3LXTA

Crystal structure of glutathione s transferase from pseudomonas fluorescens
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
204
structure length
204
Chain Sequence
SLKLIGMLDSPYVRRVAISLKSLGLPFEHHSLSVFSTFEQFKAINPVVKAPTLVCEGGEVLMDSSLIIDYLETLAGPQRSLMPTALPQRLRELRLVGLALAACEKSVQIVYERNLRPAEKQHGPWLERVGGQLQAAYGELEQELQKQPLPRDGSLGQAGISLAVAWSFSQMMVADQFNPGQFPAVRGFAEYAEQLPVFLATPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S Transferase
publication title Crystal structure of Glutathione S Transferase from Pseudomonas fluorescens
rcsb
source organism Pseudomonas fluorescens
molecule tags Transferase
total genus 69
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3lxtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lxtA01
3EC3A 4ML1A 1EP7A 2LRCA 4OD7A 5EY6A 1HQOA 2LV3A 3HXSA 3D22A 2LJRA 5LD0A 3VPQA 2PUKC 4XHMA 3RBTA 2C0FA 5B6MA 3UMAA 3L0HA 3KCMA 1JZWA 5A4WA 2PN8A 2GQKA 3FYGA 3TUEA 4EUYA 5INYA 1GUKA 2F51A 2HRNA 2X8GA 3MAKA 2H30A 3GSTA 2GZYA 2BJXA 2HRKA 2GQMA 2DJ2A 4LMWA 2VL2A 2RIIA 4TR1A 4TR3A 3Q18A 2MMNA 4ECCA 3KEBA 1SJIA 1XWAA 12GSA 4G2EA 1H75A 1NHYA 3HCZA 2IMKA 4OMVA 3FY7A 4IBPA 2TIRA 4XTSA 4EKZA 1AXDA 1AQVA 1SU9A 3VWXA 1F3BA 1SD8A 2H8LA 4AJ7A 3TRQA 2M72A 2FWHA 3UVTA 3GX0A 3TKSE 3LG6A 4TOPA 3GURA 1B8XA 1PN9A 3F0IA 8GSSA 5LCZA 1O85A 4JR4A 1GSSA 3TJJA 2HSMA 4L5OA 5LNKe 1M7TA 22GSA 2F8FA 3H1NA 1VRSD 2JZSA 3ZZXA 4ECIA 2VLTA 1C72A 1EWXA 3ERGA 3A2XA 3TDGA 2H6ZA 3CBUA 5IQYA 5G31A 1KEBA 2WRTA 1HYUA 3K8NA 4DSSA 1NHOA 4Z7XA 5F0GA 2CX3A 2VCZA 2HZEA 9GSSA 1O8XA 2N5AA 4BVYA 3BCIA 5KEJA 3GN3A 5IM9A 4HZ4A 1WJKA 1JZRA 4KCEA 2DBCA 4K7NA 2A2RA 2K9FA 1SL0B 2CX4A 1TKDB 2HRKB 1EZKA 16GSA 4TR1B 19GSA 3QPMA 4TN8A 1EV9A 3JCML 2DC5A 2C1YA 1LJRA 2E2MA 3HZ8A 3GYKA 3TJFA 6GSUA 4O7HA 2H72A 3FKFA 4G0LA 4QL9A 5IOXA 3CSJA 2E7PA 2CT6A 2VL3A 2H0IA 2GQLA 11GSA 1Z6MA 2B7KA 1ZGNA 2M46A 2FA4A 2B7JA 4MZWA 4IHUA 2P5QA 5B8BA 4F82A 1FHEA 4JBBA 2EIRA 4MH2A 2O85A 4F0CA 1EOGA 4KDXA 2JADA 3DEXA 3Q6OA 2B5EA 3N5OA 5J41A 4KUNA 5ELAA 2A2SA 4NHZA 1M9BA 1OKTA 3IAM2 3LQ7A 1M2DA 3H79A 4Q5FA 4O32A 3O6TA 5HR1A 5ABRA 1I5GA 3I6AA 1EV4A 2AYTA 4MPFA 3TB2A 1X9WB 4I2TA 3A2WA 2HZEB 3APQA 3HJPA 2F3MA 3DKSA 4PUFC 4FQUA 4BVYB 1GLPA 1K0AA 2LRNA 3DRNA 1AC1A 2AUVA 5G5FA 4TVEA 1TOFA 2VCQA 1UVZA 2ZCTA 4I8BA 2HFDA 4KSMA 4MJBA 3GV1A 1EGOA 2QC7A 2X99A 2EIOA 3QAVA 4ULXA 3FZ5A 1F2EA 1XBSA 3TJGA 3ZMKA 1OC9B 4WXTA 1PKWA 1TI3A 2WULA 2ON5A 4IJ3A 2ON7A 3IBHA 2R3XA 3GA4A 4N11A 1BG5A 2XC2A 4WKWA 3TJBA 2TRXA 2FWFA 4HQZA 4ZILA 1VGLA 3VLNA 1R7HA 2PBJA 4PNFA 1THXA 2H75A 1PKZA 2YWNA 3ERFA 1KNGA 4K8MA 2HI7A 1W89A 3EINA 1J9BA 2P5RA 6GSSA 3RDWA 3E9JB 1MEKA 2H66A 2J23A 3D5JA 4G0IA 2GTUA 4RUVA 3IA1A 4YAPA 5KN1A 4KF9A 1YDKA 2C4JA 1OE8A 5D9VA 4NV2A 2C0EA 2FHEA 1K0CA 2GZPA 1G6WA 3IE3A 1SKRB 4OO5A 2VM1A 2DIZA 3G7YA 2RUEA 3F3RA 3VWWA 6GSXA 4EDYA 1R5PA 2YZUA 4DEJA 1PSQA 3VWVA 4AJ8A 2WFCA 2L59A 2H1BA 2IWTA 2OADA 1XCCA 4LA1A 2C80A 1QK8A 3D6IA 1BQ7A 3ZFBA 1Y6EA 3ZFLA 1MDJA 5ECPB 3HA9A 3WD6A 6GSWA 2HNLA 2JZRA 1J0FA 2DJJA 1TXXA 3M0FA 2L4QA 3KTBA 2O8VB 1GTIA 3F4RA 4X1UA 4OFMA 3IOSA 3VK9A 5F06A 4BL7A 5IPHA 1KTEA 1PMTA 1GTBA 5D96A 1EEJA 5CO3A 5F05A 5AN1A 4KDYA 1MD3A 4F03A 3ED3A 3C73A 3DWVA 2H6XA 3UARA 2KLXA 4EC0A 2XPEA 1EOHA 2OA7A 4KE3A 2LNSA 1JFUA 2HT9A 2UZ8A 2WZ9A 4PUAA 5A4VA 3UJ1A 1YJ6A 3HY2A 1IYIA 4LMVA 4QQ7A 3EMXA 5COHA 5E59A 5H5SA 4I5QA 4ZB9A 2C3QA 3IK9A 4HI7A 1QXHA 3KJYA 3UL3A 2GT6A 1OKDA 4NMUA 1N2AA 1GSFA 3DGQA 4KH7A 2H6YA 3O76A 3M1GA 5IO0A 2C8UA 5HR3A 3RPPA 3TCOA 4ZBAA 2G2QA 2YV7A 2R6KA 2ALBA 2NVLA 4FYUA 4IP6A 5DDLA 2IL3A 5A5KA 2VCTA 3ME8A 2EIQA 1K0OA 1B9YC 5ECLB 4MABA 5IMZA 2PVQA 4YQUA 2M80A 4MJAA 4GLTA 2K8VA 5ENUA 1XVQA 3GRXA 2DLXA 2REMA 4BL7B 2EC4A 1EGRA 3BJ5A 1BX9A 4ACSA 5G30A 4BVXA 4V2NA 1U88A 1PQNA 3DVXA 1T3BA 2GZZA 1A0RP 2FUG2 5CRHA 2H74A 4OCFA 2AJQB 1AW9A 3BD2A 1RW1A 1S3AA 1FVJA 1ON4A 5ECKB 1GSEA 3GL3A 1TK0B 1FOVA 3NIVA 2FWGA 14GSA 2YZHA 4H86A 1IYHA 4TR4A 1SK1A 4MF7A 4PQ1A 5GAPD 1M2AA 1U87A 3IXRA 4AGSA 1WE0A 1ERTA 3H4KA 3ZL5A 2LNTA 2XBIA 2LJKA 4MDCA 2GT5A 2VLUA 1GNEA 2I4AA 4XRAA 5G1KA 3NOFA 1Z5YE 1R26A 5GSSA 2YWIA 4EDZA 3M8NA 3IC8A 5DQYA 3QOUA 2KHPA 3GFKA 5F07A 5G1LA 3E0UA 3KP9A 1XPVA 1YKCA 4KX4A 2PPTA 5D93A 3W8SA 2X8CA 1YZXA 2XBQA 2YP6A 1WRYA 4HU9A 3A3TA 4FO5A 1E2YA 3QDNA 3CMIA 1F3AA 1OE7A 3TKRA 5HR0A 1R4WA 2E0QA 4JRRA 3W6GA 2OACA 4KSOA 3WT1A 3VI5A 2AAWA 4EE0A 1K3YA 2R37A 2HZFA 3RHBA 1NSWA 2MYGA 3TOUA 2CVDA 4ZB8A 3EE2A 2WB9A 4GSTA 2L57A 2QSIA 3O3TA 3L9SA 3IRAA 1MTCA 4N0VA 3MSZA 4K9ZA 4ECBA 1WOUA 2R5GA 3QMXA 2ZNMA 1G7EA 1ABAA 1X9SB 5FT3A 3VFIA 1ZMAA 2DJKA 3LYPA 5KN0A 2PGTA 3HD5A 2OJLA 2AHEA 5FWGA 4MZBA 4JE1A 1GUHA 1XZOA 3C8EA 2PWJA 1ML6A 4GRFA 4TKYA 3SWLA 3AY8A 3G9BA 1ZZYA 1PX7A 2GS3A 1VF2A 2DSAA 1B4QA 4ZBDA 2IN3A 1B4PA 4PX1A 1X5EA 4J56E 2VM2A 5ECHB 2CQ9A 3HVXA 4MMMA 2B1KA 2I81A 3ZIVA 4PURA 3VWUA 3HYPA 1G6YA 1ERVA 1MDIA 2N5BA 3KTLA 2H70A 2CV4A 20GSA 5CP1A 5DJLA 1PD21 4MA9A 3ZIJA 2BMXA 1TDIA 4KA0A 4ZIJA 1A2MA 4HQSA 4LL4B 5ECSA 1SYRA 1SYXA 1AUCA 5ECIB 1OC8A 5DALA 4POLA 2V2GA 2L6CA 3LJRA 1HNCA 4GXZA 3WGDA 1V98A 5G5EA 3OR5A 1VF3A 1V58A 4XCSA 1FB0A 5HFIA 4ID0A 2H0HA 2HSMB 5DQSA 4XS4A 3HJMA 1ZCPA 3L9VA 3C71A 5ID2A 1FB6A 2L5OA 1SL2B 4GSNA 3TRXA 4DVCA 2ZUPA 4WF4A 5IOWA 4I6XA 4DSSB 4YH2A 2IMEA 1GLQA 1GSYA 3LFLA 5GAND 1QMVA 3G7JA 4WBRD 2HLSA 3DD3A 3EMPA 2VO4A 3FK8A 5IMFA 2OE0A 1TU7A 1T4ZA 5ECRB 1F37A 3UOMA 4K1FA 2V6KA 4RI6A 3RPNA 1XOAA 1HNAA 1M99A 1FG4A 3VURA 1WMJA 2RLIA 5ECMB 3L78A 3UBLA 2MBTA 3I43A 3TKSA 2F9SA 4FYBA 4N30A 1ERUA 1FVKA 2X64A 4POKA 3UVHA 5F8BA 2LRTA 1SKWB 3PINA 1YEXA 2G0FA 2PMTA 2C0GA 4MJCA 1H4OA 4K6XA 5DALB 1JLWA 3GKNA 1CQHA 1XW6A 3ZTLA 2K8SA 5A4UA 3Q74A 2C0DA 2GGTA 1GTUA 1J08A 2OE1A 1OC3A 2FGXA 4MZCA 4LL1B 2AB6A 4EL1A 5ID2B 1NW2A 1DE1A 4HJMA 4EXJA 4JU5A 1A23A 2J9HA 2H1DA 2YNXA 1G0TA 1X5DA 1PRXA 5J9CA 2CVKA 2CZ2A 3QD9A 2OBIA 4HJ2A 1JZDA 1JZOA 3DVWA 2YCDA 1F9MA 3GKXA 2HQTA 1N8JA 1K0NA 3Q19A 3CSHA 4Q5NA 4G0KA 4EVMA 3KM6A 17GSA 3D4MA 1GRXA 1M9AA 2CVBA 5CNWA 4ECJA 5JCGA 3ZMLA 1I9DA 4TR0A 5JWOB 1TI1A 4J2FA 3IDVA 1GP1A 1F6MC 3F63A 2VUPA 2Z9SA 4GCIA 5CAXA 1E6BA 4G10A 1A2LA 5JCWA 5DVBA 5B6NA 1TP9A 5HR2A 3KH7A 2IMFA 4L8EA 4NHWA 4ZB6A 4KDUA 2HSHA 3IPZA 3PGTA 3GTUA 5J9BA 6GSTA 3TJKA 4L5LA 2V1MA 1UN2A 2JZTA 3CSIA 3QAGA 2DMLA 2I9HA 1EP8A 4POMA 4O92A 3I9V2 2JSZA 5IMCA 1SL1B 1QQ2A 2FD3A 3LGCA 1A8YA 1XIYA 4KAEA 2FLSA 2VCXA 1OVNA 1TRWA 2MZCA 5IMAA 5EVOA 3HVVA 4BPYA 4DSRA 1Q4JA 1V40A 2N5FA 1RK4A 2LKUA 3P90A 2FWEA 3P7XA 1X0RA 4XS6A 2I1UA 3M9KA 1ERWA 4GWRA 3EWLA 4EF0A 4ML6A 1DE2A 4AF2A 2GSTA 3TOTA 4NPBA 3QAWA 4KGIA 4MF5A 3CYNA 2OBKA 5IMDA 4TRXA 2BTOT 1DSBA 1JHBA 1T4YA 1VF4A 3FRCA 3F8UA 3W8JA 3ZRDA 3DXBA 3CRTA 3NZNA 3N9JA 1GUMA 2FCHA 2B3SA 4ZL7A 4E8EA 3F9UA 4K0GA 2GVPA 4F0BA 4D73A 3GKKA 2R4VA 1ZYEA 3FZ4A 5D9WA 4IW9A 4MCUA 2DMMA 3G7IA 5HFGA 2MBSA 1XW5A 3DYRA 1NM3A 1M0UA 1K3LA 5GZZB 3LXTA 1XW9A 4IGJA 1QUWA 3R2QA 1SK0A 3PH9A 1OAZA 4NXIA 1LU4A 1V2AA 3F6DA 4NWYA 1X5CA 4E8HA 3C1SA 4F2IA 4WF5A 4V1Ap 2LTKA 2HE3A 4WEYA 13GSA 1EEMA 3ME7A 2IIYA 4N10A 1AAZA 1O81A 1TRVA 1K0BA 5JCUA 1GWCA 3S9FA 3L4NA 4MPGA 3HVSA 3P2AA 1XWCA 4K7IA 3A2VA 2WJUA 4MP4A 3U5RE 4PGTA 3KH9A 3ZYWA 3F6FA 2RM6A 4KCAA 4RI7A 3GH6A 2YV9A 2L6DA 2QKEA 4LLRA 3GMFA 1XWGA 4I97A 5FHIA 2ES7A 3KIJA 10GSA 3HJOA 4GF0A 1WWJA 1GULA 1GL8A 1TRUA 2DIYA 1FO5A 5D9TA 1ST9A 3GSSA 4D73B 4N0ZA 2VD0A 1YF0A 2DJ0A 3KZQA 3TGZA 1TK8B 2HSNB 1FW1A 3MWHA 4HUAA 3H93A 4KB3A 4KW6A 4ZL8A 3IR4A 3F4SA 4BWQA 2IFQA 3IC4A 3CTGA 4WR4A 4L0UA 2IMDA 2YANA 3BCKA 2KOKA 4GTUA 2O7KA 1MD4A 1JLVA 2LEGA 2H73A 5IMVA 2NBSA 1SJZA 3QFBC 3SBCA 1M2BA 2A4VA 1ACVA 1YKAA 1KBNA 2LQQA 2XHFA 4TW5A 4HOJA 3UEMA 2LUSA 3APOA 1A8LA 3PR8A 4XRDA 4WETA 4L0WA 2JU5A 3HZ4A 1THOA 4MH3A 1G7OA 1XWKA 4BVXB 3KD0A 4PNGA 2QGVA 3LSZA 4MK3A 2H76A 4PQIA 3VPTA 5J5NA 3HKRA 3GNJA 2B1LA 5DBQA 3TRPA 5DAKA 2KUCA 1GSUA 2NDOA 1T7PB 3M3MA 1A24A 3HHVA 4CW9A 5HQPA 2LS5A 3LYKA 2GLRA 3J7Yk 4RQRA 3FW2A 1S3CA 1GH2A 1XWBA 2V6OA 2H71A 4Q5RA 5DJMA 4P3YB 2VCWA 4G19A 3APSA 1Z9HA 1FAAA 3UAPA 3EURA 3E3EA 3C1RA 4WR5A 1SK2A 2CZ3A 2DJ1A 2P0GA 3WYWA 2C3TA 2GSRA 3ZLPA 1GSQA 4USSA 3WT2A 3HDCA 2GDRA 1U3AA 1TJDA 5ELGA 5DCHA 5C00A 3LEFA 2FY6A 2YPMA 3GIXA 1TTZA 2OKAA 1PL2A 4I2UA 4HEA2 2O89A 4PXOA 3GHAA 2H1AA 2NPBA 1ILOA 4G9HA 3GH9A 4MJEA 2IFQB 3GL5A 1TW9A 2HRFA 4NAXA 2PU9C 4YQMA 4GQFA 2B5XA 3U6VA 1K0MA 2RUFA 1U6TA 6GSVA 3EU4A 1PL1A 3D0ZA 3D4TA 5JWRB 4OFNA 2HRAA 5J4UA 4ZL9A 2FNOA 1SENA 4IP1A 2CAQA 3GX8A 4TXVA 1S3DA 1OC9A 4V2LA 1QGVA 1UA5A 3FEUA 2H0GA 2C3NA 1SD9A 1TRSA 2B6MA 3QCPA 1PX6A 1XXUA 5DAKB 4GQCA 5B8AA 5ECOB 1A2JA 1QFNA 5D8IA 3ZVJD 3M9JA 2VIMA 5B7CA 2MMOA 4IQ1A 1O6JA 6GSYA 2DJ3A 4RQXA 3DMLA 4JZQA 2X8HA 1ZOFA 5AIVA 2WGRA 5H5QA 4GSSA 5KN2A 3QR6A 3FR6A 3TKPA 2R2JA 4K0NA 2JL4A 2CA8A 1YEPA 1DUGA 3P8WA 2VL2C 3FHKA 2HXKA 1T8EB 4K7OA 4EO3A 5IIZA 2LJAA 4BWSA 4ZXGA 1CQGA 1B9XC 3FR3A 4IVFA 1URMA 2HYXA 2VLVA 4O5RA 4IQAA 3ZREA 3FZAA 4QL7A 2P31A 3J7Yb 3GUSA 3IV4A 3BBYA 3D21A 3WGXA 1SKSB 2H1GA 3KMOA 2FA8A 4X0XA 4WBJA 5CRWA 2GSQA 3MNGA 4BA7A 5KN3A 3A5WA 4XIHA 1AQWA 1SJ6A 4JEDA 5D73A 3MDKA 5G2ZA 2NTOA 2YJ7A 4HU7A 4J57E 4YAVA 1GNWA 1YQ1A 2LSTA 3EVIA 4IELA 4FIWA 1XVWA 4XS4B 4IJIA 2YWMA 2PERA 1Z7PA 4V2MA 3US3A 4FYCA 1VF1A 2LQOA 5ECQB 3VI7A 1X9MB 5CRDA 2B5YA 5CREA 3LWAA 2H19A 1ZYQB 1USBA 1B48A 1WP0A 2KP2A 5CRGA 1Z7RA 1V9WA 4CDOA 1Z3EA 2IJYA 2MMAA 1Z6NA 3FR9A 4K2DA 5C04A 1ZL9A 5IO2A 1K3OA 5CYYA 3ZVJA 4OWYA 1WIKA 3I69A 2VOCA 4HS1A 2V41A 1AQXA 2AV4A 4ISDA 5J3RA 4OFTA 3GKMA 1YF1A 2YN1A 2WCIA 4XS1A 2VCVA 1TK5B 5H5RA 1BEDA 5EPFA 1W4VA 4IKHA 3RHCA 1WPIA 7GSSA 4FH8A 3ERWA 4F9ZA 18GSA 4CHSA 3IHQA 4IS0A 1LBKA 1TU8A 1UC7A 3R3EA 2I3YA 2L4CA 1Y25A 4PQHA 3F4TA 5IPGA 2K6VA 3KXOA 2YOIA 3TKQA 1HD2A 2VL9A 4AJ6A 4TXOA 2PVOC 4DSQA 1A0FA 3UIWA 1XOBA 3L9UA 3ZITA 2O87A 2L5LA 3C7MA 4IN0A 2JACA 4PTSA 1XFLA 3KMNA 4NV5A 2D2ZA 2IPAA 5DCGA 1AIUA 5EL8A 3BOAA 1GTAA 4OO4A 5AGYA 3F3QA 2JSYA 1V57A 2VAFA 3H8QA 4OCEA 5JWQB 2K18A 1R5AA 1BAYA 2GSSA 5E4WA 1U3IA 1RQMA 3ISOA 1BJXA 4HDEA 3CRUA 3FZ9A 1HNBA 4POBA 3WGEA 3RAZA 2YJHA 1PGTA 4MF6A 3TKSC 2WDUA 4V1Ag 1K0DA 2VD1A 3V1WA 1T00A 2YWOA 3QFAC 4ZBBA 2XPDA 5AISA 3EYTA 2F8AA 1GSDA 1O8WA 1O73A 5GSTA 3GTUB 2HSYA 5HFKA 5BMUA 2H01A 3LXZA 1O7UA 4YQVA 3CTFA 1BYEA 4JR6A 3LORA 2TRCP 3KP8A 1PA3A 2OE3A 3UBKA 4TXOB 5D9XA 3PPUA 2IMIA 4X43A 2V32A 1DBYA 1T1VA 3DIEA 3KGKA 4ILFA 2RM5A 3EU3A 1MDKA 5ECNB 4Q5QA 2E2GA 2CAIA 3CXGA 4MLYA 5L71A 4HZ2A 2KP1A 1OYJA 5AIXA 4KNDA 3IK7A 1Q98A 1YY7A 2WS2A 2MMZA 3IAS2
chains in the Genus database with same CATH superfamily
3EC3A 4ML1A 1EP7A 2LRCA 4O5UA 2A2PA 4OD7A 5EY6A 1HQOA 2LV3A 3HXSA 3D22A 2LJRA 5LD0A 3VPQA 2PUKC 4XHMA 3RBTA 2C0FA 5B6MA 3UMAA 3L0HA 3KCMA 1JZWA 5A4WA 2PN8A 2GQKA 3FYGA 3TUEA 4QMKA 4EUYA 5INYA 1GUKA 2F51A 2HRNA 2X8GA 5BMUB 3MAKA 2H30A 3GSTA 2GZYA 2BJXA 2HRKA 2GQMA 2DJ2A 4LMWA 2VL2A 2RIIA 4TR1A 4TR3A 3Q18A 2MMNA 4ECCA 3KEBA 1SJIA 1XWAA 12GSA 4G2EA 1H75A 1NHYA 3HCZA 2IMKA 4OMVA 3FY7A 4IBPA 2TIRA 4XTSA 2R0CA 1AXDA 4EKZA 1AQVA 1SU9A 3VWXA 1F3BA 1SD8A 2H8LA 4AJ7A 3TRQA 2M72A 2FWHA 3UVTA 3GX0A 3TKSE 2O36A 3LG6A 4TOPA 3GURA 1B8XA 1PN9A 3F0IA 8GSSA 5LCZA 1O85A 4JR4A 1GSSA 3TJJA 2HSMA 4L5OA 5LNKe 1M7TA 22GSA 2JZSA 2F8FA 3H1NA 1VRSD 3ZZXA 4ECIA 4PI0C 2VLTA 1C72A 1EWXA 3ERGA 3A2XA 3TDGA 2H6ZA 3CBUA 5IQYA 5G31A 1KEBA 2WRTA 1HYUA 3K8NA 4DSSA 1NHOA 4Z7XA 5F0GA 2CX3A 2VCZA 2HZEA 9GSSA 1O8XA 2N5AA 4BVYA 3BCIA 4N3ZA 5KEJA 3GN3A 5IM9A 4HZ4A 1WJKA 1JZRA 4KCEA 2DBCA 4K7NA 2A2RA 2K9FA 1SL0B 2CX4A 1TKDB 2HRKB 1EZKA 16GSA 4TR1B 19GSA 3QPMA 4TN8A 1EV9A 3JCML 1M3IA 2DC5A 2C1YA 1LJRA 2E2MA 3HZ8A 3GYKA 3TJFA 6GSUA 4O7HA 2H72A 3FKFA 3IHGA 4G0LA 4QL9A 5IOXA 3CSJA 2E7PA 2CT6A 2VL3A 2H0IA 2GQLA 11GSA 1Z6MA 2B7KA 1ZGNA 2M46A 2FA4A 2B7JA 4MZWA 4IHUA 2P5QA 5B8BA 4F82A 1FHEA 4JBBA 2EIRA 4MH2A 2O85A 4F0CA 1EOGA 4KDXA 2JADA 3DEXA 3Q6OA 2B5EA 3N5OA 3CHXC 5J41A 4KUNA 5ELAA 2A2SA 4NHZA 1M9BA 1OKTA 3IAM2 3LQ7A 1M2DA 3H79A 4Q5FA 4O32A 3O6TA 5HR1A 5ABRA 1I5GA 3I6AA 4AKIA 1EV4A 2AYTA 4MPFA 3TB2A 1X9WB 4I2TA 3A2WA 2HZEB 3APQA 3HJPA 2F3MA 3DKSA 4PUFC 4FQUA 4BVYB 1GLPA 1K0AA 2LRNA 3DRNA 1AC1A 2AUVA 5G5FA 4TVEA 1TOFA 2VCQA 1UVZA 2ZCTA 4I8BA 2HFDA 4KSMA 4MJBA 3GV1A 1EGOA 2QC7A 5J4VA 2X99A 4W66A 2EIOA 3QAVA 4ULXA 3FZ5A 1F2EA 1XBSA 3TJGA 3ZMKA 1OC9B 4WXTA 1PKWA 1TI3A 2WULA 2ON5A 4IJ3A 2ON7A 3IBHA 2R3XA 3GA4A 4N11A 1BG5A 2XC2A 4WKWA 3TJBA 2TRXA 2FWFA 4HQZA 4ZILA 1VGLA 3VLNA 1R7HA 2PBJA 4PNFA 1THXA 2H75A 1PKZA 2YWNA 3ERFA 1KNGA 4K8MA 2HI7A 1W89A 3EINA 1J9BA 2P5RA 6GSSA 3RDWA 3E9JB 1MEKA 2H66A 2J23A 3D5JA 4G0IA 2GTUA 4RUVA 3IA1A 4YAPA 5KN1A 2A4HA 4KF9A 1YDKA 2C4JA 1OE8A 5D9VA 4NV2A 2C0EA 2DKHA 2FHEA 1K0CA 2GZPA 1G6WA 3IE3A 1SKRB 4HSCX 4OO5A 2VM1A 2DIZA 3G7YA 2RUEA 3F3RA 3VWWA 6GSXA 4EDYA 1R5PA 2YZUA 4DEJA 1PSQA 3VWVA 4AJ8A 2WFCA 2H1LA 2L59A 2H1BA 2IWTA 2OADA 1XCCA 4LA1A 2C80A 2R0GA 1QK8A 3D6IA 1BQ7A 3ZFBA 1Y6EA 3ZFLA 1MDJA 5ECPB 3HA9A 3WD6A 6GSWA 2HNLA 2JZRA 2EFEA 1J0FA 2DJJA 1TXXA 3M0FA 2L4QA 3KTBA 2O8VB 1GTIA 3F4RA 4X1UA 4OFMA 3IOSA 3VK9A 4YKFA 5F06A 4BL7A 5IPHA 1KTEA 1PMTA 1GTBA 5D96A 1EEJA 5CO3A 5F05A 5AN1A 4KDYA 1MD3A 4F03A 3ED3A 3C73A 3DWVA 2H6XA 3UARA 2KLXA 2DKIA 4EC0A 2XPEA 1EOHA 2OA7A 4KE3A 2LNSA 1JFUA 2HT9A 2UZ8A 2WZ9A 4PUAA 5A4VA 3UJ1A 1YJ6A 3HY2A 1IYIA 4Z2UA 4LMVA 4QQ7A 3EMXA 5COHA 5E59A 2EFHA 5H5SA 4CY8A 4I5QA 4ZB9A 2C3QA 3IK9A 4HI7A 1QXHA 3KJYA 3UL3A 2GT6A 1OKDA 4NMUA 1N2AA 1GSFA 3DGQA 4KH7A 2H6YA 3O76A 2HSNA 3M1GA 5IO0A 2C8UA 5HR3A 3RPPA 3TCOA 4ZBAA 2G2QA 2YV7A 2R6KA 5KOWA 3LW9A 2ALBA 2NVLA 4FYUA 4IP6A 1Y1UA 5DDLA 2IL3A 5A5KA 2VCTA 3ME8A 2EIQA 1K0OA 1B9YC 5ECLB 4MABA 5IMZA 2PVQA 4EIQA 4YQUA 2M80A 4MJAA 4GLTA 2K8VA 5ENUA 1XVQA 3GRXA 2DLXA 2REMA 4BL7B 2EC4A 3TU3B 1EGRA 3BJ5A 1BX9A 4ACSA 5G30A 4BVXA 4V2NA 1U88A 1PQNA 3DVXA 3MYDA 1T3BA 2GZZA 1A0RP 2FUG2 5CRHA 2H74A 4OCFA 2AJQB 1AW9A 3BD2A 1RW1A 1S3AA 1FVJA 1ON4A 5ECKB 1GSEA 3GL3A 1TK0B 1FOVA 3NIVA 2FWGA 14GSA 2YZHA 5A5HB 4H86A 1IYHA 4TR4A 1SK1A 4MF7A 4PQ1A 5GAPD 1M2AA 3MIXA 1U87A 3IXRA 4AGSA 1WE0A 1ERTA 3H4KA 3ZL5A 2LNTA 2XBIA 2LJKA 5KOXA 2R0PA 4MDCA 2GT5A 2VLUA 1GNEA 2I4AA 4XRAA 5G1KA 3NOFA 1Z5YE 1R26A 5GSSA 2YWIA 4EDZA 3M8NA 3IC8A 5DQYA 3QOUA 2KHPA 3A5IA 3GFKA 5F07A 5G1LA 3E0UA 3KP9A 1XPVA 1YKCA 4KX4A 2PPTA 5D93A 3W8SA 2X8CA 1YZXA 2XBQA 2YP6A 2EFCA 1WRYA 4HU9A 3A3TA 4FO5A 1E2YA 4CY6A 3QDNA 3CMIA 1F3AA 1OE7A 3TKRA 5HR0A 1R4WA 2E0QA 4JRRA 3W6GA 4AKHA 2OACA 4KSOA 3WT1A 3VI5A 2AAWA 4EE0A 1K3YA 2R37A 2HZFA 3RHBA 1NSWA 2MYGA 3TOUA 2CVDA 4ZB8A 3EE2A 2WB9A 4GSTA 4EIPA 2L57A 4E68A 2QSIA 3O3TA 3L9SA 3IRAA 1MTCA 4N0VA 3MSZA 4K9ZA 4ECBA 1WOUA 2R5GA 3QMXA 2ZNMA 1G7EA 1ABAA 1X9SB 5FT3A 3VFIA 1ZMAA 2DJKA 3LYPA 5KN0A 4K5RA 2PGTA 3HD5A 2OJLA 2AHEA 5FWGA 4MZBA 4JE1A 1GUHA 1XZOA 3C8EA 2PWJA 1ML6A 4GRFA 4TKYA 3SWLA 1SVMA 3AY8A 3G9BA 1ZZYA 1PX7A 2GS3A 1VF2A 2DSAA 2QA2A 1B4QA 4ZBDA 2IN3A 1B4PA 4PX1A 1X5EA 4J56E 2VM2A 5ECHB 2CQ9A 3HVXA 4MMMA 2B1KA 2I81A 3ZIVA 4PURA 3VWUA 3HYPA 2WVZA 1G6YA 1ERVA 1MDIA 2N5BA 3KTLA 2H70A 2CV4A 20GSA 1ZYNA 5CP1A 5DJLA 1PD21 4MA9A 3ZIJA 2WW1A 2BMXA 1TDIA 4KA0A 4ZIJA 1A2MA 4HQSA 4LL4B 5ECSA 1SYRA 1SYXA 1AUCA 5ECIB 1OC8A 5DALA 4POLA 2V2GA 2L6CA 3LJRA 1HNCA 4GXZA 3WGDA 1V98A 5G5EA 2WVYA 3OR5A 1VF3A 1V58A 4XCSA 1FB0A 5HFIA 4ID0A 2H0HA 2HSMB 5DQSA 4XS4A 3HJMA 1ZCPA 3L9VA 3C71A 5ID2A 1FB6A 2L5OA 1SL2B 4GSNA 5BRTA 3TRXA 4DVCA 2ZUPA 4BIKA 4WF4A 5IOWA 4I6XA 4DSSB 4YH2A 2IMEA 1GLQA 1GSYA 3LFLA 5GAND 1QMVA 3G7JA 4WBRD 2HLSA 3DD3A 3EMPA 2VO4A 3FK8A 5IMFA 2OE0A 1TU7A 1T4ZA 2X49A 5ECRB 1F37A 3UOMA 4K1FA 2V6KA 4RI6A 3RPNA 1XOAA 4GDFA 1HNAA 1M99A 1FG4A 3VURA 1WMJA 2RLIA 5ECMB 3L78A 3UBLA 2MBTA 3I43A 3TKSA 2F9SA 4FYBA 4N30A 1ERUA 1FVKA 2X64A 4POKA 3UVHA 5F8BA 2LRTA 1SKWB 3PINA 1YEXA 2G0FA 2PMTA 2C0GA 4G01A 4MJCA 1H4OA 4K6XA 5DALB 1JLWA 4AKGA 3GKNA 1CQHA 1XW6A 3ZTLA 2K8SA 4AKXB 5A4UA 3Q74A 2C0DA 2GGTA 1GTUA 1J08A 2OE1A 1OC3A 2FGXA 4MZCA 4LL1B 2AB6A 4EL1A 5ID2B 1NW2A 1DE1A 4HJMA 4EXJA 4JU5A 1YVLA 1A23A 2J9HA 2H1DA 2YNXA 1G0TA 1X5DA 1PRXA 5J9CA 2CVKA 2CZ2A 3QD9A 2OBIA 4HJ2A 1JZDA 1JZOA 3DVWA 2YCDA 1F9MA 3GKXA 2HQTA 1N8JA 1K0NA 3Q19A 3CSHA 4Q5NA 4G0KA 4EVMA 3KM6A 17GSA 3D4MA 1GRXA 1M9AA 2CVBA 5CNWA 4ECJA 5JCGA 3ZMLA 1I9DA 4TR0A 5JWOB 1TI1A 4J2FA 3IDVA 1GP1A 1F6MC 3F63A 2VUPA 2Z9SA 4GCIA 5CAXA 1E6BA 4G10A 1A2LA 5JCWA 5DVBA 1YEWC 5B6NA 1TP9A 5HR2A 3KH7A 2IMFA 4L8EA 4NHWA 4ZB6A 4KDUA 2HSHA 3IPZA 3PGTA 3GTUA 5J9BA 6GSTA 3TJKA 4L5LA 2V1MA 1UN2A 2JZTA 3CSIA 3QAGA 2VKZG 2DMLA 2I9HA 1EP8A 4POMA 4O92A 3I9V2 2JSZA 5IMCA 1SL1B 1QQ2A 2O3EA 2FD3A 3LGCA 2O5VA 1A8YA 1XIYA 4KAEA 2FLSA 2UV8G 2VCXA 1OVNA 1TRWA 2MZCA 3EPTA 5IMAA 5EVOA 3HVVA 4BPYA 4DSRA 1Q4JA 1V40A 2N5FA 1RK4A 2LKUA 3P90A 2FWEA 3P7XA 1X0RA 4XS6A 2I1UA 3M9KA 1ERWA 4GWRA 3EWLA 4EF0A 4ML6A 1DE2A 4AF2A 2GSTA 3TOTA 4NPBA 3QAWA 4KGIA 4MF5A 3CYNA 2OBKA 5IMDA 4TRXA 2BTOT 1DSBA 1JHBA 1T4YA 1VF4A 3FRCA 3F8UA 3W8JA 3ZRDA 3DXBA 3CRTA 3NZNA 3N9JA 1GUMA 2FCHA 2B3SA 4ZL7A 4E8EA 3F9UA 4K0GA 2GVPA 4F0BA 4D73A 3GKKA 2R4VA 1ZYEA 3FZ4A 5D9WA 4IW9A 4MCUA 2DMMA 3G7IA 5HFGA 2MBSA 1XW5A 3DYRA 1NM3A 1M0UA 1K3LA 5GZZB 3LXTA 1XW9A 3CQFA 4IGJA 1QUWA 3R2QA 1SK0A 5A1NA 3PH9A 1OAZA 4NXIA 1LU4A 1V2AA 3F6DA 4NWYA 1X5CA 4E8HA 3C1SA 4F2IA 4WF5A 4V1Ap 2LTKA 2HE3A 4WEYA 13GSA 1EEMA 3ME7A 2IIYA 4N10A 1AAZA 2EFDA 1O81A 1TRVA 1K0BA 5JCUA 1GWCA 3S9FA 3L4NA 4O5QA 4MPGA 3HVSA 3P2AA 1XWCA 2WVXA 4K7IA 3A2VA 2WJUA 4MP4A 3U5RE 1ZYPA 4PGTA 1SVOA 1N25A 3KH9A 3ZYWA 4MNNA 3F6FA 2RM6A 4KCAA 4RI7A 3GH6A 2YV9A 2L6DA 2QKEA 4LLRA 3GMFA 1XWGA 4I97A 5FHIA 1PFOA 2ES7A 2WW0A 3KIJA 10GSA 3HJOA 4GF0A 1WWJA 1M3JA 1GULA 1GL8A 1TRUA 2DIYA 1FO5A 5D9TA 1ST9A 3GSSA 4D73B 4N0ZA 2VD0A 5A34A 1YF0A 2DJ0A 3KZQA 3TGZA 1TK8B 2HSNB 1FW1A 4Z2RA 3MWHA 4HUAA 3H93A 4KB3A 4KW6A 4ZL8A 3IR4A 3F4SA 4BWQA 2IFQA 3IC4A 3CTGA 4WR4A 4L0UA 2IMDA 2YANA 3BCKA 2KOKA 4GTUA 2O7KA 1MD4A 5A1NB 1JLVA 2LEGA 2H73A 5IMVA 2NBSA 1SJZA 3QFBC 3SBCA 1M2BA 2A4VA 1ACVA 1YKAA 1KBNA 2LQQA 2XHFA 4TW5A 4HOJA 3UEMA 2LUSA 3APOA 1A8LA 3PR8A 4XRDA 4WETA 4L0WA 1TXUA 2JU5A 3HZ4A 1THOA 4MH3A 1G7OA 1XWKA 4BVXB 3KD0A 4PNGA 2QGVA 3LSZA 4MK3A 2H76A 4PQIA 3VPTA 5J5NA 3HKRA 3RFRC 3GNJA 2B1LA 5DBQA 3TRPA 2WVXB 5DAKA 2KUCA 1GSUA 2NDOA 1T7PB 3M3MA 1A24A 3HHVA 4CW9A 5HQPA 2LS5A 3LYKA 2GLRA 3J7Yk 4RQRA 3FW2A 1S3CA 1GH2A 1XWBA 2V6OA 2H71A 4Q5RA 5DJMA 4P3YB 2VCWA 4G19A 3APSA 1Z9HA 1FAAA 3UAPA 3EURA 3E3EA 3C1RA 4WR5A 1SK2A 2CZ3A 2DJ1A 2P0GA 3WYWA 2C3TA 2GSRA 3ZLPA 1GSQA 4USSA 5A34B 3HDCA 3WT2A 2GDRA 2OT3A 1U3AA 1TJDA 5ELGA 5DCHA 5C00A 3LEFA 2FY6A 2YPMA 3GIXA 1TTZA 2OKAA 1PL2A 4I2UA 1S4BP 4HEA2 2O89A 4PXOA 3GHAA 2H1AA 2NPBA 1ILOA 4G9HA 3GH9A 4MJEA 2IFQB 3GL5A 1TW9A 2HRFA 4NAXA 2WW2A 2PU9C 4YQMA 4GQFA 2B5XA 3U6VA 1K0MA 2RUFA 1U6TA 6GSVA 3EU4A 1PL1A 3D0ZA 3D4TA 5JWRB 4OFNA 2HRAA 5J4UA 4ZL9A 2FNOA 1SENA 4IP1A 2CAQA 3GX8A 4TXVA 1S3DA 1OC9A 4V2LA 1QGVA 1UA5A 3FEUA 2H0GA 2C3NA 1SD9A 1TRSA 2B6MA 3QCPA 1PX6A 1XXUA 5DAKB 4GQCA 5B8AA 5ECOB 1A2JA 1QFNA 5D8IA 3ZVJD 3M9JA 2VIMA 5B7CA 2MMOA 4IQ1A 1XG8A 1O6JA 6GSYA 2DJ3A 4RQXA 3DMLA 4JZQA 2X8HA 1ZOFA 5AIVA 2WGRA 5H5QA 4GSSA 5KN2A 3QR6A 3FR6A 3TKPA 1FOHA 2R2JA 4K0NA 2JL4A 2CA8A 3RGBC 1YEPA 1DUGA 3P8WA 4A5PA 2VL2C 3FHKA 1BF5A 2HXKA 1T8EB 4K7OA 4EO3A 5IIZA 2LJAA 4BWSA 4ZXGA 1CQGA 1B9XC 3FR3A 4IVFA 1URMA 2HYXA 2VLVA 4O5RA 3CWGA 4IQAA 3ZREA 3HVNA 3FZAA 4QL7A 2P31A 3J7Yb 3GUSA 3IV4A 4ICYA 1S3RA 3BBYA 3D21A 4ZB7A 3WGXA 1SKSB 2H1GA 3KMOA 2FA8A 4X0XA 4WBJA 5CRWA 2GSQA 3MNGA 4Z2TA 4BA7A 5KN3A 3A5WA 4XIHA 2WW3A 1AQWA 1SJ6A 4JEDA 5D73A 3MDKA 5G2ZA 2NTOA 2YJ7A 4HU7A 4J57E 4YAVA 1GNWA 1YQ1A 4YKGA 2LSTA 3EVIA 3HMJG 4K2XA 4IELA 4FIWA 1XVWA 4XS4B 4IJIA 5J4YA 2YWMA 2PERA 1Z7PA 4V2MA 3US3A 4FYCA 1VF1A 2LQOA 5ECQB 3VI7A 1X9MB 5CRDA 2B5YA 5CREA 3LWAA 2H19A 1ZYQB 1USBA 1B48A 1WP0A 2KP2A 5CRGA 1Z7RA 1V9WA 4CDOA 1Z3EA 2IJYA 2MMAA 1Z6NA 3FR9A 4K2DA 5C04A 1ZL9A 5IO2A 1K3OA 4K5SA 5CYYA 3ZVJA 4OWYA 1WIKA 3I69A 2VOCA 4HS1A 2V41A 1AQXA 5J47A 4X4JA 2AV4A 4ISDA 5J3RA 4OFTA 3GKMA 1YF1A 2YN1A 2WCIA 4XS1A 2X4AA 2VCVA 1TK5B 5H5RA 1I1IP 1BEDA 4PHZC 1PN0A 5EPFA 1W4VA 4IKHA 3RHCA 1WPIA 7GSSA 4FH8A 3ERWA 4F9ZA 18GSA 4CHSA 3IHQA 4IS0A 1LBKA 1TU8A 1UC7A 3R3EA 2I3YA 2L4CA 1Y25A 4PQHA 3F4TA 5IPGA 2K6VA 3KXOA 2YOIA 3TKQA 1HD2A 2VL9A 4AJ6A 4TXOA 2PVOC 4DSQA 1A0FA 3UIWA 4FXYP 1XOBA 3L9UA 1SVLA 3ZITA 2O87A 2L5LA 3C7MA 4IN0A 2JACA 4PTSA 1XFLA 3KMNA 4NV5A 2D2ZA 2IPAA 5DCGA 1AIUA 5EL8A 3BOAA 1GTAA 4OO4A 5AGYA 3F3QA 2JSYA 1V57A 2VAFA 3H8QA 4OCEA 5JWQB 2K18A 1R5AA 1BAYA 2GSSA 5E4WA 1U3IA 3FMWA 1RQMA 3ISOA 1BJXA 4HDEA 3CRUA 3FZ9A 1HNBA 4POBA 3WGEA 3RAZA 2YJHA 1PGTA 4MF6A 5A5HA 3TKSC 2WDUA 4V1Ag 1K0DA 2VD1A 3V1WA 1T00A 2YWOA 3QFAC 2QA1A 4ZBBA 2XPDA 5AISA 3EYTA 2F8AA 1GSDA 1O8WA 1O73A 5GSTA 3GTUB 2HSYA 5HFKA 5BMUA 4PI2C 2H01A 4AI6A 3LXZA 1O7UA 4YQVA 3CTFA 1BYEA 4JR6A 3LORA 2TRCP 3KP8A 1PA3A 2OE3A 3UBKA 2WZSA 4TXOB 5D9XA 3PPUA 2IMIA 4X43A 2V32A 1DBYA 1T1VA 3DIEA 3KGKA 4ILFA 2RM5A 3EU3A 1MDKA 5ECNB 4Q5QA 2E2GA 2CAIA 3CXGA 4MLYA 5L71A 4HZ2A 2KP1A 1OYJA 1BG1A 5AIXA 4KNDA 3IK7A 1Q98A 1YY7A 2WS2A 2MMZA 5J40A 3IAS2
chains in the Genus database with same CATH topology
3EC3A 4ML1A 1EP7A 2LRCA 4O5UA 2A2PA 4OD7A 5EY6A 1HQOA 2LV3A 3HXSA 3D22A 2LJRA 5LD0A 3VPQA 2PUKC 4XHMA 3RBTA 2C0FA 5B6MA 3UMAA 3L0HA 3KCMA 1JZWA 5A4WA 2PN8A 2GQKA 3FYGA 3TUEA 4QMKA 4EUYA 5INYA 1GUKA 2F51A 2HRNA 2X8GA 5BMUB 3MAKA 2H30A 3GSTA 2GZYA 2BJXA 2HRKA 2GQMA 2DJ2A 4LMWA 2VL2A 2RIIA 4TR1A 4TR3A 3Q18A 2MMNA 4ECCA 3KEBA 1SJIA 1XWAA 12GSA 4G2EA 1H75A 1NHYA 3HCZA 2IMKA 4OMVA 3FY7A 4IBPA 2TIRA 4XTSA 2R0CA 1AXDA 4EKZA 1AQVA 1SU9A 3VWXA 1F3BA 1SD8A 2H8LA 4AJ7A 3TRQA 2M72A 2FWHA 3UVTA 3GX0A 3TKSE 3LG6A 4TOPA 3GURA 1B8XA 1PN9A 3F0IA 8GSSA 5LCZA 1O85A 4JR4A 1GSSA 3TJJA 2HSMA 4L5OA 5LNKe 1M7TA 22GSA 2JZSA 2F8FA 3H1NA 1VRSD 3ZZXA 4ECIA 2VLTA 1C72A 1EWXA 3ERGA 3A2XA 3TDGA 2H6ZA 3CBUA 5IQYA 5G31A 1KEBA 2WRTA 1HYUA 3K8NA 4DSSA 1NHOA 4Z7XA 5F0GA 2CX3A 2VCZA 2HZEA 9GSSA 1O8XA 2N5AA 4BVYA 3BCIA 4N3ZA 5KEJA 3GN3A 5IM9A 4HZ4A 1WJKA 1JZRA 4KCEA 2DBCA 4K7NA 2A2RA 2K9FA 1SL0B 2CX4A 1TKDB 2HRKB 1EZKA 16GSA 4TR1B 19GSA 3QPMA 4TN8A 1EV9A 3JCML 2DC5A 2C1YA 1LJRA 2E2MA 3HZ8A 3GYKA 3TJFA 6GSUA 4O7HA 2H72A 3FKFA 3IHGA 4G0LA 4QL9A 5IOXA 3CSJA 2E7PA 2CT6A 2VL3A 2H0IA 2GQLA 11GSA 1Z6MA 2B7KA 1ZGNA 2M46A 2FA4A 2B7JA 4MZWA 4IHUA 2P5QA 5B8BA 4F82A 1FHEA 4JBBA 2EIRA 4MH2A 2O85A 4F0CA 1EOGA 4KDXA 2JADA 3DEXA 3Q6OA 2B5EA 3N5OA 5J41A 4KUNA 5ELAA 2A2SA 4NHZA 1M9BA 1OKTA 3IAM2 3LQ7A 1M2DA 3H79A 4Q5FA 4O32A 3O6TA 5HR1A 5ABRA 1I5GA 3I6AA 4AKIA 1EV4A 2AYTA 4MPFA 3TB2A 1X9WB 4I2TA 3A2WA 2HZEB 3APQA 3HJPA 2F3MA 3DKSA 4PUFC 4FQUA 4BVYB 1GLPA 1K0AA 2LRNA 3DRNA 1AC1A 2AUVA 5G5FA 4TVEA 1TOFA 2VCQA 1UVZA 2ZCTA 4I8BA 2HFDA 4KSMA 4MJBA 3GV1A 1EGOA 2QC7A 5J4VA 2X99A 4W66A 2EIOA 3QAVA 4ULXA 3FZ5A 1F2EA 1XBSA 3TJGA 3ZMKA 1OC9B 4WXTA 1PKWA 1TI3A 2WULA 2ON5A 4IJ3A 2ON7A 3IBHA 2R3XA 3GA4A 4N11A 1BG5A 2XC2A 4WKWA 3TJBA 2TRXA 2FWFA 4HQZA 4ZILA 1VGLA 3VLNA 1R7HA 2PBJA 4PNFA 1THXA 2H75A 1PKZA 2YWNA 3ERFA 1KNGA 4K8MA 2HI7A 1W89A 3EINA 1J9BA 2P5RA 6GSSA 3RDWA 3E9JB 1MEKA 2H66A 2J23A 3D5JA 4G0IA 2GTUA 4RUVA 3IA1A 4YAPA 5KN1A 2A4HA 4KF9A 1YDKA 2C4JA 1OE8A 5D9VA 4NV2A 2C0EA 2DKHA 2FHEA 1K0CA 2GZPA 1G6WA 3IE3A 1SKRB 4OO5A 2VM1A 2DIZA 3G7YA 2RUEA 3F3RA 3VWWA 6GSXA 4EDYA 1R5PA 2YZUA 4DEJA 1PSQA 3VWVA 4AJ8A 2WFCA 2H1LA 2L59A 2H1BA 2IWTA 2OADA 1XCCA 4LA1A 2C80A 2R0GA 1QK8A 3D6IA 1BQ7A 3ZFBA 1Y6EA 3ZFLA 1MDJA 5ECPB 3HA9A 3WD6A 6GSWA 2HNLA 2JZRA 2EFEA 1J0FA 2DJJA 1TXXA 3M0FA 2L4QA 3KTBA 2O8VB 1GTIA 3F4RA 4X1UA 4OFMA 3IOSA 3VK9A 4YKFA 5F06A 4BL7A 5IPHA 1KTEA 1PMTA 1GTBA 5D96A 1EEJA 5CO3A 5F05A 5AN1A 4KDYA 1MD3A 4F03A 3ED3A 3C73A 3DWVA 2H6XA 3UARA 2KLXA 2DKIA 4EC0A 2XPEA 1EOHA 2OA7A 4KE3A 2LNSA 1JFUA 2HT9A 2UZ8A 2WZ9A 4PUAA 5A4VA 3UJ1A 1YJ6A 3HY2A 1IYIA 4Z2UA 4LMVA 4QQ7A 3EMXA 5COHA 5E59A 2EFHA 5H5SA 4CY8A 4I5QA 4ZB9A 2C3QA 3IK9A 4HI7A 1QXHA 3KJYA 3UL3A 2GT6A 1OKDA 4NMUA 1N2AA 1GSFA 3DGQA 4KH7A 2H6YA 3O76A 2HSNA 3M1GA 5IO0A 2C8UA 5HR3A 3RPPA 3TCOA 4ZBAA 2G2QA 2YV7A 2R6KA 5KOWA 3LW9A 2ALBA 2NVLA 4FYUA 4IP6A 1Y1UA 5DDLA 2IL3A 5A5KA 2VCTA 3ME8A 2EIQA 1K0OA 1B9YC 5ECLB 4MABA 5IMZA 2PVQA 4EIQA 4YQUA 2M80A 4MJAA 4GLTA 2K8VA 5ENUA 1XVQA 3GRXA 2DLXA 2REMA 4BL7B 2EC4A 3TU3B 1EGRA 3BJ5A 1BX9A 4ACSA 5G30A 4BVXA 4V2NA 1U88A 1PQNA 3DVXA 3MYDA 1T3BA 2GZZA 1A0RP 2FUG2 5CRHA 2H74A 4OCFA 2AJQB 1AW9A 3BD2A 1RW1A 1S3AA 1FVJA 1ON4A 5ECKB 1GSEA 3GL3A 1TK0B 1FOVA 3NIVA 2FWGA 14GSA 2YZHA 5A5HB 4H86A 1IYHA 4TR4A 1SK1A 4MF7A 4PQ1A 5GAPD 1M2AA 3MIXA 1U87A 3IXRA 4AGSA 1WE0A 1ERTA 3H4KA 3ZL5A 2LNTA 2XBIA 2LJKA 5KOXA 2R0PA 4MDCA 2GT5A 2VLUA 1GNEA 2I4AA 4XRAA 5G1KA 3NOFA 1Z5YE 1R26A 5GSSA 2YWIA 4EDZA 3M8NA 3IC8A 5DQYA 3QOUA 2KHPA 3A5IA 3GFKA 5F07A 5G1LA 3E0UA 3KP9A 1XPVA 1YKCA 4KX4A 2PPTA 5D93A 3W8SA 2X8CA 1YZXA 2XBQA 2YP6A 2EFCA 1WRYA 4HU9A 3A3TA 4FO5A 1E2YA 4CY6A 3QDNA 3CMIA 1F3AA 1OE7A 3TKRA 5HR0A 1R4WA 2E0QA 4JRRA 3W6GA 4AKHA 2OACA 4KSOA 3WT1A 3VI5A 2AAWA 4EE0A 1K3YA 2R37A 2HZFA 3RHBA 1NSWA 2MYGA 3TOUA 2CVDA 4ZB8A 3EE2A 2WB9A 4GSTA 4EIPA 2L57A 4E68A 2QSIA 3O3TA 3L9SA 3IRAA 1MTCA 4N0VA 3MSZA 4K9ZA 4ECBA 1WOUA 2R5GA 3QMXA 2ZNMA 1G7EA 1ABAA 1X9SB 5FT3A 3VFIA 1ZMAA 2DJKA 3LYPA 5KN0A 4K5RA 2PGTA 3HD5A 2OJLA 2AHEA 5FWGA 4MZBA 4JE1A 1GUHA 1XZOA 3C8EA 2PWJA 1ML6A 4GRFA 4TKYA 3SWLA 1SVMA 3AY8A 3G9BA 1ZZYA 1PX7A 2GS3A 1VF2A 2DSAA 2QA2A 1B4QA 4ZBDA 2IN3A 1B4PA 4PX1A 1X5EA 4J56E 2VM2A 5ECHB 2CQ9A 3HVXA 4MMMA 2B1KA 2I81A 3ZIVA 4PURA 3VWUA 3HYPA 1G6YA 1ERVA 1MDIA 2N5BA 3KTLA 2H70A 2CV4A 20GSA 1ZYNA 5CP1A 5DJLA 1PD21 4MA9A 3ZIJA 2BMXA 1TDIA 4KA0A 4ZIJA 1A2MA 4HQSA 4LL4B 5ECSA 1SYRA 1SYXA 1AUCA 5ECIB 1OC8A 5DALA 4POLA 2V2GA 2L6CA 3LJRA 1HNCA 4GXZA 3WGDA 1V98A 5G5EA 3OR5A 1VF3A 1V58A 4XCSA 1FB0A 5HFIA 4ID0A 2H0HA 2HSMB 5DQSA 4XS4A 3HJMA 1ZCPA 3L9VA 3C71A 5ID2A 1FB6A 2L5OA 1SL2B 4GSNA 5BRTA 3TRXA 4DVCA 2ZUPA 4WF4A 5IOWA 4I6XA 4DSSB 4YH2A 2IMEA 1GLQA 1GSYA 3LFLA 5GAND 1QMVA 3G7JA 4WBRD 2HLSA 3DD3A 3EMPA 2VO4A 3FK8A 5IMFA 2OE0A 1TU7A 1T4ZA 2X49A 5ECRB 1F37A 3UOMA 4K1FA 2V6KA 4RI6A 3RPNA 1XOAA 4GDFA 1HNAA 1M99A 1FG4A 3VURA 1WMJA 2RLIA 5ECMB 3L78A 3UBLA 2MBTA 3I43A 3TKSA 2F9SA 4FYBA 4N30A 1ERUA 1FVKA 2X64A 4POKA 3UVHA 5F8BA 2LRTA 1SKWB 3PINA 1YEXA 2G0FA 2PMTA 2C0GA 4G01A 4MJCA 1H4OA 4K6XA 5DALB 1JLWA 4AKGA 3GKNA 1CQHA 1XW6A 3ZTLA 2K8SA 4AKXB 5A4UA 3Q74A 2C0DA 2GGTA 1GTUA 1J08A 2OE1A 1OC3A 2FGXA 4MZCA 4LL1B 2AB6A 4EL1A 5ID2B 1NW2A 1DE1A 4HJMA 4EXJA 4JU5A 1YVLA 1A23A 2J9HA 2H1DA 2YNXA 1G0TA 1X5DA 1PRXA 5J9CA 2CVKA 2CZ2A 3QD9A 2OBIA 4HJ2A 1JZDA 1JZOA 3DVWA 2YCDA 1F9MA 3GKXA 2HQTA 1N8JA 1K0NA 3Q19A 3CSHA 4Q5NA 4G0KA 4EVMA 3KM6A 17GSA 3D4MA 1GRXA 1M9AA 2CVBA 5CNWA 4ECJA 5JCGA 3ZMLA 1I9DA 4TR0A 5JWOB 1TI1A 4J2FA 3IDVA 1GP1A 1F6MC 3F63A 2VUPA 2Z9SA 4GCIA 5CAXA 1E6BA 4G10A 1A2LA 5JCWA 5DVBA 5B6NA 1TP9A 5HR2A 3KH7A 2IMFA 4L8EA 4NHWA 4ZB6A 4KDUA 2HSHA 3IPZA 3PGTA 3GTUA 5J9BA 6GSTA 3TJKA 4L5LA 2V1MA 1UN2A 2JZTA 3CSIA 3QAGA 2VKZG 2DMLA 2I9HA 1EP8A 4POMA 4O92A 3I9V2 2JSZA 5IMCA 1SL1B 1QQ2A 2FD3A 3LGCA 2O5VA 1A8YA 1XIYA 4KAEA 2FLSA 2UV8G 2VCXA 1OVNA 1TRWA 2MZCA 3EPTA 5IMAA 5EVOA 3HVVA 4BPYA 4DSRA 1Q4JA 1V40A 2N5FA 1RK4A 2LKUA 3P90A 2FWEA 3P7XA 1X0RA 4XS6A 2I1UA 3M9KA 1ERWA 4GWRA 3EWLA 4EF0A 4ML6A 1DE2A 4AF2A 2GSTA 3TOTA 4NPBA 3QAWA 4KGIA 4MF5A 3CYNA 2OBKA 5IMDA 4TRXA 2BTOT 1DSBA 1JHBA 1T4YA 1VF4A 3FRCA 3F8UA 3W8JA 3ZRDA 3DXBA 3CRTA 3NZNA 3N9JA 1GUMA 2FCHA 2B3SA 4ZL7A 4E8EA 3F9UA 4K0GA 2GVPA 4F0BA 4D73A 3GKKA 2R4VA 1ZYEA 3FZ4A 5D9WA 4IW9A 4MCUA 2DMMA 3G7IA 5HFGA 2MBSA 1XW5A 3DYRA 1NM3A 1M0UA 1K3LA 5GZZB 3LXTA 1XW9A 4IGJA 1QUWA 3R2QA 1SK0A 5A1NA 3PH9A 1OAZA 4NXIA 1LU4A 1V2AA 3F6DA 4NWYA 1X5CA 4E8HA 3C1SA 4F2IA 4WF5A 4V1Ap 2LTKA 2HE3A 4WEYA 13GSA 1EEMA 3ME7A 2IIYA 4N10A 1AAZA 2EFDA 1O81A 1TRVA 1K0BA 5JCUA 1GWCA 3S9FA 3L4NA 4O5QA 4MPGA 3HVSA 3P2AA 1XWCA 4K7IA 3A2VA 2WJUA 4MP4A 3U5RE 1ZYPA 4PGTA 1SVOA 1N25A 3KH9A 3ZYWA 4MNNA 3F6FA 2RM6A 4KCAA 4RI7A 3GH6A 2YV9A 2L6DA 2QKEA 4LLRA 3GMFA 1XWGA 4I97A 5FHIA 2ES7A 3KIJA 10GSA 3HJOA 4GF0A 1WWJA 1GULA 1GL8A 1TRUA 2DIYA 1FO5A 5D9TA 1ST9A 3GSSA 4D73B 4N0ZA 2VD0A 5A34A 1YF0A 2DJ0A 3KZQA 3TGZA 1TK8B 2HSNB 1FW1A 4Z2RA 3MWHA 4HUAA 3H93A 4KB3A 4KW6A 4ZL8A 3IR4A 3F4SA 4BWQA 2IFQA 3IC4A 3CTGA 4WR4A 4L0UA 2IMDA 2YANA 3BCKA 2KOKA 4GTUA 2O7KA 1MD4A 5A1NB 1JLVA 2LEGA 2H73A 5IMVA 2NBSA 1SJZA 3QFBC 3SBCA 1M2BA 2A4VA 1ACVA 1YKAA 1KBNA 2LQQA 2XHFA 4TW5A 4HOJA 3UEMA 2LUSA 3APOA 1A8LA 3PR8A 4XRDA 4WETA 4L0WA 1TXUA 2JU5A 3HZ4A 1THOA 4MH3A 1G7OA 1XWKA 4BVXB 3KD0A 4PNGA 2QGVA 3LSZA 4MK3A 2H76A 4PQIA 3VPTA 5J5NA 3HKRA 3GNJA 2B1LA 5DBQA 3TRPA 5DAKA 2KUCA 1GSUA 2NDOA 1T7PB 3M3MA 1A24A 3HHVA 4CW9A 5HQPA 2LS5A 3LYKA 2GLRA 3J7Yk 4RQRA 3FW2A 1S3CA 1GH2A 1XWBA 2V6OA 2H71A 4Q5RA 5DJMA 4P3YB 2VCWA 4G19A 3APSA 1Z9HA 1FAAA 3UAPA 3EURA 3E3EA 3C1RA 4WR5A 1SK2A 2CZ3A 2DJ1A 2P0GA 3WYWA 2C3TA 2GSRA 3ZLPA 1GSQA 4USSA 5A34B 3HDCA 3WT2A 2GDRA 2OT3A 1U3AA 1TJDA 5ELGA 5DCHA 5C00A 3LEFA 2FY6A 2YPMA 3GIXA 1TTZA 2OKAA 1PL2A 4I2UA 4HEA2 2O89A 4PXOA 3GHAA 2H1AA 2NPBA 1ILOA 4G9HA 3GH9A 4MJEA 2IFQB 3GL5A 1TW9A 2HRFA 4NAXA 2PU9C 4YQMA 4GQFA 2B5XA 3U6VA 1K0MA 2RUFA 1U6TA 6GSVA 3EU4A 1PL1A 3D0ZA 3D4TA 5JWRB 4OFNA 2HRAA 5J4UA 4ZL9A 2FNOA 1SENA 4IP1A 2CAQA 3GX8A 4TXVA 1S3DA 1OC9A 4V2LA 1QGVA 1UA5A 3FEUA 2H0GA 2C3NA 1SD9A 1TRSA 2B6MA 3QCPA 1PX6A 1XXUA 5DAKB 4GQCA 5B8AA 5ECOB 1A2JA 1QFNA 5D8IA 3ZVJD 3M9JA 2VIMA 5B7CA 2MMOA 4IQ1A 1O6JA 6GSYA 2DJ3A 4RQXA 3DMLA 4JZQA 2X8HA 1ZOFA 5AIVA 2WGRA 5H5QA 4GSSA 5KN2A 3QR6A 3FR6A 3TKPA 1FOHA 2R2JA 4K0NA 2JL4A 2CA8A 1YEPA 1DUGA 3P8WA 4A5PA 2VL2C 3FHKA 1BF5A 2HXKA 1T8EB 4K7OA 4EO3A 5IIZA 2LJAA 4BWSA 4ZXGA 1CQGA 1B9XC 3FR3A 4IVFA 1URMA 2HYXA 2VLVA 4O5RA 3CWGA 4IQAA 3ZREA 3FZAA 4QL7A 2P31A 3J7Yb 3GUSA 3IV4A 4ICYA 3BBYA 3D21A 4ZB7A 3WGXA 1SKSB 2H1GA 3KMOA 2FA8A 4X0XA 4WBJA 5CRWA 2GSQA 3MNGA 4Z2TA 4BA7A 5KN3A 3A5WA 4XIHA 1AQWA 1SJ6A 4JEDA 5D73A 3MDKA 5G2ZA 2NTOA 2YJ7A 4HU7A 4J57E 4YAVA 1GNWA 1YQ1A 4YKGA 2LSTA 3EVIA 3HMJG 4K2XA 4IELA 4FIWA 1XVWA 4XS4B 4IJIA 5J4YA 2YWMA 2PERA 1Z7PA 4V2MA 3US3A 4FYCA 1VF1A 2LQOA 5ECQB 3VI7A 1X9MB 5CRDA 2B5YA 5CREA 3LWAA 2H19A 1ZYQB 1USBA 1B48A 1WP0A 2KP2A 5CRGA 1Z7RA 1V9WA 4CDOA 1Z3EA 2IJYA 2MMAA 1Z6NA 3FR9A 4K2DA 5C04A 1ZL9A 5IO2A 1K3OA 4K5SA 5CYYA 3ZVJA 4OWYA 1WIKA 3I69A 2VOCA 4HS1A 2V41A 1AQXA 5J47A 4X4JA 2AV4A 4ISDA 5J3RA 4OFTA 3GKMA 1YF1A 2YN1A 2WCIA 4XS1A 2X4AA 2VCVA 1TK5B 5H5RA 1BEDA 1PN0A 5EPFA 1W4VA 4IKHA 3RHCA 1WPIA 7GSSA 4FH8A 3ERWA 4F9ZA 18GSA 4CHSA 3IHQA 4IS0A 1LBKA 1TU8A 1UC7A 3R3EA 2I3YA 2L4CA 1Y25A 4PQHA 3F4TA 5IPGA 2K6VA 3KXOA 2YOIA 3TKQA 1HD2A 2VL9A 4AJ6A 4TXOA 2PVOC 4DSQA 1A0FA 3UIWA 1XOBA 3L9UA 1SVLA 3ZITA 2O87A 2L5LA 3C7MA 4IN0A 2JACA 4PTSA 1XFLA 3KMNA 4NV5A 2D2ZA 2IPAA 5DCGA 1AIUA 5EL8A 3BOAA 1GTAA 4OO4A 5AGYA 3F3QA 2JSYA 1V57A 2VAFA 3H8QA 4OCEA 5JWQB 2K18A 1R5AA 1BAYA 2GSSA 5E4WA 1U3IA 3FMWA 1RQMA 3ISOA 1BJXA 4HDEA 3CRUA 3FZ9A 1HNBA 4POBA 3WGEA 3RAZA 2YJHA 1PGTA 4MF6A 5A5HA 3TKSC 2WDUA 4V1Ag 1K0DA 2VD1A 3V1WA 1T00A 2YWOA 3QFAC 2QA1A 4ZBBA 2XPDA 5AISA 3EYTA 2F8AA 1GSDA 1O8WA 1O73A 5GSTA 3GTUB 2HSYA 5HFKA 5BMUA 2H01A 4AI6A 3LXZA 1O7UA 4YQVA 3CTFA 1BYEA 4JR6A 3LORA 2TRCP 3KP8A 1PA3A 2OE3A 3UBKA 4TXOB 5D9XA 3PPUA 2IMIA 4X43A 2V32A 1DBYA 1T1VA 3DIEA 3KGKA 4ILFA 2RM5A 3EU3A 1MDKA 5ECNB 4Q5QA 2E2GA 2CAIA 3CXGA 4MLYA 5L71A 4HZ2A 2KP1A 1OYJA 1BG1A 5AIXA 4KNDA 3IK7A 1Q98A 1YY7A 2WS2A 2MMZA 5J40A 3IAS2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EC3 A;  4ML1 A;  1EP7 A;  2LRC A;  4OD7 A;  5EY6 A;  1HQO A;  2LV3 A;  3HXS A;  3D22 A;  2LJR A;  5LD0 A;  3VPQ A;  2PUK C;  4XHM A;  3RBT A;  2C0F A;  5B6M A;  3UMA A;  3L0H A;  3KCM A;  1JZW A;  5A4W A;  2PN8 A;  2GQK A;  3FYG A;  3TUE A;  4EUY A;  5INY A;  1GUK A;  2F51 A;  2HRN A;  2X8G A;  3MAK A;  2H30 A;  3GST A;  2GZY A;  2BJX A;  2HRK A;  2GQM A;  2DJ2 A;  4LMW A;  2VL2 A;  2RII A;  4TR1 A;  4TR3 A;  3Q18 A;  2MMN A;  4ECC A;  3KEB A;  1SJI A;  1XWA A;  12GS A;  4G2E A;  1H75 A;  1NHY A;  3HCZ A;  2IMK A;  4OMV A;  3FY7 A;  4IBP A;  2TIR A;  4XTS A;  4EKZ A;  1AXD A;  1AQV A;  1SU9 A;  3VWX A;  1F3B A;  1SD8 A;  2H8L A;  4AJ7 A;  3TRQ A;  2M72 A;  2FWH A;  3UVT A;  3GX0 A;  3TKS E;  3LG6 A;  4TOP A;  3GUR A;  1B8X A;  1PN9 A;  3F0I A;  8GSS A;  5LCZ A;  1O85 A;  4JR4 A;  1GSS A;  3TJJ A;  2HSM A;  4L5O A;  5LNK e;  1M7T A;  22GS A;  2F8F A;  3H1N A;  1VRS D;  2JZS A;  3ZZX A;  4ECI A;  2VLT A;  1C72 A;  1EWX A;  3ERG A;  3A2X A;  3TDG A;  2H6Z A;  3CBU A;  5IQY A;  5G31 A;  1KEB A;  2WRT A;  1HYU A;  3K8N A;  4DSS A;  1NHO A;  4Z7X A;  5F0G A;  2CX3 A;  2VCZ A;  2HZE A;  9GSS A;  1O8X A;  2N5A A;  4BVY A;  3BCI A;  5KEJ A;  3GN3 A;  5IM9 A;  4HZ4 A;  1WJK A;  1JZR A;  4KCE A;  2DBC A;  4K7N A;  2A2R A;  2K9F A;  1SL0 B;  2CX4 A;  1TKD B;  2HRK B;  1EZK A;  16GS A;  4TR1 B;  19GS A;  3QPM A;  4TN8 A;  1EV9 A;  3JCM L;  2DC5 A;  2C1Y A;  1LJR A;  2E2M A;  3HZ8 A;  3GYK A;  3TJF A;  6GSU A;  4O7H A;  2H72 A;  3FKF A;  4G0L A;  4QL9 A;  5IOX A;  3CSJ A;  2E7P A;  2CT6 A;  2VL3 A;  2H0I A;  2GQL A;  11GS A;  1Z6M A;  2B7K A;  1ZGN A;  2M46 A;  2FA4 A;  2B7J A;  4MZW A;  4IHU A;  2P5Q A;  5B8B A;  4F82 A;  1FHE A;  4JBB A;  2EIR A;  4MH2 A;  2O85 A;  4F0C A;  1EOG A;  4KDX A;  2JAD A;  3DEX A;  3Q6O A;  2B5E A;  3N5O A;  5J41 A;  4KUN A;  5ELA A;  2A2S A;  4NHZ A;  1M9B A;  1OKT A;  3IAM 2;  3LQ7 A;  1M2D A;  3H79 A;  4Q5F A;  4O32 A;  3O6T A;  5HR1 A;  5ABR A;  1I5G A;  3I6A A;  1EV4 A;  2AYT A;  4MPF A;  3TB2 A;  1X9W B;  4I2T A;  3A2W A;  2HZE B;  3APQ A;  3HJP A;  2F3M A;  3DKS A;  4PUF C;  4FQU A;  4BVY B;  1GLP A;  1K0A A;  2LRN A;  3DRN A;  1AC1 A;  2AUV A;  5G5F A;  4TVE A;  1TOF A;  2VCQ A;  1UVZ A;  2ZCT A;  4I8B A;  2HFD A;  4KSM A;  4MJB A;  3GV1 A;  1EGO A;  2QC7 A;  2X99 A;  2EIO A;  3QAV A;  4ULX A;  3FZ5 A;  1F2E A;  1XBS A;  3TJG A;  3ZMK A;  1OC9 B;  4WXT A;  1PKW A;  1TI3 A;  2WUL A;  2ON5 A;  4IJ3 A;  2ON7 A;  3IBH A;  2R3X A;  3GA4 A;  4N11 A;  1BG5 A;  2XC2 A;  4WKW A;  3TJB A;  2TRX A;  2FWF A;  4HQZ A;  4ZIL A;  1VGL A;  3VLN A;  1R7H A;  2PBJ A;  4PNF A;  1THX A;  2H75 A;  1PKZ A;  2YWN A;  3ERF A;  1KNG A;  4K8M A;  2HI7 A;  1W89 A;  3EIN A;  1J9B A;  2P5R A;  6GSS A;  3RDW A;  3E9J B;  1MEK A;  2H66 A;  2J23 A;  3D5J A;  4G0I A;  2GTU A;  4RUV A;  3IA1 A;  4YAP A;  5KN1 A;  4KF9 A;  1YDK A;  2C4J A;  1OE8 A;  5D9V A;  4NV2 A;  2C0E A;  2FHE A;  1K0C A;  2GZP A;  1G6W A;  3IE3 A;  1SKR B;  4OO5 A;  2VM1 A;  2DIZ A;  3G7Y A;  2RUE A;  3F3R A;  3VWW A;  6GSX A;  4EDY A;  1R5P A;  2YZU A;  4DEJ A;  1PSQ A;  3VWV A;  4AJ8 A;  2WFC A;  2L59 A;  2H1B A;  2IWT A;  2OAD A;  1XCC A;  4LA1 A;  2C80 A;  1QK8 A;  3D6I A;  1BQ7 A;  3ZFB A;  1Y6E A;  3ZFL A;  1MDJ A;  5ECP B;  3HA9 A;  3WD6 A;  6GSW A;  2HNL A;  2JZR A;  1J0F A;  2DJJ A;  1TXX A;  3M0F A;  2L4Q A;  3KTB A;  2O8V B;  1GTI A;  3F4R A;  4X1U A;  4OFM A;  3IOS A;  3VK9 A;  5F06 A;  4BL7 A;  5IPH A;  1KTE A;  1PMT A;  1GTB A;  5D96 A;  1EEJ A;  5CO3 A;  5F05 A;  5AN1 A;  4KDY A;  1MD3 A;  4F03 A;  3ED3 A;  3C73 A;  3DWV A;  2H6X A;  3UAR A;  2KLX A;  4EC0 A;  2XPE A;  1EOH A;  2OA7 A;  4KE3 A;  2LNS A;  1JFU A;  2HT9 A;  2UZ8 A;  2WZ9 A;  4PUA A;  5A4V A;  3UJ1 A;  1YJ6 A;  3HY2 A;  1IYI A;  4LMV A;  4QQ7 A;  3EMX A;  5COH A;  5E59 A;  5H5S A;  4I5Q A;  4ZB9 A;  2C3Q A;  3IK9 A;  4HI7 A;  1QXH A;  3KJY A;  3UL3 A;  2GT6 A;  1OKD A;  4NMU A;  1N2A A;  1GSF A;  3DGQ A;  4KH7 A;  2H6Y A;  3O76 A;  3M1G A;  5IO0 A;  2C8U A;  5HR3 A;  3RPP A;  3TCO A;  4ZBA A;  2G2Q A;  2YV7 A;  2R6K A;  2ALB A;  2NVL A;  4FYU A;  4IP6 A;  5DDL A;  2IL3 A;  5A5K A;  2VCT A;  3ME8 A;  2EIQ A;  1K0O A;  1B9Y C;  5ECL B;  4MAB A;  5IMZ A;  2PVQ A;  4YQU A;  2M80 A;  4MJA A;  4GLT A;  2K8V A;  5ENU A;  1XVQ A;  3GRX A;  2DLX A;  2REM A;  4BL7 B;  2EC4 A;  1EGR A;  3BJ5 A;  1BX9 A;  4ACS A;  5G30 A;  4BVX A;  4V2N A;  1U88 A;  1PQN A;  3DVX A;  1T3B A;  2GZZ A;  1A0R P;  2FUG 2;  5CRH A;  2H74 A;  4OCF A;  2AJQ B;  1AW9 A;  3BD2 A;  1RW1 A;  1S3A A;  1FVJ A;  1ON4 A;  5ECK B;  1GSE A;  3GL3 A;  1TK0 B;  1FOV A;  3NIV A;  2FWG A;  14GS A;  2YZH A;  4H86 A;  1IYH A;  4TR4 A;  1SK1 A;  4MF7 A;  4PQ1 A;  5GAP D;  1M2A A;  1U87 A;  3IXR A;  4AGS A;  1WE0 A;  1ERT A;  3H4K A;  3ZL5 A;  2LNT A;  2XBI A;  2LJK A;  4MDC A;  2GT5 A;  2VLU A;  1GNE A;  2I4A A;  4XRA A;  5G1K A;  3NOF A;  1Z5Y E;  1R26 A;  5GSS A;  2YWI A;  4EDZ A;  3M8N A;  3IC8 A;  5DQY A;  3QOU A;  2KHP A;  3GFK A;  5F07 A;  5G1L A;  3E0U A;  3KP9 A;  1XPV A;  1YKC A;  4KX4 A;  2PPT A;  5D93 A;  3W8S A;  2X8C A;  1YZX A;  2XBQ A;  2YP6 A;  1WRY A;  4HU9 A;  3A3T A;  4FO5 A;  1E2Y A;  3QDN A;  3CMI A;  1F3A A;  1OE7 A;  3TKR A;  5HR0 A;  1R4W A;  2E0Q A;  4JRR A;  3W6G A;  2OAC A;  4KSO A;  3WT1 A;  3VI5 A;  2AAW A;  4EE0 A;  1K3Y A;  2R37 A;  2HZF A;  3RHB A;  1NSW A;  2MYG A;  3TOU A;  2CVD A;  4ZB8 A;  3EE2 A;  2WB9 A;  4GST A;  2L57 A;  2QSI A;  3O3T A;  3L9S A;  3IRA A;  1MTC A;  4N0V A;  3MSZ A;  4K9Z A;  4ECB A;  1WOU A;  2R5G A;  3QMX A;  2ZNM A;  1G7E A;  1ABA A;  1X9S B;  5FT3 A;  3VFI A;  1ZMA A;  2DJK A;  3LYP A;  5KN0 A;  2PGT A;  3HD5 A;  2OJL A;  2AHE A;  5FWG A;  4MZB A;  4JE1 A;  1GUH A;  1XZO A;  3C8E A;  2PWJ A;  1ML6 A;  4GRF A;  4TKY A;  3SWL A;  3AY8 A;  3G9B A;  1ZZY A;  1PX7 A;  2GS3 A;  1VF2 A;  2DSA A;  1B4Q A;  4ZBD A;  2IN3 A;  1B4P A;  4PX1 A;  1X5E A;  4J56 E;  2VM2 A;  5ECH B;  2CQ9 A;  3HVX A;  4MMM A;  2B1K A;  2I81 A;  3ZIV A;  4PUR A;  3VWU A;  3HYP A;  1G6Y A;  1ERV A;  1MDI A;  2N5B A;  3KTL A;  2H70 A;  2CV4 A;  20GS A;  5CP1 A;  5DJL A;  1PD2 1;  4MA9 A;  3ZIJ A;  2BMX A;  1TDI A;  4KA0 A;  4ZIJ A;  1A2M A;  4HQS A;  4LL4 B;  5ECS A;  1SYR A;  1SYX A;  1AUC A;  5ECI B;  1OC8 A;  5DAL A;  4POL A;  2V2G A;  2L6C A;  3LJR A;  1HNC A;  4GXZ A;  3WGD A;  1V98 A;  5G5E A;  3OR5 A;  1VF3 A;  1V58 A;  4XCS A;  1FB0 A;  5HFI A;  4ID0 A;  2H0H A;  2HSM B;  5DQS A;  4XS4 A;  3HJM A;  1ZCP A;  3L9V A;  3C71 A;  5ID2 A;  1FB6 A;  2L5O A;  1SL2 B;  4GSN A;  3TRX A;  4DVC A;  2ZUP A;  4WF4 A;  5IOW A;  4I6X A;  4DSS B;  4YH2 A;  2IME A;  1GLQ A;  1GSY A;  3LFL A;  5GAN D;  1QMV A;  3G7J A;  4WBR D;  2HLS A;  3DD3 A;  3EMP A;  2VO4 A;  3FK8 A;  5IMF A;  2OE0 A;  1TU7 A;  1T4Z A;  5ECR B;  1F37 A;  3UOM A;  4K1F A;  2V6K A;  4RI6 A;  3RPN A;  1XOA A;  1HNA A;  1M99 A;  1FG4 A;  3VUR A;  1WMJ A;  2RLI A;  5ECM B;  3L78 A;  3UBL A;  2MBT A;  3I43 A;  3TKS A;  2F9S A;  4FYB A;  4N30 A;  1ERU A;  1FVK A;  2X64 A;  4POK A;  3UVH A;  5F8B A;  2LRT A;  1SKW B;  3PIN A;  1YEX A;  2G0F A;  2PMT A;  2C0G A;  4MJC A;  1H4O A;  4K6X A;  5DAL B;  1JLW A;  3GKN A;  1CQH A;  1XW6 A;  3ZTL A;  2K8S A;  5A4U A;  3Q74 A;  2C0D A;  2GGT A;  1GTU A;  1J08 A;  2OE1 A;  1OC3 A;  2FGX A;  4MZC A;  4LL1 B;  2AB6 A;  4EL1 A;  5ID2 B;  1NW2 A;  1DE1 A;  4HJM A;  4EXJ A;  4JU5 A;  1A23 A;  2J9H A;  2H1D A;  2YNX A;  1G0T A;  1X5D A;  1PRX A;  5J9C A;  2CVK A;  2CZ2 A;  3QD9 A;  2OBI A;  4HJ2 A;  1JZD A;  1JZO A;  3DVW A;  2YCD A;  1F9M A;  3GKX A;  2HQT A;  1N8J A;  1K0N A;  3Q19 A;  3CSH A;  4Q5N A;  4G0K A;  4EVM A;  3KM6 A;  17GS A;  3D4M A;  1GRX A;  1M9A A;  2CVB A;  5CNW A;  4ECJ A;  5JCG A;  3ZML A;  1I9D A;  4TR0 A;  5JWO B;  1TI1 A;  4J2F A;  3IDV A;  1GP1 A;  1F6M C;  3F63 A;  2VUP A;  2Z9S A;  4GCI A;  5CAX A;  1E6B A;  4G10 A;  1A2L A;  5JCW A;  5DVB A;  5B6N A;  1TP9 A;  5HR2 A;  3KH7 A;  2IMF A;  4L8E A;  4NHW A;  4ZB6 A;  4KDU A;  2HSH A;  3IPZ A;  3PGT A;  3GTU A;  5J9B A;  6GST A;  3TJK A;  4L5L A;  2V1M A;  1UN2 A;  2JZT A;  3CSI A;  3QAG A;  2DML A;  2I9H A;  1EP8 A;  4POM A;  4O92 A;  3I9V 2;  2JSZ A;  5IMC A;  1SL1 B;  1QQ2 A;  2FD3 A;  3LGC A;  1A8Y A;  1XIY A;  4KAE A;  2FLS A;  2VCX A;  1OVN A;  1TRW A;  2MZC A;  5IMA A;  5EVO A;  3HVV A;  4BPY A;  4DSR A;  1Q4J A;  1V40 A;  2N5F A;  1RK4 A;  2LKU A;  3P90 A;  2FWE A;  3P7X A;  1X0R A;  4XS6 A;  2I1U A;  3M9K A;  1ERW A;  4GWR A;  3EWL A;  4EF0 A;  4ML6 A;  1DE2 A;  4AF2 A;  2GST A;  3TOT A;  4NPB A;  3QAW A;  4KGI A;  4MF5 A;  3CYN A;  2OBK A;  5IMD A;  4TRX A;  2BTO T;  1DSB A;  1JHB A;  1T4Y A;  1VF4 A;  3FRC A;  3F8U A;  3W8J A;  3ZRD A;  3DXB A;  3CRT A;  3NZN A;  3N9J A;  1GUM A;  2FCH A;  2B3S A;  4ZL7 A;  4E8E A;  3F9U A;  4K0G A;  2GVP A;  4F0B A;  4D73 A;  3GKK A;  2R4V A;  1ZYE A;  3FZ4 A;  5D9W A;  4IW9 A;  4MCU A;  2DMM A;  3G7I A;  5HFG A;  2MBS A;  1XW5 A;  3DYR A;  1NM3 A;  1M0U A;  1K3L A;  5GZZ B;  3LXT A;  1XW9 A;  4IGJ A;  1QUW A;  3R2Q A;  1SK0 A;  3PH9 A;  1OAZ A;  4NXI A;  1LU4 A;  1V2A A;  3F6D A;  4NWY A;  1X5C A;  4E8H A;  3C1S A;  4F2I A;  4WF5 A;  4V1A p;  2LTK A;  2HE3 A;  4WEY A;  13GS A;  1EEM A;  3ME7 A;  2IIY A;  4N10 A;  1AAZ A;  1O81 A;  1TRV A;  1K0B A;  5JCU A;  1GWC A;  3S9F A;  3L4N A;  4MPG A;  3HVS A;  3P2A A;  1XWC A;  4K7I A;  3A2V A;  2WJU A;  4MP4 A;  3U5R E;  4PGT A;  3KH9 A;  3ZYW A;  3F6F A;  2RM6 A;  4KCA A;  4RI7 A;  3GH6 A;  2YV9 A;  2L6D A;  2QKE A;  4LLR A;  3GMF A;  1XWG A;  4I97 A;  5FHI A;  2ES7 A;  3KIJ A;  10GS A;  3HJO A;  4GF0 A;  1WWJ A;  1GUL A;  1GL8 A;  1TRU A;  2DIY A;  1FO5 A;  5D9T A;  1ST9 A;  3GSS A;  4D73 B;  4N0Z A;  2VD0 A;  1YF0 A;  2DJ0 A;  3KZQ A;  3TGZ A;  1TK8 B;  2HSN B;  1FW1 A;  3MWH A;  4HUA A;  3H93 A;  4KB3 A;  4KW6 A;  4ZL8 A;  3IR4 A;  3F4S A;  4BWQ A;  2IFQ A;  3IC4 A;  3CTG A;  4WR4 A;  4L0U A;  2IMD A;  2YAN A;  3BCK A;  2KOK A;  4GTU A;  2O7K A;  1MD4 A;  1JLV A;  2LEG A;  2H73 A;  5IMV A;  2NBS A;  1SJZ A;  3QFB C;  3SBC A;  1M2B A;  2A4V A;  1ACV A;  1YKA A;  1KBN A;  2LQQ A;  2XHF A;  4TW5 A;  4HOJ A;  3UEM A;  2LUS A;  3APO A;  1A8L A;  3PR8 A;  4XRD A;  4WET A;  4L0W A;  2JU5 A;  3HZ4 A;  1THO A;  4MH3 A;  1G7O A;  1XWK A;  4BVX B;  3KD0 A;  4PNG A;  2QGV A;  3LSZ A;  4MK3 A;  2H76 A;  4PQI A;  3VPT A;  5J5N A;  3HKR A;  3GNJ A;  2B1L A;  5DBQ A;  3TRP A;  5DAK A;  2KUC A;  1GSU A;  2NDO A;  1T7P B;  3M3M A;  1A24 A;  3HHV A;  4CW9 A;  5HQP A;  2LS5 A;  3LYK A;  2GLR A;  3J7Y k;  4RQR A;  3FW2 A;  1S3C A;  1GH2 A;  1XWB A;  2V6O A;  2H71 A;  4Q5R A;  5DJM A;  4P3Y B;  2VCW A;  4G19 A;  3APS A;  1Z9H A;  1FAA A;  3UAP A;  3EUR A;  3E3E A;  3C1R A;  4WR5 A;  1SK2 A;  2CZ3 A;  2DJ1 A;  2P0G A;  3WYW A;  2C3T A;  2GSR A;  3ZLP A;  1GSQ A;  4USS A;  3WT2 A;  3HDC A;  2GDR A;  1U3A A;  1TJD A;  5ELG A;  5DCH A;  5C00 A;  3LEF A;  2FY6 A;  2YPM A;  3GIX A;  1TTZ A;  2OKA A;  1PL2 A;  4I2U A;  4HEA 2;  2O89 A;  4PXO A;  3GHA A;  2H1A A;  2NPB A;  1ILO A;  4G9H A;  3GH9 A;  4MJE A;  2IFQ B;  3GL5 A;  1TW9 A;  2HRF A;  4NAX A;  2PU9 C;  4YQM A;  4GQF A;  2B5X A;  3U6V A;  1K0M A;  2RUF A;  1U6T A;  6GSV A;  3EU4 A;  1PL1 A;  3D0Z A;  3D4T A;  5JWR B;  4OFN A;  2HRA A;  5J4U A;  4ZL9 A;  2FNO A;  1SEN A;  4IP1 A;  2CAQ A;  3GX8 A;  4TXV A;  1S3D A;  1OC9 A;  4V2L A;  1QGV A;  1UA5 A;  3FEU A;  2H0G A;  2C3N A;  1SD9 A;  1TRS A;  2B6M A;  3QCP A;  1PX6 A;  1XXU A;  5DAK B;  4GQC A;  5B8A A;  5ECO B;  1A2J A;  1QFN A;  5D8I A;  3ZVJ D;  3M9J A;  2VIM A;  5B7C A;  2MMO A;  4IQ1 A;  1O6J A;  6GSY A;  2DJ3 A;  4RQX A;  3DML A;  4JZQ A;  2X8H A;  1ZOF A;  5AIV A;  2WGR A;  5H5Q A;  4GSS A;  5KN2 A;  3QR6 A;  3FR6 A;  3TKP A;  2R2J A;  4K0N A;  2JL4 A;  2CA8 A;  1YEP A;  1DUG A;  3P8W A;  2VL2 C;  3FHK A;  2HXK A;  1T8E B;  4K7O A;  4EO3 A;  5IIZ A;  2LJA A;  4BWS A;  4ZXG A;  1CQG A;  1B9X C;  3FR3 A;  4IVF A;  1URM A;  2HYX A;  2VLV A;  4O5R A;  4IQA A;  3ZRE A;  3FZA A;  4QL7 A;  2P31 A;  3J7Y b;  3GUS A;  3IV4 A;  3BBY A;  3D21 A;  3WGX A;  1SKS B;  2H1G A;  3KMO A;  2FA8 A;  4X0X A;  4WBJ A;  5CRW A;  2GSQ A;  3MNG A;  4BA7 A;  5KN3 A;  3A5W A;  4XIH A;  1AQW A;  1SJ6 A;  4JED A;  5D73 A;  3MDK A;  5G2Z A;  2NTO A;  2YJ7 A;  4HU7 A;  4J57 E;  4YAV A;  1GNW A;  1YQ1 A;  2LST A;  3EVI A;  4IEL A;  4FIW A;  1XVW A;  4XS4 B;  4IJI A;  2YWM A;  2PER A;  1Z7P A;  4V2M A;  3US3 A;  4FYC A;  1VF1 A;  2LQO A;  5ECQ B;  3VI7 A;  1X9M B;  5CRD A;  2B5Y A;  5CRE A;  3LWA A;  2H19 A;  1ZYQ B;  1USB A;  1B48 A;  1WP0 A;  2KP2 A;  5CRG A;  1Z7R A;  1V9W A;  4CDO A;  1Z3E A;  2IJY A;  2MMA A;  1Z6N A;  3FR9 A;  4K2D A;  5C04 A;  1ZL9 A;  5IO2 A;  1K3O A;  5CYY A;  3ZVJ A;  4OWY A;  1WIK A;  3I69 A;  2VOC A;  4HS1 A;  2V41 A;  1AQX A;  2AV4 A;  4ISD A;  5J3R A;  4OFT A;  3GKM A;  1YF1 A;  2YN1 A;  2WCI A;  4XS1 A;  2VCV A;  1TK5 B;  5H5R A;  1BED A;  5EPF A;  1W4V A;  4IKH A;  3RHC A;  1WPI A;  7GSS A;  4FH8 A;  3ERW A;  4F9Z A;  18GS A;  4CHS A;  3IHQ A;  4IS0 A;  1LBK A;  1TU8 A;  1UC7 A;  3R3E A;  2I3Y A;  2L4C A;  1Y25 A;  4PQH A;  3F4T A;  5IPG A;  2K6V A;  3KXO A;  2YOI A;  3TKQ A;  1HD2 A;  2VL9 A;  4AJ6 A;  4TXO A;  2PVO C;  4DSQ A;  1A0F A;  3UIW A;  1XOB A;  3L9U A;  3ZIT A;  2O87 A;  2L5L A;  3C7M A;  4IN0 A;  2JAC A;  4PTS A;  1XFL A;  3KMN A;  4NV5 A;  2D2Z A;  2IPA A;  5DCG A;  1AIU A;  5EL8 A;  3BOA A;  1GTA A;  4OO4 A;  5AGY A;  3F3Q A;  2JSY A;  1V57 A;  2VAF A;  3H8Q A;  4OCE A;  5JWQ B;  2K18 A;  1R5A A;  1BAY A;  2GSS A;  5E4W A;  1U3I A;  1RQM A;  3ISO A;  1BJX A;  4HDE A;  3CRU A;  3FZ9 A;  1HNB A;  4POB A;  3WGE A;  3RAZ A;  2YJH A;  1PGT A;  4MF6 A;  3TKS C;  2WDU A;  4V1A g;  1K0D A;  2VD1 A;  3V1W A;  1T00 A;  2YWO A;  3QFA C;  4ZBB A;  2XPD A;  5AIS A;  3EYT A;  2F8A A;  1GSD A;  1O8W A;  1O73 A;  5GST A;  3GTU B;  2HSY A;  5HFK A;  5BMU A;  2H01 A;  3LXZ A;  1O7U A;  4YQV A;  3CTF A;  1BYE A;  4JR6 A;  3LOR A;  2TRC P;  3KP8 A;  1PA3 A;  2OE3 A;  3UBK A;  4TXO B;  5D9X A;  3PPU A;  2IMI A;  4X43 A;  2V32 A;  1DBY A;  1T1V A;  3DIE A;  3KGK A;  4ILF A;  2RM5 A;  3EU3 A;  1MDK A;  5ECN B;  4Q5Q A;  2E2G A;  2CAI A;  3CXG A;  4MLY A;  5L71 A;  4HZ2 A;  2KP1 A;  1OYJ A;  5AIX A;  4KND A;  3IK7 A;  1Q98 A;  1YY7 A;  2WS2 A;  2MMZ A;  3IAS 2; 
#chains in the Genus database with same CATH topology
 3EC3 A;  4ML1 A;  1EP7 A;  2LRC A;  4O5U A;  2A2P A;  4OD7 A;  5EY6 A;  1HQO A;  2LV3 A;  3HXS A;  3D22 A;  2LJR A;  5LD0 A;  3VPQ A;  2PUK C;  4XHM A;  3RBT A;  2C0F A;  5B6M A;  3UMA A;  3L0H A;  3KCM A;  1JZW A;  5A4W A;  2PN8 A;  2GQK A;  3FYG A;  3TUE A;  4QMK A;  4EUY A;  5INY A;  1GUK A;  2F51 A;  2HRN A;  2X8G A;  5BMU B;  3MAK A;  2H30 A;  3GST A;  2GZY A;  2BJX A;  2HRK A;  2GQM A;  2DJ2 A;  4LMW A;  2VL2 A;  2RII A;  4TR1 A;  4TR3 A;  3Q18 A;  2MMN A;  4ECC A;  3KEB A;  1SJI A;  1XWA A;  12GS A;  4G2E A;  1H75 A;  1NHY A;  3HCZ A;  2IMK A;  4OMV A;  3FY7 A;  4IBP A;  2TIR A;  4XTS A;  2R0C A;  1AXD A;  4EKZ A;  1AQV A;  1SU9 A;  3VWX A;  1F3B A;  1SD8 A;  2H8L A;  4AJ7 A;  3TRQ A;  2M72 A;  2FWH A;  3UVT A;  3GX0 A;  3TKS E;  2O36 A;  3LG6 A;  4TOP A;  3GUR A;  1B8X A;  1PN9 A;  3F0I A;  8GSS A;  5LCZ A;  1O85 A;  4JR4 A;  1GSS A;  3TJJ A;  2HSM A;  4L5O A;  5LNK e;  1M7T A;  22GS A;  2JZS A;  2F8F A;  3H1N A;  1VRS D;  3ZZX A;  4ECI A;  4PI0 C;  2VLT A;  1C72 A;  1EWX A;  3ERG A;  3A2X A;  3TDG A;  2H6Z A;  3CBU A;  5IQY A;  5G31 A;  1KEB A;  2WRT A;  1HYU A;  3K8N A;  4DSS A;  1NHO A;  4Z7X A;  5F0G A;  2CX3 A;  2VCZ A;  2HZE A;  9GSS A;  1O8X A;  2N5A A;  4BVY A;  3BCI A;  4N3Z A;  5KEJ A;  3GN3 A;  5IM9 A;  4HZ4 A;  1WJK A;  1JZR A;  4KCE A;  2DBC A;  4K7N A;  2A2R A;  2K9F A;  1SL0 B;  2CX4 A;  1TKD B;  2HRK B;  1EZK A;  16GS A;  4TR1 B;  19GS A;  3QPM A;  4TN8 A;  1EV9 A;  3JCM L;  1M3I A;  2DC5 A;  2C1Y A;  1LJR A;  2E2M A;  3HZ8 A;  3GYK A;  3TJF A;  6GSU A;  4O7H A;  2H72 A;  3FKF A;  3IHG A;  4G0L A;  4QL9 A;  5IOX A;  3CSJ A;  2E7P A;  2CT6 A;  2VL3 A;  2H0I A;  2GQL A;  11GS A;  1Z6M A;  2B7K A;  1ZGN A;  2M46 A;  2FA4 A;  2B7J A;  4MZW A;  4IHU A;  2P5Q A;  5B8B A;  4F82 A;  1FHE A;  4JBB A;  2EIR A;  4MH2 A;  2O85 A;  4F0C A;  1EOG A;  4KDX A;  2JAD A;  3DEX A;  3Q6O A;  2B5E A;  3N5O A;  3CHX C;  5J41 A;  4KUN A;  5ELA A;  2A2S A;  4NHZ A;  1M9B A;  1OKT A;  3IAM 2;  3LQ7 A;  1M2D A;  3H79 A;  4Q5F A;  4O32 A;  3O6T A;  5HR1 A;  5ABR A;  1I5G A;  3I6A A;  4AKI A;  1EV4 A;  2AYT A;  4MPF A;  3TB2 A;  1X9W B;  4I2T A;  3A2W A;  2HZE B;  3APQ A;  3HJP A;  2F3M A;  3DKS A;  4PUF C;  4FQU A;  4BVY B;  1GLP A;  1K0A A;  2LRN A;  3DRN A;  1AC1 A;  2AUV A;  5G5F A;  4TVE A;  1TOF A;  2VCQ A;  1UVZ A;  2ZCT A;  4I8B A;  2HFD A;  4KSM A;  4MJB A;  3GV1 A;  1EGO A;  2QC7 A;  5J4V A;  2X99 A;  4W66 A;  2EIO A;  3QAV A;  4ULX A;  3FZ5 A;  1F2E A;  1XBS A;  3TJG A;  3ZMK A;  1OC9 B;  4WXT A;  1PKW A;  1TI3 A;  2WUL A;  2ON5 A;  4IJ3 A;  2ON7 A;  3IBH A;  2R3X A;  3GA4 A;  4N11 A;  1BG5 A;  2XC2 A;  4WKW A;  3TJB A;  2TRX A;  2FWF A;  4HQZ A;  4ZIL A;  1VGL A;  3VLN A;  1R7H A;  2PBJ A;  4PNF A;  1THX A;  2H75 A;  1PKZ A;  2YWN A;  3ERF A;  1KNG A;  4K8M A;  2HI7 A;  1W89 A;  3EIN A;  1J9B A;  2P5R A;  6GSS A;  3RDW A;  3E9J B;  1MEK A;  2H66 A;  2J23 A;  3D5J A;  4G0I A;  2GTU A;  4RUV A;  3IA1 A;  4YAP A;  5KN1 A;  2A4H A;  4KF9 A;  1YDK A;  2C4J A;  1OE8 A;  5D9V A;  4NV2 A;  2C0E A;  2DKH A;  2FHE A;  1K0C A;  2GZP A;  1G6W A;  3IE3 A;  1SKR B;  4HSC X;  4OO5 A;  2VM1 A;  2DIZ A;  3G7Y A;  2RUE A;  3F3R A;  3VWW A;  6GSX A;  4EDY A;  1R5P A;  2YZU A;  4DEJ A;  1PSQ A;  3VWV A;  4AJ8 A;  2WFC A;  2H1L A;  2L59 A;  2H1B A;  2IWT A;  2OAD A;  1XCC A;  4LA1 A;  2C80 A;  2R0G A;  1QK8 A;  3D6I A;  1BQ7 A;  3ZFB A;  1Y6E A;  3ZFL A;  1MDJ A;  5ECP B;  3HA9 A;  3WD6 A;  6GSW A;  2HNL A;  2JZR A;  2EFE A;  1J0F A;  2DJJ A;  1TXX A;  3M0F A;  2L4Q A;  3KTB A;  2O8V B;  1GTI A;  3F4R A;  4X1U A;  4OFM A;  3IOS A;  3VK9 A;  4YKF A;  5F06 A;  4BL7 A;  5IPH A;  1KTE A;  1PMT A;  1GTB A;  5D96 A;  1EEJ A;  5CO3 A;  5F05 A;  5AN1 A;  4KDY A;  1MD3 A;  4F03 A;  3ED3 A;  3C73 A;  3DWV A;  2H6X A;  3UAR A;  2KLX A;  2DKI A;  4EC0 A;  2XPE A;  1EOH A;  2OA7 A;  4KE3 A;  2LNS A;  1JFU A;  2HT9 A;  2UZ8 A;  2WZ9 A;  4PUA A;  5A4V A;  3UJ1 A;  1YJ6 A;  3HY2 A;  1IYI A;  4Z2U A;  4LMV A;  4QQ7 A;  3EMX A;  5COH A;  5E59 A;  2EFH A;  5H5S A;  4CY8 A;  4I5Q A;  4ZB9 A;  2C3Q A;  3IK9 A;  4HI7 A;  1QXH A;  3KJY A;  3UL3 A;  2GT6 A;  1OKD A;  4NMU A;  1N2A A;  1GSF A;  3DGQ A;  4KH7 A;  2H6Y A;  3O76 A;  2HSN A;  3M1G A;  5IO0 A;  2C8U A;  5HR3 A;  3RPP A;  3TCO A;  4ZBA A;  2G2Q A;  2YV7 A;  2R6K A;  5KOW A;  3LW9 A;  2ALB A;  2NVL A;  4FYU A;  4IP6 A;  1Y1U A;  5DDL A;  2IL3 A;  5A5K A;  2VCT A;  3ME8 A;  2EIQ A;  1K0O A;  1B9Y C;  5ECL B;  4MAB A;  5IMZ A;  2PVQ A;  4EIQ A;  4YQU A;  2M80 A;  4MJA A;  4GLT A;  2K8V A;  5ENU A;  1XVQ A;  3GRX A;  2DLX A;  2REM A;  4BL7 B;  2EC4 A;  3TU3 B;  1EGR A;  3BJ5 A;  1BX9 A;  4ACS A;  5G30 A;  4BVX A;  4V2N A;  1U88 A;  1PQN A;  3DVX A;  3MYD A;  1T3B A;  2GZZ A;  1A0R P;  2FUG 2;  5CRH A;  2H74 A;  4OCF A;  2AJQ B;  1AW9 A;  3BD2 A;  1RW1 A;  1S3A A;  1FVJ A;  1ON4 A;  5ECK B;  1GSE A;  3GL3 A;  1TK0 B;  1FOV A;  3NIV A;  2FWG A;  14GS A;  2YZH A;  5A5H B;  4H86 A;  1IYH A;  4TR4 A;  1SK1 A;  4MF7 A;  4PQ1 A;  5GAP D;  1M2A A;  3MIX A;  1U87 A;  3IXR A;  4AGS A;  1WE0 A;  1ERT A;  3H4K A;  3ZL5 A;  2LNT A;  2XBI A;  2LJK A;  5KOX A;  2R0P A;  4MDC A;  2GT5 A;  2VLU A;  1GNE A;  2I4A A;  4XRA A;  5G1K A;  3NOF A;  1Z5Y E;  1R26 A;  5GSS A;  2YWI A;  4EDZ A;  3M8N A;  3IC8 A;  5DQY A;  3QOU A;  2KHP A;  3A5I A;  3GFK A;  5F07 A;  5G1L A;  3E0U A;  3KP9 A;  1XPV A;  1YKC A;  4KX4 A;  2PPT A;  5D93 A;  3W8S A;  2X8C A;  1YZX A;  2XBQ A;  2YP6 A;  2EFC A;  1WRY A;  4HU9 A;  3A3T A;  4FO5 A;  1E2Y A;  4CY6 A;  3QDN A;  3CMI A;  1F3A A;  1OE7 A;  3TKR A;  5HR0 A;  1R4W A;  2E0Q A;  4JRR A;  3W6G A;  4AKH A;  2OAC A;  4KSO A;  3WT1 A;  3VI5 A;  2AAW A;  4EE0 A;  1K3Y A;  2R37 A;  2HZF A;  3RHB A;  1NSW A;  2MYG A;  3TOU A;  2CVD A;  4ZB8 A;  3EE2 A;  2WB9 A;  4GST A;  4EIP A;  2L57 A;  4E68 A;  2QSI A;  3O3T A;  3L9S A;  3IRA A;  1MTC A;  4N0V A;  3MSZ A;  4K9Z A;  4ECB A;  1WOU A;  2R5G A;  3QMX A;  2ZNM A;  1G7E A;  1ABA A;  1X9S B;  5FT3 A;  3VFI A;  1ZMA A;  2DJK A;  3LYP A;  5KN0 A;  4K5R A;  2PGT A;  3HD5 A;  2OJL A;  2AHE A;  5FWG A;  4MZB A;  4JE1 A;  1GUH A;  1XZO A;  3C8E A;  2PWJ A;  1ML6 A;  4GRF A;  4TKY A;  3SWL A;  1SVM A;  3AY8 A;  3G9B A;  1ZZY A;  1PX7 A;  2GS3 A;  1VF2 A;  2DSA A;  2QA2 A;  1B4Q A;  4ZBD A;  2IN3 A;  1B4P A;  4PX1 A;  1X5E A;  4J56 E;  2VM2 A;  5ECH B;  2CQ9 A;  3HVX A;  4MMM A;  2B1K A;  2I81 A;  3ZIV A;  4PUR A;  3VWU A;  3HYP A;  2WVZ A;  1G6Y A;  1ERV A;  1MDI A;  2N5B A;  3KTL A;  2H70 A;  2CV4 A;  20GS A;  1ZYN A;  5CP1 A;  5DJL A;  1PD2 1;  4MA9 A;  3ZIJ A;  2WW1 A;  2BMX A;  1TDI A;  4KA0 A;  4ZIJ A;  1A2M A;  4HQS A;  4LL4 B;  5ECS A;  1SYR A;  1SYX A;  1AUC A;  5ECI B;  1OC8 A;  5DAL A;  4POL A;  2V2G A;  2L6C A;  3LJR A;  1HNC A;  4GXZ A;  3WGD A;  1V98 A;  5G5E A;  2WVY A;  3OR5 A;  1VF3 A;  1V58 A;  4XCS A;  1FB0 A;  5HFI A;  4ID0 A;  2H0H A;  2HSM B;  5DQS A;  4XS4 A;  3HJM A;  1ZCP A;  3L9V A;  3C71 A;  5ID2 A;  1FB6 A;  2L5O A;  1SL2 B;  4GSN A;  5BRT A;  3TRX A;  4DVC A;  2ZUP A;  4BIK A;  4WF4 A;  5IOW A;  4I6X A;  4DSS B;  4YH2 A;  2IME A;  1GLQ A;  1GSY A;  3LFL A;  5GAN D;  1QMV A;  3G7J A;  4WBR D;  2HLS A;  3DD3 A;  3EMP A;  2VO4 A;  3FK8 A;  5IMF A;  2OE0 A;  1TU7 A;  1T4Z A;  2X49 A;  5ECR B;  1F37 A;  3UOM A;  4K1F A;  2V6K A;  4RI6 A;  3RPN A;  1XOA A;  4GDF A;  1HNA A;  1M99 A;  1FG4 A;  3VUR A;  1WMJ A;  2RLI A;  5ECM B;  3L78 A;  3UBL A;  2MBT A;  3I43 A;  3TKS A;  2F9S A;  4FYB A;  4N30 A;  1ERU A;  1FVK A;  2X64 A;  4POK A;  3UVH A;  5F8B A;  2LRT A;  1SKW B;  3PIN A;  1YEX A;  2G0F A;  2PMT A;  2C0G A;  4G01 A;  4MJC A;  1H4O A;  4K6X A;  5DAL B;  1JLW A;  4AKG A;  3GKN A;  1CQH A;  1XW6 A;  3ZTL A;  2K8S A;  4AKX B;  5A4U A;  3Q74 A;  2C0D A;  2GGT A;  1GTU A;  1J08 A;  2OE1 A;  1OC3 A;  2FGX A;  4MZC A;  4LL1 B;  2AB6 A;  4EL1 A;  5ID2 B;  1NW2 A;  1DE1 A;  4HJM A;  4EXJ A;  4JU5 A;  1YVL A;  1A23 A;  2J9H A;  2H1D A;  2YNX A;  1G0T A;  1X5D A;  1PRX A;  5J9C A;  2CVK A;  2CZ2 A;  3QD9 A;  2OBI A;  4HJ2 A;  1JZD A;  1JZO A;  3DVW A;  2YCD A;  1F9M A;  3GKX A;  2HQT A;  1N8J A;  1K0N A;  3Q19 A;  3CSH A;  4Q5N A;  4G0K A;  4EVM A;  3KM6 A;  17GS A;  3D4M A;  1GRX A;  1M9A A;  2CVB A;  5CNW A;  4ECJ A;  5JCG A;  3ZML A;  1I9D A;  4TR0 A;  5JWO B;  1TI1 A;  4J2F A;  3IDV A;  1GP1 A;  1F6M C;  3F63 A;  2VUP A;  2Z9S A;  4GCI A;  5CAX A;  1E6B A;  4G10 A;  1A2L A;  5JCW A;  5DVB A;  1YEW C;  5B6N A;  1TP9 A;  5HR2 A;  3KH7 A;  2IMF A;  4L8E A;  4NHW A;  4ZB6 A;  4KDU A;  2HSH A;  3IPZ A;  3PGT A;  3GTU A;  5J9B A;  6GST A;  3TJK A;  4L5L A;  2V1M A;  1UN2 A;  2JZT A;  3CSI A;  3QAG A;  2VKZ G;  2DML A;  2I9H A;  1EP8 A;  4POM A;  4O92 A;  3I9V 2;  2JSZ A;  5IMC A;  1SL1 B;  1QQ2 A;  2O3E A;  2FD3 A;  3LGC A;  2O5V A;  1A8Y A;  1XIY A;  4KAE A;  2FLS A;  2UV8 G;  2VCX A;  1OVN A;  1TRW A;  2MZC A;  3EPT A;  5IMA A;  5EVO A;  3HVV A;  4BPY A;  4DSR A;  1Q4J A;  1V40 A;  2N5F A;  1RK4 A;  2LKU A;  3P90 A;  2FWE A;  3P7X A;  1X0R A;  4XS6 A;  2I1U A;  3M9K A;  1ERW A;  4GWR A;  3EWL A;  4EF0 A;  4ML6 A;  1DE2 A;  4AF2 A;  2GST A;  3TOT A;  4NPB A;  3QAW A;  4KGI A;  4MF5 A;  3CYN A;  2OBK A;  5IMD A;  4TRX A;  2BTO T;  1DSB A;  1JHB A;  1T4Y A;  1VF4 A;  3FRC A;  3F8U A;  3W8J A;  3ZRD A;  3DXB A;  3CRT A;  3NZN A;  3N9J A;  1GUM A;  2FCH A;  2B3S A;  4ZL7 A;  4E8E A;  3F9U A;  4K0G A;  2GVP A;  4F0B A;  4D73 A;  3GKK A;  2R4V A;  1ZYE A;  3FZ4 A;  5D9W A;  4IW9 A;  4MCU A;  2DMM A;  3G7I A;  5HFG A;  2MBS A;  1XW5 A;  3DYR A;  1NM3 A;  1M0U A;  1K3L A;  5GZZ B;  3LXT A;  1XW9 A;  3CQF A;  4IGJ A;  1QUW A;  3R2Q A;  1SK0 A;  5A1N A;  3PH9 A;  1OAZ A;  4NXI A;  1LU4 A;  1V2A A;  3F6D A;  4NWY A;  1X5C A;  4E8H A;  3C1S A;  4F2I A;  4WF5 A;  4V1A p;  2LTK A;  2HE3 A;  4WEY A;  13GS A;  1EEM A;  3ME7 A;  2IIY A;  4N10 A;  1AAZ A;  2EFD A;  1O81 A;  1TRV A;  1K0B A;  5JCU A;  1GWC A;  3S9F A;  3L4N A;  4O5Q A;  4MPG A;  3HVS A;  3P2A A;  1XWC A;  2WVX A;  4K7I A;  3A2V A;  2WJU A;  4MP4 A;  3U5R E;  1ZYP A;  4PGT A;  1SVO A;  1N25 A;  3KH9 A;  3ZYW A;  4MNN A;  3F6F A;  2RM6 A;  4KCA A;  4RI7 A;  3GH6 A;  2YV9 A;  2L6D A;  2QKE A;  4LLR A;  3GMF A;  1XWG A;  4I97 A;  5FHI A;  1PFO A;  2ES7 A;  2WW0 A;  3KIJ A;  10GS A;  3HJO A;  4GF0 A;  1WWJ A;  1M3J A;  1GUL A;  1GL8 A;  1TRU A;  2DIY A;  1FO5 A;  5D9T A;  1ST9 A;  3GSS A;  4D73 B;  4N0Z A;  2VD0 A;  5A34 A;  1YF0 A;  2DJ0 A;  3KZQ A;  3TGZ A;  1TK8 B;  2HSN B;  1FW1 A;  4Z2R A;  3MWH A;  4HUA A;  3H93 A;  4KB3 A;  4KW6 A;  4ZL8 A;  3IR4 A;  3F4S A;  4BWQ A;  2IFQ A;  3IC4 A;  3CTG A;  4WR4 A;  4L0U A;  2IMD A;  2YAN A;  3BCK A;  2KOK A;  4GTU A;  2O7K A;  1MD4 A;  5A1N B;  1JLV A;  2LEG A;  2H73 A;  5IMV A;  2NBS A;  1SJZ A;  3QFB C;  3SBC A;  1M2B A;  2A4V A;  1ACV A;  1YKA A;  1KBN A;  2LQQ A;  2XHF A;  4TW5 A;  4HOJ A;  3UEM A;  2LUS A;  3APO A;  1A8L A;  3PR8 A;  4XRD A;  4WET A;  4L0W A;  1TXU A;  2JU5 A;  3HZ4 A;  1THO A;  4MH3 A;  1G7O A;  1XWK A;  4BVX B;  3KD0 A;  4PNG A;  2QGV A;  3LSZ A;  4MK3 A;  2H76 A;  4PQI A;  3VPT A;  5J5N A;  3HKR A;  3RFR C;  3GNJ A;  2B1L A;  5DBQ A;  3TRP A;  2WVX B;  5DAK A;  2KUC A;  1GSU A;  2NDO A;  1T7P B;  3M3M A;  1A24 A;  3HHV A;  4CW9 A;  5HQP A;  2LS5 A;  3LYK A;  2GLR A;  3J7Y k;  4RQR A;  3FW2 A;  1S3C A;  1GH2 A;  1XWB A;  2V6O A;  2H71 A;  4Q5R A;  5DJM A;  4P3Y B;  2VCW A;  4G19 A;  3APS A;  1Z9H A;  1FAA A;  3UAP A;  3EUR A;  3E3E A;  3C1R A;  4WR5 A;  1SK2 A;  2CZ3 A;  2DJ1 A;  2P0G A;  3WYW A;  2C3T A;  2GSR A;  3ZLP A;  1GSQ A;  4USS A;  5A34 B;  3HDC A;  3WT2 A;  2GDR A;  2OT3 A;  1U3A A;  1TJD A;  5ELG A;  5DCH A;  5C00 A;  3LEF A;  2FY6 A;  2YPM A;  3GIX A;  1TTZ A;  2OKA A;  1PL2 A;  4I2U A;  1S4B P;  4HEA 2;  2O89 A;  4PXO A;  3GHA A;  2H1A A;  2NPB A;  1ILO A;  4G9H A;  3GH9 A;  4MJE A;  2IFQ B;  3GL5 A;  1TW9 A;  2HRF A;  4NAX A;  2WW2 A;  2PU9 C;  4YQM A;  4GQF A;  2B5X A;  3U6V A;  1K0M A;  2RUF A;  1U6T A;  6GSV A;  3EU4 A;  1PL1 A;  3D0Z A;  3D4T A;  5JWR B;  4OFN A;  2HRA A;  5J4U A;  4ZL9 A;  2FNO A;  1SEN A;  4IP1 A;  2CAQ A;  3GX8 A;  4TXV A;  1S3D A;  1OC9 A;  4V2L A;  1QGV A;  1UA5 A;  3FEU A;  2H0G A;  2C3N A;  1SD9 A;  1TRS A;  2B6M A;  3QCP A;  1PX6 A;  1XXU A;  5DAK B;  4GQC A;  5B8A A;  5ECO B;  1A2J A;  1QFN A;  5D8I A;  3ZVJ D;  3M9J A;  2VIM A;  5B7C A;  2MMO A;  4IQ1 A;  1XG8 A;  1O6J A;  6GSY A;  2DJ3 A;  4RQX A;  3DML A;  4JZQ A;  2X8H A;  1ZOF A;  5AIV A;  2WGR A;  5H5Q A;  4GSS A;  5KN2 A;  3QR6 A;  3FR6 A;  3TKP A;  1FOH A;  2R2J A;  4K0N A;  2JL4 A;  2CA8 A;  3RGB C;  1YEP A;  1DUG A;  3P8W A;  4A5P A;  2VL2 C;  3FHK A;  1BF5 A;  2HXK A;  1T8E B;  4K7O A;  4EO3 A;  5IIZ A;  2LJA A;  4BWS A;  4ZXG A;  1CQG A;  1B9X C;  3FR3 A;  4IVF A;  1URM A;  2HYX A;  2VLV A;  4O5R A;  3CWG A;  4IQA A;  3ZRE A;  3HVN A;  3FZA A;  4QL7 A;  2P31 A;  3J7Y b;  3GUS A;  3IV4 A;  4ICY A;  1S3R A;  3BBY A;  3D21 A;  4ZB7 A;  3WGX A;  1SKS B;  2H1G A;  3KMO A;  2FA8 A;  4X0X A;  4WBJ A;  5CRW A;  2GSQ A;  3MNG A;  4Z2T A;  4BA7 A;  5KN3 A;  3A5W A;  4XIH A;  2WW3 A;  1AQW A;  1SJ6 A;  4JED A;  5D73 A;  3MDK A;  5G2Z A;  2NTO A;  2YJ7 A;  4HU7 A;  4J57 E;  4YAV A;  1GNW A;  1YQ1 A;  4YKG A;  2LST A;  3EVI A;  3HMJ G;  4K2X A;  4IEL A;  4FIW A;  1XVW A;  4XS4 B;  4IJI A;  5J4Y A;  2YWM A;  2PER A;  1Z7P A;  4V2M A;  3US3 A;  4FYC A;  1VF1 A;  2LQO A;  5ECQ B;  3VI7 A;  1X9M B;  5CRD A;  2B5Y A;  5CRE A;  3LWA A;  2H19 A;  1ZYQ B;  1USB A;  1B48 A;  1WP0 A;  2KP2 A;  5CRG A;  1Z7R A;  1V9W A;  4CDO A;  1Z3E A;  2IJY A;  2MMA A;  1Z6N A;  3FR9 A;  4K2D A;  5C04 A;  1ZL9 A;  5IO2 A;  1K3O A;  4K5S A;  5CYY A;  3ZVJ A;  4OWY A;  1WIK A;  3I69 A;  2VOC A;  4HS1 A;  2V41 A;  1AQX A;  5J47 A;  4X4J A;  2AV4 A;  4ISD A;  5J3R A;  4OFT A;  3GKM A;  1YF1 A;  2YN1 A;  2WCI A;  4XS1 A;  2X4A A;  2VCV A;  1TK5 B;  5H5R A;  1I1I P;  1BED A;  4PHZ C;  1PN0 A;  5EPF A;  1W4V A;  4IKH A;  3RHC A;  1WPI A;  7GSS A;  4FH8 A;  3ERW A;  4F9Z A;  18GS A;  4CHS A;  3IHQ A;  4IS0 A;  1LBK A;  1TU8 A;  1UC7 A;  3R3E A;  2I3Y A;  2L4C A;  1Y25 A;  4PQH A;  3F4T A;  5IPG A;  2K6V A;  3KXO A;  2YOI A;  3TKQ A;  1HD2 A;  2VL9 A;  4AJ6 A;  4TXO A;  2PVO C;  4DSQ A;  1A0F A;  3UIW A;  4FXY P;  1XOB A;  3L9U A;  1SVL A;  3ZIT A;  2O87 A;  2L5L A;  3C7M A;  4IN0 A;  2JAC A;  4PTS A;  1XFL A;  3KMN A;  4NV5 A;  2D2Z A;  2IPA A;  5DCG A;  1AIU A;  5EL8 A;  3BOA A;  1GTA A;  4OO4 A;  5AGY A;  3F3Q A;  2JSY A;  1V57 A;  2VAF A;  3H8Q A;  4OCE A;  5JWQ B;  2K18 A;  1R5A A;  1BAY A;  2GSS A;  5E4W A;  1U3I A;  3FMW A;  1RQM A;  3ISO A;  1BJX A;  4HDE A;  3CRU A;  3FZ9 A;  1HNB A;  4POB A;  3WGE A;  3RAZ A;  2YJH A;  1PGT A;  4MF6 A;  5A5H A;  3TKS C;  2WDU A;  4V1A g;  1K0D A;  2VD1 A;  3V1W A;  1T00 A;  2YWO A;  3QFA C;  2QA1 A;  4ZBB A;  2XPD A;  5AIS A;  3EYT A;  2F8A A;  1GSD A;  1O8W A;  1O73 A;  5GST A;  3GTU B;  2HSY A;  5HFK A;  5BMU A;  4PI2 C;  2H01 A;  4AI6 A;  3LXZ A;  1O7U A;  4YQV A;  3CTF A;  1BYE A;  4JR6 A;  3LOR A;  2TRC P;  3KP8 A;  1PA3 A;  2OE3 A;  3UBK A;  2WZS A;  4TXO B;  5D9X A;  3PPU A;  2IMI A;  4X43 A;  2V32 A;  1DBY A;  1T1V A;  3DIE A;  3KGK A;  4ILF A;  2RM5 A;  3EU3 A;  1MDK A;  5ECN B;  4Q5Q A;  2E2G A;  2CAI A;  3CXG A;  4MLY A;  5L71 A;  4HZ2 A;  2KP1 A;  1OYJ A;  1BG1 A;  5AIX A;  4KND A;  3IK7 A;  1Q98 A;  1YY7 A;  2WS2 A;  2MMZ A;  5J40 A;  3IAS 2; 
#chains in the Genus database with same CATH homology
 3EC3 A;  4ML1 A;  1EP7 A;  2LRC A;  4O5U A;  2A2P A;  4OD7 A;  5EY6 A;  1HQO A;  2LV3 A;  3HXS A;  3D22 A;  2LJR A;  5LD0 A;  3VPQ A;  2PUK C;  4XHM A;  3RBT A;  2C0F A;  5B6M A;  3UMA A;  3L0H A;  3KCM A;  1JZW A;  5A4W A;  2PN8 A;  2GQK A;  3FYG A;  3TUE A;  4QMK A;  4EUY A;  5INY A;  1GUK A;  2F51 A;  2HRN A;  2X8G A;  5BMU B;  3MAK A;  2H30 A;  3GST A;  2GZY A;  2BJX A;  2HRK A;  2GQM A;  2DJ2 A;  4LMW A;  2VL2 A;  2RII A;  4TR1 A;  4TR3 A;  3Q18 A;  2MMN A;  4ECC A;  3KEB A;  1SJI A;  1XWA A;  12GS A;  4G2E A;  1H75 A;  1NHY A;  3HCZ A;  2IMK A;  4OMV A;  3FY7 A;  4IBP A;  2TIR A;  4XTS A;  2R0C A;  1AXD A;  4EKZ A;  1AQV A;  1SU9 A;  3VWX A;  1F3B A;  1SD8 A;  2H8L A;  4AJ7 A;  3TRQ A;  2M72 A;  2FWH A;  3UVT A;  3GX0 A;  3TKS E;  3LG6 A;  4TOP A;  3GUR A;  1B8X A;  1PN9 A;  3F0I A;  8GSS A;  5LCZ A;  1O85 A;  4JR4 A;  1GSS A;  3TJJ A;  2HSM A;  4L5O A;  5LNK e;  1M7T A;  22GS A;  2JZS A;  2F8F A;  3H1N A;  1VRS D;  3ZZX A;  4ECI A;  2VLT A;  1C72 A;  1EWX A;  3ERG A;  3A2X A;  3TDG A;  2H6Z A;  3CBU A;  5IQY A;  5G31 A;  1KEB A;  2WRT A;  1HYU A;  3K8N A;  4DSS A;  1NHO A;  4Z7X A;  5F0G A;  2CX3 A;  2VCZ A;  2HZE A;  9GSS A;  1O8X A;  2N5A A;  4BVY A;  3BCI A;  4N3Z A;  5KEJ A;  3GN3 A;  5IM9 A;  4HZ4 A;  1WJK A;  1JZR A;  4KCE A;  2DBC A;  4K7N A;  2A2R A;  2K9F A;  1SL0 B;  2CX4 A;  1TKD B;  2HRK B;  1EZK A;  16GS A;  4TR1 B;  19GS A;  3QPM A;  4TN8 A;  1EV9 A;  3JCM L;  2DC5 A;  2C1Y A;  1LJR A;  2E2M A;  3HZ8 A;  3GYK A;  3TJF A;  6GSU A;  4O7H A;  2H72 A;  3FKF A;  3IHG A;  4G0L A;  4QL9 A;  5IOX A;  3CSJ A;  2E7P A;  2CT6 A;  2VL3 A;  2H0I A;  2GQL A;  11GS A;  1Z6M A;  2B7K A;  1ZGN A;  2M46 A;  2FA4 A;  2B7J A;  4MZW A;  4IHU A;  2P5Q A;  5B8B A;  4F82 A;  1FHE A;  4JBB A;  2EIR A;  4MH2 A;  2O85 A;  4F0C A;  1EOG A;  4KDX A;  2JAD A;  3DEX A;  3Q6O A;  2B5E A;  3N5O A;  5J41 A;  4KUN A;  5ELA A;  2A2S A;  4NHZ A;  1M9B A;  1OKT A;  3IAM 2;  3LQ7 A;  1M2D A;  3H79 A;  4Q5F A;  4O32 A;  3O6T A;  5HR1 A;  5ABR A;  1I5G A;  3I6A A;  4AKI A;  1EV4 A;  2AYT A;  4MPF A;  3TB2 A;  1X9W B;  4I2T A;  3A2W A;  2HZE B;  3APQ A;  3HJP A;  2F3M A;  3DKS A;  4PUF C;  4FQU A;  4BVY B;  1GLP A;  1K0A A;  2LRN A;  3DRN A;  1AC1 A;  2AUV A;  5G5F A;  4TVE A;  1TOF A;  2VCQ A;  1UVZ A;  2ZCT A;  4I8B A;  2HFD A;  4KSM A;  4MJB A;  3GV1 A;  1EGO A;  2QC7 A;  5J4V A;  2X99 A;  4W66 A;  2EIO A;  3QAV A;  4ULX A;  3FZ5 A;  1F2E A;  1XBS A;  3TJG A;  3ZMK A;  1OC9 B;  4WXT A;  1PKW A;  1TI3 A;  2WUL A;  2ON5 A;  4IJ3 A;  2ON7 A;  3IBH A;  2R3X A;  3GA4 A;  4N11 A;  1BG5 A;  2XC2 A;  4WKW A;  3TJB A;  2TRX A;  2FWF A;  4HQZ A;  4ZIL A;  1VGL A;  3VLN A;  1R7H A;  2PBJ A;  4PNF A;  1THX A;  2H75 A;  1PKZ A;  2YWN A;  3ERF A;  1KNG A;  4K8M A;  2HI7 A;  1W89 A;  3EIN A;  1J9B A;  2P5R A;  6GSS A;  3RDW A;  3E9J B;  1MEK A;  2H66 A;  2J23 A;  3D5J A;  4G0I A;  2GTU A;  4RUV A;  3IA1 A;  4YAP A;  5KN1 A;  2A4H A;  4KF9 A;  1YDK A;  2C4J A;  1OE8 A;  5D9V A;  4NV2 A;  2C0E A;  2DKH A;  2FHE A;  1K0C A;  2GZP A;  1G6W A;  3IE3 A;  1SKR B;  4OO5 A;  2VM1 A;  2DIZ A;  3G7Y A;  2RUE A;  3F3R A;  3VWW A;  6GSX A;  4EDY A;  1R5P A;  2YZU A;  4DEJ A;  1PSQ A;  3VWV A;  4AJ8 A;  2WFC A;  2H1L A;  2L59 A;  2H1B A;  2IWT A;  2OAD A;  1XCC A;  4LA1 A;  2C80 A;  2R0G A;  1QK8 A;  3D6I A;  1BQ7 A;  3ZFB A;  1Y6E A;  3ZFL A;  1MDJ A;  5ECP B;  3HA9 A;  3WD6 A;  6GSW A;  2HNL A;  2JZR A;  2EFE A;  1J0F A;  2DJJ A;  1TXX A;  3M0F A;  2L4Q A;  3KTB A;  2O8V B;  1GTI A;  3F4R A;  4X1U A;  4OFM A;  3IOS A;  3VK9 A;  4YKF A;  5F06 A;  4BL7 A;  5IPH A;  1KTE A;  1PMT A;  1GTB A;  5D96 A;  1EEJ A;  5CO3 A;  5F05 A;  5AN1 A;  4KDY A;  1MD3 A;  4F03 A;  3ED3 A;  3C73 A;  3DWV A;  2H6X A;  3UAR A;  2KLX A;  2DKI A;  4EC0 A;  2XPE A;  1EOH A;  2OA7 A;  4KE3 A;  2LNS A;  1JFU A;  2HT9 A;  2UZ8 A;  2WZ9 A;  4PUA A;  5A4V A;  3UJ1 A;  1YJ6 A;  3HY2 A;  1IYI A;  4Z2U A;  4LMV A;  4QQ7 A;  3EMX A;  5COH A;  5E59 A;  2EFH A;  5H5S A;  4CY8 A;  4I5Q A;  4ZB9 A;  2C3Q A;  3IK9 A;  4HI7 A;  1QXH A;  3KJY A;  3UL3 A;  2GT6 A;  1OKD A;  4NMU A;  1N2A A;  1GSF A;  3DGQ A;  4KH7 A;  2H6Y A;  3O76 A;  2HSN A;  3M1G A;  5IO0 A;  2C8U A;  5HR3 A;  3RPP A;  3TCO A;  4ZBA A;  2G2Q A;  2YV7 A;  2R6K A;  5KOW A;  3LW9 A;  2ALB A;  2NVL A;  4FYU A;  4IP6 A;  1Y1U A;  5DDL A;  2IL3 A;  5A5K A;  2VCT A;  3ME8 A;  2EIQ A;  1K0O A;  1B9Y C;  5ECL B;  4MAB A;  5IMZ A;  2PVQ A;  4EIQ A;  4YQU A;  2M80 A;  4MJA A;  4GLT A;  2K8V A;  5ENU A;  1XVQ A;  3GRX A;  2DLX A;  2REM A;  4BL7 B;  2EC4 A;  3TU3 B;  1EGR A;  3BJ5 A;  1BX9 A;  4ACS A;  5G30 A;  4BVX A;  4V2N A;  1U88 A;  1PQN A;  3DVX A;  3MYD A;  1T3B A;  2GZZ A;  1A0R P;  2FUG 2;  5CRH A;  2H74 A;  4OCF A;  2AJQ B;  1AW9 A;  3BD2 A;  1RW1 A;  1S3A A;  1FVJ A;  1ON4 A;  5ECK B;  1GSE A;  3GL3 A;  1TK0 B;  1FOV A;  3NIV A;  2FWG A;  14GS A;  2YZH A;  5A5H B;  4H86 A;  1IYH A;  4TR4 A;  1SK1 A;  4MF7 A;  4PQ1 A;  5GAP D;  1M2A A;  3MIX A;  1U87 A;  3IXR A;  4AGS A;  1WE0 A;  1ERT A;  3H4K A;  3ZL5 A;  2LNT A;  2XBI A;  2LJK A;  5KOX A;  2R0P A;  4MDC A;  2GT5 A;  2VLU A;  1GNE A;  2I4A A;  4XRA A;  5G1K A;  3NOF A;  1Z5Y E;  1R26 A;  5GSS A;  2YWI A;  4EDZ A;  3M8N A;  3IC8 A;  5DQY A;  3QOU A;  2KHP A;  3A5I A;  3GFK A;  5F07 A;  5G1L A;  3E0U A;  3KP9 A;  1XPV A;  1YKC A;  4KX4 A;  2PPT A;  5D93 A;  3W8S A;  2X8C A;  1YZX A;  2XBQ A;  2YP6 A;  2EFC A;  1WRY A;  4HU9 A;  3A3T A;  4FO5 A;  1E2Y A;  4CY6 A;  3QDN A;  3CMI A;  1F3A A;  1OE7 A;  3TKR A;  5HR0 A;  1R4W A;  2E0Q A;  4JRR A;  3W6G A;  4AKH A;  2OAC A;  4KSO A;  3WT1 A;  3VI5 A;  2AAW A;  4EE0 A;  1K3Y A;  2R37 A;  2HZF A;  3RHB A;  1NSW A;  2MYG A;  3TOU A;  2CVD A;  4ZB8 A;  3EE2 A;  2WB9 A;  4GST A;  4EIP A;  2L57 A;  4E68 A;  2QSI A;  3O3T A;  3L9S A;  3IRA A;  1MTC A;  4N0V A;  3MSZ A;  4K9Z A;  4ECB A;  1WOU A;  2R5G A;  3QMX A;  2ZNM A;  1G7E A;  1ABA A;  1X9S B;  5FT3 A;  3VFI A;  1ZMA A;  2DJK A;  3LYP A;  5KN0 A;  4K5R A;  2PGT A;  3HD5 A;  2OJL A;  2AHE A;  5FWG A;  4MZB A;  4JE1 A;  1GUH A;  1XZO A;  3C8E A;  2PWJ A;  1ML6 A;  4GRF A;  4TKY A;  3SWL A;  1SVM A;  3AY8 A;  3G9B A;  1ZZY A;  1PX7 A;  2GS3 A;  1VF2 A;  2DSA A;  2QA2 A;  1B4Q A;  4ZBD A;  2IN3 A;  1B4P A;  4PX1 A;  1X5E A;  4J56 E;  2VM2 A;  5ECH B;  2CQ9 A;  3HVX A;  4MMM A;  2B1K A;  2I81 A;  3ZIV A;  4PUR A;  3VWU A;  3HYP A;  1G6Y A;  1ERV A;  1MDI A;  2N5B A;  3KTL A;  2H70 A;  2CV4 A;  20GS A;  1ZYN A;  5CP1 A;  5DJL A;  1PD2 1;  4MA9 A;  3ZIJ A;  2BMX A;  1TDI A;  4KA0 A;  4ZIJ A;  1A2M A;  4HQS A;  4LL4 B;  5ECS A;  1SYR A;  1SYX A;  1AUC A;  5ECI B;  1OC8 A;  5DAL A;  4POL A;  2V2G A;  2L6C A;  3LJR A;  1HNC A;  4GXZ A;  3WGD A;  1V98 A;  5G5E A;  3OR5 A;  1VF3 A;  1V58 A;  4XCS A;  1FB0 A;  5HFI A;  4ID0 A;  2H0H A;  2HSM B;  5DQS A;  4XS4 A;  3HJM A;  1ZCP A;  3L9V A;  3C71 A;  5ID2 A;  1FB6 A;  2L5O A;  1SL2 B;  4GSN A;  5BRT A;  3TRX A;  4DVC A;  2ZUP A;  4WF4 A;  5IOW A;  4I6X A;  4DSS B;  4YH2 A;  2IME A;  1GLQ A;  1GSY A;  3LFL A;  5GAN D;  1QMV A;  3G7J A;  4WBR D;  2HLS A;  3DD3 A;  3EMP A;  2VO4 A;  3FK8 A;  5IMF A;  2OE0 A;  1TU7 A;  1T4Z A;  2X49 A;  5ECR B;  1F37 A;  3UOM A;  4K1F A;  2V6K A;  4RI6 A;  3RPN A;  1XOA A;  4GDF A;  1HNA A;  1M99 A;  1FG4 A;  3VUR A;  1WMJ A;  2RLI A;  5ECM B;  3L78 A;  3UBL A;  2MBT A;  3I43 A;  3TKS A;  2F9S A;  4FYB A;  4N30 A;  1ERU A;  1FVK A;  2X64 A;  4POK A;  3UVH A;  5F8B A;  2LRT A;  1SKW B;  3PIN A;  1YEX A;  2G0F A;  2PMT A;  2C0G A;  4G01 A;  4MJC A;  1H4O A;  4K6X A;  5DAL B;  1JLW A;  4AKG A;  3GKN A;  1CQH A;  1XW6 A;  3ZTL A;  2K8S A;  4AKX B;  5A4U A;  3Q74 A;  2C0D A;  2GGT A;  1GTU A;  1J08 A;  2OE1 A;  1OC3 A;  2FGX A;  4MZC A;  4LL1 B;  2AB6 A;  4EL1 A;  5ID2 B;  1NW2 A;  1DE1 A;  4HJM A;  4EXJ A;  4JU5 A;  1YVL A;  1A23 A;  2J9H A;  2H1D A;  2YNX A;  1G0T A;  1X5D A;  1PRX A;  5J9C A;  2CVK A;  2CZ2 A;  3QD9 A;  2OBI A;  4HJ2 A;  1JZD A;  1JZO A;  3DVW A;  2YCD A;  1F9M A;  3GKX A;  2HQT A;  1N8J A;  1K0N A;  3Q19 A;  3CSH A;  4Q5N A;  4G0K A;  4EVM A;  3KM6 A;  17GS A;  3D4M A;  1GRX A;  1M9A A;  2CVB A;  5CNW A;  4ECJ A;  5JCG A;  3ZML A;  1I9D A;  4TR0 A;  5JWO B;  1TI1 A;  4J2F A;  3IDV A;  1GP1 A;  1F6M C;  3F63 A;  2VUP A;  2Z9S A;  4GCI A;  5CAX A;  1E6B A;  4G10 A;  1A2L A;  5JCW A;  5DVB A;  5B6N A;  1TP9 A;  5HR2 A;  3KH7 A;  2IMF A;  4L8E A;  4NHW A;  4ZB6 A;  4KDU A;  2HSH A;  3IPZ A;  3PGT A;  3GTU A;  5J9B A;  6GST A;  3TJK A;  4L5L A;  2V1M A;  1UN2 A;  2JZT A;  3CSI A;  3QAG A;  2VKZ G;  2DML A;  2I9H A;  1EP8 A;  4POM A;  4O92 A;  3I9V 2;  2JSZ A;  5IMC A;  1SL1 B;  1QQ2 A;  2FD3 A;  3LGC A;  2O5V A;  1A8Y A;  1XIY A;  4KAE A;  2FLS A;  2UV8 G;  2VCX A;  1OVN A;  1TRW A;  2MZC A;  3EPT A;  5IMA A;  5EVO A;  3HVV A;  4BPY A;  4DSR A;  1Q4J A;  1V40 A;  2N5F A;  1RK4 A;  2LKU A;  3P90 A;  2FWE A;  3P7X A;  1X0R A;  4XS6 A;  2I1U A;  3M9K A;  1ERW A;  4GWR A;  3EWL A;  4EF0 A;  4ML6 A;  1DE2 A;  4AF2 A;  2GST A;  3TOT A;  4NPB A;  3QAW A;  4KGI A;  4MF5 A;  3CYN A;  2OBK A;  5IMD A;  4TRX A;  2BTO T;  1DSB A;  1JHB A;  1T4Y A;  1VF4 A;  3FRC A;  3F8U A;  3W8J A;  3ZRD A;  3DXB A;  3CRT A;  3NZN A;  3N9J A;  1GUM A;  2FCH A;  2B3S A;  4ZL7 A;  4E8E A;  3F9U A;  4K0G A;  2GVP A;  4F0B A;  4D73 A;  3GKK A;  2R4V A;  1ZYE A;  3FZ4 A;  5D9W A;  4IW9 A;  4MCU A;  2DMM A;  3G7I A;  5HFG A;  2MBS A;  1XW5 A;  3DYR A;  1NM3 A;  1M0U A;  1K3L A;  5GZZ B;  3LXT A;  1XW9 A;  4IGJ A;  1QUW A;  3R2Q A;  1SK0 A;  5A1N A;  3PH9 A;  1OAZ A;  4NXI A;  1LU4 A;  1V2A A;  3F6D A;  4NWY A;  1X5C A;  4E8H A;  3C1S A;  4F2I A;  4WF5 A;  4V1A p;  2LTK A;  2HE3 A;  4WEY A;  13GS A;  1EEM A;  3ME7 A;  2IIY A;  4N10 A;  1AAZ A;  2EFD A;  1O81 A;  1TRV A;  1K0B A;  5JCU A;  1GWC A;  3S9F A;  3L4N A;  4O5Q A;  4MPG A;  3HVS A;  3P2A A;  1XWC A;  4K7I A;  3A2V A;  2WJU A;  4MP4 A;  3U5R E;  1ZYP A;  4PGT A;  1SVO A;  1N25 A;  3KH9 A;  3ZYW A;  4MNN A;  3F6F A;  2RM6 A;  4KCA A;  4RI7 A;  3GH6 A;  2YV9 A;  2L6D A;  2QKE A;  4LLR A;  3GMF A;  1XWG A;  4I97 A;  5FHI A;  2ES7 A;  3KIJ A;  10GS A;  3HJO A;  4GF0 A;  1WWJ A;  1GUL A;  1GL8 A;  1TRU A;  2DIY A;  1FO5 A;  5D9T A;  1ST9 A;  3GSS A;  4D73 B;  4N0Z A;  2VD0 A;  5A34 A;  1YF0 A;  2DJ0 A;  3KZQ A;  3TGZ A;  1TK8 B;  2HSN B;  1FW1 A;  4Z2R A;  3MWH A;  4HUA A;  3H93 A;  4KB3 A;  4KW6 A;  4ZL8 A;  3IR4 A;  3F4S A;  4BWQ A;  2IFQ A;  3IC4 A;  3CTG A;  4WR4 A;  4L0U A;  2IMD A;  2YAN A;  3BCK A;  2KOK A;  4GTU A;  2O7K A;  1MD4 A;  5A1N B;  1JLV A;  2LEG A;  2H73 A;  5IMV A;  2NBS A;  1SJZ A;  3QFB C;  3SBC A;  1M2B A;  2A4V A;  1ACV A;  1YKA A;  1KBN A;  2LQQ A;  2XHF A;  4TW5 A;  4HOJ A;  3UEM A;  2LUS A;  3APO A;  1A8L A;  3PR8 A;  4XRD A;  4WET A;  4L0W A;  1TXU A;  2JU5 A;  3HZ4 A;  1THO A;  4MH3 A;  1G7O A;  1XWK A;  4BVX B;  3KD0 A;  4PNG A;  2QGV A;  3LSZ A;  4MK3 A;  2H76 A;  4PQI A;  3VPT A;  5J5N A;  3HKR A;  3GNJ A;  2B1L A;  5DBQ A;  3TRP A;  5DAK A;  2KUC A;  1GSU A;  2NDO A;  1T7P B;  3M3M A;  1A24 A;  3HHV A;  4CW9 A;  5HQP A;  2LS5 A;  3LYK A;  2GLR A;  3J7Y k;  4RQR A;  3FW2 A;  1S3C A;  1GH2 A;  1XWB A;  2V6O A;  2H71 A;  4Q5R A;  5DJM A;  4P3Y B;  2VCW A;  4G19 A;  3APS A;  1Z9H A;  1FAA A;  3UAP A;  3EUR A;  3E3E A;  3C1R A;  4WR5 A;  1SK2 A;  2CZ3 A;  2DJ1 A;  2P0G A;  3WYW A;  2C3T A;  2GSR A;  3ZLP A;  1GSQ A;  4USS A;  5A34 B;  3HDC A;  3WT2 A;  2GDR A;  2OT3 A;  1U3A A;  1TJD A;  5ELG A;  5DCH A;  5C00 A;  3LEF A;  2FY6 A;  2YPM A;  3GIX A;  1TTZ A;  2OKA A;  1PL2 A;  4I2U A;  4HEA 2;  2O89 A;  4PXO A;  3GHA A;  2H1A A;  2NPB A;  1ILO A;  4G9H A;  3GH9 A;  4MJE A;  2IFQ B;  3GL5 A;  1TW9 A;  2HRF A;  4NAX A;  2PU9 C;  4YQM A;  4GQF A;  2B5X A;  3U6V A;  1K0M A;  2RUF A;  1U6T A;  6GSV A;  3EU4 A;  1PL1 A;  3D0Z A;  3D4T A;  5JWR B;  4OFN A;  2HRA A;  5J4U A;  4ZL9 A;  2FNO A;  1SEN A;  4IP1 A;  2CAQ A;  3GX8 A;  4TXV A;  1S3D A;  1OC9 A;  4V2L A;  1QGV A;  1UA5 A;  3FEU A;  2H0G A;  2C3N A;  1SD9 A;  1TRS A;  2B6M A;  3QCP A;  1PX6 A;  1XXU A;  5DAK B;  4GQC A;  5B8A A;  5ECO B;  1A2J A;  1QFN A;  5D8I A;  3ZVJ D;  3M9J A;  2VIM A;  5B7C A;  2MMO A;  4IQ1 A;  1O6J A;  6GSY A;  2DJ3 A;  4RQX A;  3DML A;  4JZQ A;  2X8H A;  1ZOF A;  5AIV A;  2WGR A;  5H5Q A;  4GSS A;  5KN2 A;  3QR6 A;  3FR6 A;  3TKP A;  1FOH A;  2R2J A;  4K0N A;  2JL4 A;  2CA8 A;  1YEP A;  1DUG A;  3P8W A;  4A5P A;  2VL2 C;  3FHK A;  1BF5 A;  2HXK A;  1T8E B;  4K7O A;  4EO3 A;  5IIZ A;  2LJA A;  4BWS A;  4ZXG A;  1CQG A;  1B9X C;  3FR3 A;  4IVF A;  1URM A;  2HYX A;  2VLV A;  4O5R A;  3CWG A;  4IQA A;  3ZRE A;  3FZA A;  4QL7 A;  2P31 A;  3J7Y b;  3GUS A;  3IV4 A;  4ICY A;  3BBY A;  3D21 A;  4ZB7 A;  3WGX A;  1SKS B;  2H1G A;  3KMO A;  2FA8 A;  4X0X A;  4WBJ A;  5CRW A;  2GSQ A;  3MNG A;  4Z2T A;  4BA7 A;  5KN3 A;  3A5W A;  4XIH A;  1AQW A;  1SJ6 A;  4JED A;  5D73 A;  3MDK A;  5G2Z A;  2NTO A;  2YJ7 A;  4HU7 A;  4J57 E;  4YAV A;  1GNW A;  1YQ1 A;  4YKG A;  2LST A;  3EVI A;  3HMJ G;  4K2X A;  4IEL A;  4FIW A;  1XVW A;  4XS4 B;  4IJI A;  5J4Y A;  2YWM A;  2PER A;  1Z7P A;  4V2M A;  3US3 A;  4FYC A;  1VF1 A;  2LQO A;  5ECQ B;  3VI7 A;  1X9M B;  5CRD A;  2B5Y A;  5CRE A;  3LWA A;  2H19 A;  1ZYQ B;  1USB A;  1B48 A;  1WP0 A;  2KP2 A;  5CRG A;  1Z7R A;  1V9W A;  4CDO A;  1Z3E A;  2IJY A;  2MMA A;  1Z6N A;  3FR9 A;  4K2D A;  5C04 A;  1ZL9 A;  5IO2 A;  1K3O A;  4K5S A;  5CYY A;  3ZVJ A;  4OWY A;  1WIK A;  3I69 A;  2VOC A;  4HS1 A;  2V41 A;  1AQX A;  5J47 A;  4X4J A;  2AV4 A;  4ISD A;  5J3R A;  4OFT A;  3GKM A;  1YF1 A;  2YN1 A;  2WCI A;  4XS1 A;  2X4A A;  2VCV A;  1TK5 B;  5H5R A;  1BED A;  1PN0 A;  5EPF A;  1W4V A;  4IKH A;  3RHC A;  1WPI A;  7GSS A;  4FH8 A;  3ERW A;  4F9Z A;  18GS A;  4CHS A;  3IHQ A;  4IS0 A;  1LBK A;  1TU8 A;  1UC7 A;  3R3E A;  2I3Y A;  2L4C A;  1Y25 A;  4PQH A;  3F4T A;  5IPG A;  2K6V A;  3KXO A;  2YOI A;  3TKQ A;  1HD2 A;  2VL9 A;  4AJ6 A;  4TXO A;  2PVO C;  4DSQ A;  1A0F A;  3UIW A;  1XOB A;  3L9U A;  1SVL A;  3ZIT A;  2O87 A;  2L5L A;  3C7M A;  4IN0 A;  2JAC A;  4PTS A;  1XFL A;  3KMN A;  4NV5 A;  2D2Z A;  2IPA A;  5DCG A;  1AIU A;  5EL8 A;  3BOA A;  1GTA A;  4OO4 A;  5AGY A;  3F3Q A;  2JSY A;  1V57 A;  2VAF A;  3H8Q A;  4OCE A;  5JWQ B;  2K18 A;  1R5A A;  1BAY A;  2GSS A;  5E4W A;  1U3I A;  3FMW A;  1RQM A;  3ISO A;  1BJX A;  4HDE A;  3CRU A;  3FZ9 A;  1HNB A;  4POB A;  3WGE A;  3RAZ A;  2YJH A;  1PGT A;  4MF6 A;  5A5H A;  3TKS C;  2WDU A;  4V1A g;  1K0D A;  2VD1 A;  3V1W A;  1T00 A;  2YWO A;  3QFA C;  2QA1 A;  4ZBB A;  2XPD A;  5AIS A;  3EYT A;  2F8A A;  1GSD A;  1O8W A;  1O73 A;  5GST A;  3GTU B;  2HSY A;  5HFK A;  5BMU A;  2H01 A;  4AI6 A;  3LXZ A;  1O7U A;  4YQV A;  3CTF A;  1BYE A;  4JR6 A;  3LOR A;  2TRC P;  3KP8 A;  1PA3 A;  2OE3 A;  3UBK A;  4TXO B;  5D9X A;  3PPU A;  2IMI A;  4X43 A;  2V32 A;  1DBY A;  1T1V A;  3DIE A;  3KGK A;  4ILF A;  2RM5 A;  3EU3 A;  1MDK A;  5ECN B;  4Q5Q A;  2E2G A;  2CAI A;  3CXG A;  4MLY A;  5L71 A;  4HZ2 A;  2KP1 A;  1OYJ A;  1BG1 A;  5AIX A;  4KND A;  3IK7 A;  1Q98 A;  1YY7 A;  2WS2 A;  2MMZ A;  5J40 A;  3IAS 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...