3LYEA

Crystal structure of oxaloacetate acetylhydrolase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
293
structure length
285
Chain Sequence
b'EPFSGAKKLRHLLENTDELIVCPGVYDGLSARTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDPFGPPLIADMDTGYGGPIMVARTVEHYIRSGVAGAHLEDQILTKKVVSRDEYLVRIRAAVATKRRLRSDFVLIARTDALQSLGYEECIERLRAARDEGADVGLLEGFRSKEQAAAAVAALAPWPLLLNSVENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHGVVGTPDGITPVRLFEVCGLQDAMEVDNGAGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxaloacetate acetyl hydrolase
publication title Structure of oxalacetate acetylhydrolase, a virulence factor of the chestnut blight fungus.
pubmed doi rcsb
source organism Cryphonectria parasitica
molecule tags Hydrolase
total genus 102
structure length 285
sequence length 293
ec nomenclature ec 3.7.1.1: Oxaloacetase.
pdb deposition date 2010-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3lyeA00
2DIKA 4KRZA 2ZE3A 4L7ZA 1F8MA 3N25A 3R4IA 4FXFA 5TAOA 1A49A 1IZCA 1OQFA 3MA8A 2XDFA 1E0TA 3SRKA 4QG9A 2HWGA 1F3XA 4KCVA 4QGCA 3M0KA 4DRSA 3SRHA 1OY0A 3QQWA 4YNGA 4TV6A 1PKMA 1KBLA 2VGIA 2DUAA 3QZ6A 2BG5A 4QG8A 1M3UA 4WJ8A 1F61A 4B5TA 3QTGA 3GG8A 3H6OA 3LYEA 2HRWA 1Z6KA 3B8IA 1VBHA 2V5JA 4IP7A 4YJ5A 2VWSA 2VGFA 1AQFA 1A3XA 4B5XA 4KCWA 3EOOA 3OYXA 1KC7A 4IQEA 2KX9A 3U2ZA 1M1BA 1PKYA 1MUMA 2VGGA 4B5UA 1A3WA 1DIKA 4MF4A 4L9YA 4MG4A 1F3WA 1U5HA 2VWTA 4FXJA 4HYWA 1VBGA 3OYZA 4B5SA 1DXEA 3EZ4A 2R82A 3PP7A 3HQPA 1E0UA 3E0VA 1O66A 4B5WA 3LG3A 1T5AA 4ROQA 3KTXA 3QV7A 1S2TA 4QG6A 3VAVA 1GGOA 1PKNA 3QV6A 3IS4A 4IQDA 2HROA 1DXFA 3QV9A 2XZ7A 4L80A 3FA3A 1ZJHA 3BJFA 2V5KA 2L5HA 1XG3A 3GQYA 3M0JA 1DQUA 3I4EA 2X0SA 2QIWA 1U5VA 2VGBA 3OQ8A 4RPPA 3SRDA 3QV8A 1F8IA 2XZ9A 4L9ZA 1JDEA 3T07A 4HYVA 4KCUA 2E28A 4B2DA 3ME3A 3E5BA 3HQNA 3KHDA 4B2DD 3G2GA 3FA4A 3BJTA 1S2UA 3HQOA 3QLLA 1PKLA 4KCTA 2G50A 3P0XA 1A5UA 1UJQA 4TV5A 2WQDA 4B5VA 1XG4A 4JPGA 4LSBA 1S2VA 3EOLA 1O68A 3E0WA 3T0TA 4G1NA 1SGJA 2HJPA 1ZLPA 3GR4A 4IMAA 3T05A 4KS0A 3PUGA 1IGWA 3EOEA 3SRFA 1O5QA 1PYMA 1S2WA 2OLSA 5JVLA
chains in the Genus database with same CATH superfamily
2YJQA 3AYSA 4HSOA 1UWSA 4I5UA 4DRSA 3C2OA 3QSTA 2VZOA 4BJHA 5A5WA 1Q6EA 5L9FA 3SB0A 2QUUA 4X0VA 2C1IA 2BX7A 2QCDA 5EB8A 4GFSA 3UG3A 2J7EA 3IGXA 3ARPA 3ITXA 3WNLA 3K1GA 5C9RA 5IXEA 3MWAA 4EK7A 4GD0A 4HSNA 4NY2A 4O12A 3WD0A 4Y8FA 3OZYA 1P1XA 2ABBA 7CGTA 3II1A 1IXOA 1QASA 1VKFA 3B0UX 1C8VA 3MKKA 4NJIA 5M2FX 4J27A 4AB4A 4I7UA 2I7GA 4UTLA 1Q6RA 2FDSA 3B05A 2KAUC 1CXEA 4RDWA 4R7WA 3GG7A 2TSYA 4V27A 1L2UA 1OFEA 3NYZA 2XVLA 1MO0A 1P1MA 2XVGA 3CS2A 3F5JA 1BWLA 3HO8A 3PZOA 1FP8A 5E70A 1QVBA 3QGKC 1X6LA 3R12A 3CZJA 4UFHA 3WBYA 3LERA 4DF2A 4QJ4B 2DUZA 5CQ1A 3BMVA 4XB3A 4ZR8A 2ZA1A 1JDCA 4ATWA 1LQ2A 3BW2A 4HA3A 3LRLA 2FZDA 3W2MA 3NYDA 4K37A 4H2HA 1PYMA 3EOEA 1VJSA 4WZHA 2Y6ZA 5FKYA 4B4FA 1R46A 3A64A 1S2CA 3V3WA 2HCVA 1KCZA 4KBXA 3OOQA 4MFDA 4DO6A 5DX7A 3LCGA 2DJLA 1OY0A 3U2OA 1C93A 3A3XA 3WLQA 2DVXA 1QPKA 1KWKA 4UWMA 3CQHA 2EKGA 4O8AA 4FNPA 2PDWA 1KB3A 2AGKA 4RV3A 4E8CA 4E2DA 1ZSXA 4U2ZA 1Z48A 3WLNA 3ZO9A 1X97A 1H51A 1I9CB 1V51A 4CQAA 4TVUA 3FXYA 1OFQA 1AW1A 3M0XA 3SR7A 1JCJA 1LQAA 1FFRA 1QNPA 1OIMA 3LXCA 4AEOA 4Q8TA 1ZPTA 1DJYA 4TUFA 2PTDA 1A5NC 4JN7A 1LQ0A 1LOQA 2PTZA 5FF0A 2O4QA 2J79A 4V33A 1EJSC 3W23A 3SGZA 1KLZA 1SZNA 3N2MA 1PZ1A 3AZRA 3PJTA 3PTQA 1M9HA 4AXKA 4BI6A 1WZKA 2B0MA 4YHGA 1S5VA 1EUNA 3RLVA 4K2SA 3NQ8A 1LLZA 2Y70A 1NDVA 5DXXA 1G6CA 3T9PA 3P60A 2YCEA 5I78A 1MSSA 5ABTA 1ISYA 3SRHA 3I3BA 3S6TA 1QW7A 1YNQA 2WHJA 1XFBA 4M1BA 1YTEA 4ICCX 3H4XA 5DMMA 1JF5A 1VS1A 3QRHA 4MIMA 1FCQA 2Q3OA 1WCGA 3VDCA 3P3BA 1US0A 4UFLA 1DJWA 3TNOA 3QSRA 3AHZA 3MJYA 1SFLA 1LBMA 3WK0A 2D73A 1C8XA 5EGRA 1U5HA 4NZJA 5D37A 3UEQA 3IIVA 1E6XM 3CHVA 3F5LA 3LBCA 3BQ6A 4ZO6A 4HVXA 1SO4A 4JIQA 3BAKA 1H7PA 3N9RA 3WLRA 2FFCA 4GWEA 4DYKA 4B3ZA 3M5ZA 1XSIA 3WIJA 2PRMA 3QHMA 3H53A 4B9YA 1I2QA 3DHFA 1B3OA 4XBSA 3BSHA 4K8EA 1TJPA 5I0DA 1KCKA 3TQVA 1LOLA 2W3ZA 3WUBA 4D6HA 1Z3NA 3T1GA 3MMWA 4A2SA 3S1WA 1QCWA 5B7ZA 1UR3M 1LRQA 4K38A 2VZUA 1ZAHA 1R3TA 4PUMA 3SCTA 4V28A 5A6SA 2WSRA 4GMEA 2VR5A 1N8WA 4IUOA 3GIYA 3OIXA 4HU8A 5LZLA 4W7WA 2IQTA 3BXWA 5HQMA 1TKKA 2OO0A 3PTKA 5LIXX 2Q71A 4CQBA 1F3TA 2J8FA 4L4PA 1EHNA 3L4XA 1YX1A 1KC7A 2VC6A 1O94A 2OZ3A 1XLJA 3B9OA 4JD4A 2REQA 2J74A 4EAMA 1KV8A 4XUGA 4E4FA 1XW8A 5LIKX 2X1RA 3M46A 1PWMA 4JYDA 3TH6A 4WSKA 3LGGA 4MJZA 1T0OA 2GGEA 2QUTA 4IX0A 4IMEA 3W84A 2PDXA 3I6TA 2AKMA 4MWAB 4I9TA 1V8EA 3NSMA 1FWGC 5T8GA 1XQKA 2DZTA 1PKNA 4JICA 3URNA 1P7TB 1CZ1A 5CC7A 2VX5A 4GCXA 2X0SA 1R3QA 4MDPA 2I5IA 4L9ZA 1UG6A 1EYWA 3W26A 1U83A 2WC4A 4YLWA 1B3ZA 1PZ0A 4FF5A 3E0LA 1EF2A 4AWTA 3UZWA 2WQDA 3JRKA 5KMYA 4J3XA 4AUBA 2PDCA 2WANA 3K8KA 2GGHA 1NM9A 2CC0A 4JTIA 2VEMA 4MM1A 1JCTA 4L7ZA 3LZ5A 3SCUA 1Q6FA 3WD4A 3TFCA 3VGEA 1DWIM 5BCAA 1Q4NX 3W1TA 1AODA 3KVKA 1BTMA 3CV1A 3M0KA 1K4GA 1KM0A 4XTDA 1ICPA 4D6DA 4NZ5A 4AZ5A 1B30A 2EGZA 4PEKA 1X39A 3W2LA 1WV2A 3V16A 1MYRA 2VR4A 1J0HA 1LWHA 1P6WA 4MB5A 3M41A 2YBUA 3IJ6A 4NZ4A 3ORWA 1XXXA 3MQTA 3WUFA 3HFTA 2OXNA 1YDOA 2PLMA 4XAYA 4LNYA 4DF0A 1FWIC 1EJVC 1JXKA 4D6GA 5GPRA 5M1TA 4CKQA 4FMVA 5HK4A 3WD3A 3FHQA 5SWUA 4DYEA 3UPMA 2O9TA 4BR1A 4CQ9A 2BVDA 1W56A 5HATA 4N9CA 1VH7A 3M0IA 1N82A 3WDIA 2EPKX 4LY4A 3ONCA 1OZQA 1Z42A 4K8GA 4O1DA 3W74A 1R9ZA 1KXHA 3DYPA 3WFAA 1NWTA 4JL1A 5CG7A 1HFBA 2H8ZA 4CNOA 1UJQA 3EWDA 5G4HC 1ZENA 5LSMA 3RCMA 1B3WA 5C9WA 1AZ1A 3LNPA 2CLEA 2W62A 2VXNA 3GG0A 1V6WA 3NVTA 1XLFA 4AU0A 5AC4A 3RDKA 3GR4A 5EA9A 3G1AA 2BVTA 4RNJA 3BOLA 1E4LA 4PCNA 4YTSA 1X38A 4F4RA 5A6MA 4IT1A 3DFHA 3VIOA 3L21A 4HZ6A 3NL5A 4IM4A 2R1PA 1QBAA 2DPEA 3AJ7A 1VJIA 3KZPA 3TSBA 4IFKA 3EOUA 3U57A 4JCMA 1HIZA 3WELA 1W32A 4WJ8A 3PG8A 3AYTA 2R1MA 4O1AA 1V3HA 3MMDA 4F79A 4RZBA 4MWAC 1A3XA 5CGQA 5HXMA 4W93A 1GK8A 1XC6A 1VB9A 2H9AB 4H01A 4HU0A 3AMGA 1FRBA 2BV9A 1SZGA 1EH9A 3EA1A 5K4XA 1HUVA 3VGFA 2QPXA 4HMCA 4LXFA 2DQWA 4KEMA 3S83A 1MI3A 2ATSA 3W86A 4YN5A 4FA3A 4GIRA 3M7SA 1JAKA 2G96A 6ALDA 3TU9A 2YPIA 3NZ1A 2P8CA 3AHTA 1R7OA 3UF9A 3GQYA 3KRBA 4IUGA 3PZUA 3NEHA 3AIUA 1UKSA 1GPWA 1DV7A 3B8DA 1J2WA 5LHEA 2GJLA 4F0RA 4INFA 2NQLA 1LYXA 2Y8KA 4AZ6A 4OFCA 3HPFA 4C6JA 4LOCA 1KFLA 5EMMA 3M9YA 3EWWA 2YCIX 3ZXWA 1EP1A 2IKHA 1MW2A 1TZ7A 2QUNA 4ZFCA 4QTGA 1KGUA 1MQQA 4IJCA 3ZVIA 4IP5A 3E5PA 1UR9A 2WWCA 3D46A 4LRSA 2PP1A 4Q4KA 4AIEA 1TQXA 3SY8A 4ZB2A 1F3EA 2DZPA 4LT9A 2G41A 4U5IA 3N9SA 1E5JA 4LCQA 1U5JA 2UZ9A 1F61A 2XSBA 2YR1A 3E2VA 1CNVA 1RPXA 2IPFA 2CBVA 5FSDC 1Z6KA 4ATLA 1SJCA 4HN8A 1UPMB 4JTJA 3F7JA 1TWSA 4BHYA 1W1PA 4E38A 5LKYA 1J9YA 3L4YA 4BWLA 3GKAA 3URQA 3NEVA 3EWUA 1C90A 4HCDA 3W2KA 3GR7A 3LOTA 1GW9A 4FSAA 4RZ5A 1GHSA 1IEVA 5EFFA 4R3UA 3TZNA 2G5WA 1DIDA 2IUZA 4ZOBA 3KOWA 3QW3A 4AD1A 3MCMA 1VHNA 1XIJA 4ECLA 4RR4A 5FJPA 2PRLA 5DMLA 3QV8A 1FH8A 4GI8A 1CDGA 3O8AA 2XGZA 4J3SA 5CSSA 4K7YA 3RUBL 3I10A 3QKZA 2TAAA 2ZZ7A 4Q4OA 1G4TA 1DJZA 4KWUA 2F2HA 3EWBX 3WLIA 2NZLA 3TIMA 1B4KA 2PDHA 3OBAA 3IIZA 4NX0A 3PANA 2F38A 3TROA 2BVWA 2DZWA 1LF1A 4H7VA 3LPPA 2XH0A 1ICQA 1LBLA 1T6MA 2ZYFA 2IS7A 3WO8A 3NL2A 4I7WA 5EMYA 3G1HA 3S46A 4MPKA 2QDGA 4B91A 2JGQA 3NQFA 1UH2A 3CMJA 3M07A 4YJ5A 4QLLA 3QJAA 1W5MA 3FIGA 1UZHA 3DFOA 4NAEB 3BLFA 3F2BA 2WZIA 1VBRA 3FY1A 3FDGA 2V5DA 2QVNA 3PZVA 3AXMA 2PDGA 1TTIA 2ZRYA 4LX4A 1FP9A 5AYBA 1BF6A 3U48A 1OF8A 3FAWA 1OCJA 3M5YA 3UERA 2FJUB 1G4EA 1OIFA 3ABXA 1I0DA 2R8WA 4HPGA 1SZEA 4GVIA 1EJRC 5J5DA 5I07A 3LLFA 4WY0B 4TV5A 3SY5A 1WPCA 2FHBA 5HOSA 3G0XA 1XH1A 2XIQA 3A12A 4GXMA 1I8JA 3UR2A 1W5OA 3KP0A 4A35A 4H19A 1UWTA 4TVCA 4JTGA 2ODOA 3NO5A 3EDDA 3IVTA 3QPEA 4H7ZA 5I77A 3W82A 2QULA 1XLHA 3PJUA 3KBVA 3OQEA 1A49A 5DLCA 1BQGA 3LPGA 3H2FA 3TCEA 4DBWA 1Q7QA 2YB4A 3G1VA 2WM0A 1TTPA 3EXSA 1B31A 1KFWA 1W9XA 4PCPA 4M29A 3SCWA 3QTGA 1LLOA 1YDYA 4J2MA 3T09A 4WDXA 1W5QA 1XUZA 4C6MA 5KITA 2YDQA 4AX7A 1J10A 3FW6A 1KD0A 2P3EA 4IOTA 1ME8A 3TLLA 2F8QA 1GOQA 3W27A 4A2RA 1IWPA 1PIFA 5XIAA 1B90A 2XIMA 1ZBCA 4DX3A 2FIQA 2XN1A 1AJZA 3GVWA 4UCFA 3VE9A 5HAOA 3LM7A 3BGJA 4E3VA 3XIMA 4J4KA 5D9MA 2FZ8A 3B03A 4UFKA 2E0PA 1RHCA 1JUBA 4HP5A 3WQDA 4Z2KA 1TMQA 1V03A 3PG9A 2NUYA 5REQA 2XZ9A 3W81A 1FCVA 4KCUA 1JFXA 5I03A 1ZTVA 1EEXA 3S6DA 2WCGA 4XZHA 3MUAA 3JS3A 4ERIA 4ADTA 1O68A 2INEA 1SGJA 3NTYA 1E9IA 1BSLA 1RP8A 5KZMA 4TIMA 3NGFA 1O5XA 1ZP4A 2C13A 3I4KA 4WY0F 1POKA 4C60A 4LB4A 5F2GA 4HNTA 3WLMA 4C6BA 1I2OA 2FTWA 1L6FA 4XD4A 3N17A 3T8QA 3UWVA 3WBXA 4JS3A 2Y24A 3HOJA 2FVLA 5FJIA 2VFEA 3THDA 1RQBA 1V3MA 1IEQA 5LA1A 3C2FA 3NJ3A 1VQTA 4QAWA 3KS6A 1JYWA 1GZ1A 2Y8UA 2GSHA 1WDQA 3WQVA 4C91A 1UR4A 1QNRA 3PJWA 2V2HA 1GVIA 3QZEA 3WZ0E 5BOOA 4NNBA 5FJOA 3VX0A 4DVOA 2QNEA 4NL1A 3W73A 2OX1A 2D3NA 1PO9A 1CEOA 2IKJA 3WL0A 2J27A 2ZZ4A 1IGSA 3CAVA 5GQBA 1IIGA 4Q7NA 2CZFA 3G1XA 2NLYA 4JAWA 4PULA 3WSUA 1H7NA 2QAPA 2V5KA 3NQAA 5FOOA 3ARTA 5T26A 1MXSA 3M16A 2F61A 5ABHA 3FKKA 1NAL1 2QS8A 4WGHA 1T41A 3WQEA 4IMDA 3RNDA 5K9DA 4LAMA 4FIRA 1F5ZA 1EJUC 3OGSA 4AX6A 4L61A 1W3TA 4AW7A 3K4WA 1KBBA 3KUMA 1TVLA 4ATDA 1G5AA 2VEFA 1RVKA 3OHIA 1FCUA 3R0UA 1WKFA 1SJAA 1BYBA 2ZTKA 2GJRA 2HS6A 1E0TA 3RN6A 1KXQA 4JX5A 2VP8A 2BY2A 3OA3A 4D71A 3CU2A 3B9DA 4MJ4A 4XTIA 5E9XA 4H2CA 4QG8A 1MFUA 3GX9A 4D72A 1M68A 4PUJA 4AVFA 2Y0FA 4F9JA 2ZBTA 4GQQA 2FVMA 3AMDA 3R11A 4GISA 1TWIA 4C90A 1NWSA 3GKFA 1XBXA 1XSKA 1O6IA 1JJKA 2Z4GA 5D09A 3RLGA 3WLLA 2W4XA 4BF7A 3EX1A 1UC4A 5E5CA 3ABQA 1A5OC 4HMDA 5D04C 4ACZA 4QJ3B 2DZAA 3W1NA 4GYJA 4DO7A 2FH8A 4B16A 1KM5A 3WENA 3DHUA 1JDFA 4OOUA 3G18A 1KM1A 3KOZA 4EACA 1IR1A 3TQKA 4NJHA 4LVAA 2CCRA 4OZOA 3BTNA 2OSYA 5D33A 2VUYA 3L4UA 2RDWA 4UOQA 2VJXA 3S2NA 2QJIA 3H23A 3VMPA 6TAAA 3QR3A 5BWFA 5MF5A 5K2ZA 4RE3A 3RPDA 4M82A 2I9EA 1BLIA 3UJEA 2WK2A 3TN5A 1ECEA 2JKPA 2VVSA 1E6NA 3AHXA 1ONEA 1PWLA 3MCOA 2A2IA 3WD2A 4QGCA 3T08A 1PIIA 5C7HA 2JKAA 2X40A 3TQ0A 3LD5A 4ZA0A 1OADA 2DT1A 4JKLA 5C9UA 1K7XA 3SSZA 1CI1A 2BGNE 3W6MA 3NXFA 3CAQA 4OJYA 1XFCA 4PMYA 1SSDA 3F4WA 1KXTA 4FPSA 3VC6A 2BDQA 4MG4A 5IHSA 1EJ7L 3EMCA 4MMWA 3N2TA 4JKMA 1XJBA 3TUUA 2TPSA 5FEZA 4PRWA 5CGTA 1PUDA 3B8WA 2CPUA 3LZ3A 3GXIA 1A0EA 1UUMA 4IICA 3Q65A 1OZMA 4KWWA 3NZQA 1XCWA 3T4CA 4AHOA 4XZIA 2VOTA 4F0SA 2VCCA 1X8CA 2NV2A 4KIEA 4MZ8A 3B8TA 1L9WA 4GBDA 1F05A 3E1F1 1UBSA 4LAUA 1QXLA 2OMAA 2WNZA 4GC4A 2YBTA 4MNJA 1E56A 3F4CA 2Q8XA 5DELA 1SM9A 3W87A 4F0KA 1MW3A 3P8JA 1FA2A 3VGHA 2GSJA 2Y62A 1G67A 1HKKA 1E40A 3OGRA 3OIHA 1Q6LA 2HBXA 1NWRA 3A4JA 1XKYA 1V6UA 3C3NA 3DKJA 3GXTA 4REQA 4AZCA 2WCAA 5BXPA 3ITVA 1NDWA 1PZ2A 8TIMA 4LV4A 4QISA 4AIOA 1N2VA 4XUYA 5CPSA 3FN9A 3TNBA 3Q67A 4D6IA 3QHOA 3DHPA 3N4AA 1ZJIA 1E6PA 4BKNA 3BAJA 3OLDA 5U7SA 2VWTA 3MUXA 4HYWA 1XS2A 8RUCA 3AIEA 1NY1A 1M04A 3GNNA 4U28A 2X1TA 1JPKA 4AZIA 1GGOA 4JIRA 4C6DA 3LU2A 2Z6IA 2FZBA 7A3HA 1AH0A 4MY1A 4EP8C 5GVJA 3I3EA 1R3WA 3CMFA 1FHUA 3E49A 4TTGA 2OLAA 2BHUA 2TYSA 4S3KA 3W72A 2X1UA 4M6PA 3MUY1 3DC8A 3H2CA 5JBFA 4JIIX 1AFSA 2BBFA 2WOQA 1VP5A 2WQPA 1IZKA 2V6AA 1S39A 2POTA 4TX8A 2ADAA 4V1XA 3GNDA 2JK2A 4K36A 1JUEA 4Q7IA 3GXFA 4JTEA 1NWUA 3GZAA 2WBGA 4QDPA 3CQKA 3T0CA 2ZUSA 4JEJA 3FFSA 4DI9A 4AD3A 3ARRA 1T7LA 2RH9A 1K8XA 4KWVA 4I7VA 1T8QA 1RAKA 3CO4A 3EDJA 1EBGA 1AUSL 2J8TA 2DT2A 3WCZA 3A5VA 3TLQA 4HZMA 2V63A 5CH9A 4IP7A 1CECA 1NFGA 4Z1CA 2VGFA 3RF9A 1VCVA 1GNXA 3KX6A 2WLYA 1JI2A 1W3IA 1RR2A 4AD2A 3ITLA 3DFQA 2FHCA 1OCBA 2FGZA 2O9OA 2WMGA 4QNWA 3EEZA 4Y9OA 4CNSA 2QV5A 1GTEA 3R13A 4HMEA 1FWFC 2X09A 4MWAA 4QE4A 4AWUA 5HR6A 3TN4A 2WB5A 3CT2A 3CZEA 1KQZA 5FJUA 1EIXA 3KDOA 5BXTA 9XIAA 1P7TA 4NJGA 3S47A 4F0MA 2WCSA 2Y7EA 2OO6A 4FXRA 2OYLA 5DY2A 3S1GA 3CL7A 2E28A 4LF1A 2RDUA 1LJYA 1XYMA 4DUOA 1S2UA 1YYAA 1YXYA 2QZRA 4WR3A 3WQGA 4JTTA 3T55A 1ME9A 1QOXA 3IAPA 4DWDA 1F74A 2H8XA 3NQ6A 4NG3A 3ZSTA 2RDTA 1LBFA 1LT7A 1V7YA 1H7RA 2AGTA 4MJ2A 3SGGA 2E25A 4MAZA 2DT3A 1WE5A 3NR0A 4Y96A 3N2XA 5LIYX 5HUOA 4CD4A 2VEPA 1DXIA 3STFA 1MW0A 3CQJA 2ZWZA 3IEBA 2J8GA 2H90A 1B4EA 4LALA 3AXHA 4C6CA 1DTNA 1BRLA 1CXKA 3LLXA 5FF7A 2RJGA 4Q4RA 3GTNA 2C18A 4ZTXA 3HG3A 2ZX6A 3WMCA 1MXGA 3W7PA 4UTKA 1GOOA 4DUWA 5LNVA 4XAFA 3HF3A 2OB3A 3A4AA 1SJDA 3AU2A 4UCGA 5DCEA 2DIEA 4N7QA 4LBUA 1AH3A 3MI2A 1E73M 3GDBA 4X61A 1QPOA 3QY8A 3TSDA 2CLFA 5JU6A 4J35A 1XR2A 3NSNA 1T99A 1E6QM 2XM2A 3GE7A 3HGSA 5E0CA 5FESA 3PSWA 4OHQA 1J0KA 2XTKA 2UY3A 2ZUNA 4HBKA 5DCDA 3O1NA 1XCXA 2QIIA 4Z2LA 1SQ7A 4PCSA 5DQPA 1MMFA 4PUKA 4GXPA 4Q8NA 3W6LA 2Z1KA 3BH4A 4ZFMA 4IFOA 1DKWA 1EQCA 4JGDA 4B2DD 3HMCA 1VFTA 1V3JA 3RX3A 4WJXA 2VURA 4EE9A 3F03K 3ARVA 3A9IA 2HE5A 2DSUA 1ODUA 2VTFA 1ZBKA 3AISA 3O0FA 2E8ZA 5MHBA 3BGGA 1UA3A 2XU2A 2PU1A 2Z0IA 1KKRA 1QDSA 2G3MA 4RX0A 1PIGA 4D2JA 2WMHA 3OZMA 3VNJA 4C7FA 4KEUA 5T9CE 1OINA 3BSMA 2W79A 4HIBA 4WSHA 4IPJA 4CCCA 5AZ0A 2BSLA 2X7WA 1PKMA 3ABRA 5LIWX 4XD5A 1Q5MA 4Y6GA 4URIA 2OZ8A 2Z7KA 2A6LA 4W84A 4EWND 3PM6A 1I4NA 4DIAA 1GYLA 4R9XA 4ADUA 3G0SA 1MRQA 2H9AA 2INZA 4B9ZA 1HJSA 4ERGA 1GOMA 1YIXA 2QHAA 1HZYA 4H4IA 3LPOA 3T44A 3ZOAA 1K9FA 1AD4A 3N4EA 4FXJA 1IEWA 2Y5SA 4PTWA 3DIPA 3GVGA 4KH2A 1PB0A 1XGDA 3LBOA 3W7KA 4S3GA 1EEPA 4LUSB 4UNKA 1XLAA 3FYPA 1ZJHA 3BJFA 3UT0A 2ASHA 2ZXAA 4QS6A 1KRMA 3OLGA 1DWHM 1SO3A 3UWQA 4DZIA 3CYJA 3VNKA 1MUWA 2OVLA 3BC9A 5M17A 3VDGA 5I06A 3VUSA 1BYCA 3ARUA 1I1WA 4OUIA 5JQ9A 3ZMRA 3LDVA 1BG4A 1B54A 4IG2B 3CL8A 1WDWA 1UD8A 3GTFA 5XIMA 5AHMA 1XDLA 3J7HA 4PUNA 4P2VA 2ZC8A 1GVYA 2E6DA 1BWVA 1ZQ5A 4H9UA 1M7OA 1SO5A 1F3XA 2QKFA 1MQPA 1OYCA 3TCSA 2GDQA 3RLHA 4ML4A 3BOXA 5HINA 4D6FA 4IQJA 4P5UA 1VFOA 2PGWA 1VR6A 1R38A 3NG3A 3U8GA 3R58A 2C7FA 2Q8ZA 1AL7A 4X0NA 1Q6OA 3MP4A 1LL4A 3W7MA 2ZA3A 4HHHA 4Q4SA 1GG1A 3AO0A 3VFCA 1F2JA 3OVPA 4B5SA 3H8AA 2YA1A 1DJGA 1D9EA 1JPDX 3W1QA 3WMBA 3WJYA 4A29A 3QV7A 2OQLA 1NJJA 5ECUA 4Y9AA 4UZUA 5KEZA 3DYMA 3RM9A 3TTOA 2PWEA 2YSWA 4KEZA 1RALA 1RLCL 3MHUA 2ISSA 2NVDA 1EGVA 1ICSA 3ANYA 3E5BA 3IPWA 2FTPA 1PX3A 3THCA 4XO7A 1GVRA 3AUJA 4ZQRA 1WXJA 3B0PA 4I8DA 4A6GA 1YNPA 3QH2A 2I14A 1S5NA 5A95A 2ZVRA 3IVSA 4Z2GA 1JDAA 3IGUA 1EOKA 3FNDA 3W70A 2G3FA 2OZ0A 1SW7A 1OFOA 4NZFA 2CHRA 2ZCGA 1JEZA 2TMDA 2OOFA 4J28A 3KBJA 2VC5A 2BMBA 1AZ2A 4JTQA 5AYXA 4PMVA 5H8MA 1A80A 1VYRA 3G8EA 1D3HA 2V67A 3B8IA 4OU1A 1O1HA 4CUCA 3EOOA 4TVDA 4XBKA 3S4TA 2PSNA 3TAKA 2G3NA 3AS3A 3MZNA 4NAEA 3UWYA 3N6HA 2BP1A 3B8UA 1JPHA 3OYZA 1JNDA 3PF3A 4HHLA 1GW1A 3GDLA 3CUZA 3G1YA 3NQMA 3VM5A 5CAKA 1H1ZA 5GJPA 3RAOA 1JUKA 1ITCA 4LS1A 2EF9A 4AYGA 1W9UA 1FDYA 4CD7A 1TR9A 4DBEA 5PTDA 1BVZA 3PJXA 4FX6M 4HOXA 3S5YA 2BLEA 5HMSA 1BGGA 1JIBA 4B3KA 4GLEA 1KM4A 1QR7A 2P5NA 2XUCA 3H12A 2P50A 1AW5A 2O9PA 5HNNA 2GVYA 1E1FA 4IMFA 2GPTA 3WDPP 1S5WA 4DELA 5E6YA 1ZLPA 4XO6A 3GU9A 3B40A 3PTDA 4GJJA 9XIMA 4ZL1A 5CKSA 3W2JA 1XIFA 5DBUA 4RJEA 1BKHA 5CJ5A 4HA4A 1SMDA 3E2RA 1OQFA 3GTXA 3RHGA 1DE6A 3OLEA 1R8LA 1UW9A 1WB0A 3UGRA 3KE0A 1XDMA 2WMJA 3WLHA 2VX6A 4DLMA 3UPBA 4DYJA 1K8YA 1LL6A 4QCEA 3V0UA 3K4AA 4WK9A 4YWIA 2JALA 3TW6A 1WAUA 1YTDA 2CYGA 1O4UA 1GG0A 3BAYA 1K02A 3LGDA 4RE4A 2FZNA 3JZUA 2WHMA 4I9AA 1UP0A 2R6OA 3EKZA 3FLUA 2NVCA 4X63A 3TJIA 3NDZA 2UV8G 1KCLA 2CHOA 3O6AA 5D4YA 4PMZA 1HJVA 3G8RA 2HROA 5E6ZA 4D8AA 5FF3A 2QCHA 1AL8A 1P48A 3TYZA 3R89A 2HQAA 2QIWA 2W66A 3SUSA 3OQ8A 4GJIA 5CAHA 1JFHA 3WLKX 4DJED 5MKGB 2WNQA 1L6YA 3GUGA 3OP2A 3RMJA 2PF8A 4PUEA 2YL5A 4A3YA 1W9VA 3S5SA 3W38A 3UXIA 2AQOA 4AXNA 4KS0A 2ZADA 1H61A 1V6VA 3BAIA 3QR0A 3GO2A 1O5QA 3DC0A 5TAOA 3W24A 1H41A 4UQAA 2QPSA 2Z24A 1QMLA 5HNRA 4XQ6A 1CW2A 2ZUTA 5HJYA 2Y2WA 4WIWA 4JQ4A 4QR6A 1OC7A 4O57A 1RD6A 1H62A 3T78A 2NVAA 5A8QA 2Y63A 3NUKA 3DFSA 4JDYA 2E09A 3JU2A 3SM0A 4TO8A 4DZAA 2BOFX 2O7QA 1UWUA 2QXWA 4L9YA 1JQXA 4HGXA 1BG9A 3PBYA 3GAYA 3CL6A 2B7QA 3NPXA 1IT7A 2FMNA 3WBEA 1W9BM 4JTKA 2WM1A 4XZLX 2JKEA 1WOAA 2WO5A 3TR9A 3T0AA 2ISDA 4DBDA 2WZHA 3B9NA 1JPMA 4C1NB 4PMXA 3HQOA 1WXYA 4UTHA 4O0QA 4ZQPA 3DECA 1RXOB 2VX4A 5TD4A 1C9WA 1E1EA 2XFFA 4PEEA 1OGBA 3T05A 5FA5A 3DAQA 3H4WA 1ENUA 3SRFA 2A85A 1XF0A 2MANA 3QFWA 3AHVA 4L64A 2EXOA 4KT2A 2BVYA 3SRKA 4NYYA 4QDMA 5EMUA 2ICSA 1W1YA 3GH7A 4N6FA 5DBTA 2D2HA 1PTDA 5ECVA 3MO4A 5KSWA 4JFUA 3TTEA 5BWAA 4QSFA 1OCQA 2QR6A 4F8XA 3WLPA 1LG2A 4M7SA 3BLKA 3O6CA 2HK1A 4MTVA 4MY9A 3APYA 1W17A 4CD6A 2PLCA 2I57A 1YPFA 2VO5A 1AQHA 3CH0A 1VYPX 3B97A 1XDJA 3G0UA 1CTNA 1XD1A 2DZUA 4RV8A 4TQTA 4A8LA 2HXUA 3L5LA 4MPQA 2RKXA 4QSHA 3NQGA 4IJBA 3CT7A 3R6IA 3VCCA 3U5YA 4IGHA 2X41A 4Y9PA 1WKDA 4RKAA 2VUNA 3UG4A 2QF8A 2AMXA 2OPJA 4BQ4A 1A5UA 3SUVA 3OVGA 3PZ9A 4GA8A 4I9MA 3VUPA 1E4NA 1IWBA 4F0LA 2DSZA 1RPKA 4Z2IA 4LEFA 3WF1A 3NZPA 2C15A 3NVDA 3OTRA 3CMGA 3VO0A 4FR1A 2QMKA 3N11A 4AZBA 3WLTA 3OLIA 1HT6A 1KR0A 4C6OA 3ATZA 4W8AA 3N29A 2X1SA 2Y88A 3BE7A 3AS0A 3EPOA 3FXGA 2PD5A 4CCZA 4P61A 1VBHA 3C86A 1E51A 3RPMA 4GIAA 2GWNA 3IRSA 2IKGA 2ZRXA 3E2SA 1DVJA 2HEJA 2XFRA 4YVVA 3CHCA 4UTMA 2XVPA 3PP7A 1B57A 3LBMA 3IJ9A 5HUPA 1C91A 1Q8JA 2Z29A 1J4EA 1GORA 4PB3A 1QJWA 4LY8A 4X2PA 4LAOA 3BSGA 1NP0A 1K8CA 4MKSA 1K3UA 4K39A 4DJDD 1ZHAA 1UKPA 1NVMA 5M03A 3COTA 3KW3A 5U4NA 3L2LA 3CHEA 3F2CA 3GFXA 4E6MA 1XLGA 3LQLA 5AHLA 2ZOXA 4HSHA 4L4OA 1GYNA 3C8NA 2F6KA 2WVVB 2B7PA 1YQ2A 1V08A 3S9IA 4DHGA 2HS8A 2ZTJA 2HE8A 1FBAA 3OO2A 5D9OA 3B3DA 2PODA 2ZE3A 3PBUA 1V4YA 2J77A 2DUXA 2GVEA 1RUSA 1C29A 4IXXA 1TRIA 2VGIA 3KFTA 3P8IA 3VIMA 3LXAA 5EPDA 4PTVA 1H1YA 4EPEC 2JIEA 4JFVA 2X30A 1ADOA 1L6WA 1X1ZA 4UFIA 2DZSA 1DOSA 5D30A 5E0FA 1V0NA 3AMKA 4ZTYA 1QWKA 1X8FA 1E55A 3NCOA 1CGWA 3BMWA 1G1YA 3MB9A 1T5AA 1J12A 4FAMA 1B3VA 1LZOA 4WKHA 4NYUA 1U1JA 1KXVA 3BLIA 4ICMA 4HJWA 5HQLA 4PTMA 4CN1A 3USZA 2Z1WA 2GDUA 3KVJA 4UR7A 4IXHA 4JOMA 5DF0A 1C8QA 4LWWA 1J0IA 1UWQA 3A5FA 3ME3A 1XKJA 4ZBCA 1PKLA 4PZVA 3MDUA 3LRKA 3CASA 3S6OA 3LTYA 4V1YA 3HPZA 1CX9A 1CT5A 1AQ0A 4AF0B 1Y5XA 4Q8QA 4DN1A 2WVSA 2QDDA 1N8FA 2I1OA 4QEHA 3GFZA 1ZAIA 3AJXA 4HNNA 2D0FA 5GJMA 1VIZA 2B4GA 4TOQA 1OYAA 3DESA 4PUDA 4A3RA 1K9TA 1DTUA 4QQ3A 2FTYA 2HBVA 3CWOX 4PMJA 2O0TA 1W3JA 1GQNA 1EDGA 4QCFA 5CPOA 4YL2A 2ZXQA 1X6NA 1MUMA 1DJXA 1U2YA 1C7SA 2ISWA 1EC8A 4HYRA 2A7RA 4MZYA 2FKPA 1GT8A 1DJHA 3LHYA 3EDEA 5FF4A 4UQEA 2GGJA 1Q7MA 3QVQA 3MBDA 4ROQA 1VYSX 3GWQA 3U9IA 5I02A 2C8NA 1AJ0A 1R7AA 3F4NA 3STEA 1HKJA 1M03A 2PU0A 1RV8A 2BNJA 3T2OA 2WW5A 3VU2A 1WKEA 4B3LA 2G97A 2QEZA 4ZQMA 4KPLA 1LL7A 3ANVA 2QCNA 3O9NA 2Q09A 5BRQA 3MTWA 4JQ2A 1W54A 3BZJA 3ECQA 1RQEA 2OG9A 2OODA 1YDNA 4NU7A 1FH7A 4B5VA 3CQIA 2OWXA 3GG1A 2OT0A 2ZWYA 3CIWA 3KRZA 3W3OA 1YE6A 1H5VA 4M81A 2WVUA 3PBGA 4HNLA 2OQYA 3QYSA 1W8GA 4AZ7A 2NQ9A 4S1FA 4IH3A 1HW6A 4H6EA 5EMLA 5EBUA 2CEQA 3TTQA 1RH9A 4Q22A 4TMCA 1Q45A 5EYWA 3FK4A 4O1EA 1PHWA 3W7HA 4FZIA 4JN6A 4AH7A 1W5PA 3FA5A 2OWCA 4Z1BA 5GNYA 4S2BA 4A3UA 3CIXA 3YPIA 4HPNA 4EX4A 4JL2A 1QPQA 3W7QA 1HKIA 2ABAA 3URBA 1I45A 3UZJA 3RYSA 3EKLA 3S2JA 4BA0A 2VC7A 5CSYA 2J7GA 1VBGA 2OR2A 1IXNA 3W2NA 2ZZ6A 4CN4A 2WWDA 4KRUA 4XAPA 3W1UA 1ALDA 2WZEA 5BW6A 5CXPA 4DJEC 4OGZA 4R85A 3B8SA 4C65A 4GGBA 1E72M 3PK7A 2NW0A 1B2YA 4P8WA 4OIFA 3NQ2A 1S5MA 3PTMA 1EPVA 2FVKA 2Y7GA 2ZQ0A 4R53A 2PFHA 3OW1A 3REQB 4PODA 3MVIA 4WOQA 3ABZA 3BAWA 4B90A 5FD0A 4UMCA 1TFVA 5DXYA 1E70M 1NH6A 4Q8PA 3GHSA 4J5NA 5EU9A 4M1RA 4JPGA 3VKDA 1P0DA 1JCMP 3UG5A 3NZGA 4RL3A 3TEVA 1GKRA 2O56A 3N2OA 3WQ8A 1EDTA 1X98A 3SCOA 4F2UA 4M7TA 3AS1A 3GU1A 4ROPA 3K30A 3MW7A 1Z32X 2YIHA 1ZGDA 2VZSA 1L6GA 4OBRA 1A4MA 3TX9A 4H41A 1V6XA 1F76A 3DKLA 1FHDA 1R2RA 3MP5A 3VKAA 5H8PA 4S39A 4G56A 3VOCA 3RM8A 1HJXA 1P6CA 1D3GA 2QCFA 3ZT7A 3T4WA 4MKNA 4EF9A 4XKYA 3SN1A 4BF9A 1M1BA 1UD6A 2XM1A 2QQ6A 4O1BA 1XRSA 2A3CA 3GDTA 4O53A 3P74A 2OT1A 2GK1B 5AVHA 3U7BA 1NIUA 4JQ3A 2EG6A 4R7JA 2PC4A 3P2VA 4KIRA 4NRSA 3BLOA 1UD3A 2UWFA 4A05A 4IPNB 3CB3A 4O54A 1A0CA 3VOHA 4LUSA 2GQAA 3DFYA 1XI3A 3H24A 1OC5A 1JYXA 3HN3A 3UPWA 3S3GA 1DQUA 7PTDA 1H60A 2PA6A 3CWNA 5A6TC 2OELA 2QCMA 3C52A 4IF2A 1FUYA 4I90A 3LHWA 1DE5A 3EX2A 1HO4A 2Y89A 1XWYA 1YLVA 4H9YA 3URAA 4W85A 4Z0JA 2ZIDA 4NJJA 3WN6A 1MDLA 4IG2A 4I5XA 2NX3A 2INFA 4H8NA 4PMDA 3JR2A 2E9MA 4FXSA 5FL1A 2IKIA 3GVQA 3OZPA 3RO6A 2OEMA 1JXJA 3N19B 1TA3B 1RJQA 4CGTA 2WAGA 1QK0A 1OX5A 4HD5A 3ARWA 2BG5A 1P0NA 4S23A 1EP3A 2A21A 4L56A 4N9DA 4IIGA 3SCQA 4CEXC 4PMQA 3GBEA 3OVQA 4PMRA 4GOAA 4YIWA 1PCKA 1Z9AA 2BZNA 3A24A 2PDIA 1EZ2A 5FSEC 2VHLA 1MZRA 1YRRA 1IT0A 1VJZA 3P61A 4GZJA 3HBLA 6A3HA 1XGZA 4MFEA 1QW9A 3GVRA 5E0KA 3SCVA 2DW7A 5CSUA 2V3EA 5I3IA 1EOMA 4TTUA 4LC6A 3QXBA 3WBWA 1EJWC 1MDRA 4HYVA 4RXFA 3L65A 2ZUUA 4DY1A 2NQ5A 3AU6A 4B15A 1ZUAX 3UFYA 1NEYA 2HPIA 5I2UA 2EPMX 4LJ3A 2DGAA 4H9XA 2PDNA 4GVHA 2XWDA 3VPLA 2ZICA 1TV3A 3MBFA 1UWAA 1GPFA 1Q6CA 1QPRA 1B1YA 2ZX9A 1S2WA 2X8RA 4ZO9A 1F8MA 2BY1A 3IGHX 3GD6A 3TAOA 3CHDA 4WEVX 4K1GA 1R9XA 4AIBA 3D3FA 1ZALA 3C2VA 2GUYA 4ACYA 3OA5A 1OT1A 1EJXC 3GG8A 5D9PA 3NO1A 3PFRA 3TW7A 3GDMA 4N02A 5JUVA 2J25A 4Z17A 3N13A 4HK5A 1RD5A 2HISA 3W7JA 2BHZA 2IMRA 2IQDA 4IPPA 1JF6A 1E6SM 4D1JA 4GJ1A 4DJDC 3PPGA 4XBJA 3SI9A 4B5WA 2PDQA 4YTTA 1KFJA 1HP4A 2RGMA 5T91A 4EXAA 4LUYA 1A0DA 2JEPA 2PTYA 1JRBA 4HHPA 3QQ1A 1L0PA 3RO8A 3CPUA 1JZ2A 4O8RA 2EO7A 4L80A 3CO8A 2WZMA 3FYOA 2VGBA 3ARXA 5G5IA 3A21A 3GXPA 4O52A 1J5SA 1F07A 4FF7A 4ZOAA 4QLKA 1KNWA 4IMGA 5A8MA 3VKBA 3LSBA 1EKOA 3TOPA 4O13A 5I3FA 3LI0A 3MV11 2OYKA 4EWJA 2C14A 1YEYA 5AC5A 3RGTA 3RX2A 3FOKA 3VGDA 1ML1A 4R7OA 3KCOA 4XV0A 4N9BA 1CGVA 4GI9A 2VX7A 4FS9A 4B4HA 4JTSA 2V5CA 5JVLA 1J01A 3GDKA 3WY1A 3A3WA 2DORA 2PCEA 4GI6A 3EBVA 1XIEA 5HMEA 1JULA 3CV7A 3WUGA 3M4HA 1T40A 1UROA 3S8HA 1P5BA 1KRBC 2E5BA 2QYGA 3WF3A 2WXDM 1QWGA 3P5YA 4F40A 5DRIA 1JZ6A 3TXZA 1G4SA 4NAFB 2BB0A 4PGLA 1FWDC 3T6CA 2A4AA 3SIMA 3LQGA 1BF2A 1W8SA 3RK8A 3I7SA 3MANA 5HDRA 4RK8A 1DXEA 3MO7A 3DFTA 4MSSA 3L4TA 2VT0A 4UTUA 3O15A 4JY9A 5CBJA 3QY7A 3CUJA 5HA7A 4ZSTA 4JIHA 3W6YA 3GFYA 1K77A 3WNNA 2QDEA 3UW6A 4NHVA 2FHFA 1VEOA 3GHTA 2ON3A 2CHNA 4N9EA 4QM1A 3BWWA 3N9KA 4OECA 4WXYA 3WKZA 1POJA 4B2DA 1NARA 1HN1A 2CZ5A 5MKGA 1QHPA 4J1OA 2WSPA 1HJQA 2QF7A 3SFKA 3GSMA 2JGYA 2G0WA 1HQTA 5C2CA 3CPRA 1FY6A 2PWFA 3DOPA 3CJPA 3VD5A 4C6IA 1KRAC 1Q2RA 4GFIA 3SADA 1BAGA 2ZUVA 1R9YA 2DVUA 3A4XA 1GOKA 4C5ZA 3RM4A 5KZDA 1JD7A 5DFAA 2DZVA 5E93A 1TCDA 5C0QA 2GQ8A 6TIMA 5G4EA 2MNRA 2VDHA 3UZ5A 1PL9A 3AIVA 3WLSA 3D6NA 4DO4A 3WH8A 3LUTA 1R0MA 4WD0A 4IISA 4AYSA 3CZKA 3IJIA 4RE0A 4L5ZA 2RDXA 4PMOA 3EEGA 1IQ8A 1QO5A 3WJWA 1XC4A 3HIJA 3CZ8A 3ZS4A 4O28A 2IXUA 3U2ZA 1PKYA 2YL8A 3VZYA 4XZBA 3LXBA 1V02A 1OT2A 3UY8A 1F7BA 3N15A 1G7UA 5HWJA 4MB3A 5A8NA 3WUEA 4EPBC 3T0BA 1YADA 2PDLA 3RR1A 1CXLA 1V5XA 4N4PA 5F1VA 3GC4A 3NQVA 2E7FA 2BY3A 5GJNA 2FPTA 1GQLA 1SW0A 2A3BA 3WF0A 1R86A 3LCIA 4MZ1A 3PPCA 2DT0A 4RDYA 4H6KA 1FWCC 3K8MA 2NX1A 4BI5A 3G3DA 3SCSA 2XGIA 2NXIA 1LM1A 1E3XA 1XG4A 4MGGA 5I3JA 1EPXA 4PRTA 3RPTA 3KZSA 1IHIA 1ONWA 3M0YA 2OFJA 4RZ6A 3VCNA 2AAMA 1TPVA 3EXTA 2C1GA 4RUBA 3FHAA 2YZ5A 4QAIA 4G1KA 4FIQA 1JI1A 1XD0A 3PC0A 1A5BA 5IBXC 1KBJA 1N55A 2V8ZA 2CBUA 3K2GA 4XISA 1FFQA 3LV5A 4K8HA 1TWZA 1VPXA 1XBVA 4D9PA 2WV8A 5A6JA 1W3LA 4I6KA 3UETA 3L4ZA 1JYVA 3QOKA 4GYKA 2NQJA 3E0VA 5K7JA 1HJWA 2NLIA 3KTCA 2R9RA 4HMNA 3DG7A 3VOIA 3DCPA 1S5TA 1OFRA 2VQTA 5LA0A 5F7UA 3FA3A 4ML9A 4LB3A 2PGRA 4GQGA 2VFFA 4NNAA 2Y7DA 4TX9A 3GIQA 2CLPA 1A5KC 4KWOA 3OB8A 3UA3A 3UCCA 3BANA 1MQRA 2RHGA 3MZ2A 2E77A 2WKLA 1VEPA 2R1LA 5ABGA 2QCEA 4AD4A 4LV9A 3R7MA 1WOBA 1U33A 1WP6A 3A22A 4QIUA 4FK9A 3CC1A 4PL1A 3V35A 3UNTA 4AC1X 3AWOA 3V4BA 1FWWA 2ZA2A 1IZCA 3PZGA 3JVAA 4M24A 1F6KA 4ASTA 1D3CA 1UZ4A 1FWEC 3V5FA 1VFUA 1BYDA 2BASA 4GUFA 2RFGA 4OE7A 3AS2A 1ZY9A 1OG6A 3LV6A 5CPNA 3EB3A 1TVPA 3UWUA 3ZWTA 5A3HA 2VGGA 1Q65A 2PTXA 3OODA 4PBGA 5CZSA 4HPHA 2ZZ5A 3W76A 4LU0A 3G1FA 3DN5A 3EWCA 1E0UA 3DH7A 3HV8A 2PDKA 3RXZA 5C55A 1AW2A 4OVXA 3SQSA 4QP0A 1JCYA 2CLOA 1DXFA 3KBMA 2I9UA 3VM7A 4V2XA 4UZSA 3IUIA 4Z0SA 1M6JA 3ARYA 4ZOEA 3UXKA 3B04A 4PSRA 4RE2A 1CXFA 3NNTA 2VKZG 1X7FA 5J04A 4L4MA 3GDRA 2OEJA 1PX8A 3NPUA 3W1AA 4ZB5A 2OYMA 5A2BA 4J2PA 2JF6A 4GYPC 3OPSA 2PWHA 4RDZA 1W5NA 4KQNA 3GZ3A 4MOZA 3ZLGA 4EXBA 3ZVHB 1VBJA 4QFUA 2XH4A 1DL3A 1GUVA 4KETA 4Q32A 2PDPA 3UG8A 2WHKA 4OOZA 1RK6A 3B0YA 4IPIA 4KCVA 4GQRA 4OV4A 4YNGA 5K4ZA 5C8BB 3PWGA 1TV4A 1QO2A 1C9DA 1GHRA 1WNOA 4PCTA 5G1TA 2VFDA 5CC3A 3C0LA 4XZMX 5IRPA 4B5XA 3W00A 1DBTA 2PLJA 3SCPA 2PUZA 1VFMA 4ZQNA 4MKVA 4MY8A 3IJLA 1VD6A 5LNSA 4GUHA 3NM3A 1IV8A 5KZEA 4IIFA 1LWIA 1X96A 4CCEA 2XH2A 4QG6A 4GX8A 1PJ9A 1T8XA 4RNHA 1KQYA 4RW3A 3P7YA 3NZRA 2C91A 1ZL1A 3LHTA 2FMOA 4CQDA 1AK5A 2V3DA 3ZQ9A 4DJEA 4JYEA 1BVWA 2BFGA 3TSMA 1Q63A 2E40A 3MDWA 1VPQA 1W1VA 4WX2A 1QI4A 5LIUX 4FOKA 3LHUA 1VEMA 4QITA 3WNOA 3M5VA 2XG9A 1K70A 3CUHA 2PMQA 1SYTA 3SURA 3ZWSA 7XIMA 1N8IA 3PZNA 4S3DA 5AB3A 1SR0A 3K1DA 2NQHA 4EAYA 3WQFA 2UY4A 3W88A 3CB8A 5FCZA 2YDSA 4DAFA 4JX6A 1XRTA 2RGLA 4AEFA 1LT8A 2XIBA 3TP4A 2HMCA 1XRVA 2ACSA 2C16A 3PBMA 6PTDA 4WDUA 1DYSA 1PYFA 4C7DA 4AZGA 2GSEA 2DIJA 3W75A 1TYGA 3ALGA 4PCFA 4WHBA 3POCA 4L1WA 1J6OA 1G7VA 1AA1B 3LHVA 2NWSA 3LM3A 2I56A 3KVLA 1TPDA 4ADSA 1VRXA 1D7KA 1HG3A 3BVJA 2XZ7A 1PS9A 4J3VA 1EGMA 3P67A 3OBEA 1VC4A 3VIFA 4HTYA 3GK0A 2XWEA 1RBOB 1A5CA 1MXDA 3HQNA 4A22A 3WK1A 4LS0A 3FJLA 1I2RA 4JHMA 1KTCA 4UMAA 1QW8A 2GOUA 1DWJM 4HCHA 3GRIA 3USBA 1EC7A 1EC9A 5HNTA 1OFPA 4JQ1A 4GGHA 2D0HA 3KLKA 2PE4A 5HQEA 2X1IA 5H2ZA 4GX9A 2Q8LA 4MYXA 5F2LA 2AL1A 2BHYA 3W07A 4PUUA 4UXDA 2VD8A 2BODX 2R94A 4LPCA 4H7CA 1TJ2A 2XN0A 1PX4A 1ODZA 2PD9A 5LA2A 1BWKA 3C0SA 1W1ZA 1W1B1 4QE1A 1W31A 4UTIA 3ELFA 1HO1A 1P6BA 1XYFA 3DGBA 3S5NA 2D1ZA 3CUIA 2BGQA 2PZ0A 1YPXA 2EPHA 4E0CA 3EPNA 4NQ1A 5F4WA 5CEWA 3VCRA 5BNKA 1E0VA 4MUZA 3PZQA 3BLLA 4GACA 4L6OA 3R5EA 4GKLA 3SDOA 4JR5A 4IMCA 3BG3A 4NF7A 4Y7EA 1LORA 3EYPA 3P84A 1M5WA 2XH7A 3UVAA 4ZZ9A 4XVDA 4I3GA 3MT1A 2OU4A 3REQA 1LCOA 4QX4A 4ZQOA 1L8PA 2VM8A 3W7GA 1DJIA 2A1YA 4GNJA 1PV8A 2YFOA 3L66A 1TPUA 4WF7A 3AIBA 1VZWA 2YYUA 3LA4A 4E5TA 5HPOA 4ZSUA 3EAUA 3KOYA 4U3CA 2A3AA 4OV9A 4L9XA 3AIWA 5KETA 5G2HA 4PTDA 4PTNA 4FX8A 4E2OA 1US3A 2FGBA 1CXIA 4CU6A 1LUCB 1VBUA 3O2LA 1HVXA 4CNUA 1Q6DA 1QBBA 1JZ3A 1OFAA 4NIRA 3KWXA 1XPYA 3QGVA 3RMEA 1XIHA 2ZX5A 4H9ZA 1GYMA 3KBWA 3QZ6A 4HOZA 2V2CA 2ZC1A 2C79A 3MVTA 4O4WA 4AY1A 3ARQA 3K46A 9RUBA 1E3ZA 6REQB 4O0KA 3WQ6A 2O7SA 3T8LA 4DXVA 5CZTA 3SUTA 5M3WA 3L68A 1SSGA 5D2YA 4H83A 5A69A 3R0DA 3RRAA 3PB2A 1TQJA 2E9LA 3WFLA 2X0HA 2GK1A 2FFIA 5T9BG 4BEQA 5A6BD 4EXQA 4HOWA 1BPLB 3QMSA 3QV9A 4UTTA 2QPUA 4FI4A 4DJDA 2PGFA 1EDQA 4JNMA 5AYZA 1CBGA 2F7FA 1IF2A 4GE8A 3DYOA 3H55A 3LMZA 4HN4A 3EKGA 3VDAA 3EWZA 2V68A 1R3SA 1HL2A 2QCGA 2E1WA 4ZXOA 3ZJKA 5AHNA 4C6KA 2BTMA 6XIMA 1TWWA 3S0CA 4V15A 4GHRA 3CHFA 1X1OA 2J66A 5H1WA 4KEVA 2BXYA 4GC3A 2C71A 1H2JA 1IE7C 1UQYA 4DNMA 3SEPA 3N3MA 5HPCA 7REQB 2XN2A 3NOEA 3MMTA 4J9JA 1TA3A 3GB6A 3MCNA 1OK4A 1QHZA 1EL3A 4ZE4A 5RUBA 2FJKA 1D7FA 3VK5A 1EGZA 1OHLA 5HANA 3FGCB 1UH3A 2OQHA 1FXPA 4CNTA 2W9MA 2PTWA 3V5CA 5FIPA 1LRTA 3G1RA 4GIEA 1YXCA 3IWPA 5HMFA 1C8YA 2X42A 3FV9A 1ISZA 3BK0A 3MYPA 3R1ZA 3B06A 4M51A 3Q4DA 1ISVA 4MYAA 1IZJA 3QOMA 2G37A 5LYRA 3DG6A 2YFNA 3I7RA 3S1UA 2P53A 1LRNA 3KL3A 3HM7A 3HG5A 1E0WA 5A8GA 4LGXA 3HG2A 1G4PA 3PFMA 4WDTA 3EDFA 4JBRA 4WUIA 1UYQA 1T96A 1R3YA 4IWWA 1WDDA 2XSXA 1JZ4A 3RRXA 3CWHA 4LCSA 1KTBA 1ELSA 4W7VA 2BXZA 3PBWA 3I3DA 1FQ0A 1RCXB 4H3DA 3HZ3A 4K6AA 4BS0A 4X3ZA 1RZMA 5AECA 3M1ZA 1CCWB 2W5FA 2V30A 2OLSA 1IXPA 3IRDA 2EHHA 1R2TA 2VRQA 4U33A 1HXJA 2DFAA 5EKYA 2QUMA 1SMAA 4US5D 1FWJC 2EPOA 1RBAA 1KBLA 2AKZA 3G22A 2ZZ3A 1XRFA 1YBQB 2ISFA 3B8VA 2XFYA 1FWNA 4S3JA 1M7PA 3EX4A 1BFNA 2CLIA 3KHJA 4P7LA 1FH9A 4QROA 4AIUA 1H1NA 4GKTA 3KDNA 5CSRA 4DM1A 4GZIA 3LCXA 3PZTA 1SZRA 3QM3A 1Q2SA 3SJNA 3W7CA 3DBNA 3KRUA 1E15A 4C6LA 1O66A 2WJZA 3W85A 1J8VA 2XHYA 5I3GA 1QRQA 3QW4B 5DMNA 4JN8A 3VINA 3N34A 4S3BA 1NOFA 1UC5A 2L5HA 3M0JA 3N12A 5I3HA 4BY3A 3I4EA 4WDWA 2DSVA 3TC3A 1JYNA 1W9DM 1J0ZA 5D2XA 4X22A 3BLPX 1F6YA 4PSPA 3TVAA 4ACZB 4GVFA 3WFZA 4AAJA 2OTDA 2PDYA 2QJGA 4JTAA 1NTHA 1XINA 3WD1A 5HJXA 1WX0A 5C7VA 1BQCA 2WJDA 3EMQA 1A5AA 2QGHA 3WJZA 3QC3A 3LCHA 1H0IA 3VD3A 1VAHA 1W37A 1RJPA 1WDRA 2YDRA 1R3VA 2Y1HA 2PDMA 5D9NA 5I00A 4XSLA 3W7LA 2AQVA 1ZRQA 2W61A 3M47A 1DIEA 1DQXA 4E4UA 3HV9A 2A0NA 4IJRA 5FJTA 1QAPA 3RCYA 1SW3A 4Y9MA 1GQJA 2DP3A 1B9ZA 2NX9A 4HJFA 1QUMA 4GO8A 4NAFA 2TODA 1M7XA 1G01A 1MVYA 3NQCA 3KXQA 1EWDA 3THAA 2J6VA 3G24A 3EX3A 4J40A 5IBXA 3SIZA 4DNHA 4ZO8A 3V75A 4AY7A 1BD0A 1EB3A 1QI2A 3CXOA 3W1LA 2PDFA 5J8LA 3GHRA 3LMYA 3BLEA 1S1RA 3BV4A 4UUIA 3HGJA 3PUOA 2YCKX 4AEEA 1DPMA 1W9PA 2YW3A 3N3TA 1JCNA 4NJKA 2ZX7A 2BXVA 1ESWA 1KM2A 4YHEA 1VLIA 4CEUC 3JZEA 1TV2A 5D38A 4CNNA 3T07A 4O11A 2CWXA 1Q6QA 1ZBWA 3IK4A 4DXXA 3C2RA 4C6EA 4GO9A 2YZRA 1RY0A 2PB1A 4Z2JA 4EPKA 3E0WA 1C7TA 3NPVA 3AXXA 3KLLA 3LN3A 4XX6A 1ZNNA 4WXZA 4XSMA 4W5ZA 5KTLA 4U5KA 1F4AA 3WEOA 2J7DA 3A23A 1WA3A 1F6PA 1PVNA 4H04A 4PMUA 4R34A 3RG6A 1H11A 1UA7A 6CGTA 4DI8A 4US6A 4P8UA 3KOXA 2B81A 2WJFA 4ZXLA 3GH5A 4CNPA 3VMNA 4GPNA 3UXAA 3VD9A 4Z2HA 1OJXA 1VF8A 1UMLA 3SN0A 3SECA 3GR8A 1KO0A 5KINA 2Y5JA 2GDVA 3FCPA 4MHBA 5F4XA 3R43A 4REQB 1MEIA 1RJRA 4AZCB 5AFDA 1NOUA 4MWAE 1NU5A 3APTA 1P0EA 4AWSA 2ZVIA 3MI6A 3EWYA 1TVNA 1JDDA 3H2NA 3UA4A 3G1SA 3GW0A 3MMUA 3NQEA 3UBPC 2EJ1A 3SAZA 4YS1A 2HZGA 1NFPA 3UYCA 4D6EA 3TDFA 4G5DA 3EA3A 1KBIA 2D3LA 3F2DA 3WMSA 3TJLA 3TONA 1UKOA 3VGBA 2ZKMX 1I2PA 1ADDA 2GQ3A 4WLCA 3E0IA 1BXBA 1I2NA 1BEUA 4UTJA 1TWDA 4KWSA 4GYPA 2V2DA 3DFPA 1IWAA 3W1PA 1HNYA 1DP0A 1UR1A 4C6QA 3KS5A 4BFAA 1KLYA 4DEFA 2YX0A 3UJFA 3NQ7A 3UXLA 2IPGA 1RP9A 3TTYA 2GGGA 1OG0A 1BGAA 5DT7A 5FI8A 1R30A 2IXVA 1ADSA 4EKJA 1CGXA 4AG0A 1QATA 3DENA 1QNQA 4PTXA 2Z00A 1ONRA 3P82A 3N2CA 4Q8OA 2E9BA 3IK2A 3ZT6A 1XHGA 3WF4A 4AHPA 1PDYA 2EQDA 3FS2A 5G2IA 2ZRVA 1O95A 5IOBA 1MRAA 4XZ9A 5AC6A 1KA9F 3V1HA 4E2VA 2GJNA 4CCDA 2YCLB 4RPPA 3MWCA 2FQIA 4BZYA 1XLBA 4GBUA 4UR8A 3NGJA 4GY7A 4AMCA 2FZ9A 3KHDA 4MADA 3CTTA 1JG9A 3BJTA 5FACA 1R87A 5LXXA 1KGXA 2J47A 5D2WA 4YXGA 2C0HA 3KP1A 2CXGA 5AKQA 2D0GA 2VENA 3I65A 3D5HA 1H49A 1S3HA 4JTCA 2ZUMA 1UASA 3GXNA 2EKCA 2DVTA 2C1HA 2ISVA 3GM8A 3VX1A 4KFOA 4LW7A 3ZSSA 3TTSA 1OD0A 4UQBA 5JBEA 1FWAC 3TZFA 2OKTA 3IARA 3CAWA 4Q3MA 3DERA 3W71A 3H2AA 3M44A 3UZYA 3OJGA 1GOWA 1KTNA 1TE6A 1QFEA 2HRWA 1FX6A 5D2TA 3JW7A 4IPLA 1BYAA 4IQEA 1XIDA 3B4UA 3TA9A 3SN4A 4HPJA 3DBPA 3IIPA 5F2MA 3C4UA 2Z1VA 1HTIA 2ANUA 2ZRWA 1BRLB 2AMGA 4JTRA 5G1MA 3KTXA 5JXQA 5K9CA 3BOFA 3SGUA 2EPNA 1ZS2A 1A5MC 3M5XA 8A3HA 4W89A 1W1TA 3G6MA 4O0ZA 3GTIA 3ATYA 2CERA 3QTPA 1S1PA 3THUA 2B31A 3HMJG 3BL3A 4ZOCA 4DQWA 1TPC1 4U2YA 2H6RA 3NFUA 3GXMA 3L0NA 2FGLA 2HNHA 1AMYA 4AFYA 3H7UA 2XVNA 3HTWA 4NXKA 2VCAA 3UGVA 1SVDA 3T0TA 3RFAA 4TU1A 4PH6A 2DY3A 1GJUA 1QK2A 3TMQA 4UNLA 2JFEX 4N42A 1H7XA 3ZVHA 1K7EA 2WHLA 3QMRA 3VOJA 1M53A 5CZKA 3B0XA 1QU4A 4Y90A 1VIWA 2CLKA 1G9HA 3E02A 1EHAA 2EEXA 1OX4B 3DXIA 1J5TA 3PNUA 4RCXA 1E4MM 3AQUA 4FALA 4WOZA 4LUIA 1K8ZA 4H8VA 4A3HA 4O1CA 1X1NA 3LS9A 2XGBA 3Q37A 2RJHA 3KVMA 2Y85A 4JZ5A 5LGZA 4RNFA 1DIKA 1F3WA 2X2YA 2NSOA 1XLMA 5A1AA 1WYIA 2R82A 2I5GA 3ES8A 1HVQA 3BICA 1D8WA 4TX6A 3IIXA 3DHDA 3LTSA 1YHTA 5CC5A 4ZODA 1V3KA 3WDQA 3E9AA 2FPYA 1WZLA 4H1ZA 3GNOA 5CG0A 3V18A 5EFDA 4QS5A 3Q58A 1B0IA 3AUOA 3VOGA 2NWRA 3AMCA 3A47A 3TYBA 8XIAA 4XZWA 4RZ4A 5FAGA 3VTRA 1V3LA 3CAKA 1JZ8A 2YA0A 3T42A 4KGJA 4MAVA 2PC8A 4GY1A 3FEQA 3LB0A 4UTWC 4B92A 1TPEA 2OCZA 3UNDA 3B9AA 3HPAA 1GEQA 3C5QA 2HWGA 3NQDA 4MLRA 4IP4A 1SZFA 2WKJA 3NXLA 4PA8A 3ITYA 4HU3A 1LWJA 2UBPC 1EA0A 3AROA 1EIBA 2DSKA 2NT1A 3L23A 2PDJA 1XYCA 1O12A 3CK5A 3NDOA 4FHAA 5FEXA 1M41A 2GVGA 5TQLA 3QPYA 3A4WA 4CU7A 4CQ8A 1E0XA 4JKKA 1GJPA 4ERAA 4L1XA 1O7AA 4D8LA 4MJMA 1K9DA 3O6YX 4GCAA 2NXHA 3VIPA 3MP3A 4KGLA 5ABEA 2YL6A 1CLXA 3U2CA 3VNZA 1UP2A 4LYRA 3GC2A 1OM0A 4IQLA 1WDPA 4J3TA 1N7KA 2VCBA 1AH4A 3IANA 1H63A 2G4JA 1UBPC 1M01A 3GTHA 4GRSA 3C61A 5IDZA 1TUXA 3ES7A 2J7HA 3UWZA 3W7EA 5BMWA 4KFNA 3MKVA 3BG9A 4DLFA 5AC8A 4G7FA 3VKCA 3PZMA 2BOEX 3L0GA 2AL2B 2RAGA 2J6XA 3R4IA 4Q33A 2J7BA 1JZ5A 2GGIA 4TXEA 3MSRA 2GJPA 1X6UA 5HR7A 2D24A 1GKPA 1RBLA 5BMXA 1NDZA 5A6KA 2YLLA 5A94A 4YCPA 2MUCA 3ENLA 1DJNA 3C2YA 5GNZA 3M0MA 2VEKA 3S42A 3VABA 3BURA 3QZAA 4MUPA 2P0IA 3VDHA 7TAAA 1TTQA 4ORMA 2QJHA 4YMZA 5A6LA 3S5OA 3FVDA 4J3UA 4MNKA 1JQVA 4AY8A 2Q3RA 3Q2DA 1G0CA 3QEZA 3QFEA 5AHEA 2F6XA 2CLHA 4WY0A 1B5TA 1ITUA 4QHRA 1E71M 5EY5A 3RCNA 3VFLA 3SCRA 1LLWA 1XIMA 4GUJA 1KV5A 3VVGA 3EPMA 2AOSA 4AD5A 4N2YA 3STGA 1GVEA 3B9EA 1TJ0A 4RNIA 3BMXA 3TWBA 3VIIA 3E12A 3MC5A 3QLLA 1CLVA 4HCLA 2XFWA 5K9XA 4DUXA 4CQCA 1VFSA 4WKAA 3QHNA 2PEVA 2WPBA 1O60A 1VFFA 1H3GA 3GS6A 5I5RA 4X9YA 3RU6A 3WK3A 1LUCA 3L0KA 3LTPA 4K7VA 4Q8VA 2VQUA 4DUVA 2XDFA 2A5HA 3CQ0A 4JNZA 4M6UA 3EB2A 3M6DA 4D6JA 5AHIA 2P88A 4JY8A 3M0VA 1A50A 5A8OA 6REQA 2R24A 3PPFA 5C70A 4FLOA 3WEMA 3S1VA 2PURA 2KX9A 4I6VA 2WPGA 2CLLA 3SBFA 2XJ7A 1XBYA 1TMHA 4H8HA 4JEQA 2ZX8A 1V79A 2QCLA 1HGYA 3IUHA 2Y61A 4D6CA 4QXIA 3L5MA 3QN3A 1OEPA 4HB7A 2QMJA 2PF0A 1R3RA 4H6RA 4NASA 4MVAA 1S2AA 1HKWA 1ZP3A 3FSUA 5J5RA 5HJLA 2GZXA 3K13A 4KCTA 2QDHA 1H0GA 4JXCA 4DZ5A 5CPTA 3ITCA 3KCLA 3SJ3A 1MUCA 4UR9A 3WH9A 4NSBA 2JF7A 1CYGA 1QHOA 1ITXA 5HBFA 2QGYA 7REQA 3N6JA 2JIWA 1HX0A 1TELA 1TX0A 1B3XA 1GKQA 3Q45A 1E9YB 1IEIA 1W3KA 2CESA 3FGCA 3MSDA 1ME7A 4X9SA 2HNEA 3UCQA 1EXBA 1RSCA 1ONXA 3IJQA 1V7AA 2QLYA 3VIJA 2WNNA 5I09A 1C92A 3DU0A 1XIIA 3A3HA 4Q6XA 3TYAA 2E4TA 2GWGA 2WC3A 4LUTB 4A4AA 4LVDA 7ODCA 1AMKA 1RK5A 4ALDA 4P8VA 2QVHA 5H91A 1XIBA 1LDCA 3WQWA 3E96A 3AMLA 3AAMA 3QGAC 5I6SA 3FX4A 2C3ZA 3NOYA 2GFTA 3O63A 1S38A 3H26A 1PDZA 1FOBA 3G2GA 1Y65A 2ACQA 3XINA 1YTKA 2D23A 1UZDA 4Q7BA 3NURA 4FNRA 3UWWA 4PUWA 3GU2A 1THFD 1GVSA 1OGGA 2YA2A 4WRHA 2ACRA 2I5QA 4R9OA 5EMJA 1PAMA 3V1PA 2H3BA 4PFMA 3DI0A 4KRZA 2J24A 5CPQA 3VNIA 4GNVA 2IW0A 4W87A 2A7PA 1WBHA 1JZ7A 4HA1A 1SUXA 2VRKA 4YWSA 3P14A 3RR4A 1H7OA 1PSCA 4BI7A 1LROA 3WDJA 4G7EB 1YBQA 4ICNA 4IFRA 5DN1A 3ZZ1A 3TYCA 2BWGA 3NQBA 4FLRA 1J0YA 1MZHA 2P10A 1GEHA 3W01A 3F1QA 3PPHA 2AAAA 4CD5A 5JBDA 3DEQA 4IGNA 2DSWA 3T81A 1FWRA 3HQPA 5DEZA 4N0RA 4HNCA 3ZLFA 1E4IA 2XISA 4HK7A 2C0AA 2NUWA 1FWBC 3WH6A 3U7VA 4PR4A 4EVZA 5BU6A 4LYKA 1WQ5A 2F6UA 3N18A 1JDEA 5D8ZA 1UIPA 4W4QA 1TSIA 7TIMA 3A6OA 5E9AA 2PLKA 4R33A 1MW1A 2G50A 3RU8X 3KOFA 5IFTA 4C7GA 1MWOA 3TE9A 1EX1A 4Q6JA 4XZNX 1E43A 2HVOA 2DW6A 5AYYA 5M5DA 3C2EA 2WYSA 4AC7C 1SPQA 3W7OA 3WH7A 3IUDA 2D2GA 4R5EA 1J2BA 1RA0A 3KL0A 4KW2A 1VENA 1XISA 1PTAA 4YYFA 3SFWA 4IZGA 5F2IA 2ZE0A 1A5LC 1JAEA 3DI1A 3AHYA 2YL9A 1XBZA 2H3DA 3AYVA 1Y5WA 2FLIA 1QTWA 4PL2A 1KM3A 3B0VC 2P8BA 5JIWA 3HB9A 3N73A 2W27A 3SQMA 1K03A 1GOIA 3THQA 3WJSA 3VKKA 4KF1A 4DJFD 3W83A 3W02A 4P7QA 3G77A 1R2SA 1UWIA 4KERA 4P7RA 1PEZA 4HA0A 3QV6A 4M56A 1UH4A 3CBWA 1EJTC 2XVKA 1TX2A 1WZAA 3W1RA 1PTGA 3GYEA 1OB0A 3UR7A 1JVNA 4LFYA 4MB4A 4DWSD 5C9ZA 2ACUA 4GZ7A 5BRBA 4HTBA 2UY2A 1UKQA 3UR8A 3W22A 4PRRA 2P3ZA 1DHPA 4D8ZA 4GQBA 1XH2A 2GYIA 3SSJA 1BHGA 3W29A 1B9BA 3P62A 2ZRUA 1GQIA 2CU0A 2CKRA 3BDKA 3SUUA 3UJSA 5ABFB 2GVLA 5LNUA 4LEQA 3LEPA 1GZGA 1TE1A 3MI3A 1Z69A 2CLMA 3VZZA 2QW5A 1G94A 3STPA 5FJRA 3N6QA 1IR2A 3LK6A 1HJUA 3EA2A 3EB4A 1X7IA 1XH0A 1XUUA 1R6WA 1U1HA 1FCBA 1HKMA 3QPZA 4F48A 4M0XA 3BG5A 4UMBA 1FVPA 3GYCA 4ZGYA 4C6PA 5A6BA 5DY3A 4PYSA 3WK2A 4W5UA 3P6LA 3PR2A 3D47A 2X16A 3WG6A 7ENLA 5DMYA 4HZ7A 3INPA 1Q6GA 2G3IA 2E1DA 4JFWA 5CBIA 1VFHA 4Z42C 4F2BA 1XICA 3TN3A 3TKFA 4A8RA 2BY0A 2P76A 3BCFA 1EF3A 5C9XA 3UQNA 5I3DA 1NDYA 3HJZA 1WO2A 3OEXA 1VRDA 2PS2A 1ZBVA 4OTKA 3PUEA 1IYXA 3LX9A 4UOJA 1MNSA 4W86A 3XISA 1DIOA 1DORA 4KFPA 3ZJ6A 3H2MA 3GY1A 3H70A 4GYFA 4RXGA 2VFHA 4JIEA 3CUFA 2Z6JA 1I6NA 1EBHA 2Z25A 4QBXA 3PVFA 4HK6A 3S1XA 1XPGA 1QPNA 4Z1AA 3GVVA 1TJRA 3BPWA 3H21A 4HPXA 2A6NA 3LYEA 5CBBA 2VD9A 2VRJA 3L2IA 3OYXA 3VA8A 1OSEA 1XLLA 3DUGA 2O55A 3RITA 5JH2A 4LS2A 1W1A1 3VNYA 2OKOA 3POHA 1EQPA 3W7DA 1HF6A 1J96A 1PCWA 2GJXB 1Y8BA 3EZ4A 4IIEA 4UB9A 1WXZA 1ZJAA 6XIAA 4NZ3A 2E5CA 3MUZ1 4UBPC 3R8RA 1S2TA 4NNCA 1OC6A 4NZ1A 2HSAA 3G6LA 2P1FA 1VHCA 3FAXA 1BKSA 1G69A 1GONA 2E3ZA 1WZMA 3L2MA 2JQXA 4HQVA 4UQDA 3GAKA 1GOXA 1EZWA 2YCLA 1ISXA 4ONVA 1OFBA 2ZZ1A 3LPFA 4JHZA 1REQB 3M0ZA 3UZXA 4M8UA 2WSYA 1FHLA 1OBAA 5AHFA 2PRHA 3L4VA 5D05A 5L6UA 3LHZA 4AVNA 2Q02A 3ABOA 4G1NA 3IJDA 3W7RA 3EOSA 3O6DA 3ZJ7A 4IMAA 4LCRA 2NXGA 4B5NA 3W1XA 2VYOA 3VYLA 1QOQA 3U2EA 4DPPA 5I24A 4FXFA 1CGUA 5A2AA 3VNDA 1EA9C 3WQOA 4E8GA 5CPMA 3WNMA 2DH2A 4US5A 3GHUA 3IV3A 3C0JA 2PZNA 1NOWA 4FOJA 4UTWA 3FJNA 4ZB0A 4GH3A 1TRDA 3ISIX 1BVNP 3I6EA 3UD6A 2ALRA 4H9MA 1CXHA 2V5JA 3IJ7A 4LVFA 3U5UA 2B7OA 4BCEA 3R2GA 2J7FA 1TIWA 3AXIA 1OWQA 4AHQA 2Q6ZA 2D2OA 4HT3A 2IQ0A 3GW3A 2Y7FA 3UR5A 4MB1A 4F0HA 2XIIA 1AG1O 3P93A 2PGEA 2QJJA 1Y7VA 1W91A 3IS4A 2D22A 1XYAA 4W8LA 1RVGA 2F2KA 1YDVA 2FB2A 1UKTA 2QAFA 3ZR5A 3MJMA 3VZXA 4XKMA 2Y5EA 3ID7A 3TC7A 2HXTA 4GXWA 3C6CA 3CLWA 3F4VA 3L5AA 4FOUA 3UXDA 3GNRA 9CGTA 2Y8VA 1KFKA 1SJBA 2HJPA 1DEDA 1I1XA 4O4VA 1UUOA 4J3WA 2J62A 3L67A 1BSIA 2ZXDA 4RW5A 5K3VA 1PBGA 1BTCA 2VEIA 5A8PA 3H2EA 4JYFA 3OZOA 4AZHA 3HU7A 1MNZA 2J78A 1RCQA 2O92A 1PXGA 3U6WA 3N1AA 4N4QA 2VNCA 5I23A 5B7YA 4S3FA 5LHFA 1OX4A 2E8YA 1K9EA 5AN7A 3ICJA 1FTXA 2P0OA 1K7FA 2GVJA 4TR9A 2VWSA 2XSAA 4DXKA 4QE5A 1UOZA 3WDRA 4H6QA 1PHQA 3CM4A 1UUQA 1V0MA 3UCDA 2CZDA 2CIPA 4Z1YA 1Q66A 2CZVA 3GNPA 4O16A 2A3HA 3L9CA 3U3HA 3BCJA 4DPQA 4NZCA 2HTMA 3M43A 5B80A 2X05A 5D8WA 4PBEA 1JR1A 5BXSA 2HPMA 2E68A 4BK9A 3I68A 1OD8A 2CW6A 4AWEA 2WC7A 1CPUA 3MKCA 4C6FA 4XKYB 4GI4A 1NFBA 4W8BA 1V6YA 4CD8A 1UMYA 3HPXA 3NIYA 3TR2A 4LVBA 3T2QA 4DWSB 3H2OA 2DH3A 2Z2UA 1GCYA 2DV0A 4FX7A 3P0XA 3OG2A 3TYDA 2WMIB 2LLEA 5JIPA 1S2VA 3VMOA 1RQHA 1OCNA 4J3ZA 3LCFA 2A3EA 4S2CA 4BQ2A 4O18A 3PUGA 1XIGA 3P5ZA 4XWUA 2YCJA 2OWWA 4LBRA 1DQWA 5EBAA 4GQ0A 4Q8UA 5H6HA 3CPGA 3WQ5A 4Q8WA 3TWAA 4YU1A 5BOEA 4IGMA 5EMKA 1HP5A 1W1IE 4WQ6A 1WDSA 4BQ3A 8XIMA 1H5YA 1NF7A 4FNTA 1TIMA 1TV5A 5BYWA 4XIAA 3DX5A 2C6QA 1H4PA 2G4FA 4RPQA 3ARSA 4LNCA 3A9BA 3WJXA 1DWGM 3O0KA 3JUGA 4YTUA 5DCBA 5G4WA 4YTRA 2V0TA 5CLTA 3M64A 1J0JA 3S9YA 4YTQA 1Q8AA 2WSKA 5C54A 1XLDA 1FHVA 4Z1DA 2QUVA 4MNMA 1MEHA 2VDGA 3UJ2A 1TZZA 4KKXA 3VNMA 2JEQA 2X0YA 2PWVA 1E1CB 3ZYZA 4I8YA 1LG1A 1XG3A 1WAWA 3PS7A 4G2DA 3TV8A 4NXSA 4FB7A 2DZBA 4NP7A 3ITOA 4JQAA 4DBSA 1GQKA 1PPIA 1WKYA 1VCFA 5BOFA 4YYCA 3NAVA 3LNMA 1JGMA 4C6NA 2ZRZA 2JBMA 2VL4A 3UY7A 3ZJ8A 3CUXA 3GBDA 4PMNA 3UWEA 2ESCA 2Z28A 2FDMA 2PP3A 2AL2A 1EXPA 4LYPA 3N25A 3EWXA 3CV6A 5AOUA 1W6TA 1ITQA 3O16A 5C2GA 3W0KA 3EMZA 4F3HA 4LC8A 3TN6A 2Y4SA 4UTTC 3O3RA 1M3UA 5H8UA 2QCDB 3PSVA 4DJFC 3NSXA 3H7RA 4WJEA 1HKVA 2PI6A 1TZ9A 1TREA 1K6WA 4GZEA 1UIOA 1L8NA 5IDIA 2CKSA 3LI1A 1K6AA 1TJ1A 5FJJA 3S2MA 5C71A 3P0WA 1XM3A 4MNLA 5CJMA 4XIMA 3FVMA 4DWSC 4OKDA 2CWNA 3E38A 2XYLA 3K5XA 4J7RA 5DT5A 1KFBA 2UY5A 1P43A 1EYEA 1XP3A 3BLDA 1LOSA 2PWUA 1YE4A 4UIOA 3LLDA 1NQKA 1JL8A 1NSJA 1F8IA 4IHCA 2EPLX 4W7UA 3B4YA 3S2CA 5BU9A 1NQ6A 3EOLA 2GL5A 1D2KA 3MPGA 1Q7ZA 1V0LA 4JFTA 2G8ZA 3FJ6A 3C0QA 2GQ9A 5D02A 3N14A 3CUGA 2WMKA 1YKWA 4ZEPA 2YXGA 4LUJA 3AOFA 4GG9A 3O05A 3TJXA 2V5LA 4PB4A 3T0DA 1KWGA 1XCFA 1TB3A 3SY1A 1IIHA 1UR2A 3MUIA 5GNXA 5D32A 4K1WA 1TV7A 1WBJA 5DANA 4L1GA 3HGRA 5IM51 1CLKA 2FZMA 3UVIA 3W7IA 1XYBA 2A7NA 4JTDA 3R94A 1OF6A 3NPWA 4L4LA 4LVGA 4JFSA 2PCQA 2ZXBA 1SFSA 2GUUA 1V6TA 1A3WA 1XYLA 3WLJA 3NL6A 2YXOA 2J4GA 1V02E 1Q3NA 4POCA 5C5YA 2ZUWA 4Q4QA 4FO4A 2YGYA 3TYEA 1EO7A 4LBSA 4U4MA 3MS8A 1R85A 2V9DA 3R8HA 2ZFAA 3S2LA 3WH5A 3GUWA 1Z8AA 4P7NA 1JGIA 1I75A 1CENA 2IPWA 1OABA 4DAIA 1KM6A 3SZ8A 4LRTA 1OGSA 1A3HA 1A53A 1D8CA 4S3CA 3BO9A 2ALDA 1KFEA 2DZXA 5E09A 3T40A 1QI5A 2XINA 4NUWA 4RDVA 3TYUA 1XLCA 2W0UA 3BQ5A 1V77A 1VPYA 2DQXA 3KBSA 3V5OA 3TMLA 2W92A 1Q85A 4GK8A 2OOGA 4O15A 3TK7A 1KRCC 4S38A 3OVRA 3W28A 2YW4A 5EL1A 2IPJA 2VOMA 1K1DA 3CTLA 3KM8A 4L6DA 5LGXA 3WMLA 2OJPA 3T2PA 5F4SA 5JH1A 1KR1A 5CZJA 1S46A 2W91A 4B5TA 2HDJA 2EAWA 1HGWA 1TR1A 4XVEA 3D0CA 3UJRA 3MYOA 2WKGA 1AQFA 1E6RA 1KFCA 2ATMA 2B7NA 2HV5A 2VR2A 2J13A 1P0BA 2E6AA 1E6ZA 4YPJA 5F1UA 1PZ3A 1RY8A 3HFYA 3ZR6A 2R1KA 3PHAA 3ABSA 3O7UA 3QYQA 1P4CA 3HG4A 1YPIA 5BZAA 1L2QA 3BV7A 3WDHA 4PE8A 4C1NA 4LUTA 1DWFM 4Y2WA 3IJ8A 1F9CA 3F4DA 1Y0EA 4O50A 1OYBA 3MHGA 3WL1A 5DRCA 4UTFA 3FSTA 4N6EA 4IL2A 3QR1A 1E9LA 2DU2A 2ZDRA 3KRSA 3ONBA 2CXEA 4EIVA 3M0LA 4JTHA 3CYVA 4AISA 3D3AA 1UOKA 5AC7A 3C3UA 1TTJA 5FEPA 5TBOA 3RX4A 3ITGA 3VD7A 2G95A 3DG3A 2RUSA 3WQ4A 2PBOA 2R91A 4D1IA 4NKCA 1NP2A 1FDZA 4KMQA 2J9ZA 5JMUA 1PE1A 4YVPA 4UNIA 3MUCA 4QDWA 1AVAA 5LNRA 3KL5A 3AXKA 1W0MA 2QV4A 4S3EA 4DM2A 1W2VA 2JE8A 1OVDA 4FR6A 2TRSA 1TV8A 1V93A 3H7VA 3W2UA 2YOCA 1MEWA 1UWRA 4M6QA 3RILA 3RJXA 3ZIZA 4XG1A 4QG9A 4OT7A 2Z27A 3UYIA 1QNOA 1O1ZA 1ZB5A 3R0KA 3A13A 1IEXA 2XIOA 3OGVA 3BARA 4G7EA 4ZO7A 3AZTA 4M3PA 3C8FA 2YKKA 3CLMA 2O9RA 1E5NA 2PP0A 2VFIA 4WGXA 2REQB 2J88A 1VCGA 2Z1SA 1GZJA 1SO6A 4O1FA 3BAXA 3BW3A 3TQPA 5KZ6A 1XLIA 1KGWA 4IIHA 1ZZMA 4LH8A 3EXRA 2GUBA 3OU8A 1TPB1 3STCA 2DEPA 1XLEA 3APGA 3NDYA 4FNUA 3PAJA 3EX6A 1JRCA 3ARZA 5I79A 1V3IA 4O17A 3UESA 3AICA 2XPKA 4DO5A 3NO3A 2BOGX 3L4WA 4GNKB 1J18A 3VILA 1P0KA 4ZMGA 1TG7A 1NF0A 1H7WA 3PWIA 1C3FA 1RA5A 3LENA 1DJQA 2Z1XA 1Q13A 1OFDA 4ENLA 4CLMA 4FLQA 3K4DA 4UQ9A 1TUFA 4QQUA 3S5ZA 3DZ1A 3CEPA 4NT0A 3DDMA 3U4AA 2WBKA 3G1DA 2A79A 2EJAA 3AIQA 5BRPA 1RLDA 3W25A 2VDIA 3LCLA 3LRMA 4FNSA 3U4FA 3VGGA 1ECQA 1XQLA 1CB2A 2NUXA 3PUDA 2FPVA 2WZTA 3KWSA 1UCWA 1BXCA 2D2JA 4Q4PA 1RCOB 4FEZA 2KZHA 4GH1A 4IL0A 3MU7A 3V7PA 3CZGA 5CJNA 4EF8A 3NM1A 2J75A 3R25A 4HNUA 4U3AA 5TIMA 1K4HA 4B5UA 1EO5A 1UQZA 3TC6A 4HU4A 4EPDC 2D20A 2EBNA 2NV9A 2E6FA 4A8NA 4CVUA 1VLWA 4JTFA 3Q94A 1XL9A 5D03A 1EWEA 3MSGA 4DF1A 1AD1A 3HJEA 4ZCWA 4QJ5B 3PAO<