 4XRDA 1M2AA 3HYPA 2XHFA 3GMFA 1WE0A 3CWGA 2MBSA 2AHEA 2OJLA 3ZFBA 3IC4A 3IHQA 4A5PA 1TRVA 2VIMA 3CSIA 2R6KA 3C7MA 4GSNA 4Q5QA 2HNLA 3R3EA 2KLXA 5HFGA 1OC9A 3UBLA 4N10A 5IMZA 4HU9A 1M9AA 1PD21 1JFUA 4N11A 1G7EA 4F9ZA 3CRTA 3IOSA 2E0QA 3QPMA 2GVPA 2ON7A 1XCCA 3TJBA 2HZFA 3DMLA 3N9JA 1G0TA 1X5CA 3HDCA 4OFTA 2CAIA 1TP9A 1EOHA 1JLWA 2H1AA 4WBJA 4GWRA 5AIXA 1BYEA 2XC2A 5F07A 3GIXA 2O5VA 3APOA 3G7JA 1EP7A 2MMOA 1SKRB 2KUCA 1OKTA 4MP4A 2HRKA 1VRSD 4MCUA 4EF0A 3TRQA 2HSNA 1IYIA 6GSWA 2QSIA 3EYTA 2HSMA 4IQAA 1XWGA 2B1LA 1PKWA 2XBQA 3QMXA 1KTEA 5ECNB 1F2EA 2JU5A 3F6DA 4PX1A 4RI7A 2K18A 1SENA 2CZ3A 2IN3A 16GSA 1W4VA 5JCUA 3LW9A 2F9SA 3TKQA 5JCGA 2Z9SA 4ULXA 4BVXB 2CVKA 4G0IA 3QAVA 5B8BA 1A2LA 5JWRB 1XVWA 2IPAA 1XIYA 1GNWA 3M1GA 1F6MC 5C00A 1SK1A 2KOKA 3EVIA 3ZRDA 3PH9A 5GSSA 4ZL9A 3ME8A 1GNEA 1PKZA 4IP1A 4KE3A 4POBA 5ECMB 1OC3A 4RQRA 4K7NA 5J4YA 2GQMA 1T8EB 1R4WA 3IAS2 3VPQA 3UEMA 1GP1A 2IFQB 4ZBAA 3M3MA 3KJYA 2CX4A 1F3BA 5DALB 1SL1B 4KSOA 5KN2A 2V32A 4CY6A 2HXKA 3R2QA 3RDWA 2PUKC 1BEDA 2BMXA 1PRXA 2ON5A 5DJLA 1JZRA 3FYGA 2VM1A 5AGYA 4POMA 1H75A 4PXOA 3A2VA 2PN8A 2YWOA 4ZL7A 3MDKA 1YY7A 1ERVA 1LJRA 2WCIA 3UJ1A 2K9FA 3TOUA 2RM6A 1THXA 1X5DA 4OFMA 5GSTA 2I3YA 6GSXA 3I69A 4ICYA 5IPGA 2GQLA 4ZIJA 3QAGA 2L57A 2DIZA 3IAM2 4N3ZA 1Z5YE 2O85A 4MA9A 3TKSE 5LD0A 3L78A 4H86A 3H1NA 2L6DA 4F0BA 4NAXA 2YPMA 1SJZA 1X0RA 1ERWA 2X8HA 3LWAA 2P31A 3Q6OA 3TJFA 1XOBA 1V57A 1XZOA 1S3CA 4DSRA 4O5RA 4NV2A 4J56E 1YVLA 1O81A 3QFBC 5HFKA 5IOXA 1VF4A 5G1KA 5J3RA 3L4NA 4IELA 2GZYA 4BVXA 4EIQA 3UMAA 2KP2A 3ZTLA 2VL2C 2GSQA 4I97A 4EDYA 4ZILA 1PX6A 1JZWA 4NXIA 4L8EA 3GSTA 2HE3A 2K8VA 2EFCA 2R5GA 2JSYA 1GULA 5AN1A 2I9HA 2RIIA 4QL9A 2DJ2A 5B6MA 2X4AA 4XS6A 3P90A 4ML1A 4J2FA 3FKFA 2R4VA 1PL2A 2IMEA 3Q74A 2IFQA 1AW9A 2RUFA 4Z2TA 2FA4A 3LEFA 3FMWA 5DALA 4NWYA 3HXSA 1YEXA 2LNSA 4MZWA 3F4TA 3TKRA 5A34B 1NW2A 3HKRA 3EU4A 4PQIA 3F3RA 2V1MA 4TR1A 2VLUA 5EL8A 5IPHA 3DYRA 5HQPA 2TIRA 1EGRA 4AKGA 2WB9A 4WETA 3EPTA 5GAPD 1HYUA 4K5RA 5IMCA 2H1DA 4K8MA 4PUFC 2PVOC 3FW2A 3GTUB 2LTKA 5IMAA 1HQOA 1ZOFA 3TKPA 2E7PA 2EFEA 3IXRA 3P8WA 2YWIA 1GUHA 2H19A 4X1UA 5C04A 4DSQA 4IS0A 1R7HA 4YKGA 1QFNA 5CYYA 2FUG2 1M99A 2DSAA 1Z6NA 4FQUA 1XWCA 2DKHA 1C72A 1O73A 3UARA 5D9WA 5LNKe 2VD0A 2RLIA 2DKIA 4I6XA 1GTUA 3LORA 2B7JA 3K8NA 3KP9A 1SD9A 3F6FA 2P0GA 2LV3A 3I9V2 1DUGA 2D2ZA 3IRAA 1R26A 3GH9A 1G7OA 8GSSA 3H8QA 3VWWA 4Q5FA 3GKXA 1KBNA 1SVLA 2H71A 1QK8A 2GQKA 1N8JA 5JWQB 2ES7A 2R0PA 2GT6A 1FO5A 1VF1A 1YKCA 1AQWA 4AF2A 3KH7A 4IGJA 3ZZXA 4XS4B 1K0NA 1TRUA 1TI3A 3A2WA 2OACA 1PQNA 2OBIA 3A3TA 4TR3A 3O3TA 3FHKA 1TI1A 2H75A 4HOJA 2IMDA 2EIOA 4KH7A 1A2MA 2F8AA 4NV5A 2J9HA 2MBTA 3NZNA 4ILFA 2L59A 3GH6A 2DC5A 4MJBA 4TRXA 3ED3A 3HHVA 2PERA 1SD8A 1TW9A 4GCIA 4EKZA 1XW5A 1FOVA 2C0DA 4MJCA 1G6YA 1WRYA 4RI6A 3RBTA 1LU4A 4WF4A 1CQGA 1TXUA 3UOMA 5A34A 4NHZA 18GSA 4TXVA 2HSHA 4DEJA 5CRWA 3VWUA 2NVLA 2AB6A 1YKAA 2IMIA 1GH2A 2C3NA 5DVBA 3ZMLA 4IBPA 4ZXGA 4XCSA 2PU9C 1V2AA 1GSEA 5JWOB 3C73A 2H66A 1Z6MA 4WR5A 4E8HA 4TR4A 4F0CA 1Y6EA 3CSJA 3VPTA 2B6MA 4HU7A 5HR0A 1S3AA 2VD1A 2CQ9A 2YP6A 3F9UA 3GTUA 1XW6A 4F2IA 4ECBA 3QAWA 4MPFA 3P2AA 4LMVA 2YV7A 2H76A 3ERFA 1TKDB 3RPPA 1TOFA 4ID0A 3DIEA 2V6KA 3IR4A 2MMZA 5LCZA 3UIWA 2DJ0A 3IA1A 2JSZA 4XHMA 1T00A 4NPBA 4FYBA 2C3QA 5ECIB 1OYJA 1U3AA 3H79A 1U6TA 3F8UA 1MD3A 4GSTA 1SVOA 5KEJA 2O7KA 4Z2RA 3KMNA 4MH3A 4JRRA 2FY6A 3MAKA 4W66A 3E9JB 5L71A 2MMNA 4K7OA 3ZIJA 2LKUA 5A4VA 4CW9A 1GTBA 1PMTA 5IMDA 4G0LA 4F82A 1H4OA 3I6AA 1QUWA 2G2QA 2WFCA 1A8YA 3L9UA 2N5FA 4Z7XA 2JACA 4CDOA 4RUVA 3W6GA 1QMVA 3EINA 1GSYA 2O8VB 1USBA 2VKZG 2OE0A 3DWVA 4XS4A 2M46A 3WT1A 3D4TA 3BD2A 5HR2A 3N5OA 2BJXA 4K2DA 3WGDA 3HMJG 3Q19A 19GSA 1GTAA 3MSZA 3VFIA 2LJRA 1I5GA 4ZB6A 3TJGA 2GSTA 3J7Yb 1U3IA 2PPTA 4AKIA 1YZXA 3WT2A 1SK0A 4BVYB 2HQTA 2VCTA 4QL7A 3UAPA 1XFLA 1LBKA 1FVJA 4YAPA 3BCIA 3DVXA 1GUMA 4KW6A 1ERTA 1B8XA 1V40A 2FNOA 4MF5A 4AGSA 4MDCA 1OC8A 1NHOA 3HVSA 1PN0A 1E2YA 22GSA 1TU8A 2PWJA 2KHPA 1PL1A 3HA9A 3KXOA 1GSFA 2LS5A 4L5OA 3DEXA 1J9BA 2GZZA 3QOUA 3LGCA 1M9BA 5EPFA 4IJIA 2GSSA 2CT6A 5G2ZA 1ACVA 4N0VA 1Y1UA 1NM3A 2R3XA 5DQSA 1TXXA 1KNGA 1RK4A 1ZGNA 1UVZA 1ERUA 1O8XA 3GKNA 1F3AA 3GKKA 5F0GA 5J5NA 2X8GA 3UBKA 3KP8A 1YEPA 5ECOB 1U88A 1AAZA 5A4WA 4LL1B 3HZ4A 4EUYA 2HT9A 2OKAA 1YQ1A 4POLA 4GLTA 1PN9A 2H6YA 2FHEA 5CRDA 1FHEA 4ZB9A 3LQ7A 3ZLPA 3KMOA 2AJQB 4MH2A 4V1Ap 3VWVA 5A5KA 5F8BA 2HSYA 3GA4A 4F03A 2NDOA 2GT5A 2WULA 1K0AA 4YH2A 3IV4A 2P5RA 3KD0A 3UVTA 3DKSA 2LJAA 3GV1A 4V2LA 3M9JA 3E3EA 4L0WA 2IIYA 1EGOA 4FIWA 4IKHA 3US3A 4Q5NA 20GSA 4FO5A 4HDEA 4OMVA 2VL3A 4MJEA 3ME7A 2A2SA 1FVKA 3A5WA 4HJMA 3EU3A 14GSA 3PINA 2FA8A 2JADA 4HQZA 10GSA 5DCGA 5A4UA 1Z9HA 4WKWA 1JZOA 3VI5A 1SYRA 2VCQA 3TGZA 1R5PA 4EXJA 4BVYA 4IHUA 5CREA 1O6JA 1DE2A 1HNCA 4KAEA 1XOAA 2DJKA 4WXTA 3TKSC 3TCOA 1TK0B 3Q18A 2ZUPA 4PTSA 3IK7A 2JZRA 2E2GA 5B6NA 3FZ9A 2H01A 3L9SA 4I5QA 5J4UA 2IMFA 3HVXA 3KM6A 2ALBA 4POKA 5D9VA 3DRNA 4J57E 1TDIA 4KDXA 4MF6A 1T7PB 2L5OA 4YQMA 4AJ8A 4ISDA 1MDKA 5ELGA 1NSWA 2GTUA 3EMXA 4MPGA 1URMA 3DD3A 2I4AA 2QA2A 5FT3A 1K3YA 1RQMA 1B9XC 1K0OA 3FR9A 2E2MA 1PA3A 3ISOA 2GGTA 1O7UA 4HQSA 3O76A 2VCXA 2FCHA 4IP6A 3EE2A 4IW9A 2H74A 4BPYA 3LJRA 4XIHA 2XPEA 5IM9A 2LJKA 3RPNA 4LMWA 3D4MA 3ZITA 2GLRA 1S3DA 3GN3A 5F05A 1A2JA 4FYUA 3GYKA 5ID2B 1O8WA 4YKFA 1M2BA 1ST9A 3HZ8A 3GKMA 3GNJA 1GUKA 4ECCA 2HLSA 3HD5A 4USSA 3GX0A 3M8NA 3ERWA 5DDLA 3APSA 1F37A 1QXHA 3IBHA 1PSQA 3H4KA 3TU3B 1HD2A 3G7YA 1MD4A 5G31A 2LRTA 4ECJA 2C0EA 1ABAA 2A2RA 3CXGA 5J40A 1EEMA 4WBRD 2G0FA 2OE3A 3GX8A 2F8FA 1VF3A 2F51A 2QGVA 4PNFA 2X8CA 1GWCA 2WDUA 3CTFA 3IHGA 1SKSB 5F06A 1FW1A 4KGIA 4CHSA 1TK5B 4PGTA 2NTOA 2HZEB 2H73A 2RUEA 3TRPA 1B4QA 3FR3A 3PR8A 2M80A 1T4ZA 2HFDA 2N5AA 2LQOA 1X9MB 4MLYA 2WRTA 2LUSA 1EV4A 2H72A 3TJJA 2RM5A 3WYWA 4MMMA 2GS3A 4LA1A 4GF0A 1GSUA 1K0DA 4MABA 1DSBA 3EMPA 2WGRA 3A5IA 1M2DA 4JEDA 1A0RP 3U6VA 3M0FA 1RW1A 2DJJA 3VK9A 3E0UA 1A24A 1KEBA 3F4SA 4HZ4A 1X5EA 2B5YA 2V2GA 2I81A 4JBBA 3GRXA 2CVBA 2A4VA 5FHIA 1R5AA 4EE0A 4YQVA 5HFIA 4BWQA 1YF1A 4EIPA 1TK8B 2WS2A 1XWBA 3QDNA 3QR6A 5DQYA 4JR4A 1T1VA 5KN3A 1ILOA 3LXTA 3BOAA 2C4JA 2QA1A 1EOGA 2LRNA 2M72A 2WZ9A 3FR6A 1WIKA 1UN2A 4ZB7A 5INYA 5KOWA 2TRCP 5KN1A 2YOIA 2CX3A 4K2XA 2VCZA 3BBYA 4OCFA 2OADA 5CRGA 4DSSB 2JL4A 4BL7B 2AAWA 2PGTA 5H5QA 2X99A 1EV9A 2HRKB 4ZL8A 2MZCA 3RHBA 5ID2A 1N2AA 4N0ZA 3IE3A 4TN8A 2YZUA 4XRAA 4OO5A 1ZZYA 5ECRB 4G10A 4ACSA 2YJHA 1UC7A 1FAAA 4I8BA 2H0IA 3CMIA 5ENUA 1SJ6A 4GTUA 2HRNA 4KX4A 1AQVA 1PX7A 3ERGA 2H0HA 2PBJA 2VLVA 3JCML 1THOA 3UVHA 4MZCA 2H8LA 2FLSA 3FZAA 1K0MA 3HJOA 3CYNA 4Z2UA 2DJ3A 1GLQA 3U5RE 1OVNA 4OO4A 1V58A 2C1YA 2OA7A 1GSDA 2HZEA 4KNDA 5JCWA 5IIZA 4QMKA 4XS1A 3NOFA 2R37A 4GQFA 1XWAA 5D8IA 4OD7A 1SL2B 2VOCA 1BG5A 1EZKA 1EP8A 2H1LA 3HVVA 4GXZA 1ZYNA 3EC3A 2H30A 3S9FA 2L4CA 2XBIA 5DJMA 1BJXA 4P3YB 3KTLA 3DVWA 3WD6A 4OCEA 5BRTA 3PGTA 1T4YA 5COHA 5CO3A 3HCZA 1AIUA 2EIQA 2FGXA 1GL8A 4I2UA 2V6OA 2ZCTA 2IMKA 3F63A 2UZ8A 3VI7A 4X43A 5ECQB 4ECIA 3TRXA 1SYXA 5ECPB 5KOXA 3ZVJA 2K8SA 2P5QA 5J47A 4EDZA 4PNGA 4PQ1A 3KZQA 2GDRA 2FWHA 3TDGA 5E59A 1BX9A 1JZDA 4MZBA 2VCVA 3IDVA 12GSA 4JU5A 3L0HA 4TXOB 5IMVA 3I43A 4MF7A 1WJKA 5BMUB 4KDYA 5D96A 3GL3A 5G5EA 1JLVA 2KP1A 4IVFA 3C1RA 4G2EA 4GQCA 1A23A 2J23A 4N30A 4DSSA 5AIVA 4BL7A 1TU7A 2FWFA 4K9ZA 1Y25A 2L6CA 1XW9A 2X49A 4V1Ag 3GL5A 5HR3A 5D9TA 3MYDA 2IWTA 4AJ6A 4PQHA 2YZHA 4AKXB 3FEUA 2B1KA 4MJAA 4AKHA 1XWKA 2GZPA 4WR4A 3IC8A 1PGTA 3ZREA 3H93A 5J9CA 1SL0B 4E68A 3G9BA 2FWGA 3J7Yk 2C3TA 11GSA 1XBSA 3SBCA 1OE7A 2H6ZA 2XPDA 1TRSA 3D5JA 2VLTA 5ECKB 5H5RA 2H1GA 2QC7A 2YN1A 2AV4A 4O5QA 2VAFA 1E6BA 1BG1A 1Q4JA 3HY2A 4JZQA 4KCEA 5G30A 2A2PA 3MNGA 3QD9A 4OWYA 3D22A 2YANA 5E4WA 4KDUA 4LLRA 4HI7A 3TUEA 5GAND 1FB6A 2YWMA 3G7IA 3KIJA 4FYCA 1MDJA 5A1NB 4KF9A 4NMUA 5D73A 3GSSA 7GSSA 3KEBA 3HJPA 4TR1B 5H5SA 2H6XA 4PURA 2A4HA 3BJ5A 4O32A 3KTBA 1N25A 3WGEA 3GURA 4V2MA 1GLPA 5AISA 1B9YC 1XPVA 3TOTA 1DE1A 4ZBDA 2I1UA 4IJ3A 5G5FA 1TTZA 1YF0A 1VF2A 2QKEA 6GSVA 2NPBA 2VCWA 3QCPA 1GRXA 3D0ZA 2V41A 5IOWA 1SVMA 5J4VA 1A0FA 5DBQA 3KGKA 1ZMAA 2CVDA 3VWXA 4JE1A 1AUCA 4TXOA 1HNAA 1K3LA 4HZ2A 2EFDA 4YAVA 3CBUA 5BMUA 2R0CA 2HI7A 1M0UA 3IK9A 3NIVA 1AQXA 4GRFA 3LG6A 4G9HA 1F9MA 2LRCA 1SK2A 3ZFLA 2YWNA 5D93A 1SU9A 4GSSA 2GSRA 1ZL9A 1SKWB 2LNTA 4G19A 2ZNMA 5G1LA 3EURA 5ABRA 4DVCA 2EC4A 1K0BA 2C0GA 1OKDA 2PVQA 3F3QA 2NBSA 1O85A 3W8SA 2EFHA 2IJYA 3D21A 5D9XA 1VGLA 2PMTA 5FWGA 2X64A 1B4PA 1OE8A 3D6IA 5HR1A 4JR6A 6GSTA 4G0KA 4G01A 3ZIVA 5KN0A 4KUNA 5ECHB 2EIRA 2MYGA 1J08A 3TB2A 3UL3A 1ML6A 2N5BA 2FD3A 3CTGA 3HJMA 2C80A 4EO3A 3FY7A 5DAKB 3LFLA 2C8UA 5GZZB 2IL3A 5J41A 2F3MA 1WMJA 4ML6A 4O5UA 1X9WB 4RQXA 3ZMKA 4KCAA 1MDIA 2FWEA 2CA8A 3MWHA 1K3OA 5A5HB 2R0GA 4KB3A 2B7KA 1ZYEA 3GHAA 5A1NA 6GSUA 2WJUA 1A8LA 4K1FA 3MIXA 1XVQA 2LQQA 2UV8G 3VLNA 3VURA 4HEA2 3C71A 1FB0A 1AC1A 3L9VA 4PUAA 3WGXA 4D73B 5CAXA 2VL9A 2DMLA 1UA5A 1ZCPA 3RAZA 4WF5A 3IPZA 5DCHA 4EC0A 2C0FA 1GSSA 3CSHA 4L0UA 4TOPA 4EL1A 3C8EA 3LYPA 1YDKA 2YV9A 3P7XA 4IQ1A 5IO0A 3DXBA 3ZL5A 2O87A 2DLXA 1CQHA 3F4RA 3KH9A 3V1WA 1U87A 3FZ5A 1EWXA 1TRWA 1GTIA 4E8EA 1AXDA 5EY6A 1X9SB 1ON4A 4ZB8A 4MK3A 4I2TA 1WWJA 1QGVA 3QFAC 13GSA 3EWLA 2OBKA 17GSA 4GDFA 2JZSA 1TJDA 4TR0A 1Q98A 2B5EA 4TW5A 1BAYA 4ZBBA 1Z7RA 2B5XA 2JZTA 3LXZA 2H1BA 5ECSA 3GFKA 2CV4A 1V9WA 5ECLB 3LYKA 4K0GA 1OC9B 5CP1A 1W89A 2VUPA 4HUAA 3ZVJD 3W8JA 4K7IA 4Q5RA 3AY8A 2CAQA 4XTSA 1JHBA 3DGQA 3FZ4A 3PPUA 1M7TA 1OAZA 1SJIA 1WP0A 5IQYA 2K6VA 4YQUA 4BA7A 2VO4A 1K0CA 4KA0A 1ZYQB 2DBCA 1V98A 2AYTA 3BCKA 3ZYWA 1MTCA 1MEKA 1T3BA 1EEJA 1WOUA 1GSQA 4X4JA 5J9BA 2LEGA 3APQA 5DAKA 4HS1A 3FK8A 3A2XA 4V2NA 4NHWA 2YJ7A 2HSNB 2HYXA 2HSMB 2H0GA 1WPIA 3M9KA 5A5HA 1Z3EA 2DJ1A 3GUSA 2REMA 1B48A 1HNBA 2DIYA 6GSSA 1DBYA 4IN0A 2OT3A 9GSSA 4QQ7A 2TRXA 4CY8A 1XXUA 2HRFA 2B3SA 4MNNA 6GSYA 1I9DA 2YNXA 2VM2A 2CZ2A 4D73A 3OR5A 3LSZA 4TVEA 1BQ7A 2L4QA 1NHYA 4WEYA 3CRUA 3RHCA 5IO2A 3SWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J0F A;  4HJ2 A;  2OE1 A;  1IYH A;  4AJ7 A;  4EVM A;  3TKS A;  4K0N A;  5CRH A;  5B7C A;  4O7H A;  2L5L A;  3FRC A;  2H70 A;  3KCM A;  3C1S A;  3TJK A;  5ELA A;  2MMA A;  5CNW A;  2DMM A;  4LL4 B;  4K6X A;  4OFN A;  2LST A;  5EVO A;  5B8A A;  2AUV A;  2YCD A;  2O89 A;  4FH8 A;  2VL2 A;  1FG4 A;  1QQ2 A;  2BTO T;  4TKY A;  1YJ6 A;  1Z7P A;  2R2J A;  3F0I A;  3O6T A;  4BWS A;  4L5L A;  1G6W A;  4O92 A;  5IMF A;  2HRA A;  4KSM A;  4X0X A;  4XRD A;  1M2A A;  3HYP A;  2XHF A;  3GMF A;  1WE0 A;  2MBS A;  2AHE A;  2OJL A;  3ZFB A;  3IC4 A;  3IHQ A;  1TRV A;  2VIM A;  3CSI A;  2R6K A;  3C7M A;  4GSN A;  4Q5Q A;  2HNL A;  3R3E A;  2KLX A;  5HFG A;  1OC9 A;  3UBL A;  4N10 A;  5IMZ A;  4HU9 A;  1M9A A;  1PD2 1;  1JFU A;  4N11 A;  1G7E A;  4F9Z A;  3CRT A;  3IOS A;  2E0Q A;  3QPM A;  2GVP A;  2ON7 A;  1XCC A;  3TJB A;  2HZF A;  3DML A;  3N9J A;  1G0T A;  1X5C A;  3HDC A;  4OFT A;  2CAI A;  1TP9 A;  1EOH A;  1JLW A;  2H1A A;  4WBJ A;  4GWR A;  5AIX A;  1BYE A;  2XC2 A;  5F07 A;  3GIX A;  3APO A;  3G7J A;  1EP7 A;  2MMO A;  1SKR B;  2KUC A;  1OKT A;  4MP4 A;  2HRK A;  1VRS D;  4MCU A;  4EF0 A;  3TRQ A;  1IYI A;  6GSW A;  2QSI A;  3EYT A;  2HSM A;  4IQA A;  1XWG A;  2B1L A;  1PKW A;  2XBQ A;  3QMX A;  1KTE A;  5ECN B;  1F2E A;  2JU5 A;  3F6D A;  4PX1 A;  4RI7 A;  2K18 A;  1SEN A;  2CZ3 A;  2IN3 A;  16GS A;  1W4V A;  5JCU A;  2F9S A;  3TKQ A;  5JCG A;  2Z9S A;  4ULX A;  4BVX B;  2CVK A;  4G0I A;  3QAV A;  5B8B A;  1A2L A;  5JWR B;  1XVW A;  2IPA A;  1XIY A;  1GNW A;  3M1G A;  1F6M C;  5C00 A;  1SK1 A;  2KOK A;  3EVI A;  3ZRD A;  3PH9 A;  5GSS A;  4ZL9 A;  3ME8 A;  1GNE A;  1PKZ A;  4IP1 A;  4KE3 A;  4POB A;  5ECM B;  1OC3 A;  4RQR A;  4K7N A;  2GQM A;  1T8E B;  1R4W A;  3IAS 2;  3VPQ A;  3UEM A;  1GP1 A;  2IFQ B;  4ZBA A;  3M3M A;  3KJY A;  2CX4 A;  1F3B A;  5DAL B;  1SL1 B;  4KSO A;  5KN2 A;  2V32 A;  2HXK A;  3R2Q A;  3RDW A;  2PUK C;  1BED A;  2BMX A;  1PRX A;  2ON5 A;  5DJL A;  1JZR A;  3FYG A;  2VM1 A;  5AGY A;  4POM A;  1H75 A;  4PXO A;  3A2V A;  2PN8 A;  2YWO A;  4ZL7 A;  3MDK A;  1YY7 A;  1ERV A;  1LJR A;  2WCI A;  3UJ1 A;  2K9F A;  3TOU A;  2RM6 A;  1THX A;  1X5D A;  4OFM A;  5GST A;  2I3Y A;  6GSX A;  3I69 A;  5IPG A;  2GQL A;  4ZIJ A;  3QAG A;  2L57 A;  2DIZ A;  3IAM 2;  1Z5Y E;  2O85 A;  4MA9 A;  3TKS E;  5LD0 A;  3L78 A;  4H86 A;  3H1N A;  2L6D A;  4F0B A;  4NAX A;  2YPM A;  1SJZ A;  1X0R A;  1ERW A;  2X8H A;  3LWA A;  2P31 A;  3Q6O A;  3TJF A;  1XOB A;  1V57 A;  1XZO A;  1S3C A;  4DSR A;  4O5R A;  4NV2 A;  4J56 E;  1O81 A;  3QFB C;  5HFK A;  5IOX A;  1VF4 A;  5G1K A;  5J3R A;  3L4N A;  4IEL A;  2GZY A;  4BVX A;  3UMA A;  2KP2 A;  3ZTL A;  2VL2 C;  2GSQ A;  4I97 A;  4EDY A;  4ZIL A;  1PX6 A;  1JZW A;  4NXI A;  4L8E A;  3GST A;  2HE3 A;  2K8V A;  2R5G A;  2JSY A;  1GUL A;  5AN1 A;  2I9H A;  2RII A;  4QL9 A;  2DJ2 A;  5B6M A;  4XS6 A;  3P90 A;  4ML1 A;  4J2F A;  3FKF A;  2R4V A;  1PL2 A;  2IME A;  3Q74 A;  2IFQ A;  1AW9 A;  2RUF A;  2FA4 A;  3LEF A;  5DAL A;  4NWY A;  3HXS A;  1YEX A;  2LNS A;  4MZW A;  3F4T A;  3TKR A;  1NW2 A;  3HKR A;  3EU4 A;  4PQI A;  3F3R A;  2V1M A;  4TR1 A;  2VLU A;  5EL8 A;  5IPH A;  3DYR A;  5HQP A;  2TIR A;  1EGR A;  2WB9 A;  4WET A;  5GAP D;  1HYU A;  5IMC A;  2H1D A;  4K8M A;  4PUF C;  2PVO C;  3FW2 A;  3GTU B;  2LTK A;  5IMA A;  1HQO A;  1ZOF A;  3TKP A;  2E7P A;  3IXR A;  3P8W A;  2YWI A;  1GUH A;  2H19 A;  4X1U A;  5C04 A;  4DSQ A;  4IS0 A;  1R7H A;  1QFN A;  5CYY A;  2FUG 2;  1M99 A;  2DSA A;  1Z6N A;  4FQU A;  1XWC A;  1C72 A;  1O73 A;  3UAR A;  5D9W A;  5LNK e;  2VD0 A;  2RLI A;  4I6X A;  1GTU A;  3LOR A;  2B7J A;  3K8N A;  3KP9 A;  1SD9 A;  3F6F A;  2P0G A;  2LV3 A;  3I9V 2;  1DUG A;  2D2Z A;  3IRA A;  1R26 A;  3GH9 A;  1G7O A;  8GSS A;  3H8Q A;  3VWW A;  4Q5F A;  3GKX A;  1KBN A;  2H71 A;  1QK8 A;  2GQK A;  1N8J A;  5JWQ B;  2ES7 A;  2GT6 A;  1FO5 A;  1VF1 A;  1YKC A;  1AQW A;  4AF2 A;  3KH7 A;  4IGJ A;  3ZZX A;  4XS4 B;  1K0N A;  1TRU A;  1TI3 A;  3A2W A;  2OAC A;  1PQN A;  2OBI A;  3A3T A;  4TR3 A;  3O3T A;  3FHK A;  1TI1 A;  2H75 A;  4HOJ A;  2IMD A;  2EIO A;  4KH7 A;  1A2M A;  2F8A A;  4NV5 A;  2J9H A;  2MBT A;  3NZN A;  4ILF A;  2L59 A;  3GH6 A;  2DC5 A;  4MJB A;  4TRX A;  3ED3 A;  3HHV A;  2PER A;  1SD8 A;  1TW9 A;  4GCI A;  4EKZ A;  1XW5 A;  1FOV A;  2C0D A;  4MJC A;  1G6Y A;  1WRY A;  4RI6 A;  3RBT A;  1LU4 A;  4WF4 A;  1CQG A;  3UOM A;  4NHZ A;  18GS A;  4TXV A;  2HSH A;  4DEJ A;  5CRW A;  3VWU A;  2NVL A;  2AB6 A;  1YKA A;  2IMI A;  1GH2 A;  2C3N A;  5DVB A;  3ZML A;  4IBP A;  4ZXG A;  4XCS A;  2PU9 C;  1V2A A;  1GSE A;  5JWO B;  3C73 A;  2H66 A;  1Z6M A;  4WR5 A;  4E8H A;  4TR4 A;  4F0C A;  1Y6E A;  3CSJ A;  3VPT A;  2B6M A;  4HU7 A;  5HR0 A;  1S3A A;  2VD1 A;  2CQ9 A;  2YP6 A;  3F9U A;  3GTU A;  1XW6 A;  4F2I A;  4ECB A;  3QAW A;  4MPF A;  3P2A A;  4LMV A;  2YV7 A;  2H76 A;  3ERF A;  1TKD B;  3RPP A;  1TOF A;  4ID0 A;  3DIE A;  2V6K A;  3IR4 A;  2MMZ A;  5LCZ A;  3UIW A;  2DJ0 A;  3IA1 A;  2JSZ A;  4XHM A;  1T00 A;  4NPB A;  4FYB A;  2C3Q A;  5ECI B;  1OYJ A;  1U3A A;  3H79 A;  1U6T A;  3F8U A;  1MD3 A;  4GST A;  5KEJ A;  2O7K A;  3KMN A;  4MH3 A;  4JRR A;  2FY6 A;  3MAK A;  3E9J B;  5L71 A;  2MMN A;  4K7O A;  3ZIJ A;  2LKU A;  5A4V A;  4CW9 A;  1GTB A;  1PMT A;  5IMD A;  4G0L A;  4F82 A;  1H4O A;  3I6A A;  1QUW A;  2G2Q A;  2WFC A;  1A8Y A;  3L9U A;  2N5F A;  4Z7X A;  2JAC A;  4CDO A;  4RUV A;  3W6G A;  1QMV A;  3EIN A;  1GSY A;  2O8V B;  1USB A;  2OE0 A;  3DWV A;  4XS4 A;  2M46 A;  3WT1 A;  3D4T A;  3BD2 A;  5HR2 A;  3N5O A;  2BJX A;  4K2D A;  3WGD A;  3Q19 A;  19GS A;  1GTA A;  3MSZ A;  3VFI A;  2LJR A;  1I5G A;  4ZB6 A;  3TJG A;  2GST A;  3J7Y b;  1U3I A;  2PPT A;  1YZX A;  3WT2 A;  1SK0 A;  4BVY B;  2HQT A;  2VCT A;  4QL7 A;  3UAP A;  1XFL A;  1LBK A;  1FVJ A;  4YAP A;  3BCI A;  3DVX A;  1GUM A;  4KW6 A;  1ERT A;  1B8X A;  1V40 A;  2FNO A;  4MF5 A;  4AGS A;  4MDC A;  1OC8 A;  1NHO A;  3HVS A;  1E2Y A;  22GS A;  1TU8 A;  2PWJ A;  2KHP A;  1PL1 A;  3HA9 A;  3KXO A;  1GSF A;  2LS5 A;  4L5O A;  3DEX A;  1J9B A;  2GZZ A;  3QOU A;  3LGC A;  1M9B A;  5EPF A;  4IJI A;  2GSS A;  2CT6 A;  5G2Z A;  1ACV A;  4N0V A;  1NM3 A;  2R3X A;  5DQS A;  1TXX A;  1KNG A;  1RK4 A;  1ZGN A;  1UVZ A;  1ERU A;  1O8X A;  3GKN A;  1F3A A;  3GKK A;  5F0G A;  5J5N A;  2X8G A;  3UBK A;  3KP8 A;  1YEP A;  5ECO B;  1U88 A;  1AAZ A;  5A4W A;  4LL1 B;  3HZ4 A;  4EUY A;  2HT9 A;  2OKA A;  1YQ1 A;  4POL A;  4GLT A;  1PN9 A;  2H6Y A;  2FHE A;  5CRD A;  1FHE A;  4ZB9 A;  3LQ7 A;  3ZLP A;  3KMO A;  2AJQ B;  4MH2 A;  4V1A p;  3VWV A;  5A5K A;  5F8B A;  2HSY A;  3GA4 A;  4F03 A;  2NDO A;  2GT5 A;  2WUL A;  1K0A A;  4YH2 A;  3IV4 A;  2P5R A;  3KD0 A;  3UVT A;  3DKS A;  2LJA A;  3GV1 A;  4V2L A;  3M9J A;  3E3E A;  4L0W A;  2IIY A;  1EGO A;  4FIW A;  4IKH A;  3US3 A;  4Q5N A;  20GS A;  4FO5 A;  4HDE A;  4OMV A;  2VL3 A;  4MJE A;  3ME7 A;  2A2S A;  1FVK A;  3A5W A;  4HJM A;  3EU3 A;  14GS A;  3PIN A;  2FA8 A;  2JAD A;  4HQZ A;  10GS A;  5DCG A;  5A4U A;  1Z9H A;  4WKW A;  1JZO A;  3VI5 A;  1SYR A;  2VCQ A;  3TGZ A;  1R5P A;  4EXJ A;  4BVY A;  4IHU A;  5CRE A;  1O6J A;  1DE2 A;  1HNC A;  4KAE A;  1XOA A;  2DJK A;  4WXT A;  3TKS C;  3TCO A;  1TK0 B;  3Q18 A;  2ZUP A;  4PTS A;  3IK7 A;  2JZR A;  2E2G A;  5B6N A;  3FZ9 A;  2H01 A;  3L9S A;  4I5Q A;  5J4U A;  2IMF A;  3HVX A;  3KM6 A;  2ALB A;  4POK A;  5D9V A;  3DRN A;  4J57 E;  1TDI A;  4KDX A;  4MF6 A;  1T7P B;  2L5O A;  4YQM A;  4AJ8 A;  4ISD A;  1MDK A;  5ELG A;  1NSW A;  2GTU A;  3EMX A;  4MPG A;  1URM A;  3DD3 A;  2I4A A;  5FT3 A;  1K3Y A;  1RQM A;  1B9X C;  1K0O A;  3FR9 A;  2E2M A;  1PA3 A;  3ISO A;  2GGT A;  1O7U A;  4HQS A;  3O76 A;  2VCX A;  2FCH A;  4IP6 A;  3EE2 A;  4IW9 A;  2H74 A;  4BPY A;  3LJR A;  4XIH A;  2XPE A;  5IM9 A;  2LJK A;  3RPN A;  4LMW A;  3D4M A;  3ZIT A;  2GLR A;  1S3D A;  3GN3 A;  5F05 A;  1A2J A;  4FYU A;  3GYK A;  5ID2 B;  1O8W A;  1M2B A;  1ST9 A;  3HZ8 A;  3GKM A;  3GNJ A;  1GUK A;  4ECC A;  2HLS A;  3HD5 A;  4USS A;  3GX0 A;  3M8N A;  3ERW A;  5DDL A;  3APS A;  1F37 A;  1QXH A;  3IBH A;  1PSQ A;  3H4K A;  1HD2 A;  3G7Y A;  1MD4 A;  5G31 A;  2LRT A;  4ECJ A;  2C0E A;  1ABA A;  2A2R A;  3CXG A;  1EEM A;  4WBR D;  2G0F A;  2OE3 A;  3GX8 A;  2F8F A;  1VF3 A;  2F51 A;  2QGV A;  4PNF A;  2X8C A;  1GWC A;  2WDU A;  3CTF A;  1SKS B;  5F06 A;  1FW1 A;  4KGI A;  4CHS A;  1TK5 B;  4PGT A;  2NTO A;  2HZE B;  2H73 A;  2RUE A;  3TRP A;  1B4Q A;  3PR8 A;  3FR3 A;  2M80 A;  1T4Z A;  2HFD A;  2N5A A;  2LQO A;  1X9M B;  4MLY A;  2WRT A;  2LUS A;  1EV4 A;  2H72 A;  3TJJ A;  2RM5 A;  3WYW A;  4MMM A;  2GS3 A;  4LA1 A;  4GF0 A;  1GSU A;  1K0D A;  4MAB A;  1DSB A;  3EMP A;  2WGR A;  1M2D A;  4JED A;  1A0R P;  3U6V A;  3M0F A;  1RW1 A;  2DJJ A;  3VK9 A;  3E0U A;  1A24 A;  1KEB A;  3F4S A;  4HZ4 A;  1X5E A;  2B5Y A;  2V2G A;  2I81 A;  4JBB A;  3GRX A;  2CVB A;  2A4V A;  5FHI A;  1R5A A;  4EE0 A;  4YQV A;  5HFI A;  4BWQ A;  1YF1 A;  1TK8 B;  2WS2 A;  1XWB A;  3QDN A;  3QR6 A;  5DQY A;  4JR4 A;  1T1V A;  5KN3 A;  1ILO A;  3LXT A;  3BOA A;  2C4J A;  1EOG A;  2LRN A;  2M72 A;  2WZ9 A;  3FR6 A;  1WIK A;  1UN2 A;  5INY A;  2TRC P;  5KN1 A;  2YOI A;  2CX3 A;  2VCZ A;  3BBY A;  4OCF A;  2OAD A;  5CRG A;  4DSS B;  2JL4 A;  4BL7 B;  2AAW A;  2PGT A;  5H5Q A;  2X99 A;  1EV9 A;  2HRK B;  4ZL8 A;  2MZC A;  3RHB A;  5ID2 A;  1N2A A;  4N0Z A;  3IE3 A;  4TN8 A;  2YZU A;  4XRA A;  4OO5 A;  1ZZY A;  5ECR B;  4G10 A;  4ACS A;  2YJH A;  1UC7 A;  1FAA A;  4I8B A;  2H0I A;  3CMI A;  5ENU A;  1SJ6 A;  4GTU A;  2HRN A;  4KX4 A;  1AQV A;  1PX7 A;  3ERG A;  2H0H A;  2PBJ A;  2VLV A;  3JCM L;  1THO A;  3UVH A;  4MZC A;  2H8L A;  2FLS A;  3FZA A;  1K0M A;  3HJO A;  3CYN A;  2DJ3 A;  1GLQ A;  3U5R E;  1OVN A;  4OO4 A;  1V58 A;  2C1Y A;  2OA7 A;  1GSD A;  2HZE A;  4KND A;  5JCW A;  5IIZ A;  4XS1 A;  3NOF A;  2R37 A;  4GQF A;  1XWA A;  5D8I A;  4OD7 A;  1SL2 B;  2VOC A;  1BG5 A;  1EZK A;  1EP8 A;  3HVV A;  4GXZ A;  3EC3 A;  2H30 A;  3S9F A;  2L4C A;  2XBI A;  5DJM A;  1BJX A;  4P3Y B;  3KTL A;  3DVW A;  3WD6 A;  4OCE A;  3PGT A;  1T4Y A;  5COH A;  5CO3 A;  3HCZ A;  1AIU A;  2EIQ A;  2FGX A;  1GL8 A;  4I2U A;  2V6O A;  2ZCT A;  2IMK A;  3F63 A;  2UZ8 A;  3VI7 A;  4X43 A;  5ECQ B;  4ECI A;  3TRX A;  1SYX A;  5ECP B;  3ZVJ A;  2K8S A;  2P5Q A;  4EDZ A;  4PNG A;  4PQ1 A;  3KZQ A;  2GDR A;  2FWH A;  3TDG A;  5E59 A;  1BX9 A;  1JZD A;  4MZB A;  2VCV A;  3IDV A;  12GS A;  4JU5 A;  3L0H A;  4TXO B;  5IMV A;  3I43 A;  4MF7 A;  1WJK A;  4KDY A;  5D96 A;  3GL3 A;  5G5E A;  1JLV A;  2KP1 A;  4IVF A;  3C1R A;  4G2E A;  4GQC A;  1A23 A;  2J23 A;  4N30 A;  4DSS A;  5AIV A;  4BL7 A;  1TU7 A;  2FWF A;  4K9Z A;  1Y25 A;  2L6C A;  1XW9 A;  4V1A g;  3GL5 A;  5HR3 A;  5D9T A;  2IWT A;  4AJ6 A;  4PQH A;  2YZH A;  3FEU A;  2B1K A;  4MJA A;  1XWK A;  2GZP A;  4WR4 A;  3IC8 A;  1PGT A;  3ZRE A;  3H93 A;  5J9C A;  1SL0 B;  3G9B A;  2FWG A;  3J7Y k;  2C3T A;  11GS A;  1XBS A;  3SBC A;  1OE7 A;  2H6Z A;  2XPD A;  1TRS A;  3D5J A;  2VLT A;  5ECK B;  5H5R A;  2H1G A;  2QC7 A;  2YN1 A;  2AV4 A;  2VAF A;  1E6B A;  1Q4J A;  3HY2 A;  4JZQ A;  4KCE A;  5G30 A;  3QD9 A;  3MNG A;  4OWY A;  3D22 A;  2YAN A;  5E4W A;  4KDU A;  4LLR A;  4HI7 A;  3TUE A;  5GAN D;  1FB6 A;  2YWM A;  3G7I A;  3KIJ A;  4FYC A;  1MDJ A;  4KF9 A;  4NMU A;  5D73 A;  3GSS A;  7GSS A;  3KEB A;  3HJP A;  4TR1 B;  5H5S A;  2H6X A;  4PUR A;  3BJ5 A;  4O32 A;  3KTB A;  3WGE A;  3GUR A;  4V2M A;  1GLP A;  5AIS A;  1B9Y C;  1XPV A;  3TOT A;  1DE1 A;  4ZBD A;  2I1U A;  4IJ3 A;  5G5F A;  1TTZ A;  1YF0 A;  1VF2 A;  2QKE A;  6GSV A;  2NPB A;  2VCW A;  3QCP A;  1GRX A;  3D0Z A;  2V41 A;  5IOW A;  1A0F A;  5DBQ A;  3KGK A;  1ZMA A;  2CVD A;  3VWX A;  4JE1 A;  1AUC A;  4TXO A;  1HNA A;  1K3L A;  4HZ2 A;  4YAV A;  3CBU A;  5BMU A;  2HI7 A;  1M0U A;  3IK9 A;  3NIV A;  1AQX A;  4GRF A;  3LG6 A;  4G9H A;  1F9M A;  2LRC A;  1SK2 A;  3ZFL A;  2YWN A;  5D93 A;  1SU9 A;  4GSS A;  2GSR A;  1ZL9 A;  1SKW B;  2LNT A;  4G19 A;  2ZNM A;  5G1L A;  3EUR A;  5ABR A;  4DVC A;  2EC4 A;  1K0B A;  2C0G A;  1OKD A;  2PVQ A;  3F3Q A;  2NBS A;  1O85 A;  3W8S A;  2IJY A;  3D21 A;  5D9X A;  1VGL A;  2PMT A;  5FWG A;  2X64 A;  1B4P A;  1OE8 A;  3D6I A;  5HR1 A;  4JR6 A;  6GST A;  4G0K A;  3ZIV A;  5KN0 A;  4KUN A;  5ECH B;  2EIR A;  2MYG A;  1J08 A;  3TB2 A;  3UL3 A;  1ML6 A;  2N5B A;  2FD3 A;  3CTG A;  3HJM A;  2C80 A;  4EO3 A;  3FY7 A;  5DAK B;  2C8U A;  3LFL A;  5GZZ B;  2IL3 A;  5J41 A;  2F3M A;  1WMJ A;  4ML6 A;  1X9W B;  4RQX A;  3ZMK A;  4KCA A;  1MDI A;  2FWE A;  2CA8 A;  3MWH A;  1K3O A;  4KB3 A;  2B7K A;  1ZYE A;  3GHA A;  6GSU A;  2WJU A;  1A8L A;  4K1F A;  1XVQ A;  2LQQ A;  3VLN A;  3VUR A;  4HEA 2;  3C71 A;  1FB0 A;  1AC1 A;  3L9V A;  4PUA A;  3WGX A;  4D73 B;  5CAX A;  2VL9 A;  2DML A;  1UA5 A;  1ZCP A;  3RAZ A;  4WF5 A;  3IPZ A;  5DCH A;  4EC0 A;  2C0F A;  1GSS A;  3CSH A;  4L0U A;  4TOP A;  4EL1 A;  3C8E A;  3LYP A;  1YDK A;  2YV9 A;  3P7X A;  4IQ1 A;  5IO0 A;  3DXB A;  3ZL5 A;  2O87 A;  2DLX A;  1CQH A;  3F4R A;  3KH9 A;  3V1W A;  1U87 A;  3FZ5 A;  1EWX A;  1TRW A;  1GTI A;  4E8E A;  1AXD A;  5EY6 A;  1X9S B;  1ON4 A;  4ZB8 A;  4MK3 A;  4I2T A;  1WWJ A;  1QGV A;  3QFA C;  13GS A;  3EWL A;  2OBK A;  17GS A;  2JZS A;  1TJD A;  4TR0 A;  1Q98 A;  2B5E A;  4TW5 A;  1BAY A;  4ZBB A;  1Z7R A;  2B5X A;  2JZT A;  3LXZ A;  2H1B A;  5ECS A;  3GFK A;  2CV4 A;  1V9W A;  5ECL B;  3LYK A;  4K0G A;  1OC9 B;  5CP1 A;  1W89 A;  2VUP A;  4HUA A;  3ZVJ D;  3W8J A;  4K7I A;  4Q5R A;  3AY8 A;  2CAQ A;  4XTS A;  1JHB A;  3DGQ A;  3FZ4 A;  3PPU A;  1M7T A;  1OAZ A;  1SJI A;  1WP0 A;  5IQY A;  2K6V A;  4YQU A;  4BA7 A;  2VO4 A;  1K0C A;  4KA0 A;  1ZYQ B;  2DBC A;  1V98 A;  2AYT A;  3BCK A;  3ZYW A;  1MTC A;  1MEK A;  1T3B A;  1EEJ A;  1WOU A;  1GSQ A;  5J9B A;  2LEG A;  3APQ A;  5DAK A;  4HS1 A;  3FK8 A;  3A2X A;  4V2N A;  4NHW A;  2YJ7 A;  2HSN B;  2HYX A;  2HSM B;  2H0G A;  1WPI A;  3M9K A;  1Z3E A;  2DJ1 A;  3GUS A;  2REM A;  1B48 A;  1HNB A;  2DIY A;  6GSS A;  1DBY A;  4IN0 A;  9GSS A;  4QQ7 A;  2TRX A;  1XXU A;  2HRF A;  2B3S A;  6GSY A;  1I9D A;  2YNX A;  2VM2 A;  2CZ2 A;  4D73 A;  3OR5 A;  3LSZ A;  4TVE A;  1BQ7 A;  2L4Q A;  1NHY A;  4WEY A;  3CRU A;  3RHC A;  5IO2 A;  3SWL A; 
#chains in the Genus database with same CATH topology
 1J0F A;  4HJ2 A;  2OE1 A;  1IYH A;  1BF5 A;  4AJ7 A;  4EVM A;  3TKS A;  4K0N A;  5CRH A;  5B7C A;  4K5S A;  4O7H A;  2L5L A;  3FRC A;  2H70 A;  3KCM A;  3C1S A;  3TJK A;  5ELA A;  4AI6 A;  2MMA A;  5CNW A;  2DMM A;  4LL4 B;  4K6X A;  4OFN A;  2LST A;  5EVO A;  5B8A A;  2AUV A;  2YCD A;  2O89 A;  1FOH A;  4FH8 A;  2VL2 A;  1FG4 A;  1QQ2 A;  2BTO T;  4TKY A;  1YJ6 A;  1Z7P A;  2R2J A;  3F0I A;  4HSC X;  3O6T A;  4BWS A;  1ZYP A;  4L5L A;  1G6W A;  4O92 A;  5IMF A;  2HRA A;  4KSM A;  4X0X A;  4XRD A;  1M2A A;  3HYP A;  2XHF A;  3GMF A;  1WE0 A;  3CWG A;  2MBS A;  2AHE A;  2OJL A;  3ZFB A;  3IC4 A;  3IHQ A;  4A5P A;  1TRV A;  2VIM A;  3CSI A;  2R6K A;  3C7M A;  4GSN A;  4Q5Q A;  2HNL A;  3R3E A;  2KLX A;  5HFG A;  1OC9 A;  3UBL A;  4N10 A;  5IMZ A;  4HU9 A;  1M9A A;  1PD2 1;  1JFU A;  4N11 A;  1G7E A;  4F9Z A;  3CRT A;  3IOS A;  2E0Q A;  3QPM A;  2GVP A;  2ON7 A;  1XCC A;  3TJB A;  2HZF A;  3DML A;  3N9J A;  1G0T A;  1X5C A;  3HDC A;  4OFT A;  2CAI A;  1TP9 A;  1EOH A;  1JLW A;  2H1A A;  4WBJ A;  4GWR A;  5AIX A;  1BYE A;  2XC2 A;  5F07 A;  3GIX A;  2O5V A;  3APO A;  3G7J A;  1EP7 A;  2MMO A;  1SKR B;  2KUC A;  1OKT A;  4MP4 A;  2HRK A;  1VRS D;  4MCU A;  4EF0 A;  3TRQ A;  2HSN A;  2QSI A;  1IYI A;  6GSW A;  3EYT A;  2HSM A;  4IQA A;  1XWG A;  2B1L A;  1PKW A;  2XBQ A;  3QMX A;  1KTE A;  5ECN B;  1F2E A;  2JU5 A;  3F6D A;  4PX1 A;  4RI7 A;  2K18 A;  1SEN A;  2CZ3 A;  2IN3 A;  16GS A;  1W4V A;  5JCU A;  3LW9 A;  2F9S A;  3TKQ A;  5JCG A;  2Z9S A;  4ULX A;  4BVX B;  2CVK A;  4G0I A;  3QAV A;  5B8B A;  1A2L A;  5JWR B;  1XVW A;  2IPA A;  1XIY A;  1M3J A;  1GNW A;  3M1G A;  1F6M C;  5C00 A;  1SK1 A;  2KOK A;  3EVI A;  3ZRD A;  3PH9 A;  5GSS A;  4ZL9 A;  3ME8 A;  1GNE A;  1PKZ A;  4IP1 A;  4KE3 A;  4POB A;  5ECM B;  1OC3 A;  4RQR A;  2WW3 A;  4K7N A;  5J4Y A;  2GQM A;  1T8E B;  1R4W A;  3IAS 2;  3VPQ A;  3UEM A;  1GP1 A;  2IFQ B;  4ZBA A;  3M3M A;  3KJY A;  2CX4 A;  1F3B A;  5DAL B;  1SL1 B;  4KSO A;  5KN2 A;  2V32 A;  4CY6 A;  2HXK A;  3R2Q A;  3RDW A;  2PUK C;  1BED A;  2BMX A;  1PRX A;  2ON5 A;  5DJL A;  1JZR A;  3FYG A;  2VM1 A;  5AGY A;  4POM A;  1H75 A;  4PXO A;  3A2V A;  2PN8 A;  2YWO A;  4ZL7 A;  1YEW C;  3MDK A;  1YY7 A;  1ERV A;  1LJR A;  2WCI A;  3UJ1 A;  2K9F A;  3TOU A;  2RM6 A;  1THX A;  1X5D A;  4OFM A;  5GST A;  2I3Y A;  6GSX A;  3I69 A;  4ICY A;  5IPG A;  2GQL A;  4ZIJ A;  3QAG A;  2L57 A;  2DIZ A;  3IAM 2;  4N3Z A;  1Z5Y E;  2O85 A;  4MA9 A;  3TKS E;  5LD0 A;  3L78 A;  4H86 A;  3H1N A;  2L6D A;  4F0B A;  4NAX A;  2YPM A;  1SJZ A;  1X0R A;  1ERW A;  2X8H A;  3LWA A;  2P31 A;  3Q6O A;  3TJF A;  1XOB A;  1V57 A;  4BIK A;  1XZO A;  1S3C A;  4DSR A;  4O5R A;  4NV2 A;  4J56 E;  1YVL A;  1O81 A;  3QFB C;  5HFK A;  5IOX A;  1VF4 A;  5G1K A;  5J3R A;  3L4N A;  4IEL A;  2GZY A;  4BVX A;  4EIQ A;  3UMA A;  2KP2 A;  3ZTL A;  2VL2 C;  2GSQ A;  4I97 A;  4EDY A;  4ZIL A;  1PX6 A;  1JZW A;  4NXI A;  4L8E A;  3GST A;  2HE3 A;  2K8V A;  2EFC A;  2R5G A;  2JSY A;  1GUL A;  5AN1 A;  2I9H A;  2RII A;  4QL9 A;  2DJ2 A;  5B6M A;  2X4A A;  4XS6 A;  3P90 A;  4ML1 A;  4J2F A;  3FKF A;  2R4V A;  1PL2 A;  2IME A;  3Q74 A;  2IFQ A;  1AW9 A;  2RUF A;  4Z2T A;  2FA4 A;  3LEF A;  3FMW A;  5DAL A;  4NWY A;  3HXS A;  1YEX A;  2LNS A;  4MZW A;  3F4T A;  3TKR A;  5A34 B;  1NW2 A;  3HKR A;  3EU4 A;  4PQI A;  3F3R A;  2V1M A;  4TR1 A;  2VLU A;  5EL8 A;  5IPH A;  3DYR A;  5HQP A;  2TIR A;  1EGR A;  4AKG A;  2WB9 A;  4WET A;  3EPT A;  2WVZ A;  5GAP D;  1HYU A;  4K5R A;  5IMC A;  2H1D A;  4K8M A;  4PUF C;  2PVO C;  3FW2 A;  3GTU B;  2LTK A;  5IMA A;  1HQO A;  1ZOF A;  3TKP A;  2E7P A;  2EFE A;  3IXR A;  3P8W A;  2YWI A;  1GUH A;  2H19 A;  4X1U A;  5C04 A;  4DSQ A;  4IS0 A;  1R7H A;  4YKG A;  1QFN A;  5CYY A;  2FUG 2;  1M99 A;  2DSA A;  4FXY P;  1Z6N A;  4FQU A;  1XWC A;  2DKH A;  1C72 A;  1O73 A;  3UAR A;  5D9W A;  5LNK e;  2VD0 A;  2RLI A;  2DKI A;  4I6X A;  1GTU A;  3LOR A;  2B7J A;  3K8N A;  3KP9 A;  1SD9 A;  2WZS A;  3F6F A;  2P0G A;  2LV3 A;  3I9V 2;  1DUG A;  2D2Z A;  3IRA A;  1R26 A;  3GH9 A;  1G7O A;  8GSS A;  3H8Q A;  3VWW A;  4Q5F A;  3GKX A;  1KBN A;  1SVL A;  2H71 A;  1QK8 A;  2GQK A;  1N8J A;  5JWQ B;  2ES7 A;  2R0P A;  2GT6 A;  1FO5 A;  1VF1 A;  1YKC A;  1AQW A;  4AF2 A;  3KH7 A;  4IGJ A;  3CQF A;  3ZZX A;  4XS4 B;  1K0N A;  1TRU A;  1TI3 A;  3A2W A;  2OAC A;  1PQN A;  2OBI A;  3A3T A;  4TR3 A;  3O3T A;  3FHK A;  1TI1 A;  2H75 A;  4HOJ A;  2IMD A;  2EIO A;  4KH7 A;  1A2M A;  2F8A A;  4NV5 A;  2J9H A;  2MBT A;  3NZN A;  4ILF A;  2L59 A;  3GH6 A;  2DC5 A;  4MJB A;  4TRX A;  3ED3 A;  3HHV A;  2PER A;  1SD8 A;  1TW9 A;  4GCI A;  4EKZ A;  1XW5 A;  1FOV A;  2C0D A;  4MJC A;  1G6Y A;  1WRY A;  4RI6 A;  3RBT A;  1LU4 A;  4WF4 A;  1CQG A;  1TXU A;  3UOM A;  5A34 A;  4NHZ A;  18GS A;  4TXV A;  2HSH A;  4DEJ A;  5CRW A;  3VWU A;  2NVL A;  2AB6 A;  1YKA A;  2IMI A;  1GH2 A;  2C3N A;  5DVB A;  3ZML A;  4IBP A;  4ZXG A;  4XCS A;  2PU9 C;  1V2A A;  1GSE A;  5JWO B;  3C73 A;  2H66 A;  1Z6M A;  4WR5 A;  4E8H A;  4TR4 A;  4F0C A;  1Y6E A;  3CSJ A;  3VPT A;  2B6M A;  4PHZ C;  4HU7 A;  5HR0 A;  1S3A A;  2VD1 A;  1S4B P;  2CQ9 A;  2YP6 A;  3F9U A;  3GTU A;  1XW6 A;  4F2I A;  4ECB A;  3QAW A;  4MPF A;  3P2A A;  4LMV A;  2YV7 A;  3HVN A;  2H76 A;  3ERF A;  1TKD B;  3RPP A;  1TOF A;  4ID0 A;  3DIE A;  2V6K A;  3IR4 A;  2MMZ A;  5LCZ A;  3UIW A;  2DJ0 A;  3IA1 A;  2JSZ A;  4XHM A;  1T00 A;  4NPB A;  4FYB A;  2C3Q A;  5ECI B;  1OYJ A;  1U3A A;  3H79 A;  1U6T A;  3F8U A;  1MD3 A;  4GST A;  1SVO A;  5KEJ A;  2O7K A;  4Z2R A;  3KMN A;  4MH3 A;  4JRR A;  2FY6 A;  3MAK A;  4W66 A;  3E9J B;  5L71 A;  2MMN A;  4K7O A;  3ZIJ A;  2LKU A;  5A4V A;  4CW9 A;  1GTB A;  1PMT A;  5IMD A;  4G0L A;  4F82 A;  1H4O A;  3I6A A;  1QUW A;  2G2Q A;  2WFC A;  1A8Y A;  3L9U A;  2N5F A;  4Z7X A;  2JAC A;  4CDO A;  4RUV A;  3W6G A;  1QMV A;  3EIN A;  1GSY A;  2O8V B;  1USB A;  2VKZ G;  2OE0 A;  3DWV A;  4XS4 A;  2M46 A;  3WT1 A;  3D4T A;  3BD2 A;  5HR2 A;  3N5O A;  2BJX A;  4K2D A;  3WGD A;  3HMJ G;  3Q19 A;  19GS A;  1GTA A;  3MSZ A;  3VFI A;  2LJR A;  1I5G A;  4ZB6 A;  3TJG A;  2GST A;  3J7Y b;  1U3I A;  2PPT A;  4PI0 C;  4AKI A;  1YZX A;  3WT2 A;  1SK0 A;  4BVY B;  2HQT A;  2VCT A;  4QL7 A;  3UAP A;  1XFL A;  1LBK A;  1FVJ A;  4YAP A;  3BCI A;  3DVX A;  1GUM A;  4KW6 A;  1ERT A;  1B8X A;  1V40 A;  2FNO A;  4MF5 A;  4AGS A;  4MDC A;  1OC8 A;  1NHO A;  3HVS A;  1PN0 A;  1E2Y A;  22GS A;  1TU8 A;  2PWJ A;  2KHP A;  1PL1 A;  3HA9 A;  3KXO A;  1GSF A;  2LS5 A;  4L5O A;  3DEX A;  1J9B A;  2GZZ A;  3QOU A;  3LGC A;  1M9B A;  5EPF A;  4IJI A;  2GSS A;  2CT6 A;  5G2Z A;  1ACV A;  4N0V A;  1Y1U A;  1NM3 A;  2R3X A;  5DQS A;  1TXX A;  1KNG A;  1RK4 A;  1ZGN A;  1UVZ A;  1ERU A;  1O8X A;  3GKN A;  1F3A A;  3GKK A;  5F0G A;  5J5N A;  2X8G A;  4PI2 C;  3UBK A;  3KP8 A;  1YEP A;  5ECO B;  1U88 A;  1AAZ A;  5A4W A;  4LL1 B;  3HZ4 A;  4EUY A;  2HT9 A;  2OKA A;  1YQ1 A;  4POL A;  4GLT A;  1PN9 A;  2H6Y A;  2FHE A;  5CRD A;  1FHE A;  4ZB9 A;  3LQ7 A;  3ZLP A;  3KMO A;  2AJQ B;  4MH2 A;  4V1A p;  3VWV A;  5A5K A;  5F8B A;  2HSY A;  3GA4 A;  4F03 A;  2NDO A;  2GT5 A;  2WUL A;  1K0A A;  2WVY A;  4YH2 A;  3IV4 A;  2P5R A;  3KD0 A;  3UVT A;  3DKS A;  2LJA A;  3GV1 A;  4V2L A;  3M9J A;  3E3E A;  4L0W A;  2IIY A;  1EGO A;  4FIW A;  4IKH A;  3US3 A;  4Q5N A;  20GS A;  4FO5 A;  4HDE A;  4OMV A;  2VL3 A;  4MJE A;  3ME7 A;  2A2S A;  1FVK A;  3A5W A;  4HJM A;  3EU3 A;  14GS A;  3PIN A;  2FA8 A;  2JAD A;  4HQZ A;  10GS A;  5DCG A;  5A4U A;  1Z9H A;  4WKW A;  1JZO A;  3VI5 A;  1SYR A;  2VCQ A;  3TGZ A;  1R5P A;  4EXJ A;  4BVY A;  4IHU A;  5CRE A;  1O6J A;  1DE2 A;  1HNC A;  4KAE A;  1XOA A;  2DJK A;  4WXT A;  3TKS C;  3TCO A;  1TK0 B;  3Q18 A;  2ZUP A;  4PTS A;  3IK7 A;  2JZR A;  2E2G A;  5B6N A;  3FZ9 A;  2H01 A;  3L9S A;  4I5Q A;  5J4U A;  2IMF A;  1M3I A;  3HVX A;  3KM6 A;  2ALB A;  4POK A;  5D9V A;  3DRN A;  4J57 E;  1TDI A;  4KDX A;  4MF6 A;  1T7P B;  2L5O A;  4YQM A;  4AJ8 A;  4ISD A;  1MDK A;  5ELG A;  1NSW A;  2GTU A;  3EMX A;  4MPG A;  1URM A;  3DD3 A;  2I4A A;  2QA2 A;  5FT3 A;  1K3Y A;  1RQM A;  1B9X C;  1K0O A;  3FR9 A;  2E2M A;  1PA3 A;  3ISO A;  2GGT A;  1O7U A;  4HQS A;  3O76 A;  2VCX A;  2O3E A;  2FCH A;  4IP6 A;  3EE2 A;  4IW9 A;  2H74 A;  4BPY A;  3LJR A;  4XIH A;  2XPE A;  5IM9 A;  2LJK A;  3RPN A;  4LMW A;  3D4M A;  3ZIT A;  2GLR A;  1S3D A;  3GN3 A;  5F05 A;  1A2J A;  4FYU A;  3GYK A;  5ID2 B;  1O8W A;  4YKF A;  1M2B A;  1ST9 A;  3HZ8 A;  3GKM A;  3GNJ A;  1GUK A;  4ECC A;  2HLS A;  3HD5 A;  4USS A;  3GX0 A;  3M8N A;  3ERW A;  5DDL A;  3APS A;  1F37 A;  1QXH A;  3IBH A;  1PSQ A;  3H4K A;  3TU3 B;  1HD2 A;  3G7Y A;  1MD4 A;  5G31 A;  2LRT A;  4ECJ A;  2C0E A;  1ABA A;  2A2R A;  3CXG A;  5J40 A;  1EEM A;  4WBR D;  2G0F A;  2OE3 A;  3GX8 A;  2F8F A;  1VF3 A;  2F51 A;  2QGV A;  4PNF A;  2X8C A;  1GWC A;  2WDU A;  3CTF A;  3IHG A;  1SKS B;  5F06 A;  1FW1 A;  4KGI A;  4CHS A;  1TK5 B;  2WW1 A;  4PGT A;  2NTO A;  2HZE B;  2H73 A;  2RUE A;  3TRP A;  1B4Q A;  3FR3 A;  3PR8 A;  2M80 A;  1T4Z A;  2HFD A;  2N5A A;  2LQO A;  1X9M B;  4MLY A;  2WRT A;  2LUS A;  1EV4 A;  2WVX B;  2H72 A;  3TJJ A;  2RM5 A;  3WYW A;  4MMM A;  2GS3 A;  4LA1 A;  4GF0 A;  1GSU A;  1K0D A;  4MAB A;  1DSB A;  3EMP A;  2WGR A;  3A5I A;  1M2D A;  4JED A;  1A0R P;  3U6V A;  3M0F A;  1RW1 A;  2DJJ A;  3VK9 A;  3E0U A;  1A24 A;  1KEB A;  3F4S A;  4HZ4 A;  1X5E A;  2B5Y A;  2V2G A;  2I81 A;  4JBB A;  3GRX A;  2CVB A;  2A4V A;  5FHI A;  1R5A A;  4EE0 A;  4YQV A;  5HFI A;  4BWQ A;  1YF1 A;  4EIP A;  1TK8 B;  2WS2 A;  1PFO A;  1XWB A;  3QDN A;  3QR6 A;  5DQY A;  4JR4 A;  1T1V A;  5KN3 A;  1ILO A;  3LXT A;  3BOA A;  2C4J A;  2QA1 A;  1EOG A;  2LRN A;  2M72 A;  2WZ9 A;  3FR6 A;  1WIK A;  1UN2 A;  4ZB7 A;  5INY A;  5KOW A;  2TRC P;  5KN1 A;  2YOI A;  2CX3 A;  4K2X A;  2VCZ A;  3BBY A;  4OCF A;  2OAD A;  5CRG A;  4DSS B;  2JL4 A;  4BL7 B;  2AAW A;  2PGT A;  5H5Q A;  2X99 A;  1EV9 A;  2HRK B;  2WW2 A;  4ZL8 A;  2MZC A;  3RHB A;  5ID2 A;  1N2A A;  4N0Z A;  3IE3 A;  4TN8 A;  2YZU A;  4XRA A;  4OO5 A;  1ZZY A;  5ECR B;  4G10 A;  4ACS A;  2YJH A;  1UC7 A;  1FAA A;  4I8B A;  2H0I A;  3CMI A;  5ENU A;  1SJ6 A;  4GTU A;  2HRN A;  4KX4 A;  1AQV A;  1PX7 A;  3ERG A;  2H0H A;  2PBJ A;  2VLV A;  3JCM L;  1THO A;  3UVH A;  4MZC A;  2H8L A;  2FLS A;  3FZA A;  1K0M A;  3HJO A;  3CYN A;  4Z2U A;  2DJ3 A;  1GLQ A;  3U5R E;  1OVN A;  4OO4 A;  1V58 A;  2C1Y A;  2OA7 A;  1GSD A;  2HZE A;  4KND A;  5JCW A;  5IIZ A;  4QMK A;  4XS1 A;  3NOF A;  2R37 A;  4GQF A;  1XWA A;  5D8I A;  4OD7 A;  1SL2 B;  2VOC A;  2WVX A;  1BG5 A;  1EZK A;  1EP8 A;  2H1L A;  3HVV A;  4GXZ A;  1ZYN A;  3EC3 A;  2H30 A;  3S9F A;  2L4C A;  2XBI A;  5DJM A;  1BJX A;  4P3Y B;  3KTL A;  3DVW A;  3WD6 A;  4OCE A;  5BRT A;  3PGT A;  1T4Y A;  5COH A;  5CO3 A;  3HCZ A;  1AIU A;  2EIQ A;  2FGX A;  1GL8 A;  4I2U A;  2V6O A;  2ZCT A;  2IMK A;  3F63 A;  2UZ8 A;  3VI7 A;  4X43 A;  5ECQ B;  4ECI A;  3TRX A;  1SYX A;  5ECP B;  5KOX A;  3ZVJ A;  2K8S A;  2P5Q A;  5J47 A;  4EDZ A;  4PNG A;  4PQ1 A;  3KZQ A;  2GDR A;  2FWH A;  3TDG A;  5E59 A;  1BX9 A;  1JZD A;  4MZB A;  2VCV A;  3IDV A;  2O36 A;  12GS A;  4JU5 A;  3L0H A;  4TXO B;  5IMV A;  3I43 A;  4MF7 A;  1WJK A;  5BMU B;  4KDY A;  5D96 A;  3GL3 A;  5G5E A;  1JLV A;  2KP1 A;  4IVF A;  3C1R A;  4G2E A;  4GQC A;  1A23 A;  2J23 A;  4N30 A;  4DSS A;  5AIV A;  4BL7 A;  1TU7 A;  2FWF A;  4K9Z A;  1Y25 A;  2L6C A;  1XW9 A;  2X49 A;  4V1A g;  3GL5 A;  5HR3 A;  5D9T A;  3MYD A;  2IWT A;  4AJ6 A;  4PQH A;  2YZH A;  4AKX B;  3FEU A;  2B1K A;  4MJA A;  4AKH A;  1XWK A;  2GZP A;  4WR4 A;  3IC8 A;  1PGT A;  1S3R A;  3ZRE A;  3H93 A;  5J9C A;  1SL0 B;  4E68 A;  3G9B A;  2FWG A;  3J7Y k;  2C3T A;  11GS A;  1XBS A;  3SBC A;  1I1I P;  1OE7 A;  2H6Z A;  2XPD A;  1TRS A;  3D5J A;  2VLT A;  5ECK B;  5H5R A;  2H1G A;  2QC7 A;  2YN1 A;  2AV4 A;  4O5Q A;  2VAF A;  1E6B A;  1BG1 A;  1Q4J A;  3HY2 A;  4JZQ A;  4KCE A;  5G30 A;  2A2P A;  3MNG A;  3QD9 A;  4OWY A;  3D22 A;  2YAN A;  5E4W A;  4KDU A;  4LLR A;  4HI7 A;  3TUE A;  5GAN D;  1FB6 A;  2YWM A;  3G7I A;  3KIJ A;  4FYC A;  1MDJ A;  5A1N B;  4KF9 A;  4NMU A;  5D73 A;  3GSS A;  7GSS A;  3KEB A;  3HJP A;  4TR1 B;  5H5S A;  2H6X A;  4PUR A;  2A4H A;  3BJ5 A;  4O32 A;  3KTB A;  1N25 A;  3WGE A;  3GUR A;  4V2M A;  1GLP A;  5AIS A;  1B9Y C;  1XPV A;  3TOT A;  1DE1 A;  4ZBD A;  2I1U A;  4IJ3 A;  5G5F A;  1TTZ A;  1YF0 A;  1VF2 A;  2QKE A;  6GSV A;  2NPB A;  2VCW A;  3QCP A;  1GRX A;  3D0Z A;  2V41 A;  5IOW A;  1SVM A;  5J4V A;  1A0F A;  5DBQ A;  3KGK A;  1ZMA A;  2CVD A;  3VWX A;  4JE1 A;  1AUC A;  4TXO A;  1HNA A;  1K3L A;  4HZ2 A;  2EFD A;  4YAV A;  3CBU A;  5BMU A;  2R0C A;  2HI7 A;  1M0U A;  3IK9 A;  3NIV A;  1AQX A;  4GRF A;  3LG6 A;  4G9H A;  1F9M A;  2LRC A;  1SK2 A;  3ZFL A;  2YWN A;  5D93 A;  1SU9 A;  4GSS A;  2GSR A;  1ZL9 A;  1SKW B;  2LNT A;  4G19 A;  2ZNM A;  5G1L A;  3EUR A;  5ABR A;  4DVC A;  2EC4 A;  1K0B A;  2C0G A;  1OKD A;  2PVQ A;  3F3Q A;  2NBS A;  1O85 A;  3W8S A;  2EFH A;  2IJY A;  3D21 A;  5D9X A;  1VGL A;  2PMT A;  5FWG A;  2X64 A;  1B4P A;  1OE8 A;  3D6I A;  5HR1 A;  4JR6 A;  6GST A;  4G0K A;  4G01 A;  3ZIV A;  5KN0 A;  4KUN A;  5ECH B;  2EIR A;  2MYG A;  1J08 A;  3TB2 A;  3UL3 A;  1ML6 A;  2N5B A;  2FD3 A;  3CTG A;  3HJM A;  2C80 A;  2WW0 A;  4EO3 A;  3FY7 A;  5DAK B;  3LFL A;  2C8U A;  5GZZ B;  3RGB C;  2IL3 A;  5J41 A;  2F3M A;  1WMJ A;  4ML6 A;  4O5U A;  1X9W B;  4RQX A;  3ZMK A;  4KCA A;  1MDI A;  2FWE A;  2CA8 A;  3MWH A;  1K3O A;  5A5H B;  2R0G A;  4KB3 A;  2B7K A;  1ZYE A;  3GHA A;  3RFR C;  5A1N A;  6GSU A;  2WJU A;  1A8L A;  4K1F A;  3CHX C;  3MIX A;  1XVQ A;  2LQQ A;  2UV8 G;  3VLN A;  3VUR A;  4HEA 2;  3C71 A;  1FB0 A;  1AC1 A;  3L9V A;  4PUA A;  3WGX A;  4D73 B;  5CAX A;  2VL9 A;  2DML A;  1UA5 A;  1ZCP A;  3RAZ A;  4WF5 A;  3IPZ A;  5DCH A;  4EC0 A;  2C0F A;  1GSS A;  3CSH A;  4L0U A;  4TOP A;  4EL1 A;  3C8E A;  3LYP A;  1YDK A;  2YV9 A;  3P7X A;  4IQ1 A;  5IO0 A;  3DXB A;  3ZL5 A;  2O87 A;  2DLX A;  1CQH A;  3F4R A;  3KH9 A;  3V1W A;  1XG8 A;  1U87 A;  3FZ5 A;  1EWX A;  1TRW A;  1GTI A;  4E8E A;  1AXD A;  5EY6 A;  1X9S B;  1ON4 A;  4ZB8 A;  4MK3 A;  4I2T A;  1WWJ A;  1QGV A;  3QFA C;  13GS A;  3EWL A;  2OBK A;  17GS A;  4GDF A;  2JZS A;  1TJD A;  4TR0 A;  1Q98 A;  2B5E A;  4TW5 A;  1BAY A;  4ZBB A;  1Z7R A;  2B5X A;  2JZT A;  3LXZ A;  2H1B A;  5ECS A;  3GFK A;  2CV4 A;  1V9W A;  5ECL B;  3LYK A;  4K0G A;  1OC9 B;  5CP1 A;  1W89 A;  2VUP A;  4HUA A;  3ZVJ D;  3W8J A;  4K7I A;  4Q5R A;  3AY8 A;  2CAQ A;  4XTS A;  1JHB A;  3DGQ A;  3FZ4 A;  3PPU A;  1M7T A;  1OAZ A;  1SJI A;  1WP0 A;  5IQY A;  2K6V A;  4YQU A;  4BA7 A;  2VO4 A;  1K0C A;  4KA0 A;  1ZYQ B;  2DBC A;  1V98 A;  2AYT A;  3BCK A;  3ZYW A;  1MTC A;  1MEK A;  1T3B A;  1EEJ A;  1WOU A;  1GSQ A;  4X4J A;  5J9B A;  2LEG A;  3APQ A;  5DAK A;  4HS1 A;  3FK8 A;  3A2X A;  4V2N A;  4NHW A;  2YJ7 A;  2HSN B;  2HYX A;  2HSM B;  2H0G A;  1WPI A;  3M9K A;  5A5H A;  1Z3E A;  2DJ1 A;  3GUS A;  2REM A;  1B48 A;  1HNB A;  2DIY A;  6GSS A;  1DBY A;  4IN0 A;  2OT3 A;  9GSS A;  4QQ7 A;  2TRX A;  4CY8 A;  1XXU A;  2HRF A;  2B3S A;  4MNN A;  6GSY A;  1I9D A;  2YNX A;  2VM2 A;  2CZ2 A;  4D73 A;  3OR5 A;  3LSZ A;  4TVE A;  1BQ7 A;  2L4Q A;  1NHY A;  4WEY A;  3CRU A;  3RHC A;  5IO2 A;  3SWL A; 
#chains in the Genus database with same CATH homology
 1J0F A;  4HJ2 A;  2OE1 A;  1IYH A;  1BF5 A;  4AJ7 A;  4EVM A;  3TKS A;  4K0N A;  5CRH A;  5B7C A;  4K5S A;  4O7H A;  2L5L A;  3FRC A;  2H70 A;  3KCM A;  3C1S A;  3TJK A;  5ELA A;  4AI6 A;  2MMA A;  5CNW A;  2DMM A;  4LL4 B;  4K6X A;  4OFN A;  2LST A;  5EVO A;  5B8A A;  2AUV A;  2YCD A;  2O89 A;  1FOH A;  4FH8 A;  2VL2 A;  1FG4 A;  1QQ2 A;  2BTO T;  4TKY A;  1YJ6 A;  1Z7P A;  2R2J A;  3F0I A;  3O6T A;  4BWS A;  1ZYP A;  4L5L A;  1G6W A;  4O92 A;  5IMF A;  2HRA A;  4KSM A;  4X0X A;  4XRD A;  1M2A A;  3HYP A;  2XHF A;  3GMF A;  1WE0 A;  3CWG A;  2MBS A;  2AHE A;  2OJL A;  3ZFB A;  3IC4 A;  3IHQ A;  4A5P A;  1TRV A;  2VIM A;  3CSI A;  2R6K A;  3C7M A;  4GSN A;  4Q5Q A;  2HNL A;  3R3E A;  2KLX A;  5HFG A;  1OC9 A;  3UBL A;  4N10 A;  5IMZ A;  4HU9 A;  1M9A A;  1PD2 1;  1JFU A;  4N11 A;  1G7E A;  4F9Z A;  3CRT A;  3IOS A;  2E0Q A;  3QPM A;  2GVP A;  2ON7 A;  1XCC A;  3TJB A;  2HZF A;  3DML A;  3N9J A;  1G0T A;  1X5C A;  3HDC A;  4OFT A;  2CAI A;  1TP9 A;  1EOH A;  1JLW A;  2H1A A;  4WBJ A;  4GWR A;  5AIX A;  1BYE A;  2XC2 A;  5F07 A;  3GIX A;  2O5V A;  3APO A;  3G7J A;  1EP7 A;  2MMO A;  1SKR B;  2KUC A;  1OKT A;  4MP4 A;  2HRK A;  1VRS D;  4MCU A;  4EF0 A;  3TRQ A;  2HSN A;  1IYI A;  6GSW A;  2QSI A;  3EYT A;  2HSM A;  4IQA A;  1XWG A;  2B1L A;  1PKW A;  2XBQ A;  3QMX A;  1KTE A;  5ECN B;  1F2E A;  2JU5 A;  3F6D A;  4PX1 A;  4RI7 A;  2K18 A;  1SEN A;  2CZ3 A;  2IN3 A;  16GS A;  1W4V A;  5JCU A;  3LW9 A;  2F9S A;  3TKQ A;  5JCG A;  2Z9S A;  4ULX A;  4BVX B;  2CVK A;  4G0I A;  3QAV A;  5B8B A;  1A2L A;  5JWR B;  1XVW A;  2IPA A;  1XIY A;  1GNW A;  3M1G A;  1F6M C;  5C00 A;  1SK1 A;  2KOK A;  3EVI A;  3ZRD A;  3PH9 A;  5GSS A;  4ZL9 A;  3ME8 A;  1GNE A;  1PKZ A;  4IP1 A;  4KE3 A;  4POB A;  5ECM B;  1OC3 A;  4RQR A;  4K7N A;  5J4Y A;  2GQM A;  1T8E B;  1R4W A;  3IAS 2;  3VPQ A;  3UEM A;  1GP1 A;  2IFQ B;  4ZBA A;  3M3M A;  3KJY A;  2CX4 A;  1F3B A;  5DAL B;  1SL1 B;  4KSO A;  5KN2 A;  2V32 A;  4CY6 A;  2HXK A;  3R2Q A;  3RDW A;  2PUK C;  1BED A;  2BMX A;  1PRX A;  2ON5 A;  5DJL A;  1JZR A;  3FYG A;  2VM1 A;  5AGY A;  4POM A;  1H75 A;  4PXO A;  3A2V A;  2PN8 A;  2YWO A;  4ZL7 A;  3MDK A;  1YY7 A;  1ERV A;  1LJR A;  2WCI A;  3UJ1 A;  2K9F A;  3TOU A;  2RM6 A;  1THX A;  1X5D A;  4OFM A;  5GST A;  2I3Y A;  6GSX A;  3I69 A;  4ICY A;  5IPG A;  2GQL A;  4ZIJ A;  3QAG A;  2L57 A;  2DIZ A;  3IAM 2;  4N3Z A;  1Z5Y E;  2O85 A;  4MA9 A;  3TKS E;  5LD0 A;  3L78 A;  4H86 A;  3H1N A;  2L6D A;  4F0B A;  4NAX A;  2YPM A;  1SJZ A;  1X0R A;  1ERW A;  2X8H A;  3LWA A;  2P31 A;  3Q6O A;  3TJF A;  1XOB A;  1V57 A;  1XZO A;  1S3C A;  4DSR A;  4O5R A;  4NV2 A;  4J56 E;  1YVL A;  1O81 A;  3QFB C;  5HFK A;  5IOX A;  1VF4 A;  5G1K A;  5J3R A;  3L4N A;  4IEL A;  2GZY A;  4BVX A;  4EIQ A;  3UMA A;  2KP2 A;  3ZTL A;  2VL2 C;  2GSQ A;  4I97 A;  4EDY A;  4ZIL A;  1PX6 A;  1JZW A;  4NXI A;  4L8E A;  3GST A;  2HE3 A;  2K8V A;  2EFC A;  2R5G A;  2JSY A;  1GUL A;  5AN1 A;  2I9H A;  2RII A;  4QL9 A;  2DJ2 A;  5B6M A;  2X4A A;  4XS6 A;  3P90 A;  4ML1 A;  4J2F A;  3FKF A;  2R4V A;  1PL2 A;  2IME A;  3Q74 A;  2IFQ A;  1AW9 A;  2RUF A;  4Z2T A;  2FA4 A;  3LEF A;  3FMW A;  5DAL A;  4NWY A;  3HXS A;  1YEX A;  2LNS A;  4MZW A;  3F4T A;  3TKR A;  5A34 B;  1NW2 A;  3HKR A;  3EU4 A;  4PQI A;  3F3R A;  2V1M A;  4TR1 A;  2VLU A;  5EL8 A;  5IPH A;  3DYR A;  5HQP A;  2TIR A;  1EGR A;  4AKG A;  2WB9 A;  4WET A;  3EPT A;  5GAP D;  1HYU A;  4K5R A;  5IMC A;  2H1D A;  4K8M A;  4PUF C;  2PVO C;  3FW2 A;  3GTU B;  2LTK A;  5IMA A;  1HQO A;  1ZOF A;  3TKP A;  2E7P A;  2EFE A;  3IXR A;  3P8W A;  2YWI A;  1GUH A;  2H19 A;  4X1U A;  5C04 A;  4DSQ A;  4IS0 A;  1R7H A;  4YKG A;  1QFN A;  5CYY A;  2FUG 2;  1M99 A;  2DSA A;  1Z6N A;  4FQU A;  1XWC A;  2DKH A;  1C72 A;  1O73 A;  3UAR A;  5D9W A;  5LNK e;  2VD0 A;  2RLI A;  2DKI A;  4I6X A;  1GTU A;  3LOR A;  2B7J A;  3K8N A;  3KP9 A;  1SD9 A;  3F6F A;  2P0G A;  2LV3 A;  3I9V 2;  1DUG A;  2D2Z A;  3IRA A;  1R26 A;  3GH9 A;  1G7O A;  8GSS A;  3H8Q A;  3VWW A;  4Q5F A;  3GKX A;  1KBN A;  1SVL A;  2H71 A;  1QK8 A;  2GQK A;  1N8J A;  5JWQ B;  2ES7 A;  2R0P A;  2GT6 A;  1FO5 A;  1VF1 A;  1YKC A;  1AQW A;  4AF2 A;  3KH7 A;  4IGJ A;  3ZZX A;  4XS4 B;  1K0N A;  1TRU A;  1TI3 A;  3A2W A;  2OAC A;  1PQN A;  2OBI A;  3A3T A;  4TR3 A;  3O3T A;  3FHK A;  1TI1 A;  2H75 A;  4HOJ A;  2IMD A;  2EIO A;  4KH7 A;  1A2M A;  2F8A A;  4NV5 A;  2J9H A;  2MBT A;  3NZN A;  4ILF A;  2L59 A;  3GH6 A;  2DC5 A;  4MJB A;  4TRX A;  3ED3 A;  3HHV A;  2PER A;  1SD8 A;  1TW9 A;  4GCI A;  4EKZ A;  1XW5 A;  1FOV A;  2C0D A;  4MJC A;  1G6Y A;  1WRY A;  4RI6 A;  3RBT A;  1LU4 A;  4WF4 A;  1CQG A;  1TXU A;  3UOM A;  5A34 A;  4NHZ A;  18GS A;  4TXV A;  2HSH A;  4DEJ A;  5CRW A;  3VWU A;  2NVL A;  2AB6 A;  1YKA A;  2IMI A;  1GH2 A;  2C3N A;  5DVB A;  3ZML A;  4IBP A;  4ZXG A;  4XCS A;  2PU9 C;  1V2A A;  1GSE A;  5JWO B;  3C73 A;  2H66 A;  1Z6M A;  4WR5 A;  4E8H A;  4TR4 A;  4F0C A;  1Y6E A;  3CSJ A;  3VPT A;  2B6M A;  4HU7 A;  5HR0 A;  1S3A A;  2VD1 A;  2CQ9 A;  2YP6 A;  3F9U A;  3GTU A;  1XW6 A;  4F2I A;  4ECB A;  3QAW A;  4MPF A;  3P2A A;  4LMV A;  2YV7 A;  2H76 A;  3ERF A;  1TKD B;  3RPP A;  1TOF A;  4ID0 A;  3DIE A;  2V6K A;  3IR4 A;  2MMZ A;  5LCZ A;  3UIW A;  2DJ0 A;  3IA1 A;  2JSZ A;  4XHM A;  1T00 A;  4NPB A;  4FYB A;  2C3Q A;  5ECI B;  1OYJ A;  1U3A A;  3H79 A;  1U6T A;  3F8U A;  1MD3 A;  4GST A;  1SVO A;  5KEJ A;  2O7K A;  4Z2R A;  3KMN A;  4MH3 A;  4JRR A;  2FY6 A;  3MAK A;  4W66 A;  3E9J B;  5L71 A;  2MMN A;  4K7O A;  3ZIJ A;  2LKU A;  5A4V A;  4CW9 A;  1GTB A;  1PMT A;  5IMD A;  4G0L A;  4F82 A;  1H4O A;  3I6A A;  1QUW A;  2G2Q A;  2WFC A;  1A8Y A;  3L9U A;  2N5F A;  4Z7X A;  2JAC A;  4CDO A;  4RUV A;  3W6G A;  1QMV A;  3EIN A;  1GSY A;  2O8V B;  1USB A;  2VKZ G;  2OE0 A;  3DWV A;  4XS4 A;  2M46 A;  3WT1 A;  3D4T A;  3BD2 A;  5HR2 A;  3N5O A;  2BJX A;  4K2D A;  3WGD A;  3HMJ G;  3Q19 A;  19GS A;  1GTA A;  3MSZ A;  3VFI A;  2LJR A;  1I5G A;  4ZB6 A;  3TJG A;  2GST A;  3J7Y b;  1U3I A;  2PPT A;  4AKI A;  1YZX A;  3WT2 A;  1SK0 A;  4BVY B;  2HQT A;  2VCT A;  4QL7 A;  3UAP A;  1XFL A;  1LBK A;  1FVJ A;  4YAP A;  3BCI A;  3DVX A;  1GUM A;  4KW6 A;  1ERT A;  1B8X A;  1V40 A;  2FNO A;  4MF5 A;  4AGS A;  4MDC A;  1OC8 A;  1NHO A;  3HVS A;  1PN0 A;  1E2Y A;  22GS A;  1TU8 A;  2PWJ A;  2KHP A;  1PL1 A;  3HA9 A;  3KXO A;  1GSF A;  2LS5 A;  4L5O A;  3DEX A;  1J9B A;  2GZZ A;  3QOU A;  3LGC A;  1M9B A;  5EPF A;  4IJI A;  2GSS A;  2CT6 A;  5G2Z A;  1ACV A;  4N0V A;  1Y1U A;  1NM3 A;  2R3X A;  5DQS A;  1TXX A;  1KNG A;  1RK4 A;  1ZGN A;  1UVZ A;  1ERU A;  1O8X A;  3GKN A;  1F3A A;  3GKK A;  5F0G A;  5J5N A;  2X8G A;  3UBK A;  3KP8 A;  1YEP A;  5ECO B;  1U88 A;  1AAZ A;  5A4W A;  4LL1 B;  3HZ4 A;  4EUY A;  2HT9 A;  2OKA A;  1YQ1 A;  4POL A;  4GLT A;  1PN9 A;  2H6Y A;  2FHE A;  5CRD A;  1FHE A;  4ZB9 A;  3LQ7 A;  3ZLP A;  3KMO A;  2AJQ B;  4MH2 A;  4V1A p;  3VWV A;  5A5K A;  5F8B A;  2HSY A;  3GA4 A;  4F03 A;  2NDO A;  2GT5 A;  2WUL A;  1K0A A;  4YH2 A;  3IV4 A;  2P5R A;  3KD0 A;  3UVT A;  3DKS A;  2LJA A;  3GV1 A;  4V2L A;  3M9J A;  3E3E A;  4L0W A;  2IIY A;  1EGO A;  4FIW A;  4IKH A;  3US3 A;  4Q5N A;  20GS A;  4FO5 A;  4HDE A;  4OMV A;  2VL3 A;  4MJE A;  3ME7 A;  2A2S A;  1FVK A;  3A5W A;  4HJM A;  3EU3 A;  14GS A;  3PIN A;  2FA8 A;  2JAD A;  4HQZ A;  10GS A;  5DCG A;  5A4U A;  1Z9H A;  4WKW A;  1JZO A;  3VI5 A;  1SYR A;  2VCQ A;  3TGZ A;  1R5P A;  4EXJ A;  4BVY A;  4IHU A;  5CRE A;  1O6J A;  1DE2 A;  1HNC A;  4KAE A;  1XOA A;  2DJK A;  4WXT A;  3TKS C;  3TCO A;  1TK0 B;  3Q18 A;  2ZUP A;  4PTS A;  3IK7 A;  2JZR A;  2E2G A;  5B6N A;  3FZ9 A;  2H01 A;  3L9S A;  4I5Q A;  5J4U A;  2IMF A;  3HVX A;  3KM6 A;  2ALB A;  4POK A;  5D9V A;  3DRN A;  4J57 E;  1TDI A;  4KDX A;  4MF6 A;  1T7P B;  2L5O A;  4YQM A;  4AJ8 A;  4ISD A;  1MDK A;  5ELG A;  1NSW A;  2GTU A;  3EMX A;  4MPG A;  1URM A;  3DD3 A;  2I4A A;  2QA2 A;  5FT3 A;  1K3Y A;  1RQM A;  1B9X C;  1K0O A;  3FR9 A;  2E2M A;  1PA3 A;  3ISO A;  2GGT A;  1O7U A;  4HQS A;  3O76 A;  2VCX A;  2FCH A;  4IP6 A;  3EE2 A;  4IW9 A;  2H74 A;  4BPY A;  3LJR A;  4XIH A;  2XPE A;  5IM9 A;  2LJK A;  3RPN A;  4LMW A;  3D4M A;  3ZIT A;  2GLR A;  1S3D A;  3GN3 A;  5F05 A;  1A2J A;  4FYU A;  3GYK A;  5ID2 B;  1O8W A;  4YKF A;  1M2B A;  1ST9 A;  3HZ8 A;  3GKM A;  3GNJ A;  1GUK A;  4ECC A;  2HLS A;  3HD5 A;  4USS A;  3GX0 A;  3M8N A;  3ERW A;  5DDL A;  3APS A;  1F37 A;  1QXH A;  3IBH A;  1PSQ A;  3H4K A;  3TU3 B;  1HD2 A;  3G7Y A;  1MD4 A;  5G31 A;  2LRT A;  4ECJ A;  2C0E A;  1ABA A;  2A2R A;  3CXG A;  5J40 A;  1EEM A;  4WBR D;  2G0F A;  2OE3 A;  3GX8 A;  2F8F A;  1VF3 A;  2F51 A;  2QGV A;  4PNF A;  2X8C A;  1GWC A;  2WDU A;  3CTF A;  3IHG A;  1SKS B;  5F06 A;  1FW1 A;  4KGI A;  4CHS A;  1TK5 B;  4PGT A;  2NTO A;  2HZE B;  2H73 A;  2RUE A;  3TRP A;  1B4Q A;  3FR3 A;  3PR8 A;  2M80 A;  1T4Z A;  2HFD A;  2N5A A;  2LQO A;  1X9M B;  4MLY A;  2WRT A;  2LUS A;  1EV4 A;  2H72 A;  3TJJ A;  2RM5 A;  3WYW A;  4MMM A;  2GS3 A;  4LA1 A;  4GF0 A;  1GSU A;  1K0D A;  4MAB A;  1DSB A;  3EMP A;  2WGR A;  3A5I A;  1M2D A;  4JED A;  1A0R P;  3U6V A;  3M0F A;  1RW1 A;  2DJJ A;  3VK9 A;  3E0U A;  1A24 A;  1KEB A;  3F4S A;  4HZ4 A;  1X5E A;  2B5Y A;  2V2G A;  2I81 A;  4JBB A;  3GRX A;  2CVB A;  2A4V A;  5FHI A;  1R5A A;  4EE0 A;  4YQV A;  5HFI A;  4BWQ A;  1YF1 A;  4EIP A;  1TK8 B;  2WS2 A;  1XWB A;  3QDN A;  3QR6 A;  5DQY A;  4JR4 A;  1T1V A;  5KN3 A;  1ILO A;  3LXT A;  3BOA A;  2C4J A;  2QA1 A;  1EOG A;  2LRN A;  2M72 A;  2WZ9 A;  3FR6 A;  1WIK A;  1UN2 A;  4ZB7 A;  5INY A;  5KOW A;  2TRC P;  5KN1 A;  2YOI A;  2CX3 A;  4K2X A;  2VCZ A;  3BBY A;  4OCF A;  2OAD A;  5CRG A;  4DSS B;  2JL4 A;  4BL7 B;  2AAW A;  2PGT A;  5H5Q A;  2X99 A;  1EV9 A;  2HRK B;  4ZL8 A;  2MZC A;  3RHB A;  5ID2 A;  1N2A A;  4N0Z A;  3IE3 A;  4TN8 A;  2YZU A;  4XRA A;  4OO5 A;  1ZZY A;  5ECR B;  4G10 A;  4ACS A;  2YJH A;  1UC7 A;  1FAA A;  4I8B A;  2H0I A;  3CMI A;  5ENU A;  1SJ6 A;  4GTU A;  2HRN A;  4KX4 A;  1AQV A;  1PX7 A;  3ERG A;  2H0H A;  2PBJ A;  2VLV A;  3JCM L;  1THO A;  3UVH A;  4MZC A;  2H8L A;  2FLS A;  3FZA A;  1K0M A;  3HJO A;  3CYN A;  4Z2U A;  2DJ3 A;  1GLQ A;  3U5R E;  1OVN A;  4OO4 A;  1V58 A;  2C1Y A;  2OA7 A;  1GSD A;  2HZE A;  4KND A;  5JCW A;  5IIZ A;  4QMK A;  4XS1 A;  3NOF A;  2R37 A;  4GQF A;  1XWA A;  5D8I A;  4OD7 A;  1SL2 B;  2VOC A;  1BG5 A;  1EZK A;  1EP8 A;  2H1L A;  3HVV A;  4GXZ A;  1ZYN A;  3EC3 A;  2H30 A;  3S9F A;  2L4C A;  2XBI A;  5DJM A;  1BJX A;  4P3Y B;  3KTL A;  3DVW A;  3WD6 A;  4OCE A;  5BRT A;  3PGT A;  1T4Y A;  5COH A;  5CO3 A;  3HCZ A;  1AIU A;  2EIQ A;  2FGX A;  1GL8 A;  4I2U A;  2V6O A;  2ZCT A;  2IMK A;  3F63 A;  2UZ8 A;  3VI7 A;  4X43 A;  5ECQ B;  4ECI A;  3TRX A;  1SYX A;  5ECP B;  5KOX A;  3ZVJ A;  2K8S A;  2P5Q A;  5J47 A;  4EDZ A;  4PNG A;  4PQ1 A;  3KZQ A;  2GDR A;  2FWH A;  3TDG A;  5E59 A;  1BX9 A;  1JZD A;  4MZB A;  2VCV A;  3IDV A;  12GS A;  4JU5 A;  3L0H A;  4TXO B;  5IMV A;  3I43 A;  4MF7 A;  1WJK A;  5BMU B;  4KDY A;  5D96 A;  3GL3 A;  5G5E A;  1JLV A;  2KP1 A;  4IVF A;  3C1R A;  4G2E A;  4GQC A;  1A23 A;  2J23 A;  4N30 A;  4DSS A;  5AIV A;  4BL7 A;  1TU7 A;  2FWF A;  4K9Z A;  1Y25 A;  2L6C A;  1XW9 A;  2X49 A;  4V1A g;  3GL5 A;  5HR3 A;  5D9T A;  3MYD A;  2IWT A;  4AJ6 A;  4PQH A;  2YZH A;  4AKX B;  3FEU A;  2B1K A;  4MJA A;  4AKH A;  1XWK A;  2GZP A;  4WR4 A;  3IC8 A;  1PGT A;  3ZRE A;  3H93 A;  5J9C A;  1SL0 B;  4E68 A;  3G9B A;  2FWG A;  3J7Y k;  2C3T A;  11GS A;  1XBS A;  3SBC A;  1OE7 A;  2H6Z A;  2XPD A;  1TRS A;  3D5J A;  2VLT A;  5ECK B;  5H5R A;  2H1G A;  2QC7 A;  2YN1 A;  2AV4 A;  4O5Q A;  2VAF A;  1E6B A;  1BG1 A;  1Q4J A;  3HY2 A;  4JZQ A;  4KCE A;  5G30 A;  2A2P A;  3MNG A;  3QD9 A;  4OWY A;  3D22 A;  2YAN A;  5E4W A;  4KDU A;  4LLR A;  4HI7 A;  3TUE A;  5GAN D;  1FB6 A;  2YWM A;  3G7I A;  3KIJ A;  4FYC A;  1MDJ A;  5A1N B;  4KF9 A;  4NMU A;  5D73 A;  3GSS A;  7GSS A;  3KEB A;  3HJP A;  4TR1 B;  5H5S A;  2H6X A;  4PUR A;  2A4H A;  3BJ5 A;  4O32 A;  3KTB A;  1N25 A;  3WGE A;  3GUR A;  4V2M A;  1GLP A;  5AIS A;  1B9Y C;  1XPV A;  3TOT A;  1DE1 A;  4ZBD A;  2I1U A;  4IJ3 A;  5G5F A;  1TTZ A;  1YF0 A;  1VF2 A;  2QKE A;  6GSV A;  2NPB A;  2VCW A;  3QCP A;  1GRX A;  3D0Z A;  2V41 A;  5IOW A;  1SVM A;  5J4V A;  1A0F A;  5DBQ A;  3KGK A;  1ZMA A;  2CVD A;  3VWX A;  4JE1 A;  1AUC A;  4TXO A;  1HNA A;  1K3L A;  4HZ2 A;  2EFD A;  4YAV A;  3CBU A;  5BMU A;  2R0C A;  2HI7 A;  1M0U A;  3IK9 A;  3NIV A;  1AQX A;  4GRF A;  3LG6 A;  4G9H A;  1F9M A;  2LRC A;  1SK2 A;  3ZFL A;  2YWN A;  5D93 A;  1SU9 A;  4GSS A;  2GSR A;  1ZL9 A;  1SKW B;  2LNT A;  4G19 A;  2ZNM A;  5G1L A;  3EUR A;  5ABR A;  4DVC A;  2EC4 A;  1K0B A;  2C0G A;  1OKD A;  2PVQ A;  3F3Q A;  2NBS A;  1O85 A;  3W8S A;  2EFH A;  2IJY A;  3D21 A;  5D9X A;  1VGL A;  2PMT A;  5FWG A;  2X64 A;  1B4P A;  1OE8 A;  3D6I A;  5HR1 A;  4JR6 A;  6GST A;  4G0K A;  4G01 A;  3ZIV A;  5KN0 A;  4KUN A;  5ECH B;  2EIR A;  2MYG A;  1J08 A;  3TB2 A;  3UL3 A;  1ML6 A;  2N5B A;  2FD3 A;  3CTG A;  3HJM A;  2C80 A;  4EO3 A;  3FY7 A;  5DAK B;  3LFL A;  2C8U A;  5GZZ B;  2IL3 A;  5J41 A;  2F3M A;  1WMJ A;  4ML6 A;  4O5U A;  1X9W B;  4RQX A;  3ZMK A;  4KCA A;  1MDI A;  2FWE A;  2CA8 A;  3MWH A;  1K3O A;  5A5H B;  2R0G A;  4KB3 A;  2B7K A;  1ZYE A;  3GHA A;  5A1N A;  6GSU A;  2WJU A;  1A8L A;  4K1F A;  3MIX A;  1XVQ A;  2LQQ A;  2UV8 G;  3VLN A;  3VUR A;  4HEA 2;  3C71 A;  1FB0 A;  1AC1 A;  3L9V A;  4PUA A;  3WGX A;  4D73 B;  5CAX A;  2VL9 A;  2DML A;  1UA5 A;  1ZCP A;  3RAZ A;  4WF5 A;  3IPZ A;  5DCH A;  4EC0 A;  2C0F A;  1GSS A;  3CSH A;  4L0U A;  4TOP A;  4EL1 A;  3C8E A;  3LYP A;  1YDK A;  2YV9 A;  3P7X A;  4IQ1 A;  5IO0 A;  3DXB A;  3ZL5 A;  2O87 A;  2DLX A;  1CQH A;  3F4R A;  3KH9 A;  3V1W A;  1U87 A;  3FZ5 A;  1EWX A;  1TRW A;  1GTI A;  4E8E A;  1AXD A;  5EY6 A;  1X9S B;  1ON4 A;  4ZB8 A;  4MK3 A;  4I2T A;  1WWJ A;  1QGV A;  3QFA C;  13GS A;  3EWL A;  2OBK A;  17GS A;  4GDF A;  2JZS A;  1TJD A;  4TR0 A;  1Q98 A;  2B5E A;  4TW5 A;  1BAY A;  4ZBB A;  1Z7R A;  2B5X A;  2JZT A;  3LXZ A;  2H1B A;  5ECS A;  3GFK A;  2CV4 A;  1V9W A;  5ECL B;  3LYK A;  4K0G A;  1OC9 B;  5CP1 A;  1W89 A;  2VUP A;  4HUA A;  3ZVJ D;  3W8J A;  4K7I A;  4Q5R A;  3AY8 A;  2CAQ A;  4XTS A;  1JHB A;  3DGQ A;  3FZ4 A;  3PPU A;  1M7T A;  1OAZ A;  1SJI A;  1WP0 A;  5IQY A;  2K6V A;  4YQU A;  4BA7 A;  2VO4 A;  1K0C A;  4KA0 A;  1ZYQ B;  2DBC A;  1V98 A;  2AYT A;  3BCK A;  3ZYW A;  1MTC A;  1MEK A;  1T3B A;  1EEJ A;  1WOU A;  1GSQ A;  4X4J A;  5J9B A;  2LEG A;  3APQ A;  5DAK A;  4HS1 A;  3FK8 A;  3A2X A;  4V2N A;  4NHW A;  2YJ7 A;  2HSN B;  2HYX A;  2HSM B;  2H0G A;  1WPI A;  3M9K A;  5A5H A;  1Z3E A;  2DJ1 A;  3GUS A;  2REM A;  1B48 A;  1HNB A;  2DIY A;  6GSS A;  1DBY A;  4IN0 A;  2OT3 A;  9GSS A;  4QQ7 A;  2TRX A;  4CY8 A;  1XXU A;  2HRF A;  2B3S A;  4MNN A;  6GSY A;  1I9D A;  2YNX A;  2VM2 A;  2CZ2 A;  4D73 A;  3OR5 A;  3LSZ A;  4TVE A;  1BQ7 A;  2L4Q A;  1NHY A;  4WEY A;  3CRU A;  3RHC A;  5IO2 A;  3SWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...