3LYEA

Crystal structure of oxaloacetate acetylhydrolase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
293
structure length
285
Chain Sequence
EPFSGAKKLRHLLENTDELIVCPGVYDGLSARTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDPFGPPLIADMDTGYGGPIMVARTVEHYIRSGVAGAHLEDQILTKKVVSRDEYLVRIRAAVATKRRLRSDFVLIARTDALQSLGYEECIERLRAARDEGADVGLLEGFRSKEQAAAAVAALAPWPLLLNSVENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHGVVGTPDGITPVRLFEVCGLQDAMEVDNGAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of oxalacetate acetylhydrolase, a virulence factor of the chestnut blight fungus.
pubmed doi rcsb
source organism Cryphonectria parasitica
molecule tags Hydrolase
molecule keywords Oxaloacetate acetyl hydrolase
total genus 102
structure length 285
sequence length 293
ec nomenclature ec 3.7.1.1: Oxaloacetase.
pdb deposition date 2010-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3lyeA00
1VBHA 4MG4A 1SGJA 2DUAA 1PKNA 3R4IA 2V5KA 2E28A 1XG4A 4QG6A 1ZLPA 1E0UA 2WQDA 3OYXA 3EOOA 2VGBA 5TAOA 1OQFA 4TV5A 4B5VA 1PKLA 4L9ZA 1A5UA 1AQFA 3QZ6A 4KCWA 1E0TA 4YNGA 3IS4A 4FXJA 1DIKA 2VWSA 1A49A 4WJ8A 3QQWA 4KCVA 1A3XA 2HJPA 4B2DA 1O68A 2VGFA 3EOLA 1M1BA 3LYEA 1PKMA 1S2UA 3G2GA 3N25A 3I4EA 3GG8A 2L5HA 3M0KA 3QV6A 3FA3A 1KBLA 2X0SA 1OY0A 3M0JA 3U2ZA 3KHDA 4IQDA 4DRSA 3EOEA 1KC7A 4L7ZA 1M3UA 2XZ9A 4L80A 1U5VA 4L9YA 1IGWA 3FA4A 1UJQA 1T5AA 1F3WA 3GQYA 4MF4A 1S2WA 4HYVA 4RPPA 2ZE3A 3LG3A 3EZ4A 4ROQA 3PUGA 1Z6KA 2QIWA 4B5UA 4IP7A 3SRFA 4LSBA 1GGOA 1S2TA 4JPGA 1F3XA 3HQPA 3MA8A 1JDEA 3OQ8A 4HYWA 3BJFA 3BJTA 2DIKA 4QG8A 4KRZA 3PP7A 2OLSA 1DQUA 1U5HA 3SRDA 4G1NA 2HRWA 2VWTA 3E0WA 3QV8A 4YJ5A 1F8MA 1A3WA 4KCUA 4TV6A 1O66A 3OYZA 4FXFA 2VGIA 2XDFA 2HROA 3E0VA 3T0TA 1ZJHA 4B5XA 1XG3A 1F61A 2V5JA 3T07A 4IQEA 4B5SA 3QLLA 3QV9A 2KX9A 3VAVA 2VGGA 4KCTA 1DXFA 3GR4A 1PYMA 2G50A 2XZ7A 4B5WA 3SRHA 4IMAA 5JVLA 1S2VA 3ME3A 3H6OA 2BG5A 4QG9A 1VBGA 3SRKA 2HWGA 3KTXA 3HQNA 4KS0A 1IZCA 3E5BA 1DXEA 1MUMA 3QV7A 2R82A 3T05A 4QGCA 3HQOA 4B5TA 1PKYA 3QTGA 1F8IA 4B2DD 3B8IA 3P0XA 1O5QA
chains in the Genus database with same CATH superfamily
5DFAA 1E55A 1MSSA 1DWIM 3EX4A 3ITVA 4DBDA 2G8ZA 2UV8G 4D6GA 4DBWA 2QCMA 5AC4A 1A49A 3PFMA 1OCBA 2XSXA 1JQVA 2PLMA 2WBGA 5GJPA 3PBGA 1N55A 1J4EA 2BLEA 1E70M 1B3ZA 3CTLA 3WLHA 3FA3A 1GOWA 4RE2A 4ZQCA 2XZ9A 1EBHA 3CZKA 2CESA 2D2OA 3LTSA 4JDBA 3WMCA 2Z00A 2C16A 3HPXA 4UQ9A 2E8YA 4HOWA 1T8QA 3G18A 4REQB 3QMRA 1O4UA 4DZHA 4ZQRA 1BLIA 3KLLA 3LSBA 1TZ9A 3R11A 3MUCA 1D3GA 2ZZ5A 1D3HA 4DJDA 3H2NA 3K8MA 4XVEA 2YPIA 4GIYA 4DBUA 4H8UA 1QW8A 3SR7A 1B0IA 1JAEA 3WLMA 2QEZA 2Z1KA 3BK0A 4KKXA 3A9BA 4NP7A 3PZOA 2BGQA 1V03A 5ENLA 3OEXA 3BOLA 1KFLA 2ESCA 2ZTKA 5GVJA 3QRHA 2Y1HA 2QCEA 1K03A 4UTFA 2YA2A 5LNUA 3R58A 4MDPA 2PCQA 3CMFA 3QTGA 1JFXA 3UR8A 3GR8A 2O9TA 4F0MA 5HJLA 2BOFX 1EA0A 2XISA 3CGTA 5BRBA 3FDKA 1IIGA 2DFAA 4TUFA 1BWVA 1W56A 3AO0A 1RLDA 1BVNP 3SY1A 3IUIA 2O4MA 5HMSA 4S3CA 4LAUA 3EAUA 3MSRA 1Z69A 1OFQA 4JTHA 4PUNA 1JQXA 1JYXA 2HVOA 2VYOA 1P0EA 1BKHA 2PAJA 4Z2JA 2DW7A 4MB4A 4IF2A 3M64A 5MHBA 2WJEA 4YVVA 2OYKA 2WMIB 1HVQA 3V7PA 3T0BA 3FA4A 3QZEA 3NO3A 1GUVA 2Y7GA 2XGIA 2ALRA 2XH4A 5A6LA 3W24A 4J3WA 4XD6A 1CLKA 3LEPA 3VD9A 4HA4A 1VR6A 3KS5A 2ZZ2A 2ISVA 1TWWA 1WXYA 4DZ5A 4QQ3A 3N2XA 2XM1A 3T0TA 1XX1A 3UQNA 3IIOA 4PB5A 4L4LA 1LQ0A 1UWAA 5DLCA 4BF5A 1SMAA 4AZBA 4NXSA 5IHSA 3HGOA 3G1VA 4QHRA 4Z0SA 1FWHC 1OT2A 1FX6A 3SCOA 2XH7A 3ZXWA 2I16A 2XUCA 1OFOA 3EWXA 3QZAA 1A80A 2VC7A 3B8IA 1ZTVA 3MHGA 2YZ5A 4G7EA 1V0NA 1KV5A 5HULA 3WQDA 1X97A 3BG3A 3IRDA 4UUIA 5CLWA 1KLYA 2E7FA 3TROA 2GPTA 4J5NA 3FYPA 4QJ4B 3S1XA 1VEPA 2FMOA 3IWPA 1R2SA 4BWLC 3HIJA 2BX7A 5DRIA 3UR5A 3N9KA 1I45A 1LBMA 4TTUA 4D6FA 1XUZA 4RPPA 1U1UA 3EMQA 3I7QA 5D9PA 5C9XA 4PTDA 4UQCA 3VOFA 3EYPA 1JGIA 4W7WA 3WELA 2EPOA 3S83A 3RHGA 3U5YA 3EMZA 1F73A 1KNWA 2QIIA 7TAAA 3W6LA 3PC0A 4AIBA 3N6QA 3CYJA 3TWBA 1UMYA 5RUBA 5KINA 1FHVA 2VVNA 3F5JA 3IJQA 5HATA 4GJIA 2PTXA 2ACRA 2I5GA 4GKLA 1EWDA 1YDYA 4NJHA 1T8XA 3N14A 5LGZA 4HA1A 5AB3A 3VNDA 1KM1A 1QOPA 4O0ZA 3D5HA 3TUUA 1NSJA 1UWSA 3M5VA 3ALGA 2BASA 2FVMA 3BTNA 5F2LA 3F5LA 3U2OA 1XRTA 3W1AA 1ADSA 4ZB0A 1WPCA 1FVPA 1OCJA 3QSTA 3STGA 4D72A 3TOYA 2JKEA 2AQOA 3EWDA 1BGAA 1XBZA 4LX4A 2WCSA 1XISA 4N6FA 3U48A 2YCEA 3TJIA 3AYVA 3RIKA 3WLLA 1JRBA 1V6UA 4MJMA 1RQEA 4UFJA 3KL0A 3E12A 4F40A 1OGBA 1ZENA 2V9DA 4GD0A 3L4ZA 3AIEA 1I0DA 4PRRA 1POJA 2OGYA 2VWTA 1NP0A 3T1GA 3WH6A 4GY0A 2GJNA 1M53A 1IEVA 1PDYA 1EXBA 2ZXAA 3F4WA 3JS3A 2WBKA 1A4MA 1GYMA 3L5AA 1W9XA 1R47A 4LC8A 1ZJBA 3WL1A 3VIJA 2HNEA 3ARWA 5K3VA 1ENUA 3WFAA 3P6LA 1YHTA 2FPVA 1JYWA 2PDUA 3LN3A 4LRSA 3C8FA 3N17A 2A3CA 5G2HA 4Z2IA 1U33A 3SSJA 3GBEA 5C9UA 4G1KA 1OF8A 3OB8A 4O15A 4MWAE 1KM5A 2OWXA 1I75A 2Y5EA 4J3XA 1J6OA 2P1FA 3WNPA 1JDFA 4DUXA 1W2VA 3C56A 4IT1A 3TSMA 1R86A 3GVVA 4DN1A 2XIOA 3BMXA 2ON3A 3M0JA 3KHDA 4GY7A 3SZ8A 3WDIA 1AQMA 1NARA 5CPQA 1UR1A 5G2IA 4UBPC 3GU9A 1E3ZA 3FXYA 4HYVA 5H6HA 1L9WA 3ZJ6A 1SSDA 4ZO7A 3BSHA 1WYIA 1WB0A 4FF7A 4M6VA 2ABAA 5ECVA 5I07A 2OLSA 3M6YA 4B3LA 2RFGA 3LTYA 8XIAA 1JF5A 2WSRA 3W7LA 1I2PA 3UEQA 3WBAA 1VEMA 3CLWA 2PTYA 2CZVA 2Q01A 1G01A 5FEWA 2NVCA 1AZ2A 5CSRA 2RHGA 2G50A 1EJRC 2J24A 3Q37A 1MZRA 2Z27A 3C86A 4UNIA 3PHAA 1JZ8A 3C3NA 3W72A 1DQXA 1LYXA 3CUHA 1VLIA 3GXPA 2FMNA 1FWWA 2VRKA 5DT7A 5I3GA 1GJUA 4S3AA 4C7DA 4WCJA 3C4UA 5CBJA 3ARRA 3N29A 4J3TA 1NFPA 4L9ZA 1BEUA 3TEVA 3PULA 2C8NA 4JQ3A 1TPC1 4TX8A 2YW4A 3B8WA 3R8RA 4D1JA 3S5NA 2A6NA 3IPWA 3A23A 4MVAA 1H7RA 1UR0A 3BQ5A 1HXJA 4DO5A 1E1FA 1UR2A 3A6OA 3CV1A 3VX1A 1EA9C 1XPGA 4GVGA 1JXKA 3SCUA 3RCMA 5D2YA 1S5TA 1SJDA 3EZ4A 4CD6A 3GDKA 4QRNA 4CN1A 2X40A 1QNVA 5D9OA 4I8DA 2D69A 3CIXA 1BVZA 4POCA 4GO9A 4CNPA 2QZRA 3M46A 1UD8A 2HQAA 3O6CA 2QVNA 3NQBA 2Z1VA 5BW6A 1H5YA 4U10A 5JU6A 3WYZA 3WL0A 3LPGA 4GWEA 2J6XA 4UMAA 4U31A 4BWLA 3MP3A 1DIEA 1LUCB 2DQXA 3KXQA 2CHRA 4PTNA 2IMRA 2YIHA 3E0FA 2WZEA 1TWIA 4ML4A 1HVXA 3AS1A 5D9MA 1JPIA 1JPHA 4HNNA 2NUYA 4OECA 1H1YA 1HL9A 4LH8A 1LWIA 4P7RA 2Y63A 4A21A 3OZYA 4M7SA 1GVRA 3W6MA 4M7TA 3FOKA 4NU7A 3GB6A 1O68A 1KV8A 4AZIA 3W81A 4BA0A 2HDJA 4RCXA 1JDDA 1S2UA 1AK5A 3P3BA 2ZRUA 4UTKA 2GK1B 4WGHA 2G3IA 3OVQA 4KWVA 4QBXA 2RUSA 3FYOA 4N2YA 4FLRA 4I7VA 4P7LA 2RAGA 4YPJA 3AYRA 4JTEA 4ACZA 1JFHA 2EJAA 4JN8A 4L64A 1ISXA 3GNOA 1QI5A 3E5PA 4AEOA 1VP5A 2JIWA 2W0UA 5XIMA 4X9SA 5CGQA 5KSWA 3TX9A 1F6KA 3VMPA 4PBFA 1VCGA 1XC4A 4IFOA 1KWGA 1K9EA 2CBUA 3S8HA 1GQNA 1SPQA 3BZJA 3TFXA 1V6YA 3W7DA 1XBYA 4QAIA 3OHIA 4MNJA 2DZUA 1G9HA 2XVPA 1VBGA 3MKVA 2HWGA 1JNEA 2EPLX 5EY5A 1W54A 4YL2A 1DJNA 4E0CA 3M5YA 1O5QA 3WIJA 1UKOA 1OYAA 3OVGA 3MCOA 4UFMA 2J7GA 3II1A 4HOXA 1UWQA 3S1WA 4GUIA 1G94A 3P5YA 3ZJ7A 2Y2WA 1F76A 3SCPA 4BEQA 1Y65A 1UR9A 3MT1A 4V15A 1WZMA 5FAGA 2YBTA 4JTUA 4JQ4A 4ZB2A 1HKVA 2B7NA 3NURA 4M0XA 3CHEA 1UW9A 5JBDA 2X42A 5C2XA 4X0NA 4NVTA 2Z1WA 1IT8A 2QDGA 1X8CA 5E09A 5A94A 3G5EA 5HXMA 1M41A 1N82A 2D22A 1G0CA 3G77A 4IHCA 2BVTA 3TIMA 3U6WA 3P14A 2GSJA 3ZLFA 4JPGA 1JYNA 3UW6A 4QDMA 3C2RA 3SADA 5SWUA 1AD4A 1ZB5A 3B05A 4Q8OA 1X8FA 3MZ2A 4I9TA 2A7PA 4ZZ9A 3W23A 3SBFA 5FEZA 1K77A 1WE5A 1PZ1A 5CBIA 3H21A 3TN3A 1KM4A 1XYLA 2OEMA 2J7BA 3ZT5A 5JVLA 2DVTA 3V3WA 1VFUA 4ZXLA 1N8IA 4G6CA 5G4HC 4ERIA 5I06A 3TXZA 3AHTA 4XK2A 5DXXA 2CXEA 4XD3A 2Y61A 4PRWA 2E28A 1EF3A 4NZJA 3H2MA 3S2MA 4D8LA 2VGBA 4IG2A 3PY2A 3EWUA 3NL5A 2YXXA 1TA3B 3W86A 3OLDA 1AJZA 4LT9A 3GFYA 1CLXA 2A3BA 1B3OA 1SM9A 4EWND 3SECA 2OX1A 4PYSA 3MU7A 4HNVA 4O18A 1DP0A 1BWLA 2CLMA 1UP3A 1NU5A 2ZUVA 3HN3A 4GO8A 4X63A 5BOOA 3TQKA 4I7UA 1HJSA 5J8LA 1F4AA 4OKDA 2DZXA 2PD5A 3MO7A 3QHNA 4YTQA 4IP7A 3QF0A 5CEWA 4IPLA 4NF7A 2YYTA 2AOSA 3NM3A 3EEZA 1P0BA 3EPMA 2I56A 5CC5A 4GXPA 3T78A 3DYPA 5B80A 4KRZA 2B7OA 4UCGA 1FCQA 3CZJA 4U5KA 2HRWA 2VZUA 3E2VA 2PE4A 4XAPA 3OIHA 3SUSA 3CAVA 3WDJA 1L6YA 3AZRA 1W1TA 3VAVA 3W73A 4YYFA 3GNDA 1H5VA 2IXUA 2QMJA 1VB9A 2CLIA 2YCJA 2PURA 3QTPA 1GKQA 1L6FA 5FSDC 3RPTA 2WSQA 3H2EA 5MKGB 3DG3A 4MY9A 1QNSA 1OEPA 1UP0A 4H9TA 3SUWA 1W9VA 1O60A 5I24A 3BL3A 1QUMA 3Q4DA 4E38A 2A3LA 1A5MC 4TR9A 1JZ7A 3WF0A 1XW8A 5DN1A 4UTIA 3O0KA 1GPFA 3BOXA 4PRTA 3R7MA 3UU0A 4GISA 5T8GA 3EKLA 1IEWA 3KL5A 3CUZA 3LYEA 1Q66A 5IRPA 1KRAC 3WX7A 1QHOA 4AEFA 5XINA 3CAQA 3MHFA 2X0SA 3SQSA 3LPFA 3QJAA 3NPWA 2NVAA 2J9ZA 4AVNA 2V68A 3F2CA 1TJ0A 6REQB 3F03K 3GU2A 3FW6A 3L7RA 4FIRA 1ZY9A 2OZ8A 1CW2A 1EP3A 4FB7A 2EQDA 3P0WA 3PTDA 3RXZA 1OG6A 4JTJA 4GIEA 4TX6A 2C7FA 3AMGA 2GOUA 4FO4A 3NXLA 1C93A 1W1YA 1H7XA 3BAWA 2C1IA 2RJGA 1I2QA 2HXTA 3B9NA 2EHHA 2FZNA 4NRSA 4F0SA 1H7WA 1A5NC 3R10A 4OU1A 1WDDA 2GSEA 4V27A 2O55A 1MNZA 4RX0A 1DJYA 3UJSA 2J7EA 3VGBA 3SRKA 3VIGA 3APYA 3WJZA 4LUTA 3BCJA 3UWYA 2P3ZA 1MRQA 1EKOA 2VDGA 2FJKA 3WQ5A 3ZZ1A 3GKFA 3UP8A 1WDWA 1Z32X 1OABA 2ZDRA 1CIUA 3FVDA 3TJLA 1Q65A 1EC7A 1E71M 1EUNA 3KVJA 2WOQA 1THFD 5E9XA 1J5TA 4Z1YA 1LL7A 1OYCA 3P84A 2VNCA 3DGBA 2XSAA 1LLOA 1ONXA 5AKQA 4GYFA 3NGJA 4W86A 2INEA 4R5EA 5K9XA 3C6CA 5HA7A 2E0PA 3CZLA 1T6MA 1A0EA 3G3MA 3K1DA 5DMYA 5DRCA 3VTRA 5CAKA 5DY2A 5KZ6A 5DCBA 1VQTA 5FA5A 1D7KA 2YYUA 2OT0A 1GHRA 4Q4SA 2ZQ0A 2YFOA 4HA0A 1X6LA 4HYWA 3NQEA 1IF2A 3GG0A 1H4PA 1UD4A 3OBKA 5HUPA 2YBVA 2WYSA 3A3WA 1A50A 5E6ZA 3WF1A 4N9BA 1FOBA 8TIMA 1IIHA 2PP3A 2VGIA 3S42A 4MB5A 3VZXA 3ES8A 1XIEA 5TQLA 2W91A 1US0A 4A8NA 3N13A 1OG0A 2WVSA 4KWUA 3LMZA 4S3KA 3DOPA 3EWCA 2ZUWA 4WJEA 2BMBA 1QWGA 1E9YB 1FH7A 3WD0A 2Z2BA 3FKRA 2ZZ6A 1KLZA 2FPTA 2QHAA 1BXBA 3UWWA 2ZTJA 5DCEA 4Q4MA 1GG0A 3N34A 2DZVA 3ZFHA 1E0TA 5DY3A 2WMJA 2PCEA 1EDGA 4B4HA 4RDYA 4WD0A 1W3TA 2VUYA 1XH1A 1LWJA 2POTA 3G24A 4XO6A 5GJNA 4LUYA 4UXDA 1UROA 3NFUA 1XDLA 1H41A 2P5NA 3AMCA 2C6QA 2Y89A 2VEPA 3TK7A 4CCDA 1PSCA 1QBBA 3CPGA 2V5DA 3ITYA 4FLQA 1OGGA 5H8UA 1CNVA 1XIHA 3GAYA 2DP3A 4DF1A 3ANYA 1RBOB 3GNRA 2AL2A 5HJYA 3CL7A 1XG3A 3UVIA 1W1A1 3LD5A 4W4QA 4CNTA 2G37A 4ZA0A 1W5OA 3DG6A 3VUPA 3M41A 2FHCA 3GX9A 2WW5A 3B9EA 1ZNNA 4U5IA 4J3ZA 5LA0A 3K5XA 2VX6A 2A3EA 4P5UA 2ZXDA 4RNFA 1GTEA 4DZIA 2DIJA 4B2DD 3P2VA 4NI3A 1HL2A 1DQWA 1KFBA 4N4PA 2WO5A 2NUWA 3MW7A 1RXOB 1AA1B 2W63A 1AQFA 3D6NA 3UJEA 1YNPA 4MIMA 1GW9A 4PMDA 4JFUA 4NUWA 3DENA 3TA9A 2DZSA 2NSOA 2WCGA 2Y8UA 3DHDA 2NUXA 3E2QA 1OY0A 1FWEC 4JNMA 4A3RA 3RU6A 4UNLA 3F4NA 4OBSA 4I9JA 2Q8ZA 2ACQA 1HZYA 2QKFA 3MUY1 1IHIA 2G0WA 1R6WA 3H7VA 4YTRA 4HYRA 4DY1A 1JDEA 1HJVA 3TYEA 3VNIA 4PMNA 2XJ7A 4M81A 2UWFA 5EMUA 3R89A 1LTDA 2PDPA 1R30A 1OM0A 4HA3A 4K2SA 4PULA 1KBJA 2WZMA 4QIUA 3GY1A 1IXPA 1O7AA 4DHGA 1UZ4A 5G5IA 4UFKA 1XWYA 3HQ1A 2TAAA 3UWVA 1P0KA 3LK6A 4URIA 1GQKA 4A8IA 2GQ9A 4B5SA 1REQA 1V7YA 4B5WA 1TRIA 3H8AA 3VE7A 1YXDA 4DO6A 3HQOA 4AYGA 1HN1A 2A2IA 2J7HA 4GH3A 3HV9A 3LOTA 4O52A 3DFPA 5CPLA 3O6YX 3GR7A 3S6DA 2IS7A 2ZKMX 1ZL1A 3KOXA 3PSVA 2PDKA 1V3IA 3QYQA 2A3AA 1VFSA 4C65A 5K9DA 4Y9PA 3TTSA 3RK8A 1WV2A 3F7JA 3V5CA 3BW3A 3LU2A 1PJ9A 5M2FX 4CVWA 4LUIA 1YBQA 4AH7A 4HK6A 3TTEA 2A0NA 5D04C 3S3GA 3N4FA 2R1LA 3IK2A 5DBTA 2WKJA 3G1DA 4GYPA 2XN2A 5LZLA 4NYYA 3UT0A 3V35A 3VNZA 4FF5A 3O9NA 3PG9A 2FQIA 3C0SA 4Z2GA 4J28A 4E3TA 1XIMA 2GWGA 4KBXA 3HOJA 3W70A 1NIUA 1EWEA 1NM9A 4GRSA 2GJXA 3L4UA 1X1OA 4IJCA 1O5KA 3W7HA 4DI9A 2FFCA 4KERA 4C5YA 1GYNA 4KCUA 1P7TA 5AHNA 5I3KA 1E3XA 2YBUA 4H7CA 4L6DA 5EU9A 1GOKA 3MC5A 4CNNA 2FZDA 4MWAA 4GINA 8CGTA 3VZYA 1OZMA 3A24A 5HNUA 1BXCA 4DELA 4XD4A 4JGDA 1GVFA 2KZHA 1UG6A 3GIQA 3T44A 1Z42A 5BCAA 1ALDA 4DJEA 2FTWA 4CU6A 3KRSA 3M5ZA 4AF0A 3E5BA 1W37A 4E4FA 5E70A 3W3OA 4IFKB 3WF3A 5FF2A 3VNJA 5LA1A 3EDFA 4C6JA 5F2IA 4WY0A 4JNYA 3UBPC 1RVKA 2FHBA 2NX1A 2YZRA 4RE0A 4C6OA 1MWOA 2WVVB 2ZX6A 4MOZA 4N9DA 4A22A 3UVAA 4C6DA 4MJ2A 4RL3A 1P0DA 1EYEA 2FGBA 1XM3A 3RN6A 2DZTA 4O0QA 1XRVA 3BMVA 3A4WA 2FJUB 3WUFA 3K13A 4Z2HA 1ZSXA 4GJJA 1D8CA 3W2LA 4IIFA 3JZEA 2W6RA 3HPZA 5K2ZA 2NWRA 4L80A 4XUGA 1R3QA 3N11A 2FZ8A 2G3FA 3GW0A 1C29A 1XXXA 2NLIA 1UASA 4MPQA 4LVFA 5HPOA 5HR6A 3QXBA 5BWAA 1Q6QA 1C7SA 3ZYZA 1S39A 3VFLA 1JI2A 1YTEA 1OX5A 2PGRA 3NDOA 4MB1A 2PWUA 2IPWA 3MCNA 1XUUA 1RCXB 3ZLGA 3GTXA 4O53A 1VAHA 1J10A 2HE8A 1UWTA 3VI2A 1XI3A 1KTNA 3D3AA 3WD1A 4PMYA 4IUGA 4LAMA 3W76A 2FLIA 4ZODA 2VR2A 3O63A 4FHAA 3QPEA 3PBMA 4WLCA 1DXFA 5HWJA 1O95A 3DBNA 4LYPA 2YDQA 1WZAA 3A5FA 1S2VA 2HISA 3POHA 1CPUA 1J2WA 1EGVA 3V75A 5BMXA 3VABA 4AU0A 3VOHA 3VM7A 4QE4A 2DVUA 4HSOA 1TPVA 4AY7A 4JFWA 3VD5A 3LNPA 4MADA 4XZLX 1K6WA 3AJ7A 2EG6A 3UR2A 3RDKA 2QJHA 4O8RA 4MHBA 1A5UA 3EDEA 4X0VA 3FGCA 3IIVA 3LGEA 5C2CA 5CH9A 1D9EA 1XBVA 4IOTA 3IGHX 2HJPA 1G67A 2JEQA 1NWTA 1UB3A 1S46A 1LL6A 3CPRA 1BG4A 4A3HA 1FP9A 3PZMA 4I9AA 1BWKA 2PA6A 1ICSA 1RSCA 2D2GA 1R9YA 3E6EA 5LHEA 1J12A 5BXRA 2DZWA 3CHVA 3A9IA 1F74A 4LBRA 4MF4A 3AICA 5LA2A 4LUJA 3CMGA 3DI1A 3I3EA 3EOSA 4MYAA 1EEPA 4XZIA 3DXIA 3EOUA 4HHMA 3DHUA 4JCLA 3MP5A 1IEIA 1U5JA 4E8CA 3THCA 4YXGA 2MUCA 3SRDA 3ANUA 1D3CA 4JIRA 1VFTA 1E6ZA 4GNKB 1UCWA 3TVAA 4C6PA 1KFWA 5HQLA 1BHGA 3ZR5A 2P53A 3PM6A 3TV8A 3E2SA 4E4UA 4TOQA 4GFIA 4H7VA 1YE6A 3WQ8A 4LVBA 3PG8A 4WSHA 1B4EA 1HUVA 1BVWA 2ZX5A 3PWIA 3NJ3A 4CNOA 3FHQA 3T2OA 1P1XA 1EOKA 2QJMA 4AD5A 1OX4A 3VO0A 1KRBC 3FJLA 2DV0A 3VMNA 4K1GA 4P8UA 3NUKA 2QT3A 2VQUA 5D37A 1VRXA 3V0SA 3ABXA 3AYSA 3PPGA 4LRTA 3EX2A 1V7AA 4WXYA 5I3FA 3U4FA 2YA1A 2NVDA 1XDJA 5EMLA 3I6EA 3GTFA 4GI4A 1Q8JA 2DORA 1JUKA 3CZGA 3H4WA 3NA8A 1GYLA 4BQ3A 1QHPA 1MFUA 4JTFA 3B8VA 3SIMA 1TCDA 3B8DA 1PZ0A 3KOZA 8RUCA 1J8VA 4JL2A 5JXQA 1KFEA 2J88A 4EIVA 4WOZA 3MA8A 2AGKA 3U2CA 3DYOA 2OFJA 1RHCA 3WDHA 2QUUA 1XIFA 2A6LA 1R3VA 3WN6A 1H51A 4JTRA 2ZVIA 1CGUA 1RK5A 5A6AA 1OK6A 2IKGA 4GUHA 4MGGA 4KEUA 3A3XA 1KD0A 2NX3A 2FHFA 3XIMA 3WNLA 3UGVA 3VD3A 1PDZA 4MWAB 3WK3A 1QPOA 1KCKA 2QUNA 1NJJA 4HZMA 4BF7A 2PDQA 1LUCA 4BS0A 2E6FA 1FWCC 3W88A 3CV7A 1YE4A 2YL8A 4ICMA 3SEPA 1VRDA 1HO1A 2WKGA 2YOCA 3BW2A 3EBVA 3EWWA 5A6SA 5AC5A 4MZ1A 1RJRA 4XIMA 1TMQA 4WK9A 3T2PA 3G1SA 1RQBA 4HVXA 2WNWA 5FOOA 3TE9A 5FSEC 4H9VA 4IL2A 4S3EA 2GVGA 3QKEA 2O7SA 1Q63A 4HCLA 5I02A 5DT5A 2GGHA 4CD5A 4FX7A 1KC7A 4NNAA 3VOJA 4J3SA 1UC5A 4IQJA 2CWXA 3BV4A 1R7AA 4H00A 3JW7A 3G8RA 4Q7NA 1EZWA 1VS1A 1CB7B 3FK4A 1SJCA 2R1MA 3SRFA 4WOQA 5FF3A 3OQEA 1D7FA 3OQ8A 4Q8NA 1R8LA 2D3NA 3CQHA 2OR2A 1Q6RA 2E8ZA 3DC0A 1X96A 2E6DA 5CSSA 3STPA 2ADAA 5A6TC 4L6OA 2X0HA 4ZMGA 1GOQA 3GXMA 4M1RA 2C19A 3B8TA 3WFZA 1JG9A 5C9RA 1JZ4A 3GS6A 4G9PA 1RY8A 2E67A 3U9IA 3GDBA 4KH2A 1QW7A 2DW6A 2VI0A 1P6BA 2FH8A 4IFKA 4C6NA 4S3BA 1XH0A 1XLIA 3CT2A 3GUWA 3MMDA 3HPSA 2F84A 2E4TA 1NELA 3UJRA 1OFEA 2GUYA 4GCAA 1AVAA 3AU6A 4I7WA 4JFTA 5E93A 5AC8A 4A4AA 4L65A 3OA5A 3TAOA 4HHLA 3DEQA 3NWRA 5AZ0A 1KA9F 5LNVA 4Q6XA 1XFBA 4IGMA 1UIOA 3THDA 3SY5A 4NZ5A 1A5KC 3T55A 1M04A 4IMGA 3APGA 1UZHA 2CFFA 2V67A 3EDKA 2OEJA 5K7JA 4HZ7A 4AWSA 4GCXA 2H6RA 2PDBA 3L0NA 3TW6A 3A21A 2O0TA 3M0YA 1UOKA 4U3CA 5DQPA 1JPKA 1VLWA 3PVFA 3EX6A 5REQA 1AW1A 3QHOA 3RLVA 5BROA 4C60A 3PZIA 2X09A 5J5RA 1DE6A 5H8MA 3CO8A 4UWMA 3TC6A 4HGXA 3VUSA 1K7FA 1QJWA 3UXKA 2W3ZA 4YCPA 3WLNA 4XQ6A 3UPWA 1YBQB 3Q94A 2QCCA 2F6XA 3WMSA 3SQLA 2ZUSA 3CUFA 2Y4SA 5CZ0A 2W4XA 4OBRA 2CZEA 3C2OA 4H1ZA 1IR2A 3INPA 1JCYA 3IAPA 2TMDA 4UOQA 5E0FA 4H8HA 3ZR4A 4MZYA 3QVQA 4QE1A 3P0XA 2XGBA 3WF2A 5BNKA 1PTGA 1Y7VA 4Q8VA 2OX4A 2FTPA 4QG6A 3TYBA 4N02A 2FIQA 2ZZ4A 3L5LA 2IPJA 1NAL1 2JKAA 3RLUA 1UH3A 1XQKA 3WKZA 1KFCA 1YMYA 2HS8A 1FRBA 2PU1A 2PD9A 2ZUMA 2Q8LA 2YJQA 2W9MA 3VC6A 1EF2A 4Q22A 4Z0JA 3RM9A 1W6TA 2QDHA 3ARXA 1L6SA 3W53A 5HNRA 1B2YA 3AMKA 4AUBA 3EKZA 3H53A 4JN6A 3TTOA 4GIRA 1SO4A 4AIOA 3CQ0A 2J7CA 3WQWA 1A5LC 3CH0A 3EWBX 1MXSA 2VDIA 1EXPA 4QDPA 2V69A 1PCKA 1RV8A 4O57A 1FDJA 1WZKA 4GQRA 3NL2A 3VNKA 3OLGA 1XKJA 1EGZA 3STFA 1TPH1 2V3FA 3UXIA 5AY7A 3NQ6A 4PCFA 4XAZA 4Y9AA 1TE6A 2OODA 3T4CA 1GVYA 3G1YA 1Q6DA 1LWHA 5D8ZA 3PPFA 2ZRYA 3L21A 1ZP4A 3FY1A 3OOQA 1CZ1A 3TLQA 1VFOA 3KTCA 1OB0A 3AZTA 4XX6A 3V0UA 1X1ZA 3OGRA 5IFPA 3NQMA 3VK5A 4JKKA 4QITA 1J01A 4RZ5A 1ZALA 2PFHA 3HM7A 5AFDA 5I3HA 1O1ZA 3ITTA 1K7XA 2G41A 3L2IA 2F38A 1V0LA 5U7SA 3PBUA 4NILA 3T6CA 4GVIA 1UKTA 3ARZA 3B4UA 1POKA 1DTNA 1DORA 5J04A 1EDQA 1ELSA 1SW3A 2V2CA 4LOCA 4WGXA 3KBMA 4XG1A 5CPTA 4XO7A 4JAWA 2I7GA 1GT8A 7A3HA 3ITGA 1OC7A 1J0HA 1TIWA 1Q7QA 2OKOA 1C7TA 3L0KA 3QBUA 4U3AA 4LAZA 3PB2A 4GXWA 3NVTA 4JL1A 4CEXC 1U83A 2PDMA 3ZT7A 2ZE3A 1ZRQA 2Q3RA 3GIPA 3S5ZA 1TRDA 4WKAA 1G7UA 4HPNA 4AD0A 5TF0A 4LUSA 4BI7A 2QJJA 2D1ZA 4DUWA 1F07A 5JUVA 3AS3A 2DIEA 5AYXA 1A5SA 3FJNA 2O56A 1QPKA 1V5XA 1KXQA 1AJ0A 2VKZG 4FXFA 4D6JA 3TW7A 3LZ3A 4EAMA 4HQVA 4HNCA 1P48A 5C9ZA 1GCYA 3FSUA 1EJ7L 5HMEA 3KDNA 4WR3A 2NQZA 1LT7A 1Y0EA 3G8EA 2XZ7A 3UA4A 3BC9A 2QULA 1DOSA 4IP4A 3M0IA 4QXIA 2G3MA 1YDOA 2NX9A 1K9FA 1DIOA 1J0ZA 4ATWA 1RPKA 1EJSC 1HX0A 3T9PA 2DH3A 1UWIA 4WVXA 1TTIA 4KESA 4WDUA 3VIPA 1UJPA 2AGTA 1OC5A 4K68A 4P8VA 3UY7A 4KETA 2UBPC 3E02A 3VDAA 1IV8A 1E5NA 1XLGA 4JYDA 4NZCA 5AHEA 3POCA 3TONA 1ZPTA 3BOFA 1XCWA 4NAFA 3TNBA 3EOLA 3G1RA 1JCMP 1MW2A 1TR9A 2C1GA 2NQLA 3AJXA 4MMWA 5GQBA 4U28A 4JX6A 5D05A 1Q6CA 5LGXA 2GYIA 1YW1A 5CKSA 3FN9A 4UNKA 2ISWA 1AQHA 1Z7AA 2WMIA 2NQHA 4OVXA 1GTHA 4JTIA 3VVGA 4F0RA 3CT7A 5AC6A 2E09A 3GC5A 1G4PA 4U2ZA 3HBLA 3NIYA 2DEPA 1K6AA 1T0OA 4O17A 2YW3A 4XZ9A 4R27A 2O4QA 3OGVA 2YXOA 3FIGA 1UH4A 2BVWA 1AH4A 1NVMA 2MANA 1EJXC 2CLPA 1RZMA 5A2BA 1R3WA 3B0XA 4JYFA 4NZ4A 2VOMA 3LY0A 1ZAJA 2EBNA 3W1QA 1ECEA 1EOMA 4I6VA 1OZQA 1E9ZB 2PSNA 1CXLA 1W9DM 3VM5A 3VNMA 2QMKA 1GZJA 1FWJC 3IVSA 2VEGA 4I6KA 5BXPA 4LUTB 2DZPA 2AAAA 3PSWA 1V51A 2CYGA 2B7PA 1N2VA 3ARYA 2DH2A 5BOEA 2QW5A 4LTSA 4QTGA 1VBUA 3GVGA 4AXKA 1CWYA 3WH7A 1QNOA 5TIMA 4WY0F 1E51A 4Y96A 5ABTA 3P60A 2XIQA 5ABGA 4ZO8A 3GG1A 1Y5XA 2ZWYA 4L4MA 2CERA 3CEUA 2OJPA 3W0KA 3BE7A 4K6AA 3GH4A 1M3UA 3IRSA 2B81A 3W22A 2VR5A 4AZGA 3TYDA 1J5SA 1V02A 4PR4A 1JPDX 1OD0A 4TVCA 2XWDA 1VPQA 5BXTA 1LOLA 3RMJA 1HKWA 1BYAA 1GGOA 1B4KA 4PH6A 1RALA 4EACA 4WQ6A 4ZE5A 2OYLA 3VDBA 3I6TA 1DWGM 3QY7A 1QMLA 4KIEA 1NDYA 4RW3A 5CLTA 1LQ2A 2PZNA 4JIQA 1V8EA 4FI4A 3TQPA 2BY0A 3TAKA 3G6LA 3RILA 1NF7A 1YDNA 1DJIA 4HPHA 4PUJA 1TV8A 3N3MA 3SUUA 4I5UA 4UTJA 4H9YA 4M1BA 1XRSA 2BZNA 3UJ2A 5FEXA 4OV4A 2ZC1A 4GGHA 3LCWA 1KB3A 2Y70A 4QJ3B 4E5TA 1H7PA 4JCMA 3E9AA 1FKWA 3IS4A 1QPNA 3OPSA 1EPVA 1SR0A 2VJXA 3B0PA 3N1AA 3GZ3A 1H11A 3K4DA 1PHQA 4OFCA 2PWHA 4J3UA 4UFIA 2D20A 2L5HA 3KBJA 1US3A 4IH3A 1VPXA 3PF3A 1O6IA 1JAKA 1ONEA 2CLLA 2P0OA 4US5D 4B5NA 3P5ZA 1E40A 2FDMA 1H61A 1XR2A 4KFNA 4HIBA 3TJ4A 1C8YA 4H6EA 1TO3A 2HNHA 3BJFA 4R7JA 2JK2A 3N73A 3C3UA 2YL5A 5HANA 4HU4A 4Q4RA 4LWWA 4ZQOA 4QDWA 4GI8A 4P2VA 1U1JA 4BKNA 4FAMA 3WD2A 4L4PA 1TIMA 4KEVA 2HS6A 4XKYB 3GXDA 1DWHM 2FVLA 3UZXA 4AHQA 4IMAA 3W28A 5G2WA 4UTUA 3FLUA 3FVMA 4FMVA 4NI8A 1PX3A 2E9BA 1IZCA 4WJXA 2OKTA 4OOUA 1BSLA 2VURA 1OVDA 3PUEA 2RDTA 1XPYA 1QO2A 1DVJA 3TZFA 5HOSA 3QMSA 2OOGA 3KCOA 4UFLA 1QU4A 2PDGA 1EIBA 1VYRA 2QUMA 1XLBA 1HO4A 2CLEA 4FOUA 1DJHA 2PB1A 2Z7GA 3EA3A 3SFKA 3N3TA 1PX4A 5PTDA 1K4GA 2PWEA 3HU7A 2FDSA 2H8XA 2GVYA 4GFSA 4M56A 4RPQA 3OW1A 3UG4A 1IGWA 1OJXA 4C6LA 1GEHA 3LB0A 3QR1A 1GWJA 3HGSA 3CHDA 4DB7A 1UMLA 1G69A 1XC6A 4IJBA 1JD9A 3WG6A 1W3JA 3B9AA 3G1HA 2PDLA 1XLJA 4AC1X 3ARUA 2VX7A 4QQUA 4GUGA 3WNOA 1E6NA 3QPYA 1IT7A 3VOGA 3WSUA 1JUBA 1VIWA 1OGSA 3E2RA 4XISA 4B5XA 3IV3A 4V2XA 3WLSA 1A0DA 1BGGA 3K8LA 4Y6GA 5E1QA 5CC3A 1MXGA 4GX8A 4OJYA 2DT0A 1HKJA 4LW7A 5D02A 3OLEA 3W2JA 2FB2A 4RUBA 1L8PA 1Q8AA 5F1UA 3U5UA 2P0IA 3L4VA 4G8TA 3TU9A 2D0GA 3ITCA 3PUOA 1F6YA 1AMKA 3G22A 4LB4A 5JH2A 4LVDA 3IVUA 4MTVA 3AI0A 3NDYA 3C5QA 3MUZ1 2WV8A 5FL0A 1ADOA 1Q7ZA 1A3XA 2J7DA 1JZ5A 3MWAA 1RR2A 1AQ0A 1US2A 1FWSA 4GZIA 1B9BA 3Q58A 2V5CA 2A85A 3AWNA 4A35A 4HTBA 3WBEA 5HWNA 2PLKA 3NL6A 1YTDA 4H19A 3BQ6A 2VR4A 4KT2A 3T8LA 4ZE4A 3VKAA 1TFVA 1XBXA 3MS8A 4A2RA 2JALA 3W29A 2C0HA 4Q8MA 3VIFA 5A8PA 3PR2A 4Q8WA 4GBDA 1XRFA 3LQLA 3LGGA 4L61A 3CH9A 3SCTA 9RUBA 1UC4A 3WH9A 2J6VA 3F2DA 2XTKA 3O06A 4F2BA 3MSGA 3GBDA 3BGAA 2H8ZA 1QASA 4M29A 1SZEA 4ZGYA 5CJ5A 3P7YA 4E4PA 4F8XA 4EVZA 2W66A 4UZSA 2GLKA 1GW1A 1TUXA 3QC0A 4MG4A 1ZLPA 3PJWA 2YCIX 3L2LA 1JVNA 3CPUA 4EOUA 1AH3A 2BTMA 2VP8A 3ICJA 4X61A 1M68A 1JGMA 1TPDA 2DZAA 3OJGA 2EG7A 4GBUA 2E5BA 3W2UA 3WY1A 3P8JA 2WMFA 4EWJA 5G1TA 4K7YA 3WMLA 4MZ8A 4GQBA 3L23A 4NX5A 2BDQA 2QCNA 1NFGA 1ZAIA 3JZUA 3GTHA 2V2HA 1VKFA 5I7GA 3BSMA 1S2CA 3UPBA 3B03A 3V36A 4JTTA 4O1AA 4GA8A 1RP8A 2J78A 4F0LA 1W91A 4WF7A 2H3BA 1LZOA 2XIBA 3LSCA 1QCWA 4C6IA 3A22A 5LIXX 2V5BA 4W8LA 4J40A 5BU6A 4ICCX 2PC8A 4CQ8A 1PX8A 4IISA 4Z1BA 3DH7A 3HFYA 1GHSA 1WUEA 1BYBA 4LUSB 2V5KA 1XG4A 4A3YA 3M7SA 3MHUA 1FH9A 5TAOA 3SCRA 1HJQA 2XFFA 3SFWA 4JKLA 4DJED 1OFPA 4KEZA 1KWKA 1VFHA 3O3RA 4RK8A 1TYGA 2IKIA 1M1BA 4IWWA 3S6OA 1HGWA 1VJZA 4HSNA 2J75A 1ISWA 1TTJA 1OYBA 1P6CA 3ARSA 2W27A 1IWPA 2GUUA 4NAFB 4S1FA 4B3KA 2GJPA 4ECLA 5CC7A 4M82A 3DCPA 3M0LA 1E6XM 4GYPC 3G1AA 1YPFA 1Z41A 3HG5A 4H7ZA 2PPGA 1W1B1 3PZUA 3A47A 4HP5A 3UWZA 4DWSD 2WHJA 3B04A 1RJQA 3DC8A 1LQAA 3BG5A 3ZOAA 4Z1CA 4G56A 2PDHA 4CCCA 3CQJA 2VD8A 3I7SA 3M7WA 2CW6A 2PWGA 1D2KA 2NT0A 1PTDA 4HCHA 1K8CA 1TJPA 2GL5A 2ONEA 2CPUA 1JR1A 2OQHA 3LNMA 1L0PA 3AISA 4J35A 4DIAA 1UUMA 2WANA 1IZKA 4PTWA 2HTMA 5HMFA 5LYRA 1A53A 4HZ8A 4YWSA 5DMLA 3GG7A 4DYEA 2VEKA 3IVTA 1KM3A 1LF1A 4H2HA 1UD6A 2P76A 2VL4A 5LHFA 1CLVA 4O1EA 3KWXA 1OCQA 2QDDA 3NEHA 4Q8TA 3WLPA 4RXGA 1YXYA 1EO5A 5EA9A 2R8WA 3EPOA 3ABZA 4MNMA 3AMLA 1SFLA 3PWGA 1PL9A 7REQB 5FL1A 3GVRA 2QNEA 2A1YA 4K1WA 1XIIA 1B30A 3KAOA 1TV4A 4LNCA 1RPXA 4ORIA 1QNPA 3W7KA 5E0CA 3ZVIA 2HBVA 4LCRA 3KW3A 3WEZA 3KUMA 3OTRA 1I2NA 3MI3A 3RUBL 1WOAA 2YLAA 5AHMA 1J93A 4B9ZA 2AMGA 2CKSA 4K3ZA 2J77A 3OZPA 4AD3A 4NNBA 3U7VA 2WSYA 1W2PA 4YN5A 2DZBA 3A13A 3R0KA 3UYIA 4UTLA 1MMFA 3CL6A 4BI6A 3STEA 2VFEA 4PMOA 1UKQA 4H3DA 2X1IA 3GTNA 2NW0A 3NDZA 1C90A 4GZJA 3S5SA 1E4IA 3HA1A 3HZ3A 2MNRA 2IPGA 3QN3A 3O07A 5AHLA 4L1WA 1XDMA 4UCFA 2Q09A 1JCXA 2GOKA 1JZ6A 1PKLA 4Q4QA 2X30A 3C2VA 4HN8A 1CCWB 1GEQA 3EWZA 5JBEA 1WXJA 3KLKA 3F1QA 4BQ5A 1PKMA 3R25A 3CJPA 2QUVA 2G95A 4QCFA 3S1UA 4DJFA 4OOZA 1HNYA 1DV7A 3GQYA 4K8GA 4AY1A 3K46A 2ANUA 1VPYA 2INZA 4CQCA 1WKYA 3H2AA 1NQKA 1FFQA 2VC6A 3SM0A 1QFEA 5LIWX 1HIZA 2VD9A 5HNNA 1OCNA 4HSHA 1ICQA 3OHMB 2TYSA 4U2YA 1M7OA 3HG2A 1S3HA 3QLDA 1XICA 1KTCA 3WQFA 3SGGA 2X7WA 4NAEB 1HGYA 1EQPA 4YMZA 3AYTA 4XSLA 4JFVA 2ISDA 2C14A 3USBA 3MKCA 4FOKA 2DSVA 4NXKA 2HPIA 3ABRA 4FNUA 4M51A 4ML9A 1L8NA 5HPCA 4W7VA 3W02A 4QJ1A 2WK2A 1VCFA 5A2CA 4UQAA 4CEUC 1CXFA 3R1ZA 1V4YA 1FWNA 4AB4A 3EDDA 1CBGA 3N2OA 4M24A 3LRKA 4JTLA 3AROA 4QLLA 4ADSA 3TDFA 4EAYA 5A3HA 3APTA 3BGJA 1W5NA 4XBKA 3TR9A 3ZSTA 3EX1A 1XSJA 4C6QA 3RNDA 1FDYA 1GNXA 1BD0A 4C91A 4M8UA 3SURA 1NF0A 3VGEA 4CNSA 3I7RA 2OVLA 2HBXA 2O9OA 4O1CA 3KHJA 3AHXA 1JUEA 1PUDA 3GUGA 1DJZA 3S5OA 2WNNA 4NQ1A 4RDWA 1YIXA 1LCOA 2Y7FA 4AWTA 5HBFA 2I14A 3DN5A 4O19A 4NJIA 3V0TA 2YLLA 4WY0B 2NQ9A 4F3HA 1VF8A 1J0JA 4QFUA 1DE5A 2BXZA 4N42A 1BYDA 3WLTA 1SW0A 5D4YA 2W67A 2EEXA 3H23A 4OIFA 3PUDA 3JU2A 1E5JA 2QYGA 4UR7A 1EB3A 5FI8A 4U33A 2FKPA 3CUGA 3C2YA 2CBVA 2CCRA 1YNYA 1YLVA 1DXEA 3RYSA 1DWJM 1NDZA 1JJKA 4KS0A 3QOMA 5BOFA 4Y9NA 1PZ2A 3M0ZA 4HNLA 2QVHA 4RDZA 2XFRA 4JR5A 4JX5A 2TSYA 3L4TA 5CPNA 2IUZA 3TQ0A 3LV6A 3WUEA 4IZGA 4BQ4A 1TPEA 1UUOA 2XPKA 3GYEA 4GK8A 3IIXA 2WMKA 4DF0A 3VX0A 4IJRA 3QV6A 3ITLA 2GGJA 4LFYA 4CKQA 3MCMA 1G4SA 3YPIA 3XISA 3I68A 1G6CA 2JKPA 1TTPA 2D3LA 3WEOA 1HKMA 3AALA 5D2TA 2TODA 2DT1A 3SI9A 5E5CA 4E2DA 1KCLA 3LBOA 1CDGA 1H7OA 1P43A 3GHUA 4DBEA 1GVSA 3CEPA 4S3GA 1ADDA 3U4AA 2XN1A 3NPXA 1F7BA 5I2UA 4CD4A 3E0WA 3CC1A 2Q3OA 4WXZA 2V3DA 4JHZA 1TQXA 4LQ1A 1MYRA 3TYZA 1IR1A 1WDSA 1R2TA 3ISIX 2XWEA 4AX6A 7PTDA 1OFAA 3W84A 3GDMA 4ZCWA 1QK0A 4JIIX 4DUVA 4GQGA 3OZMA 2BV9A 2J8FA 3N9SA 4YTTA 4JZ5A 1K1DA 5DEZA 3RRXA 4AD2A 3NM1A 3WFLA 1OQFA 5IOBA 2ZCGA 3AHVA 3CB8A 4HHPA 1C8VA 5A8MA 4ZQPA 4WJ8A 5K9CA 2WWCA 3R13A 1Z48A 4KW2A 3SJNA 5H2ZA 1VJIA 1NEYA 4R7OA 2VGFA 3LV5A 2OZTA 2WCAA 4JQAA 4GG9A 4LVAA 1K02A 4FZIA 2XFYA 4GVHA 1SO5A 3EMCA 3UFYA 1VENA 5HQMA 4MKVA 3R12A 1F3WA 2VELA 3KP0A 4RNHA 3QH2A 2DDXA 1L6WA 1BKSA 2J25A 3IK4A 3B0UX 3MP4A 5A8NA 5FF0A 3H7UA 3VOCA 1ZS2A 1KQZA 1XFCA 1EFZA 4LCQA 4INFA 3BJTA 4AMAA 5M1TA 3R8HA 3NPUA 2PDNA 3C52A 2DT3A 3W1LA 4DUOA 3OBEA 1EP2A 3W38A 1O5XA 2VQTA 1FWIC 1S2AA 4OV9A 1J18A 4JBRA 4DNMA 1W0MA 3SRHA 4JS3A 1FH8A 1PIFA 3AAMA 3RLHA 2QF7A 4BJHA 4ADUA 3SGZA 2J62A 1YQ2A 3VYLA 3ONCA 5AC7A 4E8DA 4RV8A 1SW7A 1OHLA 4CVUA 5H1WA 2REQA 2WJZA 3PWAA 4N0RA 2JGYA 5F7UA 1X39A 4Q4OA 4GOAA 1GOIA 4WZHA 4NZ3A 2Y7EA 4EF9A 5LNRA 3CXOA 3LQGA 4NG3A 1Z44A 2ZOXA 3VKJA 2WHLA 1R9ZA 1N7KA 1T7LA 4UTWC 4KRUA 2E68A 2EPKX 1XHGA 3KM8A 1SFJA 2ZZ7A 4RZ6A 4NASA 4D6CA 3SCNA 3DG7A 4EX4A 4UTMA 2I9EA 4A2SA 2HXUA 3S9ZA 4DO7A 4DJDD 2V3EA 1TX2A 4GYJA 3H24A 4ZFCA 2OSXA 4RR4A 1PHWA 5EMMA 1R7OA 1UPPA 1KGXA 4C5ZA 1S38A 3DU0A 1XYCA 4L9XA 4G5DA 2LLEA 2BWGA 4X3ZA 1AL7A 3B06A 3NOEA 1ZFJA 2PU0A 4QROA 3FDGA 1XH2A 4FX6M 4M5PA 1Q45A 3PZGA 5C6MA 5F4WA 1TPFA 3GXFA 2WSPA 4AFYA 1O1HA 4AXNA 4IPNB 4GZ7A 1V02E 2Y8VA 4R53A 4MSSA 3AFBA 1ISYA 1YPXA 3IGUA 1UZDA 1E9LA 3IIPA 4H83A 4EXAA 3KVKA 3MKKA 3R0DA 1PKNA 5T26A 2QR6A 5DF0A 4AHOA 2OGJA 2XSBA 4UMCA 2OO0A 1ODUA 1NQ6A 3CTTA 4LXFA 2PDJA 5HINA 3S1GA 3IAQA 1L2UA 1FWTA 3AIRA 3KCJA 3WJWA 1UWRA 1WDRA 1BFNA 4IMCA 1E0WA 4TU1A 3G0UA 3LG3A 2AAMA 4NL1A 3O7UA 4GZEA 4BF9A 4Q32A 3QM3A 2QIWA 3AXKA 1PV8A 1EYWA 2VTFA 1ZAHA 3DI0A 1J0YA 4QG8A 1PEZA 4NJGA 3R2GA 5BU9A 2V30A 1KR1A 1ZBCA 3WENA 3PAOA 1VBJA 2WC7A 4EP8C 1P6WA 4YJ5A 1VEOA 2BS9A 1SJAA 5FJPA 3S47A 3PJXA 3CQKA 1RCOB 1ISVA 4O4WA 1KKOA 5H8PA 3AU2A 4H8NA 3S46A 4L1GA 3TW9A 3CIWA 2J8GA 3TQVA 1J2BA 3N12A 1E72M 1A5AA 3BG9A 3L2MA 3THQA 4UTHA 3GDLA 1RD5A 3LXBA 3GDRA 3N18A 3T05A 2PDIA 5IDIA 3UWEA 3MMWA 5F2GA 4NT0A 3W7RA 4IIEA 4K8EA 4HD5A 1TV3A 3TNOA 2XN0A 3XINA 4PC8A 3UXLA 4ZOCA 4I5RA 2VVSA 4ES4A 3S2CA 1XGDA 3ATYA 3L4WA 1SMDA 1TG7A 4GLEA 4J4KA 3N2CA 4YYCA 4YVPA 1ZBWA 3CZEA 3BAXA 4DI8A 3DIPA 1NDVA 3G2GA 4TVUA 5I5RA 2JGQA 3O8AA 1DIDA 1TJRA 4C7FA 3KVMA 3CUJA 2Q02A 4RXFA 3O15A 3TYUA 3GHSA 3UD6A 2J79A 2YFNA 1JXJA 3MO4A 5JIWA 3LHYA 1Z6KA 5A69A 4HOZA 4OQVA 4DPPA 4XIAA 2NSXA 2QPUA 1SJBA 3MZNA 3N04A 2DIKA 4BCEA 1QI4A 2QAFA 4HNUA 3B9DA 2REQB 3KZPA 1Z8AA 1R3SA 4W93A 2VZVA 3HGJA 3FCPA 4CQDA 5L6UA 4PN2A 1QOXA 3N15A 1TMLA 3N6HA 3R94A 3VKCA 4Z2KA 2D24A 1K8YA 4Q33A 4AX7A 4D1IA 1REQB 5HMDA 3IJ7A 3TJXA 3KBWA 3UXDA 3WBWA 4MAZA 4RNIA 4BK9A 3EDJA 4MYXA 3RFAA 3W7JA 4B5TA 5FJIA 3LZ5A 4DWDA 1PKYA 5JIPA 2VFIA 2R1NA 2GGEA 4AWUA 3MPGA 2Z1SA 3L12A 5KTLA 4AVOA 3ABQA 1M03A 1H2JA 2ISFA 4IP5A 4D6EA 3KE0A 4PMJA 1A5BA 3BZGA 3MV01 2ZRXA 2X7VA 3KX6A 1QT1A 3W82A 4G7FA 2BOEX 3NCOA 2PZ0A 1KQYA 2ZE0A 3AIUA 3AIQA 1BRLB 2E1DA 3ZS4A 3WMBA 5A6JA 3WH8A 1HG3A 1R2RA 3PPCA 3DDMA 4ZQNA 1EBGA 1ODZA 1TWZA 2CIPA 2E6YA 1DKWA 3MVIA 2OLHA 3DKJA 2R91A 4WKFA 4R34A 1XLKA 3MMUA 4Q6JA 5JQ9A 2A79A 1WDQA 3OG2A 4V1XA 5HWMA 1KXVA 3BJSA 2OG9A 2W61A 3GR4A 3TA6A 4XKYA 3ARVA 1LOQA 2J13A 3GAKA 5KZDA 3RO8A 4GI6A 5K4ZA 4JTDA 3ORWA 3T0DA 2CKRA 3S0CA 3TC7A 5I0DA 3TCEA 2X0YA 2RJHA 1XLAA 3I10A 4R9XA 4C1NB 2IKJA 4JD4A 1E4MM 4YCOA 1W3IA 5D2WA 2VO5A 2Z26A 2XVKA 4JIEA 4X2RA 3TSBA 1GZ1A 1P7TB 3ELFA 3VIKA 5GNYA 4FXJA 2Z25A 1IZJA 1JZ3A 3NYZA 2XFWA 2W79A 3VILA 2C3ZA 2H3DA 4CN6A 2VDHA 4TO8A 3ZWTA 1V79A 5EB8A 2GQ8A 2NLYA 2R1PA 1ICPA 1QNQA 1IGSA 3WK1A 3WNMA 3CUIA 2AQVA 4L9YA 3GFZA 1P0NA 2VMFA 3O1NA 1A0CA 2FZMA 4Q8QA 1EEXA 2XIIA 3V1PA 2WWDA 1H50A 1QXLA 1VZWA 3M5XA 1CGWA 3TH6A 5AOUA 3GWQA 4Q8PA 2CLOA 4IFRA 4S38A 2O92A 2R14A 3V5FA 2GVJA 1I1WA 1FCVA 1SZGA 4FNTA 4M19A 4LS0A 4UQBA 5EYWA 3GW3A 3CS2A 4IM4A 1R3RA 4FNRA 4DWSB 4KGJA 5GNZA 3FJ4A 4F4RA 4FPSA 4ASTA 1PYMA 2INFA 2XVGA 2YDRA 1BQCA 1B31A 4AC7C 4ZOEA 2WPBA 4O1DA 4ZFMA 2QDEA 1EP1A 4KPLA 3B40A 5A95A 2FYMA 3QV7A 3H2CA 4W5UA 4YTSA 3GRIA 1EJTC 1W17A 3WBYA 4Q4KA 3BVJA 2WMGA 2IW0A 4O16A 4PZVA 3D3FA 2NQJA 1IYXA 1M7XA 1BQGA 1SO6A 3PTQA 4P8WA 3R79A 1L2QA 1MQRA 4S2BA 4XWUA 2F2KA 3CAWA 4H6QA 3QKZA 1TSIA 2OWWA 3E3HA 1DPMA 4C6CA 3FX4A 4MJ4A 4A29A 3LLFA 4YS1A 1Q6EA 4O1FA 1OD8A 4KWSA 1Z9AA 4N9EA 1HP4A 4ZTYA 3VKDA 4S3FA 4HPJA 3MY9A 3RGTA 4FS9A 2G97A 4UTWA 5CGTA 3WQ4A 5I00A 2VUNA 2ZBTA 1S3TC 2GVLA 2OQYA 2O9PA 1TCMA 1KCZA 1YKWA 1MUCA 5D2XA 4L4OA 5LNWA 3IGXA 4LY8A 5G1YA 1W31A 3DX5A 3BH4A 4UOZA 1XLFA 2XVNA 3IUDA 1CGVA 1DHKA 4NJJA 3LI1A 4ENLA 4LYKA 1HKKA 4RZBA 3PZQA 4F9JA 5I77A 4IXHA 1DWAM 2OYMA 4RJEA 1H60A 1ITXA 4NZFA 2Y7DA 4R33A 3RX4A 3B8UA 3DKLA 1PO9A 3LPPA 4HN4A 3H4GA 1ME7A 1H1ZA 3AXHA 3KRZA 3UG8A 5FJRA 1RA0A 3VOIA 1W3HA 2R94A 1MDRA 3TTQA 4JTQA 1JRCA 3ARTA 3WLIA 1R87A 4DJDC 2WJFA 3WCZA 5I6SA 4H41A 1UD5A 3AHZA 2YL6A 1IEQA 2WNQA 1RJPA 4UMBA 3CUXA 1OF6A 3FSTA 3E38A 3NZGA 1XYBA 1XLHA 5FJOA 1AODA 2PRHA 3WUBA 4W8BA 1Q6OA 3W7MA 5EL1A 4JN7A 4E3VA 4HMEA 1FCBA 3CHFA 1UZ1A 4S23A 1YNQA 3CWHA 4ZSTA 2B31A 2CITA 2GGIA 2CBIA 1J11A 3P67A 3QPZA 1UA3A 5CAHA 3L4XA 3MI2A 1J9YA 2VEIA 4TQTA 4IGNA 3FNDA 1TPB1 3UY8A 4QISA 3FEMA 2QQ6A 3MDUA 3BURA 5JH1A 3VGGA 3W71A 2CZFA 3N4AA 2XGZA 3T7VA 5C5YA 2Z6IA 3RLGA 3BLDA 3W1PA 1DQUA 1Y5VA 1K4HA 3DHFA 4NAEA 1BF6A 1XD0A 3ABSA 2C1HA 4QSFA 2D2JA 3LTPA 3FV9A 4IICA 1B5TA 3OLIA 4AD1A 2KAUC 2ZUNA 1FKXA 1I2OA 2EG8A 3H70A 1LL4A 2OSYA 4HZ6A 4ORMA 1TREA 5A8QA 3R8GA 1F3TA 4AMCA 3PZTA 2DVXA 3JR2A 1XQLA 4C6MA 3HV8A 4DVOA 4PGLA 2D23A 2RDUA 4ZR8A 3RU8X 4HTYA 1QBAA 3BSGA 3GXNA 2YL9A 3WNKA 3LHVA 4XAGA 2X05A 2XHYA 1GVIA 4DJEC 1HKIA 1E4NA 3RX2A 1W3KA 2BBFA 3IJLA 1WA3A 3VNYA 3N25A 5E6YA 3CYVA 1UPMB 3TYAA 2VXNA 3P82A 4D6HA 1TKKA 5FD0A 3W7NA 1LRQA 2I5QA 3CASA 5CBBA 4FNQA 1YPIA 3WUGA 3NSNA 1VYPX 3FHAA 1TUFA 2O9RA 1PTAA 2ZRVA 2HMCA 3UWUA 5M03A 3V1HA 5HR7A 3VZZA 1RP9A 3ANVA 4C6KA 3VDHA 2ZVRA 1KKRA 5GNXA 3AXMA 4XSMA 2DSWA 1JNDA 1IQ8A 3T4WA 1IWAA 2PTDA 1OINA 3QGAC 1HJUA 3IJIA 4PA8A 4DWSA 5HDRA 4HJFA 1FHUA 2OWCA 1OSEA 3NQDA 2J4GA 3GNNA 3ME3A 3WDPP 2B4GA 1BXNA 4F9DA 4LVGA 2EXOA 3I3DA 4CD8A 5XIAA 2C15A 1J0IA 1MO0A 3SJ3A 3UG3A 3SGUA 3PBVA 4O8AA 5B7YA 5FF7A 3IACA 2Y8KA 3A4AA 4PB3A 2ZRWA 3CLMA 1GQIA 4LB3A 1EX5A 2Z7KA 3W01A 4CD7A 4PMZA 4HPGA 3M43A 3NAVA 1CENA 3BLOA 1NP2A 3U3HA 1JCJA 3S2JA 4DAFA 3PS7A 1MFVA 4GX9A 3RM4A 3W6YA 3CHCA 3A3HA 3ZT6A 3GG8A 3M6DA 4CCEA 5AVNA 3AIWA 4W88A 4UR8A 1W8GA 3PANA 3L68A 4H01A 4LC6A 3WQGA 4FNPA 3M16A 2J66A 4Z1AA 5DO8A 2X41A 3PUGA 2XINA 1C8QA 3TTYA 3KOFA 3C8NA 4GPNA 5D03A 3W2MA 4P61A 5DMMA 2GGGA 4KFOA 1I9CB 3F4DA 3HF3A 1YEYA 4E2VA 4JIPA 5G1MA 2ZC8A 1B90A 3NZPA 1JCLA 2VFGA 3SN1A 4MAVA 3FS2A 3O2LA 3M47A 1VFFA 2KX9A 5AZ1A 2Z24A 1E6RA 3GLCA 3PPHA 4JY9A 3C0QA 2DGAA 1CECA 3GHRA 1BTMA 1GVEA 1O12A 5C9WA 3VCRA 4JDYA 3GC4A 4C1LA 2YR1A 3MSYA 2QCDB 3M07A 4J2MA 5BRPA 1HW6A 3NZ1A 2D0FA 3FA5A 1TPWA 1VHNA 1VHCA 3ECQA 5J5DA 2QJGA 2E3ZA 5TD4A 4ERAA 3BAJA 4IL0A 1H1NA 2P10A 2SFPA 1JI1A 3C0JA 2W5FA 5AECA 3NQCA 3OBAA 2NXGA 1HQTA 1E6QM 2GDUA 1KXTA 2YSWA 3U2ZA 2VX5A 2HSAA 1PE1A 5IM51 3MBFA 3VDCA 3ALFA 2BY2A 4DYJA 2WNZA 4NRRA 2V38A 1K7EA 3SW6A 1FCUA 1TVNA 3RG6A 4TXEA 4OTKA 1E73M 2PDXA 3RPDA 5ECUA 3L67A 3OG3A 4JY8A 3I3BA 3SO7A 3AXIA 3AIBA 3RO6A 2P3EA 4WDWA 4NHVA 4X60A 1RA5A 5T9CE 3H26A 2F61A 3CWNA 1ZJAA 3FGCB 3NTYA 1XIGA 3TC3A 3W7EA 4AZ5A 3UNTA 1JCNA 1W1ZA 3ITOA 3ZIZA 5A1AA 2JF6A 1ITCA 1EL3A 3W7OA 4PCSA 4A3UA 2PF8A 3LHZA 1ITQA 4OHQA 2Z6JA 1RD6A 1EDTA 2CU0A 4WX2A 2OCZA 1XKYA 3URAA 1PIGA 1PBGA 5LXEA 1DIKA 1K9DA 4CU8A 2GJXB 4GUJA 1QVBA 2NV9A 7CGTA 2BVDA 3WO8A 2V5LA 4HMNA 3IARA 5D32A 3MUIA 1JDAA 1W8SA 3KEHA 5A6KA 3NO1A 4F2UA 3FAXA 4MY8A 2H90A 3VA8A 1LBLA 3GH7A 1CXHA 1GORA 1XYFA 2IQDA 3W74A 4AISA 2PGFA 1LROA 1CXEA 5I3DA 4MLJA 3HQPA 5CG0A 1EZ2A 2AKMA 5GPRA 4CGTA 3VKKA 7TIMA 3CNYA 4KWOA 3EGJA 5KITA 4S3JA 1MQPA 4FR1A 1DHPA 1SO3A 5D38A 2JIEA 4G1NA 1M5WA 3LM3A 1R3TA 1GONA 2ODOA 2G4FA 5FJTA 3P62A 2ZFAA 1F61A 3EA2A 2WKLA 4IMFA 2ZICA 2Z0IA 1HJWA 4TMCA 4O54A 1JCTA 4H6KA 3NGFA 2BG5A 2PDWA 3WLOA 4C6BA 5LNSA 5I78A 1K8XA 4MUPA 3G0XA 1XIBA 1GKRA 3ARPA 4ACYA 1QWKA 3DBPA 1TPUA 3A4XA 1RAKA 1EGMA 1E43A 5IHRA 2AKZA 5BMWA 3UCDA 4JHOA 2TPSA 5MF5A 3BAKA 3IJ6A 2QV4A 4DM2A 4XZNX 4GE8A 2F6KA 4PUEA 1PIIA 3ATZA 2R6OA 4I3GA 3LRMA 1WNOA 3BXWA 3VE9A 3AWOA 4XAFA 1SVDA 9XIAA 2Y0FA 5CPMA 3K4WA 1UWUA 4LV9A 3ZWSA 4ACZB 2JQXA 3KWSA 3N6JA 4A6GA 6ALDA 4O28A 2NWSA 3TN6A 1V3MA 3ABOA 3GVQA 3L65A 4B5UA 4QS5A 1V08A 3EX3A 3MTWA 1LOSA 4JTKA 2JBMA 4D71A 1OX4B 3C2EA 3VCCA 3PZVA 1FXQA 3WLRA 5FKYA 3TXVA 2WVTA 3IUHA 3SAZA 4US5A 2HROA 1FDZA 3W1UA 4ATLA 4QS6A 2DUZA 4IQEA 3QQ0A 3UNDA 1E0XA 1EJWC 2BHYA 3M0VA 6XIAA 4US6A 1BYCA 2QJNA 1Q13A 3DZ1A 2PODA 2HCVA 4MB3A 3PZNA 3CQIA 2NQ5A 2XM2A 4QNEA 2WLYA 1O94A 3H2FA 1VCVA 5EMKA 4Q8UA 4B9YA 4ZSUA 2VCCA 2Z4GA 2J27A 2WZHA 1RBAA 1WOBA 1C91A 4QNWA 1EQCA 1BTCA 2WZIA 4MFEA 3CL8A 3GU1A 4YVXA 3LDVA 2C79A 2Y62A 3DHPA 1UHVA 4MM1A 1MEIA 1WAWA 4NJKA 3MANA 4A05A 1RQHA 4QP0A 4RLIA 3KDOA 1XV8A 1UA7A 3WDRA 4WHBA 1R5YA 3TFCA 1X6UA 3OVPA 3JRKA 4MJZA 4M3PA 3NQ2A 4H2CA 2PP1A 6CGTA 3WF4A 1XLLA 3G0SA 4MLRA 5CZKA 1Q5MA 4C1KA 3V4BA 3IANA 4D8AA 1R85A 4LANA 3FEQA 5CZTA 1HF6A 5L9FA 4KWWA 4J2PA 1YXCA 4CUCA 1H49A 1NOFA 3F4CA 1HL8A 1UIPA 1KBBA 2NXHA 4BHYA 4UTTC 1I4NA 3NNTA 2E9LA 4FOJA 3D0CA 1SZRA 1V3KA 4O0KA 5BYWA 4EPKA 2BXYA 3V5OA 3CB3A 4GABA 5FIPA 2OEKA 3QW4B 1OADA 3O16A 2CLHA 3AUJA 2C71A 3GNXA 3USZA 3IJ9A 4GC3A 1KRMA 3SCSA 4R7WA 1B3YA 3QSRA 1D8WA 2VEFA 4QR6A 6XIMA 1OC6A 3B8SA 3MB9A 3DFYA 5JMUA 1GK8A 4GACA 4UFHA 3E1F1 5EMJA 2X2GA 4Y8EA 2AL2B 4DXXA 4YNGA 1WZLA 4NX0A 4H8VA 2DJXA 1VBRA 3NPVA 3VD4A 3W25A 3WDQA 1W9BM 1XCFA 5CQ1A 2VC5A 2VX4A 4RV3A 1CB2A 4Z2LA 3GC2A 4FLOA 1M01A 3QY6A 1Q6GA 4IGHA 2BP1A 3PB0A 1TELA 3HPFA 2G96A 4C90A 4E2BA 1LG1A 2ZUTA 4DJFD 3KFTA 5EPDA 3SN4A 1WBHA 3W2NA 2WVVA 2BGSA 3KBNA 3CV2A 2RH9A 3HG3A 3B0VC 3EWYA 4BR1A 3PTKA 4LGXA 4UB9A 4H4IA 4PUUA 5F2MA 4B4FA 2Z29A 4V33A 1H09A 1UH2A 3R0UA 2ZX7A 4EXQA 1YYAA 2PTWA 3SIZA 4ZTXA 5M5DA 2P8BA 4MUZA 1ZJHA 3LHTA 2WAGA 4L56A 1WKFA 2ZRZA 5A6BD 1M6JA 3E49A 4YTUA 3AUOA 1A5CA 1JYVA 3AC0A 4O50A 4E6MA 1ISZA 1NTHA 4F0HA 2CHNA 1KRCC 5G4EA 2YCKX 3VMOA 5A8GA 4ATDA 1B1YA 4TVDA 1GQLA 1J6PA 3I4KA 1U1HA 4TV5A 3ID7A 3S9YA 1HT6A 4OWGA 3QZ6A 4FNSA 3EB2A 4RW5A 3P74A 2Q6ZA 3ZO9A 3BLLA 5CSUA 2YGYA 3QQWA 4HU0A 3BW4A 3S6TA 3PK7A 4JQ2A 4ICNA 3ZVHA 3DFQA 3TZNA 5CCZA 1PS9A 4XVDA 4GUFA 2OB3A 1NWRA 3N2MA 5DXYA 5TBOA 4DRSA 5I23A 1BF2A 5D8WA 5HAOA 1XLEA 3FAWA 4EANA 4N9CA 3CM4A 3QEZA 3H22A 3HB9A 4FK9A 3Q65A 4XAYA 1XSIA 4FX8A 3JVAA 4DPQA 4GHRA 3W37A 4HBKA 2BY3A 1LJYA 2HPMA 3EXTA 2YB4A 1KCXA 3HURA 1MQQA 4ADTA 1MRAA 3H7RA 4GGBA 4AQLA 5T91A 2E9MA 3RCYA 3QR0A 4LEQA 5T9BG 4JKMA 3UZ5A 2F8QA 1ZQ5A 3TN4A 1MW0A 1QDSA 1KBKA 3V18A 3FXGA 3N2TA 1JD7A 3DERA 3PTMA 5FF4A 5KZMA 4GQQA 4W9TA 3B3DA 5C70A 3M1ZA 4M6UA 2YX0A 5DBUA 3WZ0E 4KGLA 5HNTA 5FJJA 3REQA 4GVFA 4KRTA 3D47A 3A12A 3TWAA 3P80A 2Y5SA 1XGEA 3R5EA 1TWSA 2V63A 4NY2A 3U57A 3W75A 3OVRA 1XYZA 3U0HA 4N4QA 7ENLA 1V6WA 3BLKA 1W1VA 1QNRA 1XS2A 2FTYA 3KOWA 1S2WA 1VH7A 2PGWA 2H9AB 2EGZA 4QLKA 4PSRA 1F5ZA 3VINA 1R0MA 1WCGA 2OMAA 5AN7A 2PP0A 1ZBVA 4UC5A 2FB3A 2BSLA 4U4MA 1MI3A 4O14A 2OELA 4O13A 2ATMA 1BAGA 2ZZ1A 2PRMA 1TA3A 2Y5JA 1LLZA 4H6RA 2WC4A 3OYZA 2XDFA 1ZGDA 3QC3A 3V16A 2RKXA 1KXHA 3ZVHB 2UY4A 3HGRA 4K37A 3PAJA 2IKHA 2ATSA 1CEOA 2XYLA 3UYCA 2A21A 1AZ1A 1TQJA 2PUZA 4YLWA 4AD4A 1Q7MA 2GQAA 2R24A 1ESWA 4ZVJA 4J3VA 4ONVA 2WM0A 5AYYA 2UY3A 7ODCA 1BPLB 4LAKA 3UA3A 3MYPA 4ZO9A 5DMNA 4DAIA 3W1RA 2ICSA 1B3WA 4HMDA 1W9PA 4S2CA 3SB0A 3QW3A 4PEKA 3H12A 3WLQA 4B5VA 4KF1A 5FJUA 2ZA1A 1Z3NA 2Z2UA 3EXSA 1JZ2A 2JFEX 4CQ9A 4ZQMA 3RPMA 5EGRA 1E9IA 4JXCA 3GO2A 3W9ZA 4LY4A 1DL3A 3WNNA 1V77A 4Y2WA 5BWFA 3KRBA 4ROPA 2FFIA 4ZOBA 1BSIA 3UCQA 4JEQA 3JUGA 3VIHA 4JFSA 1X7FA 2CWNA 5G4WA 4OZOA 1E6SM 4DWSC 4NZ1A 4YHEA 1K9TA 4RZ4A 2OTDA 1XLCA 4UZUA 3QV8A 1TR1A 4BY3A 2G3NA 2VC9A 4Q3MA 4AIEA 3LCXA 1QPQA 3TN5A 3QLLA 4RE4A 1V6TA 3W7PA 3VNLA 3QGKC 3ZM8A 4DF2A 1Q4NX 4PCNA 2B0MA 1LRNA 3EB4A 3GIYA 4FR6A 2QUTA 1ZUAX 3DYMA 3KS6A 1VYSX 4S39A 2QAPA 4L5ZA 5ABHA 1QTWA 2V82A 4MWAC 3ES7A 3NQ7A 2WVUA 2PWFA 1UQYA 4MY1A 4X2PA 4CLMA 4AW7A 4H9MA 5F4SA 3RMEA 4OE7A 2FGLA 1XL9A 2GDQA 4J1OA 4PSPA 3WJYA 1G7VA 1WXZA 2OO6A 1ME8A 3LCHA 4PMXA 3PZ9A 5C2GA 2Z2AA 4IQLA 4AG0A 3N4EA 1F6PA 2UY5A 1X6NA 1QK2A 2QPXA 3WD3A 1RK6A 1DBTA 5CSYA 2GDVA 1W5PA 1OK4A 3BO9A 3M0MA 1K3UA 1P1MA 3VC5A 1OFBA 3MI6A 5HK4A 4B16A 1EHAA 4O4VA 3VGHA 3NO5A 2UZ9A 5CPOA 3ZQ9A 2IXVA 4HMCA 2DY3A 3C61A 4PTXA 1UP2A 2D2HA 2Z1BA 4WKHA 4Y9OA 3VU2A 1NDWA 4WUIA 4H9UA 2HEJA 1TB3A 2GZXA 1Q2RA 1BG9A 1QATA 1VD6A 2G5WA 3H55A 3GZAA 4B91A 4F0KA 1FQ0A 5HUOA 4ERGA 4ZL1A 3PNZA 3QFWA 1LT8A 3FYYA 3RJXA 4K39A 3MMTA 2RDWA 2GJRA 5A5WA 2F7FA 3VKBA 4Q7BA 3S2NA 3DFSA 2ZX8A 9CGTA 3KOYA 2J8TA 1R3YA 3TMLA 4PL2A 2E5DA 4WSKA 3SQMA 2VRQA 3C0LA 1V0MA 5JBFA 1WAUA 3LCLA 5I3JA 1KO0A 3HJEA 2YDSA 1HFBA 1KFKA 3HTWA 5KEZA 3OO2A 1XIDA 1JEZA 4F2TA 5DCDA 1V6VA 3NG3A 3LLDA 4K8HA 3M0KA 1TV7A 3KVLA 3GH5A 1U5VA 2C0AA 4OBTA 3KBVA 4EKJA 1SYTA 3LHWA 5I79A 1LLWA 3BV7A 3NZQA 4JEJA 2AMXA 3AHYA 3NEVA 1F3EA 4EK7A 2ZA3A 1FWDC 2VHLA 2W92A 4HJWA 4IIGA 3LPOA 4LNYA 3THAA 3VCNA 2X8RA 1KGWA 4AWEA 2YCLB 3NYDA 1TJ2A 1U5HA 1XYMA 4DJFC 1EH9A 1GZGA 2WQPA 1TMHA 2VFDA 3BCFA 2OPJA 4NYUA 4EPBC 2ACUA 5LXXA 5FCZA 1DTUA 1G1YA 1MEHA 3IGSA 1XLMA 5LIKX 3UESA 5C54A 3W7GA 2I17A 4ZOAA 4H9XA 9XIMA 3U2EA 4IUOA 2QLYA 3O0FA 1IWBA 4XV0A 3NVDA 4XBJA 4LU0A 1TZ7A 1J96A 4HNTA 5H91A 1OWQA 1FP8A 3TYCA 2ABBA 3KRUA 5BZAA 2DSKA 2XH0A 1UBSA 1ONWA 4JNZA 2DSUA 3W1MA 2ZDSA 2OLAA 1MDLA 2OQLA 5K4XA 1GJWA 2A5HA 2CZDA 3WQEA 2CBJA 1E15A 1ECQA 1EPXA 1J79A 2VRJA 4KMQA 3WQCA 5CJMA 2NZLA 4DBSA 3QQ1A 3IEBA 1RY0A 3G3DA 3WQ6A 4MFDA 3BAIA 4JIHA 1DJGA 2WB5A 1E1EA 1XCXA 3W1TA 3W07A 2WLZA 4IG2B 3W87A 1F3XA 4QJ5B 1QR7A 5BRQA 4F48A 1V93A 2PDFA 3PBYA 3GHTA 3E0IA 2R1KA 1PXGA 1S5NA 2OU4A 3LMYA 1F8MA 1A3WA 4GI9A 3WQOA 3WD4A 4PMQA 1VJSA 3RCNA 1WP6A 2NXIA 3MJYA 2A3HA 5EFDA 3TMQA 3BLIA 1F2JA 2BHZA 1VIZA 1AFSA 1MUMA 1FUYA 1UQZA 2XU2A 2QGHA 3E96A 1M7PA 4BEUA 4JOMA 4PFMA 3A64A 3GM8A 4PEEA 3UETA 2OZ0A 4Z08A 5D9NA 4PTMA 1C3FA 2XH2A 4YU1A 2DSZA 5KETA 5A2AA 1XSKA 4I9MA 4UQEA 2NV2A 2WHKA 2J74A 1MUWA 2V0TA 1H7NA 4QAWA 5CXPA 3H4XA 3QFEA 3COTA 3E0LA 3G1XA 4V1YA 1I60A 3W7CA 3R43A 4P7OA 3U8GA 3UF9A 3WQVA 3W7IA 2Y24A 3LM7A 2VT0A 3TP4A 4LF2A 1XGZA 4W8AA 3W4RA 2PGEA 5IXEA 4L1XA 4XKMA 4PUKA 1S2TA 1SUXA 3MUAA 4ALDA 2I9UA 1ITUA 3P93A 5C7VA 2NV1A 3BANA 2C13A 2ZXQA 3GDTA 3KL3A 3LS9A 1EUAA 4JTGA 4LPCA 2BODX 4D2JA 1AJ2A 4IX0A 1XYAA 4M6QA 1O66A 4S3DA 4WRHA 2QPSA 3G6MA 3HMJG 3SCQA 2WHMA 4OT7A 4FIQA 3RR1A 3FJ6A 1GG1A 3A4JA 4HK7A 3MDWA 3EPNA 1I0BA 1JF6A 3MQTA 4IXXA 3CBWA 1CGTA 4PUWA 4PUMA 1F4HA 3URNA 1M7JA 4DXVA 1CT5A 4AYSA 2BNJA 4N7QA 2PDCA 1FXPA 3EKGA 2FPYA 2QCDA 4PCTA 4RKAA 4ZO6A 1IXOA 1E0UA 3DFTA 1MVYA 3K4AA 2VZOA 1UR3M 3WH5A 3OZOA 7REQA 2NT1A 4CN4A 4DQWA 2CZ5A 4XB3A 1IXNA 1FWBC 4HPXA 3T42A 4QCEA 5EKYA 1AUSL 1OBAA 1GOOA 1F9CA 3UZWA 3R6IA 4AZCB 3W1XA 1KW1A 4JYEA 1C8XA 4RDVA 1QAPA 2GFTA 5ABFB 2V81A 3AXXA 1T99A 4QSHA 3W2KA 3RITA 4IMDA 1IE7C 2PBGA 3T09A 1XLDA 4TTGA 4UR9A 4RNJA 3ITXA 3HFTA 5C71A 4PB4A 3N2BA 2E6AA 5IDZA 2QV5A 3QHMA 3OU8A 5EFFA 2RDXA 4GMEA 4TMBA 1VFLA 1ZBKA 4W87A 2CETA 1QW9A 4DX3A 2QCLA 3CMJA 4XUYA 2WJDA 3VIOA 3VD7A 4GC4A 3CIVA 5AYZA 4DEFA 1NWUA 1EJUC 4PTVA 1FWFC 2QCFA 1DWFM 1YDVA 5B7ZA 2EJ1A 2C91A 4MNKA 1GVQA 4GYKA 1RUSA 4QGCA 1KGUA 4I90A 2YXGA 3UERA 2J9XA 1NWSA 1K70A 3ENLA 3NQ8A 1N8FA 2JE8A 2WZTA 3L4YA 1OIMA 4QM1A 3S5YA 1X1NA 2HV5A 3BWWA 4JTSA 1G5AA 3UR7A 3GFXA 2X1TA 4JX4A 3S9IA 3STCA 5CC6A 1ZP3A 3LXCA 3UGRA 1DXIA 4HKPA 2E25A 3QY8A 2QGYA 1NY1A 3NSXA 3LXAA 1WBJA 2DQWA 4CNUA 3B9OA 4NNCA 5M17A 2B7QA 3UZZA 3Q2DA 1JL8A 3EEGA 1MEWA 4PCPA 4GKTA 4ZXOA 2G3JA 4WSJA 2I5IA 4Y90A 1CX9A 8XIMA 2YA0A 2OSWA 3LGDA 4LSBA 1ME9A 4ZENA 4TIMA 1LM1A 2BOGX 3DFOA 4J27A 4AVFA 4WIWA 1SZFA 4Y9MA 1TTQA 3PP7A 4UQDA 1TV5A 4L6HA 4B90A 3RRAA 1FTXA 1XF0A 2FVKA 4JTAA 1SFTA 2E5CA 2DUXA 3H54A 1UR8A 3HG4A 2P50A 3RX3A 3G1FA 3CO4A 3SN0A 3LX9A 3QV9A 2IQ0A 3K2GA 1EC9A 1TX0A 2VGGA 2AQWA 1FY6A 2P8CA 1MXDA 2X1UA 5DANA 3ZR6A 3IV8A 2ZUUA 3J7HA 2IQTA 2PWVA 3GXIA 1UD2A 4DO4A 1XD1A 2XVLA 3MJMA 3DFHA 4FA3A 1TE1A 4XTIA 2WQDA 1ZCCA 3BDKA 1PPIA 4BZYA 3OODA 3RR4A 4A3QA 4I8YA 4JQ1A 4AIUA 6A3HA 4NKCA 1QRQA 4XZMX 1YTKA 3B97A 1FWGC 5DELA 3WLKX 1M65A 1AD1A 3W85A 1KBIA 2Z28A 3THUA 2C18A 3BUVA 4FEZA 4OUEA 5CG7A 2OZ3A 2V8ZA 1YADA 2A7RA 4V28A 1EX1A 4FSAA 1TJ1A 2V3GA 4IQDA 3EOEA 4HNOA 4K7VA 2F2HA 4IIDA 1T5AA 3NR0A 1QI2A 1OIFA 4MWAD 3BMWA 4FALA 3TLLA 2PLJA 4E2OA 3FKKA 4Z1DA 4R88A 4O10A 3BCDA 1WUFA 2I57A 1Q85A 1S1RA 1HJXA 4R3UA 4MNLA 1TVLA 3ZSSA 5E0KA 1UYQA 4IIBA 4LALA 1FBAA 1H0GA 1VGAA 4DNHA 4PFHA 1UBPC 4KEMA 1LBFA 1OT1A 3I6RA 3RF9A 1OFDA 1DEDA 2EAWA 4KCTA 3KTSA 1Q6FA 4M80A 1F05A 3QR3A 2GWNA 3RAOA 3NQVA 3SY8A 3O6DA 4QG9A 3GTIA 2X1SA 1ZZMA 1KM0A 1J0KA 2PDYA 3HQNA 5REQB 1S1PA 4I5XA 1KM2A 3CU2A 3UPMA 1Z89A 2VENA 2DUAA 1KR0A 1OFRA 3OYXA 1A4LA 3L66A 3NXFA 3QYSA 4R9OA 2PTZA 2HK0A 1W5MA 5CPSA 2A4AA 1E1CB 2VFFA 4UIOA 5CGMA 3W1NA 5FAJA 2CC0A 3A5VA 1EC8A 2TRSA 3KBSA 1R38A 1WQ5A 3I4EA 4W85A 1H63A 3OA3A 1KBLA 4REQA 3U7BA 4Q7IA 2X16A 3WJXA 6PTDA 4GNVA 1EHNA 2V6AA 4O1BA 5AYIA 6TAAA 1JULA 3M4HA 3LENA 3LLXA 4G2DA 4W5ZA 4P7NA 3VIIA 3CWOX 2HVNA 3QMTA 5IFTA 3MV11 3LCFA 3M0XA 2PRLA 3B4YA 3WQPA 1VFMA 3RM8A 4XTDA 4EPDC 3PBWA 1E1CA 4Q4PA 3UXAA 8A3HA 1R46A 3REQB 1V3JA 2CLFA 5ABFA 1EIXA 1E0VA 1QOQA 2HE5A 3MSDA 1C92A 4X22A 2WC3A 1RBLA 3LCIA 4XD5A 3T07A 4AZ7A 2A7NA 1PCWA 4GJ1A 1S5MA 3LI0A 5A8OA 4LJ3A 5A6MA 3W7QA 3VGFA 5I09A 3AIVA 4A8LA 4CQAA 4Z42C 1WKEA 1GKPA 1G4TA 1PB0A 5C8BB 4ZB5A 4JTCA 2RGMA 3LCGA 4Y7EA 1UD3A 1FHLA 3KP1A 4B92A 3NQGA 3VXGA 1VBHA 5CJNA 3F5KA 3MVTA 4JHMA 3M44A