3LYEA

Crystal structure of oxaloacetate acetylhydrolase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
293
structure length
285
Chain Sequence
b'EPFSGAKKLRHLLENTDELIVCPGVYDGLSARTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDPFGPPLIADMDTGYGGPIMVARTVEHYIRSGVAGAHLEDQILTKKVVSRDEYLVRIRAAVATKRRLRSDFVLIARTDALQSLGYEECIERLRAARDEGADVGLLEGFRSKEQAAAAVAALAPWPLLLNSVENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHGVVGTPDGITPVRLFEVCGLQDAMEVDNGAGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxaloacetate acetyl hydrolase
publication title Structure of oxalacetate acetylhydrolase, a virulence factor of the chestnut blight fungus.
pubmed doi rcsb
source organism Cryphonectria parasitica
molecule tags Hydrolase
total genus 102
structure length 285
sequence length 293
ec nomenclature ec 3.7.1.1: Oxaloacetase.
pdb deposition date 2010-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3lyeA00
2HWGA 2G50A 4RPPA 3QLLA 1DXFA 3KTXA 4L80A 3E5BA 4B5SA 3EOLA 2DUAA 1KBLA 3HQOA 3IS4A 3ME3A 2BG5A 2HRWA 3M0KA 1S2TA 1A3XA 2VGIA 1UJQA 2XZ7A 4QG8A 2ZE3A 1DQUA 1Z6KA 1S2WA 1IZCA 1PYMA 3BJFA 3QZ6A 3VAVA 4B5XA 4QG9A 1T5AA 3OQ8A 2R82A 1A49A 4KRZA 3P0XA 4L9ZA 3KHDA 3H6OA 1IGWA 1S2UA 3T05A 4QG6A 2VGFA 2XZ9A 1DIKA 4TV6A 4WJ8A 3SRHA 3E0VA 4KCWA 2XDFA 4B2DD 2E28A 2L5HA 4IMAA 2HROA 4FXFA 4HYWA 3G2GA 3HQNA 3EZ4A 1DXEA 4L9YA 3OYZA 1AQFA 3B8IA 4MF4A 3T0TA 4LSBA 3QV7A 2OLSA 3QV9A 2VGGA 1PKLA 1PKMA 4KCVA 4G1NA 4B5VA 3PUGA 4ROQA 1M3UA 1SGJA 2VWTA 2V5JA 4DRSA 1A5UA 4IP7A 5JVLA 2QIWA 3GQYA 1XG3A 2V5KA 1VBGA 3E0WA 1M1BA 1PKYA 2VGBA 4KS0A 4QGCA 3EOEA 1F8IA 1E0TA 3R4IA 4KCTA 4HYVA 3BJTA 1E0UA 1GGOA 3QV8A 2HJPA 1OY0A 4YNGA 3MA8A 1MUMA 2VWSA 1KC7A 3T07A 3QV6A 3U2ZA 1F61A 3HQPA 4L7ZA 3OYXA 3GR4A 1XG4A 1ZLPA 4MG4A 1O68A 3QTGA 3FA4A 1F3WA 4FXJA 4TV5A 4IQDA 1A3WA 1F8MA 3EOOA 2X0SA 3N25A 1S2VA 4B5TA 4JPGA 1JDEA 4B2DA 3SRDA 3SRKA 3QQWA 3SRFA 3PP7A 4IQEA 2KX9A 3LYEA 4YJ5A 4B5UA 1O66A 2WQDA 4KCUA 1O5QA 1VBHA 3GG8A 1U5HA 1U5VA 1F3XA 5TAOA 1ZJHA 3I4EA 3M0JA 1OQFA 2DIKA 3FA3A 1PKNA 3LG3A 4B5WA
chains in the Genus database with same CATH superfamily
4GCAA 1DJWA 2XGBA 4W85A 2QJMA 4AC1X 4ZQRA 3NQAA 1WV2A 4KBXA 4MGGA 4FR6A 5IDIA 1QPNA 3MI6A 2WB5A 2WYSA 2ZC1A 2YCLA 4ORMA 2R82A 3VKBA 4HK7A 5DY2A 4PULA 3WQ4A 4ICMA 2IUZA 4FR1A 4IMAA 2V81A 4I6KA 4YLWA 3B8VA 4N9CA 2ZFAA 1H5VA 1VLIA 3PVFA 1QNSA 1H41A 2FMOA 2NQ9A 2X1UA 5KZMA 1G9HA 4KFOA 3PZIA 5FL0A 2O55A 3CZLA 5I09A 2QUUA 4F0MA 3TSMA 1MUMA 3MW7A 4H4IA 3R43A 2Q71A 3O8AA 3UVAA 1UUQA 3V4BA 2XGZA 2WBGA 2VZUA 2R24A 3QPYA 2WZIA 3WQPA 4D72A 1J79A 1KLZA 1ZCCA 3WK2A 3E49A 4YPJA 2WV8A 5DELA 5AZ1A 1VCGA 3SGZA 1V8EA 2BZNA 3AISA 4J1OA 3TONA 3WEZA 1FWRA 4L4OA 3O6DA 3KOFA 3XINA 4G6CA 2J8GA 3KOXA 3OOQA 1HN1A 4Z0SA 5C0QA 3KS6A 4AEFA 3ECQA 3CZ8A 2ZRXA 4FX8A 1VGAA 1VHNA 3MDUA 1ECQA 3C4UA 3KWXA 4NX5A 2PDKA 4QG8A 3OGRA 4R53A 3O07A 1F9CA 2QCFA 3Q37A 5A6TC 4Z08A 2XH0A 2YPIA 2NXIA 3L23A 4Q4KA 5D30A 5C9ZA 3DECA 1XDJA 4UNLA 1BSLA 3HOJA 3BZGA 4TV6A 2G4JA 1I2QA 5DX7A 3V18A 4NNCA 2ALRA 4QDPA 3I3EA 2V82A 1GORA 2ACUA 3VXGA 4K38A 2HVNA 1VFFA 2G97A 4KCVA 1F74A 3BAXA 1FX6A 3VNDA 3CHDA 2Y7EA 3F2BA 1EP2A 1K4HA 3QV8A 1K7FA 4AQLA 1DE6A 2VWSA 4GISA 3WLMA 2X41A 4GC4A 1LLOA 4JIPA 4JIEA 3RDKA 1DIDA 4R34A 3S8HA 1GQNA 2ZXAA 4F2BA 1RBLA 1M65A 3CZJA 4LYRA 2ZZ4A 3BCFA 1GOXA 3B05A 3ZR5A 4B4HA 3VMOA 4A21A 3AROA 5D2YA 4QLJA 2G37A 2W91A 4ZB2A 3UWVA 4Q8QA 3SN1A 3A3XA 4Q3MA 1B3VA 5C54A 1A5AA 1ZJHA 1P0DA 3GUWA 5DCEA 3AIWA 1JR1A 1FXPA 1V6VA 3TFCA 1SPQA 4O57A 2CXEA 2FVMA 3HGRA 2QF8A 2WO5A 3GD6A 3L12A 4D2JA 1GT8A 1A5OC 4YVXA 2PBOA 4XB3A 1MUWA 4C6NA 2HVMA 1C93A 3EPOA 3H2NA 4DJED 4UTWC 3JVAA 3ARUA 2WNZA 3TYAA 1KNWA 1M7PA 3O2LA 3T8LA 4RNIA 3N2TA 2CW6A 2PU1A 3WLKX 2A3BA 1S46A 1DV7A 2FTYA 1AH4A 3UF9A 5M5DA 4KFNA 5G2IA 4AF0A 4MNLA 4YS1A 2W4XA 1ZQ5A 3OJGA 1YNPA 3CZKA 1FWEC 1NH6A 1E9ZB 3VFCA 2BASA 4NSBA 2PU0A 4S2BA 4O54A 1Q6CA 1I0DA 4Q8OA 3G1SA 2B7QA 2C19A 3HPFA 5D9MA 4TVDA 3ANUA 4INFA 1W5PA 2VZOA 3O7UA 1MXSA 3F4DA 3PPCA 2Z2BA 2DIKA 2V68A 4HTYA 4AZGA 2HNEA 1H11A 1RR2A 3FKRA 1YEYA 1BHGA 2FQIA 3PC0A 1HP4A 4XZWA 3FYPA 3W87A 3M0KA 4GC3A 4XTIA 4AY1A 5CSRA 2NQJA 4GK8A 3SI9A 2Q02A 4ERAA 4E2DA 1JCJA 1Q45A 4XAFA 4CU8A 4QE5A 5KMYA 3SM0A 4RDYA 4CLMA 2NT0A 3GY1A 1B3XA 5D8WA 1SW0A 4Q4QA 1TYGA 3WFZA 2OB3A 3HPSA 1B3ZA 2YR1A 3BLIA 3W1LA 1KFWA 3MDWA 2OX4A 4HSOA 3WLNA 2QYGA 3UEQA 3OTRA 1UR0A 2PTXA 4EF8A 1KM1A 5LYRA 1XLFA 4PB3A 4MADA 4AWTA 1CPUA 2B7NA 4Q8NA 5DQPA 3THAA 2ZZ3A 1DJYA 4E2BA 1QHOA 1LBLA 4QLKA 3NSMA 3F5KA 3L4ZA 4ZGYA 3AHZA 3RO6A 3IJ9A 3NL5A 1G1YA 2J9ZA 3CV7A 1TZ7A 2BOEX 3GH4A 5F2MA 5FF7A 2QV4A 4MWAA 3II1A 3VOGA 2DQXA 3EDJA 5GJNA 2PDXA 1GVEA 3WF4A 2BDQA 4OGZA 4G7EA 3MHUA 5I6SA 3W7OA 1FWBC 1DKWA 4C60A 4AZ7A 2A85A 4HB7A 3WLRA 1JQVA 1IEVA 1RJPA 1OJXA 2YGYA 3ITOA 4NASA 1DPMA 3N13A 1C9WA 4ADSA 3CAKA 3P80A 3E0FA 3S1VA 3GDTA 4BI7A 4PYSA 4LWWA 1UP2A 4RE2A 2CLHA 5CXPA 1RBAA 1EA0A 3PZVA 4PMOA 1QW9A 5I00A 3T05A 3NPXA 2PWVA 2WHKA 2B81A 5PTDA 4S3GA 3F2CA 4PZVA 4UB9A 2OU4A 2NLIA 2CWNA 1CEOA 3QZAA 3ABRA 3OIXA 4PUDA 2Z29A 4H04A 3P93A 4KCTA 4QDMA 4L4MA 3A24A 2PWGA 3LZ5A 5FEWA 2Y8KA 3U8GA 1CXEA 3LRLA 3PZMA 2JF7A 3ZT5A 4AVNA 3MSDA 4XISA 4ZO7A 4MIMA 1R3RA 4XZMX 3W02A 1J0KA 3APTA 3NDZA 1R30A 1HF6A 1S39A 4P8WA 1L0PA 3WO8A 4U33A 2GYIA 1QHPA 4JKLA 5E0FA 3JW7A 3W7KA 1M03A 4HOXA 2WKGA 4QAWA 2Z2UA 2D3LA 5BXRA 4ZO9A 3MWCA 1NEYA 3F4VA 2YZ5A 3VDGA 2G0WA 1T6MA 2RDWA 3M0IA 2GSJA 1SW3A 3LHZA 1A80A 4BWLA 1V6UA 2F61A 4DJFA 3RM4A 2BVDA 4E4FA 1K03A 2P0OA 1AH3A 3BMVA 3VIGA 1V3MA 3PPFA 3GNDA 5FJOA 1F5ZA 4TVUA 4A8LA 1EYWA 4R7WA 2ATMA 1VIZA 1GOOA 4TR9A 1MUCA 3C2OA 3QGVA 3EA1A 4JTAA 3OYZA 2OEKA 4CNPA 3GX9A 4UCFA 3OVQA 5JVLA 4V33A 4H9UA 1CI1A 5DCDA 3LLFA 3WENA 1RD6A 4Y9OA 1DIOA 3A12A 1P48A 2FZ8A 1E4IA 2IPGA 4CNUA 1G0CA 1ISWA 1FKWA 2PODA 4CVWA 3W2LA 3U2EA 4FSAA 4B16A 5JMUA 3EX3A 1YDNA 5M2FX 1H1ZA 1S2VA 2VYOA 3I6EA 1VZWA 4PMUA 5AN7A 4RLIA 2CBJA 3UJEA 1FCQA 4NKCA 4QJ1A 4KCUA 2HPIA 3WH6A 1J0HA 1VH7A 3O0FA 1CX9A 1BWLA 1TA3A 3E5BA 3WN6A 3GU2A 1EPVA 3ARRA 4XKMA 1QASA 2V2CA 2CBUA 5A95A 2W9MA 2E3ZA 3P84A 4PBFA 4DNMA 4LCRA 2WLZA 2ZZ5A 6ENLA 3GKAA 1EJXC 3B8DA 4EPEC 3O6CA 4H6EA 4J40A 3GR7A 2XM1A 5EU9A 2YDAA 4PBGA 4HA4A 1J0JA 4CU7A 1T0OA 1GOQA 4QFUA 1E1FA 5MF5A 3RMEA 2V38A 4XD3A 3EXRA 1XCXA 3B9OA 2EAWA 3KDNA 2PDYA 4W7VA 3V75A 2ZUSA 3AU2A 3QPEA 2V5DA 3MTWA 1UQYA 1Q7MA 1EOKA 1JXJA 4LRTA 1F76A 4QHRA 2E7FA 5T8GA 1KQZA 1XDMA 3HV8A 1MDLA 2V6AA 5FKYA 1W1IE 4Z1DA 3WQFA 1D2KA 3LGGA 1TPEA 4S3FA 1VEOA 1ZBVA 3CAVA 2E77A 2QDGA 4BQ3A 1K70A 3TN4A 4CCDA 1YDYA 2PDUA 3NGJA 2EKGA 2QDDA 5CGTA 1FWDC 4QSFA 1O1HA 1V3HA 1FP8A 1NDYA 4NVTA 4UTFA 1V3JA 2GOUA 3H26A 2PD5A 3UFYA 1FA2A 2WAGA 1HJVA 4R5EA 3TWAA 3L9CA 2J74A 4Q22A 3ZVHA 2GK1B 3A22A 4GA8A 3O06A 3R8RA 4HHLA 5JUVA 4NZJA 3C3UA 3FY1A 1HKIA 1JYXA 1FCVA 1Q3NA 4AHQA 1H7WA 1W9PA 1V77A 3DN5A 2AMGA 4B91A 1XLEA 4DJDD 4L56A 3M6DA 3QXBA 3U4FA 5I02A 1B3WA 2FFCA 1P0EA 4HNUA 4IIHA 3K1GA 1F3TA 4FNTA 4XO7A 4QG6A 3QC3A 4IWWA 3LPPA 2VEGA 4UFIA 4HCLA 2CZDA 3TW9A 1J2WA 3CLMA 3QQ0A 4F8XA 4AH7A 3MBFA 3EB2A 3T4WA 4DF2A 3IRDA 3DFQA 1Q6EA 2O0TA 4KGJA 5LNVA 5EFFA 5BRPA 4LFYA 1YDVA 4Y2WA 3WH7A 3STEA 1LJYA 4NYYA 4Q7NA 1VF8A 2BHUA 5KZDA 3U2ZA 2QQ6A 1HJUA 4HPNA 1CT5A 1VFLA 4EF9A 1HQTA 1O68A 1KBBA 3QW4B 3FJLA 3M43A 7XIMA 1Z69A 4XBKA 2TAAA 2G3JA 4LANA 2YCEA 3H12A 3GVGA 3EWUA 3W7DA 3Q94A 1V03A 2QJNA 3UXLA 3LV6A 1KFCA 1RQHA 3EA2A 2JK2A 1TMQA 4OKDA 5LHEA 5MKGB 1MWOA 2WJZA 3MWAA 1B9BA 1ZY9A 1W3IA 5G4HC 1MDRA 1E4MM 2DZSA 3TYDA 4AZHA 4PGLA 1SMDA 2CYGA 3R6IA 3VU2A 3QM3A 1P4CA 2NLYA 1UJPA 4P7LA 4JTGA 2OOGA 4NXKA 2C91A 3VNMA 2PDJA 1R3SA 3LXCA 4AZBA 4XAYA 4F48A 3V0UA 2IW0A 4WY0A 1PKLA 3NQ7A 3L2MA 3WF1A 2J62A 1UROA 4GOAA 3TAOA 3WQOA 1U83A 1EQPA 3MSYA 5DXXA 1KW1A 4IIGA 4N02A 2VEMA 4F0SA 2X2YA 4KWWA 1GVIA 4JNZA 1RQEA 5H91A 3VOJA 4MDOA 4PUMA 1PAMA 1HKWA 1XICA 3DFYA 5KTLA 4IF2A 2E5CA 3PTKA 3T9PA 3LNMA 4O28A 3PB0A 4A3YA 5DXYA 4Q8VA 1Q6FA 1F4AA 3OHIA 2IS7A 3WUBA 4QE4A 4Y96A 4IISA 3CTLA 2OQLA 2F2HA 1FXQA 2PA6A 2VEIA 2DGAA 3IUIA 3OODA 1HKJA 2CU0A 3IJLA 3LGDA 3TEVA 4IXXA 4UQEA 2R14A 5I0DA 1LG2A 4PUJA 1HKVA 4XG1A 3DBPA 3FDKA 4LVFA 3TAKA 2YL6A 1ZTVA 3THDA 3TA6A 3AJXA 5BOEA 1X7FA 3W71A 4FA3A 4JIHA 3P8IA 4WKFA 1LOQA 3S1GA 1LUCA 1FFRA 3BE7A 4KRZA 3HFYA 2FHFA 3I10A 4LYQA 1U1HA 1T96A 4S3BA 5GJMA 5HNUA 1UH3A 2HQAA 4FX7A 4LH8A 4MAZA 4ZOBA 1DHPA 1LL7A 4DUVA 1A5NC 1TSIA 3ARSA 1OIFA 1LF1A 2PEVA 4P8UA 5F1VA 5CBBA 5HPCA 1CBGA 4MM1A 1AQHA 4PCFA 1E40A 3DC8A 1NDWA 4BI5A 4QE1A 5C71A 4HD5A 4HMEA 4UQ9A 4O4VA 2V69A 2DQWA 3W00A 3GIQA 1GHSA 3GTNA 3E12A 4DUWA 4L7ZA 1TTQA 2NV2A 5A6KA 1V5XA 4PFHA 1XLAA 3N25A 4WOQA 2YBVA 1FH9A 2V5LA 1ZU8A 1W5OA 1QI3A 3EDDA 3LM3A 3WJSA 3BG9A 1OX5A 3WMLA 3GXMA 2J8TA 1JD7A 3DBNA 1UD3A 3AC0A 1OFEA 5FEPA 3IJDA 5I7GA 3COTA 4E8DA 3VNKA 5D04C 3Q45A 3IJQA 3G1YA 1W5MA 3HURA 2I5IA 1JCTA 3HQ1A 1XHGA 4WKHA 3PTDA 2ASHA 4C6IA 1XLLA 3BJFA 4WLCA 3LQGA 3R2GA 2WWCA 4UFKA 3BSGA 5CBJA 4ZENA 2OSYA 2G8ZA 1K8YA 3S1XA 1XKYA 1W8GA 1OX6A 3W1AA 2RDTA 3PPHA 4AXNA 3WBWA 4HNNA 3TSDA 2VC6A 3EOUA 3KFTA 2Z4GA 2ZXDA 3IGUA 3HMCA 3B8SA 1RH9A 4L65A 1R8LA 4HZMA 1H0IA 2AQOA 2BXZA 2X09A 4DNHA 1A47A 1TJ0A 3NWRA 5A6AA 2VQTA 1G01A 2G96A 3S2CA 3CPUA 1KTBA 4KERA 1FDJA 4MB4A 3EWXA 3GNPA 2WM0A 4QNEA 2OGYA 3NDYA 1JIBA 5C2GA 1XIEA 1NM9A 3QTGA 4GG9A 4PL2A 3TYEA 2W3ZA 2YDRA 1FWHC 2E9BA 4LY8A 4JKKA 4HOZA 4N6EA 1YADA 2ZRYA 1X6UA 2ZKMX 3W1RA 3UWYA 2HDJA 4CCEA 1WDWA 2YA1A 1G67A 4Z17A 3S4TA 2E5BA 3WMSA 4KPLA 3GTIA 4H6QA 2Y5EA 2PP3A 1JCLA 4F66A 3GDBA 3L4VA 3W82A 1CGYA 2YFOA 4HTBA 4N4PA 1XIBA 3PULA 3QJAA 1ITCA 3QLDA 1TE6A 4NJHA 2WC7A 2GUUA 3VKCA 4M3PA 2CZVA 2J8FA 1QMLA 1ZAIA 3VM7A 3S5ZA 2QLYA 2ZUMA 4FIRA 4DO5A 1S2CA 2C6QA 1H63A 3UR7A 4XZBA 3UCDA 3GXTA 3P0XA 1RJRA 4L6OA 5FAGA 4ZOAA 3N6HA 1XPGA 4DLMA 3EAUA 5C9XA 1SO4A 4LS1A 1V02A 4JBRA 4M80A 4H9YA 4ADUA 1W3NA 2L5HA 4C1NB 3UESA 3G3MA 4WJEA 3S2LA 3S1UA 1HKKA 2CLLA 4IL0A 4W93A 1UQZA 1AW1A 3B9AA 3OLEA 1E70M 2EKCA 2GWGA 2JBMA 2HISA 3EKZA 4P7NA 4YYFA 5CJMA 4LAMA 4UOZA 2Q01A 1XH1A 2B7PA 3GXIA 1YPIA 2FYMA 3C2RA 1EO7A 4IUGA 1HKMA 1TPC1 1A50A 1TR9A 4CQDA 3IVUA 3FK4A 1OF8A 4OBTA 1SZRA 3VIFA 1O5KA 1KFLA 4BF9A 2DV0A 2QVHA 3RO8A 1UR8A 5HA7A 8TIMA 4NZFA 4KWOA 3NSXA 3RLGA 3N14A 4UTWA 4DO6A 3N9RA 1R2SA 4XX6A 3QSRA 4KT2A 3UGVA 3USZA 3AYRA 3CUFA 4A05A 4UR9A 4LYKA 3UY8A 2VI0A 1CNVA 1QNRA 1NP2A 3WNNA 2QCHA 4E0CA 1IEIA 2A21A 1W3TA 1TPDA 4WJ8A 3SRHA 1JZ2A 4XQ6A 3WL0A 5L9FA 3SECA 3MUZ1 3I6TA 1LP6A 2EO7A 4G1NA 2VZSA 2J7HA 1XIGA 4CNNA 1TIWA 2YCIX 2PWUA 4TMBA 2ZX7A 3PNZA 4IGHA 1AQ0A 3BJSA 1UR3M 2Z7KA 1SO6A 2CESA 4B4FA 3FJNA 1QR7A 4WQ6A 5TD4A 3EMQA 1WZAA 4PUEA 4LUTB 3VO0A 4RDVA 3IJIA 3RPDA 2Y63A 4XZIA 5KINA 3CB3A 2WZHA 2D2JA 1POKA 4HK5A 1ICSA 3W0KA 4D6EA 3NDOA 3IGHX 1RHCA 4V2XA 1Y65A 4DBWA 4GKTA 1AJZA 2HK0A 1YTEA 1UD8A 3AHVA 3N2OA 3LTYA 3AS1A 3TN5A 1DWGM 2AQWA 1EXBA 4JD4A 2X16A 3CU2A 1XP3A 3SDOA 3WG6A 1KTCA 4X0VA 3NM3A 5A5WA 3SB0A 3APGA 1UKOA 3TTQA 5FA5A 1S2WA 5CSSA 5A8MA 5I3IA 5A1AA 3NR0A 3G8RA 1LYXA 1TE1A 1KBKA 5AHMA 3SUTA 4WSJA 3TXVA 5IHSA 1GZJA 1LWJA 4PSPA 1DIKA 5D8ZA 3CLWA 1DJZA 2Z6IA 3UR8A 4OE7A 1WXYA 3L67A 1KRMA 4B3ZA 1GVSA 5REQB 5BMWA 5DMYA 4DRSA 2FGLA 4JTCA 2WSQA 5CJNA 3VCNA 3P3BA 4C1LA 3A9BA 1LG1A 3ZMRA 1BPLB 1L6GA 1ZPTA 3FW6A 4NYUA 3M0VA 3NAVA 3LHTA 4K68A 4DVOA 1FWSA 2ACQA 1K8ZA 1C91A 2AL1A 2E8YA 2QMJA 2E5DA 3CGTA 1TPUA 4Z1CA 5FSDC 1EDQA 4I9TA 4FXSA 3E02A 2Z25A 1XLKA 1C9DA 3N34A 1AJ0A 3W22A 4B5TA 2UY2A 4Q4MA 4AMCA 2IQTA 4IQEA 2P8BA 2QPXA 3BGAA 3M0ZA 2P8CA 2XYLA 3KVKA 4NAEA 3BOFA 2XN0A 3RMJA 1R3WA 3QTPA 4JR5A 3RXZA 2X0YA 3I3DA 4GO8A 4DWSD 5E70A 1ONRA 4MWAD 4R9OA 1JCXA 2GJXB 4MJZA 1SO3A 4UWMA 3KLLA 4KRTA 5FL1A 3TQKA 3AFBA 3HPZA 3IIXA 2YZRA 3PNUA 5C70A 5IM51 1WNOA 1BD0A 4J2PA 4XIMA 2GGGA 3CUJA 3NQ2A 3KBJA 3PHAA 1SSGA 1NOFA 1ZFJA 4EPKA 4YTUA 4GI9A 2MNRA 5A2CA 3EX4A 3WUGA 5BXSA 2ZZ1A 5F1UA 2XG9A 4GYKA 2BNJA 1Q6DA 5D05A 4FEZA 4NX0A 4U3CA 2HJPA 4RW3A 3CWHA 1MYRA 3ZSTA 4LBRA 3OVRA 3AIUA 4Q4SA 1QCWA 3W01A 1NOUA 1VAHA 3S5OA 1Q66A 2ZC8A 3ABSA 3R11A 3GRIA 1BYBA 4GYPA 2DZWA 5DMMA 4AEEA 1XV8A 1J01A 4HBKA 1VYSX 5ABGA 4QJ4B 2WHLA 4MY1A 1I2NA 3PWGA 1Y5VA 3NO1A 2NVAA 4GABA 3H2CA 4H8HA 4G2DA 3MV11 1H50A 6XIMA 1ZUAX 4X9SA 3IIVA 1RUSA 3NOEA 1TX2A 3E2QA 2BY3A 2VTFA 3ABQA 1IXQA 1EJVC 2E1WA 1RVKA 4TOQA 1CXKA 5C55A 3PR2A 1IZCA 1FCBA 1WQ5A 3GFZA 1WKFA 2J7BA 1WDDA 1HNYA 1JPMA 3LCGA 4U31A 4D6JA 1X7IA 3SCTA 2HBXA 1JPIA 2DSKA 3VKDA 5JXQA 2ICSA 2GVJA 1QI5A 4RZ5A 1G6CA 4GMEA 1J0YA 4L9YA 3NO5A 1POJA 3RRXA 3H7UA 5CZKA 1WCGA 4PRTA 4LX4A 4UMBA 3CIWA 1G4PA 2VZTA 3R13A 3VCCA 1RPKA 1RQBA 3J7HA 3KHJA 1OYAA 5F4SA 4IIDA 1J9YA 1FWJC 3GXDA 4WXYA 5HBFA 3N6JA 3ARYA 2NXHA 4I8DA 4Z2LA 3R7MA 5H8MA 3SRDA 3ZSSA 3W1TA 4N42A 1OBAA 2BMBA 3MMTA 3EWDA 1E15A 4GXMA 3WZ0E 1E6QM 3L7RA 3DFOA 4ZTXA 2YYTA 3S5NA 4P7QA 3SY1A 1E6XM 3HJEA 1W37A 2ISWA 3EGJA 4C6QA 1W9UA 2XVPA 4BCEA 4RNJA 3TMQA 1XD1A 1YPXA 4Z2KA 1PE1A 5D2XA 4HJWA 4OECA 1DJQA 4RE4A 3QYSA 3OQ8A 1E1EA 3M47A 4HCHA 2BGSA 3LRKA 3UXIA 2Y8VA 2XIOA 2VXNA 5E6YA 2G3FA 3BK0A 2E68A 2WMFA 3A64A 2J7GA 5CC3A 4MKNA 5CPTA 3DDMA 1R9ZA 2DFAA 2G3IA 3GVVA 3NQCA 3G0SA 3AHXA 4LB4A 4MY9A 1E6ZA 2YFNA 5G4EA 2GDUA 4AB4A 1NP0A 4HNOA 4IMEA 3TLQA 5J5DA 5AZ0A 5CC6A 2P50A 4O1FA 5DMLA 1EPXA 1HGWA 5D9NA 1GCYA 1OIMA 1ITUA 1OC6A 5BWFA 3KAOA 1EJWC 4KW2A 4M1BA 4DBDA 1D9EA 4XV0A 5A6SA 3VM5A 1NWRA 5EKYA 4AIEA 5AECA 3VGEA 5H8UA 1CGVA 4IFKB 3C52A 4H41A 2VFIA 1V3IA 3WJWA 4XTDA 1ALDA 1N7KA 1JZ3A 3FHAA 4MLRA 1BVNP 1ONWA 4UBPC 4DUOA 4CD6A 3GHUA 2FB2A 4ECLA 3SGUA 1XC6A 5DF0A 3LLDA 4TO8A 8A3HA 3B9DA 1X1NA 1EKOA 1VQTA 4DZAA 1A3XA 1HT6A 2V0TA 3L5AA 3T4CA 1AA1B 4V1XA 1ISXA 2QCMA 4WK9A 2ZUNA 3VUPA 3FSUA 2O56A 3BAWA 5LIYX 1F07A 4FOJA 2O9TA 5AY7A 2GGHA 1B54A 2D22A 3UNTA 3EWWA 3WH9A 2ZWYA 4I5UA 2QS8A 3HM7A 3TZNA 1UMYA 1SJDA 1CLVA 1TREA 3ICJA 5AFDA 1WAWA 3QGAC 2QUNA 3DFHA 3TUUA 1K02A 1QPKA 2JGYA 1IT7A 4HVXA 3M4HA 3NIYA 5LNRA 3FSTA 2V5BA 3BJTA 2Y6ZA 3K46A 1MRQA 4S39A 3T07A 5AOUA 3KBSA 3BV7A 4ACZA 2GL5A 3GDMA 1P1MA 4K3ZA 1OT2A 3BLEA 1O95A 4A29A 1A5SA 2ZVIA 1PTDA 1SUXA 1VFTA 3PZGA 4KWSA 1EX5A 2PD9A 2W0UA 1AJ2A 3T40A 4FIQA 2Y62A 4XD5A 1QI0A 1QRQA 2HSAA 2XTKA 1UASA 3A4AA 2XN2A 1ZB5A 3CHVA 4PEKA 2WMHA 1QOPA 1SSDA 1ISZA 1AVAA 3LBCA 4NILA 1VPYA 2Z26A 2V5CA 5I3HA 4AY8A 4JX6A 3N9KA 2DIEA 4M7TA 2NX1A 4LNYA 1F7BA 1JCYA 4RDZA 5FESA 2ZXQA 2V67A 2VVNA 3QMRA 1S2UA 3DERA 2QW5A 5HMFA 1XPYA 3T7VA 1J5TA 1FH8A 4M29A 4REQA 4WGXA 4CGTA 4ZFMA 1W17A 1FWWA 2CC0A 4UIOA 4J3WA 1IXPA 1S5VA 3PUGA 3PN8A 4AD5A 4GNKB 1ONEA 1RPXA 2EGZA 4HP5A 3UETA 3B9EA 3UP8A 4GFIA 4O12A 4P8XA 4E3VA 5A8GA 4UXDA 2ZUTA 3RAOA 1HVXA 2J25A 1V3LA 2MUCA 3BLOA 1JUBA 1W1YA 1K9TA 4H8VA 4WY0F 1O5XA 2CLOA 1LOSA 3MCNA 4H2HA 3PWAA 3ANYA 3SQSA 3O63A 2QUMA 1V4YA 4W9TA 3LS9A 1F05A 1KCKA 1I60A 4JYFA 4JX5A 4MY8A 4YYCA 1BRLA 1OYCA 5EMLA 3C0LA 2GDQA 1K9EA 3I4EA 4LUJA 1SZEA 4WSHA 4FF5A 1IEXA 5FF2A 1TMLA 5EPDA 3ES8A 3IEBA 1XL9A 2G50A 1UIPA 4KGLA 4WZHA 1X8CA 2QCLA 3DHUA 2JE8A 4UCGA 2P0IA 4RJEA 3AS2A 3EKGA 4YN5A 1S5TA 5CSYA 1E0VA 3T0DA 4P61A 5DRCA 2V9DA 1Q7ZA 1E1CA 4JDYA 2FPVA 4FF7A 5D2VA 1NY1A 2W67A 1MMFA 4NL1A 4IOTA 3MHGA 1UBPC 9CGTA 1NQKA 1ZS2A 4TTUA 3GNNA 3H21A 3PBYA 1GOMA 3T2PA 2UY3A 1VCVA 2OLSA 3AQUA 3WIJA 1D3HA 4HNLA 4C90A 1IF2A 4QEEA 5K9XA 4WVXA 3H7VA 3F7JA 2I56A 3UPBA 1VYRA 2A4AA 4UFHA 5HJXA 4Z2HA 4DXKA 1BF2A 4QS5A 4DY1A 1CW2A 1XRVA 1UB3A 3HQPA 1J0ZA 2PB1A 4DAFA 4FB7A 3BUVA 4ALDA 3QC0A 2AAMA 1VC4A 3IIOA 4DZHA 2OVLA 4QX4A 3JR2A 3AMLA 1PHWA 3FKKA 1NF0A 2WSYA 4PUNA 2XWEA 1O66A 4IGSA 4V15A 2LLEA 3IAQA 5J8LA 4X0NA 1HZYA 1VBRA 2NVDA 3P2VA 3Q67A 4ZTYA 4UZSA 1X8FA 1JRCA 1J6PA 3OZOA 5LKYA 2PS2A 2PDNA 3FDGA 3W7EA 3WCZA 2HRWA 1LT8A 1PCKA 1PEZA 2QKFA 3LQLA 1WE5A 1XIMA 1YHTA 3TC3A 4UTTC 3WNMA 4IG2B 3B03A 4O1CA 6A3HA 3KHDA 1J10A 1IZKA 3S9ZA 2VDGA 1PDZA 3A3HA 1JFXA 1Z3NA 3UCQA 3VIJA 3TX9A 1V0LA 4AYGA 2OSXA 5A6LA 1HUVA 1CYGA 5G1YA 1REQB 3KL0A 3T6CA 3DGBA 3OBAA 3HA1A 3IAPA 5AHIA 3BURA 3ZVIA 3G18A 4FLOA 4CNSA 3CQHA 4JFWA 5JIPA 5BNKA 3WQGA 1KV8A 1W3HA 2XSAA 3K2GA 1S1PA 3NZQA 3GR4A 1XLBA 2GLKA 3GLCA 4BK9A 5C2XA 3PWIA 5K7JA 3V36A 4E2VA 4P7OA 4WX2A 2RDUA 1EEXA 4AU0A 5CCZA 3CUHA 1OFPA 1BSIA 5H1WA 1UD2A 1F73A 3W7QA 4O17A 3ZFHA 4H8NA 3W7GA 4HPXA 4W86A 1C92A 4U28A 4EX4A 2HWGA 2PTYA 2NZLA 1L9WA 1GW1A 3EXTA 4LUSA 3L5MA 5HK4A 1SFTA 3LB0A 2BXYA 4IP5A 3W29A 3WBEA 5KEZA 3LY0A 1TRIA 2J13A 3RX2A 3SO7A 2O9OA 2WKJA 4AHOA 1SQ7A 2X42A 3ZXWA 2X2GA 4H7ZA 1YXYA 5EB8A 4CNTA 1O60A 3EWYA 4O18A 1K7XA 3STCA 3W2NA 2BP1A 1VRXA 2HXTA 2B31A 3STFA 2NX9A 3DYPA 4K2SA 6REQB 3LHVA 1OABA 3TCSA 1W1A1 3T09A 3TROA 1UWQA 2VEKA 4J3UA 3RUBL 4ZXOA 1YKWA 1DJNA 4D8ZA 4JTEA 1OK4A 2A79A 5L6UA 4G9PA 1ITXA 3P67A 2JKAA 1IV8A 5D38A 4WRHA 4LY4A 2REQA 1XLDA 3GS6A 4NG3A 2A3HA 4YVVA 1BEUA 4GY7A 2GWNA 3LPGA 4XWUA 3DHFA 3PBMA 1XIJA 4H2CA 3BAJA 1BF6A 2FGZA 4ORIA 3WLHA 1UOZA 4M8UA 1I9CB 1MXGA 2BB0A 3VUSA 3LHWA 4AZCB 4RX0A 3WFAA 4G8TA 2E1DA 3PTMA 2VM8A 3CL6A 4JL1A 4Q8UA 5HATA 3EOLA 1TVPA 4H1ZA 4I90A 2TODA 3QF0A 2D3NA 3QR3A 3ITVA 1WZMA 4QJ3B 3O1NA 4KMQA 1EA9C 3V1PA 1R86A 3GFXA 1Q7QA 5DN1A 3THQA 2JF6A 4O10A 2NVCA 5FI8A 2IKIA 3F4NA 4E3TA 5I77A 2Y8UA 2MANA 3AZTA 1XYLA 2ZADA 4GXWA 1PIGA 2WMIB 1SFLA 2X1SA 1ODZA 4OWGA 2UZ9A 1H60A 3GE7A 5AVHA 3VKJA 2VO5A 4CCZA 4E6MA 3TOPA 1AL8A 4FOUA 1R2TA 1AUSL 2ZIDA 4NJJA 3TTYA 3WH8A 4FALA 3BSMA 2QJHA 4QNWA 3SUWA 2BVWA 1J93A 1SJBA 2BY1A 5HNTA 1CLKA 3T2QA 4D1JA 3PSWA 3L0GA 3W7NA 1GVQA 4JTRA 4KEVA 4EE9A 4UQCA 1P7TA 3UBPC 4K1GA 4LT9A 3VX1A 4X3ZA 4O1DA 3WK1A 4UMAA 2BWGA 1WUEA 3W26A 1F6KA 3CL8A 3M0HA 3U3HA 3O3RA 1TPFA 1KXVA 3I7RA 1QWKA 2YCLB 4TX9A 1TWDA 2E09A 3LCIA 1KWKA 2BODX 3OHMB 5T9CE 1XQLA 1N8WA 3RILA 1XF0A 2JFEX 3EPMA 3GW3A 3KZSA 4EOUA 4R85A 1TPVA 4PFMA 2V30A 3IJ8A 3ZWTA 5JIWA 1W54A 2GQ3A 4QITA 2GJPA 4B5XA 4O16A 1A53A 1QXLA 3PBGA 4YTRA 4MUPA 3FS2A 3RR1A 2CCRA 2OG9A 3H6OA 1R2RA 2XPKA 3RF9A 5BRQA 4FMVA 4ML9A 3HQNA 1DXEA 2W63A 1GVYA 3TWBA 4ILSA 3G77A 3JUGA 4M82A 2PRLA 4FAMA 2VX5A 3CT2A 1FOBA 2EG8A 3PZTA 1QJWA 4KS0A 4ZL1A 2XINA 3S9YA 4HPJA 2Q6ZA 3W7JA 3M0LA 2I7GA 3G1DA 4MNJA 3H8AA 4DJDA 1JQXA 1WO2A 3VOIA 3T44A 4JIQA 1VJSA 1W1VA 4YVPA 2FIQA 3PSVA 2Z7GA 2BXVA 4CQ8A 2WJFA 1BG9A 4KQNA 4IIFA 4O0QA 3RPMA 4L1GA 1IZJA 2FHCA 1H1YA 2R1MA 3FIGA 5D4YA 3VIIA 2A3LA 3NURA 2EBNA 4ZB0A 4XVEA 2BFGA 3IIZA 4GNJA 1CZ1A 3PM6A 2ODOA 1YMYA 2CWXA 1KM5A 1B30A 1JUKA 1KKOA 5AHEA 1B90A 2VKZG 4PMDA 2E67A 3EDKA 2JEQA 5I06A 2I14A 4N9DA 4JQ2A 3AXKA 4KIRA 2GVYA 5BXTA 2Q3RA 3E2RA 4MB5A 4E4UA 1TRDA 2P88A 4RNHA 1U1JA 2YKKA 1A4MA 4DF0A 1LCOA 1R7AA 3WQWA 1WUFA 4TTGA 5MHBA 5DT7A 4R33A 2DZAA 3VIHA 1TWIA 2OYKA 3SEPA 1I1XA 2VWTA 1H09A 1I2RA 2WPBA 1CGWA 3DCPA 3BMWA 4FNUA 1KV5A 2PDWA 1EJ7L 5A8QA 4PMNA 3DFSA 2PDLA 3XISA 4IT1A 1J4EA 3GTHA 2ADAA 3SQLA 4LV9A 1FWTA 8RUCA 1L6SA 4MTVA 1TJRA 2HS8A 3DFTA 1EO5A 5I3GA 1YDOA 1SO5A 3DYMA 3W1UA 3L4YA 4WDUA 4JHZA 4XVDA 2NV1A 4Q8MA 1EB3A 4NZ5A 1E0WA 2XU2A 2Y0FA 2ZYFA 3QQWA 4KESA 3CUIA 2OQHA 4CD5A 2E9MA 5D2TA 3TN3A 3CXOA 1BYAA 4UQAA 3TOYA 4IMGA 3I7SA 1KFEA 1Q65A 3GHSA 5HMEA 4LAOA 4DLFA 3DESA 2D20A 3D5HA 4UC5A 3RGTA 4GNVA 3G1FA 2F7FA 2G3NA 3CV1A 3IGSA 5LA0A 2PLKA 2BLEA 2PCQA 3HJZA 3K8LA 1QNVA 3MVTA 1R7OA 1OCQA 3VYLA 1DYSA 4F9DA 4DBUA 3RJXA 2D0GA 3W70A 4X9YA 3QHOA 4C6JA 3KEHA 1XFBA 4GIEA 2Z27A 3DC0A 4JN7A 2J9YA 3GAKA 4AF0B 4IL2A 3BTNA 3KLKA 1GVRA 1Q6GA 2R6OA 4GX9A 2AMXA 1Z8AA 2WLYA 3VDAA 4XIAA 4A6GA 4H9XA 1NOWA 1V79A 1XRTA 5G2WA 1JNEA 5F2IA 3UXKA 2BGQA 2FFIA 3DOPA 4C1KA 1HJWA 3F1QA 2E9LA 3SUVA 2E25A 4GQBA 5CZJA 3GIPA 5BRBA 4D6IA 1L2UA 2XSXA 1XW8A 5A6MA 4LPCA 1B4KA 3VZYA 4NJKA 2ZZ6A 3TH6A 1H62A 1WAUA 2ATSA 3SFKA 3SR7A 3BXWA 2RHGA 2YL9A 1JFHA 1I2OA 5A94A 1FHDA 3TW6A 3CIXA 3EKLA 4CUCA 2WBKA 1U5VA 2HTMA 3BL3A 2XVLA 4MZYA 4W8BA 1VBUA 2WVVA 3R10A 3VTRA 2C1HA 4N4QA 2QVNA 2PDQA 4D6CA 3AYSA 1UWAA 2YCKX 4NT0A 4ENLA 4E2OA 1L6WA 3LBMA 1QWGA 2OLAA 3QEZA 1ZZMA 4MJMA 4GKLA 1D3GA 2A5HA 1XIIA 3TTSA 1GTHA 1E9IA 3CO8A 4AG0A 5CAKA 1XUUA 4W87A 5FJTA 2VEPA 3GC4A 4EACA 3GM8A 1EDGA 3MP3A 1QHZA 5DANA 5KZEA 1LOLA 1YXDA 4MWAB 3MPGA 1UOKA 2QJIA 2QCDA 3VGGA 4B3LA 4D8LA 4LGXA 4G7EB 3H54A 4G56A 3OYXA 4UTLA 3ZOAA 4HMCA 2WPGA 1XQKA 1HG3A 3CAWA 1TJ2A 4O11A 2PSNA 2AQVA 1B9ZA 3NQBA 4J3XA 2A0NA 3W81A 1LWIA 1GQIA 4JPGA 2D24A 2IQDA 1L8NA 3H2EA 4RV8A 1V0KA 4JTQA 3BV4A 4J3ZA 1UKQA 3WF3A 4BZYA 1BQGA 2J24A 3SCNA 1WXJA 5FCZA 3CUXA 3M0JA 3HB9A 1F2JA 2OMAA 3CH0A 2NX3A 2I1OA 1OC5A 3NZPA 1R0MA 1NF7A 4L4PA 3IV3A 5LXEA 3GXPA 3ONBA 4H83A 3V7PA 3HIJA 1L2QA 5KZ6A 3KVJA 5LSMA 5CGMA 3KM8A 1IQ8A 3I3BA 2QULA 1EEPA 1EHAA 2DZXA 3W07A 4Z2GA 3NO3A 3C2YA 1VCFA 4P5UA 3RM8A 5T9BG 2XDFA 4P7RA 5GNXA 4UUIA 4W8LA 3LHUA 1UWTA 2VZVA 3TTOA 2EF9A 1CB2A 1YTKA 4YHEA 1ZAJA 3HG4A 4AD4A 2I9UA 4JTTA 4WD0A 4PC8A 2V2HA 3L4UA 4K37A 2HK1A 4ICNA 3H4WA 2YDSA 4NIRA 1LWHA 1UW9A 3TQ0A 4HMDA 3WLJA 1S3HA 3GHTA 5C9UA 1Z7AA 1VHCA 3VABA 3TYZA 1XRFA 4EAYA 4PMYA 3MCMA 3VA8A 5GJPA 1M01A 5E6ZA 4E5TA 3EOOA 4DYEA 1VENA 2Z1BA 2XFFA 3CMJA 1ZJBA 4RK8A 3VILA 7ENLA 1EBGA 3MCOA 3WD3A 4GY1A 4XUGA 1W2VA 3ARQA 1UKPA 1TTIA 4I7WA 5DY3A 3MSRA 3C5QA 4XD4A 3LCLA 1TV5A 2ZX9A 3CYJA 4DAIA 3QLLA 3PJWA 1GHRA 3CNYA 2VENA 4S3JA 3U48A 1X1ZA 2VRQA 4NAFA 1GWJA 1PWMA 1HO4A 5CLTA 4AX7A 4I9MA 3ARXA 1VEMA 2QCGA 3VAVA 4Y9MA 4UTIA 1ME9A 1JVNA 1V08A 3L0NA 4GUJA 3TJ4A 1K7EA 5D2WA 4G7FA 3B40A 3BGGA 2DORA 1XYBA 1XYMA 1W9XA 2VEFA 2WSPA 1ZAHA 4PBEA 4S23A 1J8VA 1GJWA 2NT1A 1LM1A 3GXFA 2ANUA 2DSUA 1CXHA 3RG6A 3LOTA 2PPGA 4PCPA 3QW3A 5BROA 4CN6A 5HWMA 1U30A 4JTDA 3GH5A 2ZQ0A 5BWAA 3CMFA 2J6XA 3SIMA 1XLJA 2YA0A 3REQA 3K8KA 1KGXA 1E73M 3TSBA 3GO2A 1TA3B 3MBDA 3WLIA 3A5FA 2CHRA 4J3TA 3S2JA 1I8JA 3GXNA 1MRAA 1W56A 3SW6A 1DEDA 2R94A 2V3FA 4M6VA 2DW6A 3TU9A 2DUZA 4EXBA 1WDQA 4H01A 1PKNA 2J9XA 1X97A 3R12A 1GYNA 1YNQA 2IKJA 3WF0A 1L8PA 2YLLA 3TC7A 1C7SA 3AXHA 1P5BA 3NXFA 5I79A 1ODUA 1SR0A 2D23A 1MQRA 2J79A 1P1XA 1UR9A 2UV8G 4LRSA 1SFSA 7A3HA 3OG3A 4PMZA 5HWNA 3BCJA 3MMUA 3W1PA 3CBWA 3HGOA 5HUPA 3AIVA 1KM3A 2EEXA 1W32A 4PRRA 1GOKA 4MZ8A 4H9MA 1E6RA 3MO4A 4J2MA 4WF7A 4PTNA 1SYTA 1PKMA 5HDRA 3HFTA 2BHZA 3UVIA 2UY5A 2FPTA 3LTSA 3ZJKA 4IJBA 5IFPA 1Z89A 1X6NA 1JUEA 1KC7A 4FX6M 1XI3A 4HA0A 4XBJA 5FAJA 5IBXC 4PB4A 4OTKA 4DWDA 1H5YA 2CXGA 1QBBA 2EG7A 1TQJA 3ZVHB 3EEZA 4HIBA 1XM3A 3WQ5A 1O1ZA 1IGSA 1XKJA 4ONVA 1K4GA 4XBSA 3PP7A 5EFDA 1G5AA 1TB3A 3M9YA 4IX2A 4UTTA 1YPFA 3ARZA 3AIBA 3C0QA 1NQ6A 1TELA 4Q8WA 2QF7A 3VNLA 3WFLA 4YCPA 4RPPA 2VFHA 2QZRA 1RLDA 3G1AA 1AZ1A 4GO9A 2XSBA 3GNOA 5E93A 3SSZA 3W2KA 2A2IA 3M5VA 1SR9A 1TPB1 4ZSUA 3VOFA 4RV3A 4ZSTA 3PTQA 3GU9A 3VCRA 4AHPA 4Y6GA 4LYPA 3CEPA 3NXLA 2ZCGA 5LNUA 4MVAA 3CK5A 1TPH1 4PTVA 4HT3A 4ZBCA 1UR1A 3JZEA 3UQNA 3E2SA 1BYCA 3QV9A 1Y5XA 1JZ5A 3GNXA 1A3HA 2QPUA 6PTDA 2WNNA 3S0CA 3AUJA 4JN8A 3RU6A 4DWSA 5M3WA 4QTGA 1HL2A 5CSUA 1HIZA 3KP1A 4UTJA 2JKPA 4IMFA 4EANA 3M0MA 1EJSC 1GKPA 4UOJA 4FO4A 1O12A 2F6UA 1XD0A 1IWAA 3A4XA 2PTWA 1QOXA 2QUTA 3VE7A 3UZYA 4PMRA 1C29A 1H51A 3MZ2A 1A0CA 2YB4A 5HXMA 2HBVA 4FOKA 1L6FA 5E0KA 4UMCA 3URBA 2O9PA 1EOMA 2VDIA 3GBDA 4JGDA 1V93A 1Q4WA 1BYDA 1V0MA 4S3DA 1LDCA 2XVNA 5AYYA 4G5DA 5AYXA 4UR8A 4CQ9A 2PGRA 1YBQA 4DO4A 2C18A 5JU6A 4WY0B 3QH2A 4NHVA 2VRKA 4DXVA 1EC7A 4YTQA 1J11A 1UZ1A 3AXIA 4F79A 3M5XA 5I23A 3DI1A 4QS6A 1DORA 3VC6A 2E6DA 1VP5A 3FYOA 3KTCA 5TF0A 5U7SA 3ZYZA 3TFXA 4LVDA 5E9XA 3RNDA 4DB7A 4IPLA 1T7LA 3Q4DA 5HQEA 1JCMP 3W24A 2KAUC 3AXXA 4QQUA 1EUAA 3PPGA 2PP0A 1KQYA 4HJFA 4IX0A 3NM1A 2P3ZA 1NELA 2VCAA 2VRJA 3QY8A 3N2MA 2NSXA 1US2A 4W88A 4NRSA 3NCOA 1LQ2A 4AW7A 2RGMA 1YTDA 1TMHA 3TP4A 5DT5A 3CV6A 2HPMA 4ZODA 4IM4A 2Y85A 3SRKA 3TTEA 3FOKA 1UA3A 1XDLA 3WF2A 1E6PA 2BS9A 1IWBA 2QCEA 4LXFA 1LUCB 3UJ2A 1TV8A 1VIWA 5T26A 2NQHA 3QY6A 1Z9AA 1TKKA 4M7SA 1T8XA 4KEMA 4A22A 4CN1A 4U3AA 2F38A 3JS3A 3QBUA 3W4RA 3W85A 4ZMGA 3QYQA 3QZ6A 1OFBA 1BXNA 2P53A 1KXQA 3URAA 2PRMA 3VDCA 1CB7B 2ZX6A 4NRRA 1FP9A 3VNIA 2J88A 4G1KA 1YRRA 2YBUA 3LD5A 2PDHA 3WEMA 2NWSA 3VD5A 2WMJA 5AB3A 4DX3A 5HAOA 2F2KA 4A4AA 3WD0A 1GPFA 3DZ1A 2O92A 1XIFA 1ONXA 3W7RA 3GQYA 3E96A 2A7RA 1QPQA 4QGCA 3EOEA 3W1QA 2WCSA 3B0UX 4OV9A 2HS6A 4ZQPA 2ISDA 3SCOA 2CBIA 1R3VA 1TV7A 2POZA 2IKHA 2TPSA 3NQMA 3SY5A 4AYSA 4V1YA 1MXDA 3SUSA 5JH2A 1CDGA 2VURA 1W1ZA 1U5JA 4GUHA 3WNLA 3QSTA 4HKPA 4D6DA 3SCWA 4LUIA 4I3GA 3NZ1A 4GVIA 4PCSA 4C6BA 1AH0A 2C1GA 4QCFA 5FF3A 3PJTA 2VOMA 4L80A 4UZUA 5EBUA 3LDVA 3H4XA 2RH9A 4W5ZA 1RK5A 3ME3A 3VZXA 5EL1A 2GVGA 3EA3A 2D2GA 3RJYA 2XZ7A 1KWGA 2WOQA 1S5MA 3NTYA 3P60A 5AC8A 4PMXA 6XIAA 1UC5A 1DTUA 3ZR4A 4H6KA 3W76A 1IE7C 1KM6A 4MKVA 4M19A 7CGTA 4NUWA 1I75A 2CKRA 3ANVA 4HN8A 4BS0A 4J4KA 3POHA 3B97A 1IT8A 1LQ0A 1VBGA 3FJ6A 5HNRA 1LRNA 1E5JA 5IOBA 3AJ7A 3GWQA 3WY1A 4NXSA 1HO1A 1XGZA 1F61A 1SFJA 3WUFA 3RN6A 2E6FA 1LL6A 3I6RA 1OGSA 1F3WA 3WQDA 1GEQA 4ATWA 1JL8A 2DIJA 1Q6LA 3G22A 2PDCA 3LERA 1QNPA 2PGEA 4C6OA 1VJIA 3RHGA 3QHNA 3EMCA 2XIJA 2XVGA 3MANA 3AIEA 7ODCA 3PZNA 3NPUA 3DKLA 3IPWA 4MMWA 6TAAA 4F40A 1HXJA 6ALDA 2CNCA 1VYPX 1VRDA 3KRSA 4US6A 2QCNA 3H24A 1Q8AA 2ONEA 5IHRA 1WBJA 3OW1A 3PK7A 3W7IA 5DEZA 4BR1A 3V1HA 4U2YA 2GSHA 4Q8PA 4GQQA 2VGFA 1AG1O 1AW5A 5CLWA 4U10A 4AXKA 2HMCA 4IMCA 3RCNA 2J7FA 4ZFCA 1E9LA 1Z32X 1BVZA 3LSBA 3B4UA 3M41A 4H3DA 4ROQA 2QIWA 4JKMA 1UWUA 6CGTA 2DJXA 2DVUA 1BVWA 2FZDA 2QJGA 5AYZA 3VC5A 3U2OA 1K3UA 4Z2IA 5JBFA 3LMYA 1S38A 4Z0JA 3PZUA 4XSLA 4ZQMA 2V3DA 1W9BM 4R88A 2AAAA 4GINA 3DHPA 1KCXA 3LSCA 4IQDA 7TIMA 4S1FA 1JULA 5G5IA 3H2AA 1MNZA 1G69A 4CNOA 4YU1A 2QHAA 4O1BA 3JRKA 1P0BA 1IXNA 2VD8A 3GG8A 2FVKA 4O14A 1VFMA 4NNAA 2OZTA 2OGJA 1QPOA 4N7QA 2AL2A 4B5WA 3QR0A 1LORA 3HQOA 3SBFA 5ABTA 1R3TA 7REQA 3M6YA 5C9WA 1QU4A 1T99A 3MSGA 9XIMA 1J18A 1EF2A 2G95A 3CPGA 2NXGA 4N2YA 4NJIA 5LIUX 1ME8A 1U33A 1WDPA 3GZ3A 3S1WA 2WXDM 3HG5A 3VI2A 4OIFA 3W28A 3VD9A 3N2BA 2YXXA 1GQLA 5FACA 3ABXA 1V6WA 4LSBA 3NZRA 2PTZA 4UTUA 1UCWA 3OGVA 4PODA 2CLPA 2IMRA 3WDQA 4JYDA 2QDEA 2GGEA 3GU1A 1F6PA 4TQTA 3RFAA 3BAKA 4GPNA 4R9XA 2INFA 5EMJA 5KITA 3VIPA 4KETA 2Q8XA 3W72A 1P6BA 4PSRA 2OSWA 1XBXA 1FHLA 2UBPC 1AD1A 1TZZA 5C8BB 1XCFA 9XIAA 2WCAA 4ZXLA 1RZMA 3CWNA 1SJCA 3CQKA 4HCDA 4HYRA 4S2CA 1O5RA 2BY2A 3MUY1 1EJRC 4J5NA 4DYJA 2EJAA 1US0A 1JPDX 3BMXA 3OQEA 1UD6A 3H2OA 4W5UA 5D02A 3VNJA 1WDSA 5CZSA 3FA3A 3MP5A 1Q6OA 2BTMA 3HU7A 4MNKA 2H8ZA 1K77A 4LVGA 4IGNA 4QBXA 3L5LA 2CERA 1WP6A 5C2CA 4CQAA 1ZP3A 3MMDA 1TUXA 3N29A 1J6OA 1EFZA 3UG3A 1A5BA 4JNYA 2X7WA 3HG3A 3NYDA 1IXOA 2ZOXA 1JDAA 3PAOA 2YL8A 2ACRA 3SCQA 2OR2A 1EIXA 4GZEA 1WOAA 2DT3A 1O4UA 3ID7A 1IIHA 3QV7A 2VGGA 2CETA 4NP7A 2H3BA 3VNYA 1YXCA 4GVFA 3W23A 5BW6A 3PZQA 1OD8A 2VMFA 3N4FA 5AYBA 1EBHA 2YJQA 1CWYA 2Z6JA 4IPJA 3MUCA 3UPWA 2W6RA 2O7QA 2FZNA 1JXKA 4NAEB 1GYLA 3R79A 4W89A 3TQVA 1ZHAA 2VUYA 3P8JA 4EWJA 2RKXA 1V51A 4WSKA 4QEHA 3K4WA 4ML4A 1A3WA 4F0KA 2ISVA 1SJAA 1W9DM 3GVRA 3W86A 3WLLA 1KFJA 3LCXA 1HJSA 2C13A 2VX6A 3C86A 4UTHA 4PTWA 1EWEA 4GWEA 2QAPA 2VVSA 2WC3A 1OQFA 1ML1A 5A6BA 4Z1YA 2GGIA 3CAQA 5B80A 4PTXA 1KO0A 4OU1A 2WHMA 1TG7A 3BICA 3B0YA 1RD5A 1RY0A 3OB8A 1E72M 3PBVA 1BGAA 4FLSA 3GNRA 1FHUA 1OFRA 3TJIA 3WEOA 4A3QA 3UNDA 4H7CA 4JQAA 2XM2A 3RIKA 3AYTA 4JTHA 2VP8A 3LA4A 4XZHA 4O8AA 3S83A 4AWEA 1GYMA 2PTDA 3NGFA 4I7VA 5E5CA 5K2ZA 4NQ1A 4JS3A 3W27A 4ZA0A 1E0XA 3FNDA 4KWVA 5E9AA 3PJUA 4MJ4A 4GD0A 2CLEA 1R6WA 4B5VA 3LU2A 4QR6A 3UA3A 5CG7A 3UXAA 3IV8A 4N6FA 3E74A 1XFCA 5HJLA 4K1WA 5HWJA 1XXXA 1YE4A 2JALA 1KR0A 3G0UA 5ECVA 2ON3A 1QNOA 3O6AA 1PZ1A 1FWFC 2C8NA 4P8VA 5CC7A 3TIMA 2D73A 4MG4A 5GQBA 1Q8JA 4C7GA 2OEJA 3SCSA 3R58A 4WDXA 1JZ4A 4R27A 3BPWA 4JTIA 2E6AA 4MPKA 3URQA 1ZJIA 3OZMA 2ZRUA 2VCCA 3KDOA 4CD7A 1S3TC 4UNKA 5I3FA 1K8XA 4HA3A 2WQPA 4XSMA 4L6HA 3YPIA 4FZIA 1HL8A 1PX4A 2X8RA 3K30A 3KBMA 3UYIA 4IZGA 2DY3A 4GACA 1YIXA 3G1HA 4AMAA 1FUYA 3IANA 3V5FA 2FPYA 2CIPA 4J3VA 2IPJA 3B8WA 1G4EA 2ZICA 4PN2A 4QG9A 1OX4A 1UUOA 1TCMA 4JAWA 2RDXA 4GGBA 3KCJA 1EP1A 5F4XA 5CH9A 2XZ9A 3S46A 3FCPA 2YYUA 4DF1A 3N17A 1SZFA 2I5GA 3E0IA 1R85A 3O15A 3ONCA 4Y90A 5ABFA 1ADOA 3VGDA 5U4NA 1UWIA 3B9NA 2H90A 5CAHA 3F4WA 3ELFA 2TMDA 3Q58A 1GEHA 1OY0A 1OGGA 2WCGA 5GNYA 4GVHA 3WD4A 1K9DA 4F3HA 5FOOA 1ISYA 2YOCA 3M64A 5HOSA 2CZ5A 4NU7A 1UWRA 4K8GA 1XBVA 5K4ZA 2RUSA 1WXZA 1FHVA 2AGKA 1AK5A 3DG6A 5HNNA 1LRTA 4Q32A 3K8MA 2ESCA 3A4JA 1BXBA 2A7NA 3AIRA 1YNYA 3WK0A 4Y7EA 1A5LC 3KS5A 2X7VA 3G1XA 1EDTA 4LNCA 3TJXA 3MYOA 5CPQA 3CHEA 1JJKA 4BF7A 4ICCX 3GSMA 3UWQA 2ZA2A 4HU0A 3VKAA 1ENUA 2F6XA 3NQFA 1AD4A 1E5NA 3MT1A 4B15A 3W25A 1RK6A 4XKYA 1K6AA 3NEVA 5TQLA 3W75A 1PCWA 5IBXA 2XIBA 3FAXA 3NL6A 1O94A 4M24A 1DWIM 1UIOA 9RUBA 3U57A 2Z1KA 3ARTA 3FFSA 5G4WA 2BV9A 3BAYA 3GIYA 3CUGA 4AVFA 3B8UA 2IPWA 1RA0A 3R0UA 3STGA 3MA8A 4QDWA 4UFMA 3WNOA 3W2JA 3WNPA 1E3XA 2R8WA 2YDQA 3GTXA 4O0KA 3EXSA 3KOWA 4GY0A 5IXEA 1JDFA 2ZTJA 2ZUVA 4PUWA 3VVGA 3D0CA 1Q4NX 2OEMA 2IQ0A 1C8XA 1V02E 2F8QA 2PC4A 1JZ8A 2QNEA 3E0LA 1FTXA 4HNCA 2ZRWA 3CMGA 2IPFA 4A8IA 5EMMA 3F2DA 5I03A 5RUBA 1CGXA 2VD9A 1KFKA 3WSUA 3K4DA 3N3TA 2YBTA 4EP8C 2DZPA 3CYVA 3GYEA 1W5NA 3SCVA 2V8ZA 3UR2A 3CUZA 2DT1A 3ORWA 5A69A 3W88A 1KB3A 2J7CA 3FVMA 3GHRA 3LXAA 1M7XA 1Y8BA 2EQDA 1C8VA 2YB1A 1HP5A 2XH7A 2WZTA 1JDCA 3MHFA 3TVAA 4QRNA 3H23A 1OZQA 3V0TA 4ACZB 3LCWA 2H9AA 2C1IA 3U7VA 2NUYA 3LI0A 1ZRQA 1PTAA 1A5CA 4ZQOA 3S6TA 4EKJA 1GKRA 4OQVA 1M1BA 5G1MA 2GZXA 3SIZA 4CD8A 4YTSA 3LHYA 2DSZA 3H2FA 3POCA 1M5WA 3WMCA 3ZWSA 2EPKX 3ITGA 1FWIC 3HGJA 2WMGA 4GUFA 3UYCA 4ERGA 1H7PA 3UZJA 5LIWX 3BOXA 5EBAA 3FGCA 2AKZA 5XIAA 5HUOA 2OOFA 3OBEA 3CASA 2C0HA 1W1TA 1X98A 4KF1A 3W9ZA 3DU0A 3OVPA 3CO4A 2PMQA 3MQTA 1BTMA 4ZQCA 4M0XA 3WDRA 3LPOA 5JBDA 1F3XA 3FEQA 2JKEA 1KCLA 1PS9A 4POCA 2Y7DA 3WDPP 2WW5A 1NIUA 4CU6A 2W92A 1ECEA 2FMNA 1S1RA 2VC9A 3N19B 4REQB 3V5OA 2YSWA 4YHGA 5AC4A 4QROA 5CKSA 3BLFA 3NEHA 3P6LA 1WKDA 2WWDA 3UA4A 4PEEA 1D3CA 5CZTA 2CPUA 2WJEA 4LC6A 4RR4A 1OM0A 4QP0A 1U22A 1IEQA 1TWZA 1OZMA 1TTPA 3S2NA 2OYMA 1S2AA 3BG3A 1T8QA 4HZ7A 4WKAA 2VR4A 3DXIA 4QQ3A 5KSWA 4YIWA 1FFQA 2I57A 4DBSA 3CV2A 1XS2A 3ARVA 1BTCA 2ZA1A 1X39A 3TCEA 1EYEA 4WGHA 3NQ8A 4O8RA 3U7BA 1GPWA 4LVAA 1AFSA 3D47A 4HMNA 4MAVA 5IRPA 2FZBA 4BJHA 4DQWA 4ZE4A 3PUEA 2BOGX 2Q3OA 4RKAA 3BSHA 4JEQA 1BRLB 3OLIA 2OWXA 3UWWA 1W3LA 2E40A 3H53A 3WLOA 5E0CA 2J47A 2E8ZA 2BY0A 5BCAA 4JTKA 1JPHA 1TR1A 4TX8A 2WMKA 4ATLA 3LK6A 4OJYA 2VCBA 2ZXBA 1UHVA 2QXWA 1KGUA 1QOQA 4IGMA 4EK7A 4WHBA 3LZ3A 4S3AA 1E1CB 1O5QA 4DIAA 3R0DA 2FB3A 2J78A 2PDBA 3M46A 1JDDA 1Y7VA 5AKQA 3UGRA 2GPTA 1QI2A 4C7DA 2A6LA 2YXGA 4B5SA 1KBLA 1J2BA 1Y0EA 3PANA 2OFJA 3S2MA 4GI6A 2WANA 1EH9A 4GJ1A 3TYBA 1PSCA 1SM9A 4MNMA 2QMKA 4GI4A 4B90A 2ZZ2A 3SZ8A 2VQUA 2R1NA 5HR6A 3IARA 2ISFA 3MKKA 4LUYA 5D09A 1HW6A 4UQBA 3PZOA 3TJLA 4X60A 1JI2A 1PVNA 1IR2A 4MLJA 4RE0A 4NY2A 3KCLA 3DGRA 4GYPC 1OC7A 3W1NA 2HEJA 3WKZA 2GSEA 4JYEA 3MUAA 2BVYA 1MW2A 4RCXA 1A0DA 1VEPA 3MKCA 4NZ1A 1MW0A 4HYVA 3UU0A 3HGSA 3UZZA 2CLMA 3ALGA 1TZ9A 2ZRVA 3OIHA 1LT7A 2C0AA 2IKGA 1PWLA 2OLHA 3NYZA 3VMNA 1UPPA 3O0KA 1UR2A 1X38A 4JQ3A 3GH7A 5I24A 4CCCA 1QBAA 1XWYA 4DPPA 3W38A 3UJSA 4WJXA 4D6HA 3E3HA 2C79A 2NQZA 1W3KA 2WVSA 3ITTA 3LBOA 3BG5A 1H7NA 1DE5A 1RJQA 3PBUA 2PWDA 2OZ0A 3AALA 3G6MA 3T0BA 2PFHA 2J77A 1T40A 1BWVA 2W79A 2XIQA 2C7FA 3W7HA 4Q4RA 3A9IA 2QJJA 1R87A 3LCHA 3WQEA 3KZPA 2E4TA 2VGIA 3QVQA 4OBRA 1XYFA 4A3UA 1QNQA 4GYFA 3T2OA 4LAZA 5EMYA 3AWNA 4C6CA 3AOFA 4IP4A 1I6NA 3RLHA 2Y89A 1H3GA 3PY2A 1P6CA 1ZNNA 3SN4A 1H61A 3CH9A 5FD0A 7TAAA 3C2FA 3CQ0A 4FXFA 2CFFA 4HYWA 3AAMA 4KRUA 1J12A 4MYXA 4MZ1A 3V35A 3MKVA 1Q63A 1UC4A 2XHYA 1XG3A 2V5KA 1G4SA 5GPRA 1VR6A 2PGFA 3KVLA 1EC8A 4FHAA 3FX4A 3L2IA 2Z1VA 2PZ0A 5HQLA 4LOCA 5FJRA 3TKFA 1H7XA 4WIWA 3TA9A 5E09A 4PUKA 4ES4A 3BANA 1XSKA 3PAJA 1VKFA 4ZOCA 1OVDA 1F8MA 4C65A 1JYNA 1TWSA 1SMAA 4LUSB 4C5YA 1TFVA 1N8IA 5DO8A 1OG0A 4Q4OA 2FTPA 3WQ8A 3G1RA 3EWBX 1G7UA 3LENA 4C6PA 5A3HA 4US5A 2YCJA 4GZIA 1EWDA 3E6EA 5XINA 3UPMA 3WJXA 2IXUA 3MY9A 3V3WA 4PTDA 3O05A 3VKKA 3QHMA 2Y5JA 4F2TA 4M81A 1NFPA 2D2HA 1F4HA 2OKTA 3NG3A 4U5IA 4QCEA 1PYMA 3N3MA 2X0HA 5TBOA 3IWPA 3BCDA 1KXTA 3B0XA 1MQQA 2TSYA 1F3EA 2Q8ZA 3S6OA 3UD6A 4R7JA 3A23A 3L21A 3SUUA 3HG2A 2IXVA 2REQB 1NWTA 2F84A 3UZXA 1MVYA 2D0FA 3BAIA 1PTGA 3DI0A 3OZYA 4PMVA 4AIBA 4LS0A 3LLXA 2AOSA 3CHFA 4F9JA 2PUZA 1D7KA 3R89A 3UWUA 1YYAA 3OLGA 4U2ZA 5I3DA 1OCNA 1WBHA 1PXGA 3TNOA 3W74A 4LF2A 1E6NA 3WYZA 4JHMA 1ZJAA 2DZVA 3DG3A 1KM0A 3FA4A 3TQPA 4A8NA 1ITQA 2X40A 5CPMA 1FDZA 2J75A 4BEQA 3W7CA 4OT7A 1VPXA 3OPSA 3WBYA 2OZ8A 5BXPA 3ZJ6A 4MYAA 3EX6A 4MFDA 4RXGA 1GG0A 2QGHA 4IJRA 3ITYA 1MSSA 2YLAA 1XYZA 3VDHA 3R8GA 5K9DA 2DUAA 4DZIA 3PS7A 1PIFA 3M7WA 1PL9A 3SCUA 4UFJA 3W84A 3N2CA 3I4KA 2Y5SA 2GOKA 2BOFX 3EMZA 2Z00A 1OCJA 4GCXA 4GJIA 4E8GA 1JD9A 2NSOA 3L2LA 1P7TB 2GVEA 3AHYA 3MUXA 1CIUA 4QISA 1RY8A 3ITCA 3DH7A 1W91A 3WLPA 1QW7A 2JGQA 4IPPA 3IJ6A 3NPVA 4IQLA 4OHQA 4MSSA 1HJQA 1QK0A 1TV4A 3IVSA 2W66A 2OTDA 5AC6A 1GK8A 3KUMA 3ZJ8A 5AHNA 3RYSA 1MEIA 2FZ9A 1QK2A 5EY5A 1PZ0A 5B7ZA 1EXPA 4CEXC 4FP1A 2BHYA 1MEHA 2DT2A 2HNHA 4PTMA 4DXXA 1GJUA 1BFNA 2YA2A 1M41A 4IICA 5LA1A 3N15A 1G4TA 1LL4A 1I2PA 3ARPA 1VBHA 3D3FA 5K9CA 1QUMA 2A6NA 1Y5WA 3W7LA 3WDJA 1QT1A 3GDKA 4UR7A 3VGBA 3CTTA 3L66A 3N4AA 4HZ6A 3P0WA 1NJJA 3NOYA 2H8XA 5SWUA 1HJXA 1A0EA 3UG4A 3QMSA 1UJQA 4MPQA 3RCYA 5LNSA 1KKRA 2Y70A 4XZLX 3WBXA 3E1F1 3ALFA 4GVGA 2QUVA 2QEZA 1KGWA 4YL2A 4GZ7A 3HV9A 4IQJA 1XCWA 3RRAA 2XN1A 2NW0A 2Z1SA 3W83A 1RCQA 5K3VA 3E0VA 3U0HA 4BF5A 1ZBCA 4DJEC 4ASTA 2EPLX 3CQJA 4GIAA 4DHGA 5HULA 1TJ1A 4IP7A 4GHRA 4AWSA 4W84A 2P10A 1KA9F 3DAQA 3QOKA 3BLLA 4FS9A 3H22A 4AFYA 5M03A 2PGWA 3ZT6A 4AX6A 5AVNA 5D9PA 5CPOA 1KFBA 2P5NA 1UYQA 2UY4A 3A21A 3MS8A 2PWHA 1ZCOA 1OGBA 3MU7A 8XIMA 4ZO8A 1R9YA 3G5EA 4D9PA 4E8CA 4ZB5A 4WDTA 5EGRA 3GW0A 2VJXA 2TRSA 2VHLA 1M68A 2GQ8A 3LPFA 5HPOA 1ZL1A 4BEUA 3AIQA 2ZX5A 3AMKA 4Y8EA 4URIA 2QIIA 5D9OA 3GVWA 1HVQA 3GTFA 3AHTA 4TX6A 3S5SA 4DO7A 2INEA 1XSIA 2PAJA 3TZFA 4J27A 4XZNX 4S3EA 1VS1A 4IHCA 1ADSA 3AI0A 3URNA 1XX1A 3UCCA 1S5NA 2NQLA 4GQRA 1AQMA 3D3AA 2VL4A 5A6BD 3HMJG 2ZRZA 1WA3A 2I17A 3FA5A 3MZNA 3UZWA 1RP8A 2RJHA 4MFEA 4OV4A 4B2DD 3ZR6A 2E28A 2HROA 1W3JA 1JAKA 2WHJA 1XIHA 1XLCA 1YW1A 3EEGA 3MYPA 4HPHA 4LVBA 3EWZA 5CPSA 2FJKA 5FEXA 3S6DA 3EX1A 3WQCA 2A7PA 3AZSA 2D0HA 4GH1A 3UY7A 2ALDA 4LALA 1HX0A 1THFD 2BBFA 3CS2A 3W2UA 4OOUA 1XBYA 5A2AA 1P0NA 3SRFA 3H70A 3W7MA 3HZ3A 4QIUA 3PG8A 4Q7BA 1RBOB 4TMCA 2O7SA 4PR4A 3AS3A 4TXEA 3R25A 2CZEA 3KXQA 2PI6A 5AYIA 4JX4A 4AZ5A 1UUMA 1UZ4A 2V63A 4HGXA 5H2ZA 1DQUA 4JNMA 1FVPA 4M56A 3UJRA 5A8OA 3VINA 3PJXA 3HO8A 2HCVA 3GVQA 4GGHA 4PE8A 1XUZA 3RK8A 3R1ZA 2YW3A 4A3RA 2GK1A 2HXUA 3EWCA 3O6YX 2ZE0A 3MMWA 2YL5A 3G2GA 3MV01 1QW8A 1ZSXA 1WX0A 1JCNA 1EZ2A 5AC5A 4LCSA 4F4RA 2EJ1A 4JY8A 2ACSA 1HL9A 1M7OA 5ENLA 1OHLA 4YCOA 1VD6A 4PRWA 4L64A 4A3HA 4ZVJA 2QR6A 5F4WA 3BOLA 4MOZA 1VFHA 2WVVB 3P82A 3ARWA 2QPSA 4ZE5A 1CECA 5C5YA 4NI8A 3CL7A 5FF4A 4Z42C 3QN3A 1YX1A 4AD1A 3N6QA 4K7VA 3VOHA 1ZENA 3WQ6A 2J6VA 3E2VA 1QI4A 4IMDA 2PP1A 2EPHA 2WNWA 5I3KA 3WLTA 3T81A 4F0RA 2QV5A 2XISA 3BO9A 3WL1A 4YMZA 4BFAA 1EF3A 1DP0A 1JPKA 1FRBA 1TV2A 4L61A 3DKJA 1RALA 3L68A 2BVTA 2QCDB 2Y2WA 3ATZA 5K4XA 4GXPA 4KCWA 5C7VA 1G94A 4ZCWA 1MZHA 1M04A 5MKGA 2FDSA 4GIRA 1NU5A 1W0MA 1Q85A 3UT0A 5BU9A 1RAKA 5G1TA 4L6DA 1H0GA 2O4MA 3WBAA 4XAGA 4JCLA 1MO0A 1NSJA 4I9AA 4C6FA 1QDSA 3TR9A 3SJNA 5CQ1A 4DM1A 3VD4A 1TJPA 5C6MA 1QVBA 1NVMA 4O15A 3NL3A 2OZ3A 4AD2A 4TV5A 3NQEA 5HMDA 4GX8A 1B57A 1W8SA 3N12A 3LN3A 3P5ZA 3VFLA 4OBSA 1UG6A 2PLMA 1CXIA 4Z2JA 4J3SA 3KWSA 3N1AA 3K4AA 3V5CA 1SZGA 4IFRA 1PX8A 4Q6JA 4GH3A 1XC4A 3RX4A 1O6IA 4XUYA 2X1IA 4C6DA 5ABHA 1UP3A 4FNQA 2X1RA 4LS2A 1TCDA 3GB6A 5ABEA 4N0RA 3GC2A 2VFGA 4R3UA 4B9ZA 3HPAA 3BW3A 2FH8A 3E5PA 3GG7A 3P74A 1CGTA 1CGUA 3SADA 1R46A 3PBWA 1RA5A 4RL3A 3P5YA 1OSEA 3RM9A 1V6YA 1XYCA 3M5YA 1UPMB 2GJLA 4C91A 8XIAA 4J35A 4O53A 4JICA 3B3DA 1AQFA 1KRAC 4LBUA 4KKXA 3M7SA 1X96A 2V5JA 5F7UA 3QGKC 1XR2A 1F8IA 1E43A 3F5LA 2QGYA 4F0LA 4JFVA 4L9XA 1UP0A 2W5FA 4D8AA 4HU3A 2GUYA 3GR8A 3N18A 3IK4A 4HK6A 5DLCA 4X61A 3LNPA 1TUFA 1R3QA 1NTHA 4LCQA 2RJGA 2B7OA 1OFQA 8CGTA 1CXFA 1DJXA 4KEZA 4XZ9A 4NAFB 3ZS4A 1B1YA 2F9RA 3UW6A 3GAYA 2KX9A 1PO9A 1ZGDA 4QLLA 1DJGA 4BHYA 1JRBA 1G7VA 3FHQA 1PPIA 4KIEA 1UMLA 1FWGC 3RR4A 4XAZA 2ZA3A 1DOSA 3LG3A 4JTJA 4JDBA 1EGZA 1FH7A 3NFUA 1CENA 3NUKA 1BWKA 1QO2A 3BARA 3KTXA 4PMQA 3U4AA 2INZA 3N9SA 3OO2A 4LC8A 4HHMA 4KEUA 1LBFA 1XRSA 5LNWA 4JEJA 2V3GA 1TO3A 2PURA 1XH0A 1MFVA 3S5YA 4Q4PA 4L4LA 1RP9A 2OX1A 1DXIA 1GOWA 3S3GA 4DJDC 4O19A 4GYJA 1PX3A 4ATDA 3F5JA 2A3EA 1DHKA 3REQB 4EXQA 3THUA 1WKEA 3IUHA 2R1LA 1A5UA 2YW4A 4N9EA 2VOTA 2WKLA 3VK5A 4AVOA 1UD5A 4EAMA 1DVJA 3A3WA 1XLIA 1XISA 4J7RA 3H55A 1EGVA 3UERA 3DFNA 1FCUA 3M0YA 3VZZA 3BLKA 3U6WA 3AWOA 4ROPA 3TN6A 3W53A 2AKMA 3VOCA 1GUVA 4MB3A 3TV8A 3KL5A 4K8HA 1IWPA 4RDWA 2DW7A 4NF7A 3A6OA 1ESWA 1Z48A 1PDYA 2CHOA 1EC9A 3C0JA 3GYCA 4LF1A 1XLMA 2XH4A 4YJ5A 5LGZA 4IUOA 3WD1A 4AD3A 4K7YA 4GUGA 1I4NA 2GGJA 1R3YA 1WB0A 1LQAA 1H1NA 3USBA 3B8TA 4JIRA 2XIIA 5BU6A 1FQ0A 4W7UA 2W27A 3BZJA 3RX3A 5CG0A 2XFRA 3M07A 4O50A 2X05A 1M53A 2ZE3A 3I68A 2DDXA 3CQIA 1VB9A 1JGIA 1MFUA 3R8HA 2WSRA 4IPIA 2J7EA 4E38A 4ACYA 1MEWA 4Y9NA 2DPEA 3VE9A 4YWSA 2R9RA 4JCMA 4JXCA 4DYKA 3VGFA 4GLEA 2WZMA 1VLWA 3K1DA 5D32A 1EUNA 3FVDA 1E4NA 2VGBA 5D37A 4Y8FA 4NJGA 3N11A 3LI1A 5F2LA 2F6KA 3INPA 1Q6RA 4YNGA 1N55A 3DX5A 3M0XA 2CLKA 3FYYA 3VMPA 4DJFD 3T0CA 3EB3A 4M1RA 3KRBA 1HGYA 4C1NA 4X63A 2XFWA 3OP2A 3HBLA 2J7DA 2G3MA 4QAIA 1DTNA 1E51A 3SN0A 2BGNE 2J27A 5I78A 5FJIA 3KW3A 1XBZA 1AZ2A 5D33A 4LQ1A 2X1TA 1SU5A 4OZOA 2DJLA 1WDRA 4ERIA 5TAOA 1KXHA 3AICA 3WELA 4CN4A 4K8EA 1VJZA 3LXBA 1Q2RA 2RFGA 1DXFA 1WZKA 2JIEA 3BQ6A 3CZGA 5B7YA 1S2TA 1XLHA 1Q6QA 1GZGA 4GFSA 4IFOA 3TW7A 4RNFA 4LV4A 1DWAM 1OYBA 5AC7A 4CVUA 3QKEA 4DWSB 3NQGA 3FXYA 4HOWA 2WK2A 1EL3A 4EXAA 4EPDC 4LU0A 2R1PA 3VD3A 3V0SA 4TUFA 1OEPA 2KZHA 1XINA 3LTPA 5E1QA 4FI4A 3DEQA 1NFGA 4IJCA 4WCJA 4IIEA 2JEPA 3QR1A 1WYIA 3SY8A 3IIPA 2DZBA 1M3UA 5DBUA 4Z1AA 1UH2A 4JTUA 3THCA 4ADTA 4Y9AA 1HFBA 3VD7A 2PF0A 1FKXA 4JTLA 4YTTA 4J9JA 1JNDA 4Z1BA 3SAZA 4M51A 1X1OA 2DUXA 5G2HA 1KR1A 1KRBC 3G6LA 3QOMA 3IK2A 4H9ZA 1XGEA 2PLCA 1OFOA 1EHNA 5CEWA 2FJUB 1YBQB 1ELSA 3BLPX 5M17A 1FBAA 3CC1A 5BZAA 1OFAA 2DSWA 2CEQA 3HPXA 3SGGA 2WQDA 5FF0A 3S9IA 1PJ9A 5A6JA 5LIKX 3KP0A 5FJJA 1PV8A 5C7HA 3DYOA 1YLVA 5CGQA 1E3ZA 2J4GA 4F2UA 1ZP4A 2VFFA 1UZHA 3AYVA 1OWQA 1NAL1 7PTDA 4LUTA 5HR7A 2JQXA 1E71M 1XYAA 5EMKA 3FAWA 4AC7C 3WH5A 5FJPA 1RLCL 3NJ3A 1DWHM 4H9VA 4US5D 3W6LA 4AWUA 3RPTA 2C71A 3ZT7A 1W31A 1DJHA 1IGWA 4FNRA 1KLYA 2C15A 2RAGA 1JI1A 2I16A 2OWWA 3GZAA 2DH2A 3W3OA 4KWUA 3A47A 3JZUA 4AUBA 2YXOA 5I3JA 2DSVA 3BW4A 1GG1A 1PKYA 4JN6A 1BAGA 1B3OA 4HSNA 3TXZA 3EB4A 4H6RA 4Q33A 3S47A 4GZJA 2FZMA 1A4LA 3GDLA 5REQA 1HTIA 3TNBA 3NVDA 4DPQA 4HQVA 1H7OA 4NZCA 5KETA 1CXLA 2FTWA 2PWEA 1C90A 2Z0IA 4B9YA 2V2DA 2Y24A 2D1ZA 4O0ZA 3PUDA 3MC5A 4H7VA 3MVIA 4DN1A 4V27A 3ENLA 4DM2A 3TLLA 4FPSA 3PUOA 3LEPA 1M7JA 4I6VA 4QXIA 4D6FA 2GVLA 1BLIA 1LRQA 4QSHA 4C7FA 2EPNA 1TQXA 1K9FA 4YWIA 4K39A 4DI9A 3MUIA 2VFEA 3OEXA 3H7RA 2XJ7A 5LIXX 1W9VA 4LTSA 4UNIA 2E6YA 4NZ3A 2SFPA 3KBWA 1QPRA 1RCOB 3VPLA 1P6WA 4RZ4A 1C7TA 4I9JA 3PFMA 5C9RA 1PBGA 1JGMA 3DUGA 2CLIA 3ZJ7A 3T0AA 3ZQ9A 4PMJA 2HV5A 1FWAC 4GQ0A 4HHPA 1AMKA 1OINA 2GJXA 3PB2A 2R1KA 3W6MA 1B4EA 2XVKA 2O4QA 5BMXA 1R5YA 1E0TA 4C5ZA 4XD6A 3W1XA 3BW2A 2B4GA 1V6TA 2Z1XA 1GZ1A 1ME7A 2QDHA 3AZRA 4H19A 3OBKA 4R7OA 1ADDA 1W5QA 3SQMA 5LHFA 4PCTA 1ISVA 5A8PA 4JFUA 2PDPA 4JFTA 2PDGA 2FGBA 1GONA 3FN9A 3NQ6A 4WXZA 5EYWA 2A3AA 4S3CA 1Z42A 4MDPA 1EJTC 3C3NA 4KFPA 2GJRA 4AEOA 1OG6A 5F2GA 1KBIA 2Y7FA 3L4TA 5BOOA 3M5ZA 1MW1A 5A2BA 1R47A 3KX6A 3GUGA 1OF6A 1D8WA 1B31A 4ZOEA 1A5MC 1MW3A 3APYA 3ZLHA 4DJEA 5I5RA 4DI8A 3FEMA 2W61A 3E38A 1IYXA 1N2VA 3E9AA 3G0XA 1X6LA 1H49A 2VR2A 1XH2A 5FEZA 1T5AA 4AISA 5LA2A 4OUIA 4L9ZA 2VUNA 4BKNA 1S5WA 2RGLA 1IR1A 3NSNA 1E56A 1AL7A 3RLVA 3W37A 4OFCA 2DZUA 3PZ9A 3GBEA 1JF6A 3TC6A 4K6AA 3BDKA 2OO6A 5LZLA 3KTSA 4HA1A 3LV5A 4RW5A 1GQJA 1RV8A 5M1TA 4HU4A 4M5PA 1DQWA 1NFBA 4B5NA 5H8PA 1C8QA 3CB8A 3KVMA 5DFAA 3C6CA 3KE0A 4FNPA 1A5KC 1E0UA 2OODA 1DWFM 4C6LA 1V6XA 2Z2AA 5HJYA 3NQDA 2XUCA 1Q5MA 3BVJA 4L5ZA 3VIKA 3OU8A 1CCWB 2AGTA 4TU1A 1XG4A 3QY7A 2WVUA 3SJ3A 2GUBA 4O13A 1LBMA 3AUOA 3G8EA 1KD0A 3BC9A 2OWCA 2Q8LA 2H6RA 1RCXB 4JFSA 3QPZA 3BQ5A 4JZ5A 4M6PA 2EPOA 3B0PA 1WPCA 3L65A 2CZFA 3VIMA 2OELA 1EJUC 4B5UA 1KCZA 3ES7A 3ABZA 1DL3A 4AZ6A 3GK0A 2ABAA 1OB0A 4I8YA 2DVXA 4ZR8A 3O9NA 4L1XA 3IACA 3EDFA 1MZRA 3WD2A 2H3DA 3HTWA 4FNSA 2Y88A 2Z28A 4OUEA 2G41A 3SURA 1QTWA 4AIUA 3AO0A 5TIMA 5J5RA 1TV3A 4I5RA 4HPGA 1B2YA 3WDHA 1F6YA 3GC5A 4PL1A 1FY6A 4X22A 4EIVA 4JIIX 1GVOA 3B04A 1OK6A 3K5XA 4EPBC 1AODA 2ZUUA 3OGSA 1XSJA 4HZ8A 3UG8A 2OQYA 3KBNA 2Z24A 4AAJA 3EZ4A 1C3FA 1P0KA 4J28A 2Y61A 3NNTA 3NL2A 5AHFA 2DU2A 4RE3A 4PUUA 5J04A 4GE8A 2QCCA 3TK7A 4D6GA 1JEZA 2EG6A 3R4IA 3NZGA 2ZDRA 2GDVA 3KRZA 2PF8A 1V0NA 3P61A 5HMSA 2OYLA 3WLQA 2VC5A 4FLRA 3QV6A 2VELA 2GFTA 3AMDA 3CWOX 1PZ3A 4RUBA 3R94A 2ZX8A 3MJMA 3EYPA 5FJUA 2AL2B 1K1DA 1J96A 2G5WA 4XK2A 3S42A 1Z41A 3HF3A 1TTJA 3AXMA 3FLUA 1PZ2A 1FDYA 7REQB 3IUDA 4D1IA 2FHBA 4DELA 1U2YA 3KRUA 1FWCC 5HINA 2TYSA 4LW7A 4H8UA 1DJIA 1TIMA 1VFOA 4P2VA 4O52A 1GTEA 3G1VA 3JU2A 4ZQNA 3T78A 5I07A 2X30A 1UZDA 4C6KA 3VIOA 1I45A 4PH6A 1YE6A 3QFWA 2NUWA 3B4YA 3MP4A 4O1EA 3VX0A 1EP3A 4A2RA 4ZEPA 1GKQA 2Z1WA 4DWSC 4IFKA 3M1ZA 2E0PA 4MWAC 3MI3A 3SFW<