3LYEA

Crystal structure of oxaloacetate acetylhydrolase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
293
structure length
285
Chain Sequence
EPFSGAKKLRHLLENTDELIVCPGVYDGLSARTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDPFGPPLIADMDTGYGGPIMVARTVEHYIRSGVAGAHLEDQILTKKVVSRDEYLVRIRAAVATKRRLRSDFVLIARTDALQSLGYEECIERLRAARDEGADVGLLEGFRSKEQAAAAVAALAPWPLLLNSVENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHGVVGTPDGITPVRLFEVCGLQDAMEVDNGAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxaloacetate acetyl hydrolase
publication title Structure of oxalacetate acetylhydrolase, a virulence factor of the chestnut blight fungus.
pubmed doi rcsb
source organism Cryphonectria parasitica
molecule tags Hydrolase
total genus 102
structure length 285
sequence length 293
ec nomenclature ec 3.7.1.1: Oxaloacetase.
pdb deposition date 2010-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3lyeA00
2VGGA 1U5VA 4KCWA 1ZLPA 2DUAA 2VGIA 3LG3A 4ROQA 1F3XA 4TV5A 1A49A 4B5WA 4WJ8A 2G50A 1Z6KA 2X0SA 2VWSA 2XZ9A 2ZE3A 4JPGA 4YNGA 3QTGA 1KC7A 1ZJHA 3EZ4A 3OYXA 1PYMA 2OLSA 4RPPA 1T5AA 1E0UA 2KX9A 1M3UA 3U2ZA 1F8IA 1PKYA 2HRWA 3QZ6A 3T07A 3I4EA 4QG8A 4L9ZA 3SRKA 4B2DD 4YJ5A 4IQDA 1E0TA 1IGWA 3E0VA 3H6OA 3GG8A 4B5VA 3GR4A 4TV6A 3KTXA 1DXFA 1XG3A 2V5JA 4KCUA 5JVLA 3M0KA 3SRHA 3HQPA 4QG6A 3N25A 3B8IA 4IMAA 1SGJA 1PKNA 3QV8A 1O68A 1S2TA 3QV7A 3BJFA 4FXJA 1M1BA 3E0WA 2QIWA 1OY0A 1KBLA 3SRFA 2XZ7A 4KCVA 4B5SA 1O5QA 1F3WA 1DXEA 3OYZA 3FA3A 2XDFA 3KHDA 4KRZA 1A5UA 4HYVA 4LSBA 1VBGA 5TAOA 3QV6A 1IZCA 1DQUA 1S2UA 1S2VA 4FXFA 3P0XA 3T0TA 3QLLA 4QGCA 3QQWA 3G2GA 3PP7A 4IQEA 4L80A 1O66A 2HWGA 3HQOA 3FA4A 2BG5A 3LYEA 3ME3A 1PKLA 1U5HA 4KS0A 3BJTA 3EOLA 4L9YA 3M0JA 1AQFA 3PUGA 4MG4A 1DIKA 4G1NA 2VGFA 4DRSA 1F8MA 1F61A 4KCTA 1MUMA 1PKMA 4B5XA 3R4IA 3SRDA 2HJPA 3GQYA 1A3XA 3EOEA 4L7ZA 2R82A 3E5BA 3HQNA 2DIKA 3IS4A 4HYWA 1VBHA 1XG4A 3T05A 2V5KA 1A3WA 1OQFA 4B5TA 3QV9A 3OQ8A 4IP7A 2WQDA 2HROA 1S2WA 3MA8A 2L5HA 1JDEA 4B5UA 4B2DA 3VAVA 3EOOA 4QG9A 2VGBA 1GGOA 4MF4A 2VWTA 1UJQA 2E28A
chains in the Genus database with same CATH superfamily
1CLVA 2PDGA 1UKOA 3GYCA 4ALDA 1MNZA 4PL2A 1PL9A 4ERAA 1Q4NX 1W5OA 3LI1A 4IUGA 2WHKA 2VDHA 2G4JA 2EXOA 4Q6XA 6XIMA 1PYFA 1JZ5A 1TVPA 1XIFA 4HU3A 4LEFA 4X2PA 5E70A 1DIEA 1RR2A 2V5JA 3PFMA 3UJRA 4E6MA 4UOZA 1HZYA 4L1GA 5FOOA 1XLAA 3SCWA 4ZFMA 2UV8G 3GG1A 4ATWA 3BJFA 1IXPA 3E0WA 3STPA 2Y61A 1E1FA 2WLZA 4P7RA 4HMCA 1PIFA 1W3HA 2GK1B 3AI0A 1UD4A 4A3RA 5HR7A 1K7XA 1VHCA 2J7GA 5LGXA 2XVLA 2Q01A 1REQB 4J3SA 1C91A 3DGRA 2WSYA 1JUEA 1W9XA 1R9ZA 4NHVA 2Q09A 3W7OA 4AH7A 3KUMA 4M24A 4AZ5A 4QBXA 4I3GA 3OGVA 1BYDA 2ZVRA 1LQ2A 2FPVA 3S9IA 3FVDA 1TTPA 1GTHA 5K4ZA 1AMKA 4FIQA 3WDIA 5DBUA 3ZQ9A 4G5DA 3IACA 2WPBA 3LCFA 1W54A 5D9MA 3OGSA 3EOOA 1GVQA 3EWZA 4CD4A 4CLMA 2J6VA 1YDOA 1Y65A 3WF0A 1PHWA 3QH2A 3AROA 2Z26A 3BLEA 1HKVA 3WUBA 3TQKA 2VZVA 1W17A 3GRIA 2J9ZA 2R94A 3GXMA 3SW6A 3R8RA 4C1KA 4WY0F 1K8ZA 2NX9A 2BNJA 3KTXA 2I1OA 4RNJA 4WDUA 1JXJA 2KAUC 1JZ8A 2D2OA 2ZXQA 3URQA 1EJRC 3WQEA 4HOZA 1IT8A 1SM9A 3KXQA 2GJXB 3IJ8A 4Z0SA 3N2CA 1SZNA 1SYTA 1JPIA 1TZZA 1X8FA 3W7HA 4XZMX 1O95A 5HK4A 1IEXA 1G69A 4GA8A 5C9XA 4RJEA 2WMKA 2DZXA 2OGYA 3CHCA 3ITCA 3NZQA 1UD3A 1GQJA 4A8IA 4JN8A 3FK4A 1OZQA 3BSGA 4U2YA 4NAFB 3MUCA 4UQCA 3N9RA 4NP7A 4IM4A 1PV8A 1VFOA 3L7RA 3CUHA 5IXEA 4R9OA 2VC5A 4UFLA 4GLEA 2V5KA 1XGEA 4IJCA 3W84A 3S5NA 3W7IA 3N2OA 4CN6A 2YCJA 2VX7A 4WIWA 2UZ9A 1OBAA 4LCSA 1J9YA 2FGZA 2BV9A 3NZ1A 1V02E 4E4UA 1XICA 2YA1A 1U33A 2X0HA 5FAGA 2WKJA 1XFBA 1Q85A 3SCVA 4UQDA 1LWIA 4KETA 1M7OA 1WZMA 2QUVA 4F0MA 4CD5A 4H8NA 2Y88A 3ARYA 3N2XA 2ZBTA 2CWNA 5IFPA 3C56A 3VA8A 1M9HA 3SRHA 3FX4A 4UFMA 1GWJA 3LXBA 5DMMA 3DU0A 3W07A 3GVGA 3MUIA 1LORA 1XIJA 3ARXA 3UR7A 4H6QA 3UXAA 2W91A 1E9ZB 4H83A 1OYCA 4NY2A 4BF7A 1SFSA 3MHUA 1R7OA 1V0MA 2WHLA 2HPIA 1VFUA 2D2JA 3C2RA 5T8GA 5EA9A 5A2BA 4DBWA 5FSEC 7CGTA 1LP6A 3D3FA 2WBGA 1GYMA 4X9SA 3W01A 2OEJA 3L2LA 2BLEA 3FJLA 2OWCA 1Q7MA 3CWNA 2PGRA 2J7FA 3VD5A 3AS3A 3M0HA 3GDTA 4QJ4B 3RJYA 3PG9A 2V67A 3NSNA 3EDKA 3T44A 2XIQA 1KXTA 2P88A 4JFTA 4BQ4A 1H7PA 4J35A 4PN2A 5CJ5A 3T1GA 3E2QA 4ZODA 1DIOA 2IKGA 1V3LA 4XKYA 1OABA 2ISDA 1IHIA 3VIMA 1UPPA 3HQ1A 4BWLA 1ZUAX 3EZ4A 1W1VA 5JBDA 4XAZA 2Y2WA 1R9YA 2RUSA 4W89A 1GVYA 4HCLA 1DJNA 2DUXA 1IGWA 4JD4A 4F3HA 3U0HA 3M6YA 2ZZ2A 2V69A 3H4WA 4RX0A 3PZTA 3TP4A 3BV4A 4QG6A 4CVWA 2AGTA 2RJGA 1ML1A 1NJJA 3EKLA 4I7UA 2GUBA 4M6PA 5HMSA 4K8GA 1CGUA 3T8QA 3QV7A 1DJHA 4O8AA 3AHTA 5I00A 3ITGA 1EWDA 3L2MA 3SFKA 1F4HA 4PMUA 3A9IA 4N2YA 4M29A 1V3KA 5DCDA 4JEJA 4CEUC 1GORA 1KKRA 1AODA 3DESA 1V02A 4PBGA 2QVHA 5A95A 4NAEA 2WB5A 2QLYA 2Y7DA 1W31A 1F6KA 2D1ZA 1W1YA 3P5ZA 1GOOA 4LTSA 1C93A 3R11A 4KWSA 4WDTA 1YXYA 4AG0A 1DE5A 2RDTA 4Q8NA 4GVGA 4OOUA 2DUAA 1ADSA 3G8RA 3N6JA 3MVTA 4XIMA 2PPGA 3N4AA 2P76A 3NSXA 1EIXA 1GKRA 5I3GA 1VPQA 1G1YA 2B7OA 1AJ0A 1JPHA 3IJDA 5IHSA 3GDKA 4LALA 4GACA 5HWMA 5EU9A 4L64A 5KZEA 1NVMA 3C0JA 2YR1A 2V30A 2Q3OA 1O7AA 4MZ1A 2UBPC 1AK5A 4L65A 2QJNA 2BHUA 3L4ZA 1MI3A 2DZAA 4NKCA 1KLYA 1PX3A 3KOXA 1H7RA 3CQ0A 1TIWA 4D1IA 1ONEA 1TJ2A 3V16A 1B3XA 1GZ1A 5JIPA 3QEZA 5H91A 2A4AA 2O0TA 4KEZA 4MY8A 3AIWA 3N4EA 1KGUA 2NV1A 1P0KA 2ZCGA 3L67A 4QP0A 1H61A 1YE4A 3W00A 4PB4A 4HA0A 1VYRA 3ITYA 2R14A 4O50A 5CZJA 3C3NA 1S5MA 5CG7A 2B7PA 2ZX9A 4DO7A 1YMYA 4H6EA 3MSGA 3ISIX 3EOSA 3TK7A 2NSXA 3G6MA 4AYGA 1R9XA 4E4FA 5XIAA 3L4TA 3MV11 3TYCA 2WVSA 2XIOA 4MTVA 2ZZ4A 1I1WA 3PWAA 3CPUA 1KB3A 1XYCA 4I9MA 2WCSA 4Q4QA 2CZ5A 1AL8A 4RE0A 1S3HA 5AHEA 4QLJA 4GKTA 5CC7A 1A5LC 3M0ZA 4P8WA 5HPOA 1JXKA 4O15A 3UESA 4GQBA 5BXPA 1DPMA 4QITA 1GYLA 5GNYA 4NJJA 3W1QA 4TU1A 1M6JA 1ICPA 2WWCA 1Q45A 1UOZA 4I5UA 1ISVA 1UZHA 1YNYA 2D2HA 5F2GA 1XKYA 2HVOA 2QCNA 3KCJA 2GQ3A 1H7XA 2GOUA 5CGQA 1D3HA 3WQOA 1Y5VA 1PXGA 5I79A 1KV5A 3B9NA 2WMIA 3TV8A 3VKKA 1XQKA 3OIXA 2Y8VA 4JYDA 3AWOA 5A6BA 4IFKA 4IMCA 2W0UA 2XTKA 2V2CA 4IQLA 3UG5A 1V0LA 2ZYFA 4HKPA 2ZWZA 3S46A 5KMYA 4EXAA 3U2EA 4JKMA 5CC3A 2BMBA 4DWSC 2ZRXA 2W92A 2ISVA 3HF3A 3TR2A 3BLLA 1R3TA 1A47A 3ANYA 4C91A 5FI8A 2X1RA 4W93A 3DDMA 3CUZA 2EHHA 4U4MA 3CV2A 2WWDA 2KX9A 2I5QA 1ICQA 5D05A 4ZXOA 2VX4A 1UD6A 2DGAA 4K39A 3PZGA 3NQAA 2OO6A 2FPTA 4MKSA 4LUTA 1YBQB 3OP2A 4N42A 1XUZA 4Y96A 3GC5A 1YYAA 4NQ1A 2YA0A 1E6QM 3K4AA 1QASA 5FACA 2BVYA 3SI9A 4ZEPA 4HMDA 2PDXA 4N0RA 3S6OA 1KM0A 3SQMA 3MMUA 3R0KA 4U5IA 3E96A 3E5PA 3H12A 1IV8A 1IEIA 2ZA1A 3VDHA 2AKMA 4IT1A 5LIXX 5TAOA 4BCEA 4OECA 5E5CA 4Z1AA 5EMUA 2EO7A 3K4WA 2VC9A 2CLEA 2J79A 1R3WA 3L4VA 3A5VA 4KRTA 4QEEA 3QY7A 5A6BD 4KIEA 1TPDA 3VVGA 3L21A 4L9YA 4AWTA 2DY3A 3BK0A 1NM9A 1VIZA 2VZSA 1UKPA 4KBXA 1LLOA 4MLJA 4O1CA 3NJ3A 1WP6A 3VKBA 1D8CA 2WLYA 4EKJA 4DLFA 1RLDA 4H7ZA 4Q4OA 1HJVA 4M80A 3MA8A 3WJSA 4O57A 3DYPA 5AHIA 5HNUA 4CNSA 2JALA 4Y9PA 2E8ZA 4US5A 2IS7A 2X42A 2Y8UA 5KETA 1P1MA 1UP2A 4ZO6A 3OLEA 4UR8A 1DWAM 4TV5A 4W8BA 3G1VA 1QI3A 3TSDA 4LAKA 2J24A 3S0CA 3B9EA 5I02A 4F9JA 4BI7A 3D47A 3ZJ6A 4ZTXA 4XUGA 5E9XA 5KITA 1EP1A 1YXCA 1LL7A 2JKEA 1KQYA 3CXOA 2QDHA 4A22A 4AWEA 3KOZA 4OBTA 3SQLA 4GH1A 5CZSA 1C7SA 5K9CA 3V5CA 4JFVA 5DT7A 3LSBA 5A6TC 4DPQA 4GGBA 5LZLA 3WDHA 3A21A 3R6IA 2VFEA 2NUYA 3SO7A 1TQJA 3SIMA 1G4PA 4U33A 3H7RA 5CC6A 1CLXA 4GVIA 5BU6A 1OGSA 2CBIA 2XIMA 1QBAA 2C0AA 4S3DA 2QUMA 3NXFA 1DIKA 4IFOA 4MKVA 4DRSA 1HW6A 2QV4A 1A3XA 3VD4A 4ZQPA 3S5YA 3N2TA 3W28A 3JU2A 4BK9A 1PIGA 3W3OA 4US5D 1WXYA 3UWUA 1GONA 1OGGA 5CQ1A 4IMFA 3T78A 1X6NA 2DZVA 3F2CA 4XZ9A 5HINA 4JTKA 3TYBA 3BZJA 1PPIA 1QOXA 1UZ1A 4WOQA 3SAZA 4O53A 3NYZA 2ZZ7A 4B9YA 4HQVA 1TV3A 3UBPC 3PZ9A 2XH2A 4TV6A 3S1GA 5H6HA 1QR7A 4IL2A 1GOXA 1ITUA 4ZZ9A 1Q6DA 5LNSA 1E55A 1E6SM 4I5XA 5F2MA 1XLLA 4JCLA 5A5WA 3G24A 2IPJA 2YDQA 4DAIA 4DWSB 1UYQA 3M9YA 4JYEA 4D6FA 3M7WA 3DHDA 1W9BM 3NQFA 4YLWA 1FP8A 3M5ZA 1IWPA 2YZRA 2XHYA 4GMEA 3TKFA 4FNQA 3BLDA 4O54A 3B06A 4TUFA 1JYNA 1KFWA 2E0PA 1XIGA 1YADA 1J0IA 1R0MA 3EOLA 3AALA 2EF9A 4AHQA 4J5NA 3Q2DA 3IK4A 4GI4A 4W7VA 1TZ7A 5C2GA 2HISA 1UMLA 2PRHA 2ZX5A 1C90A 4Q4MA 2YSWA 3RM8A 1SFTA 4AY1A 3VMOA 3I10A 4WSHA 4MUPA 1UWQA 3TTYA 3S5OA 2DV0A 2YDRA 4HZ6A 1LQ0A 3NQVA 1JL8A 1JPKA 4Z17A 1E4MM 3P67A 3OYXA 5CEWA 4W7WA 1IZKA 1G6CA 2C7FA 1ZZMA 3PANA 5G4EA 1XLKA 1CXFA 1NP0A 3H53A 3H6OA 4HGXA 4AHPA 1QU4A 2ACUA 5D38A 3AHYA 4Q32A 4D6CA 1W1B1 2B0MA 4NT0A 1FKWA 3KP1A 1XJBA 4DZHA 4P8VA 1KTCA 2GVJA 1XD0A 3AXKA 2AQWA 3LRKA 3NPXA 3U57A 3YPIA 3VGEA 4Y8FA 3IRDA 2G41A 1YNQA 4BF9A 3OTRA 4JQ4A 2O55A 2ZVIA 1XBYA 4O0ZA 2Y7GA 4B16A 1UC4A 1RA0A 2Z1KA 3KBWA 4L6OA 4MJ2A 5JBFA 3SN1A 3JS3A 2NLIA 5D9NA 3GXPA 1H0IA 3GU2A 1FXPA 4J4KA 4JHOA 4PRTA 2D0HA 3PPHA 4J9JA 1R38A 3ID7A 4DWSA 3T05A 4DUOA 5H8UA 3BDKA 2CZEA 5LYRA 3GG7A 1RY8A 3NEHA 3SCNA 3LK6A 1Q63A 5AHNA 1J0HA 1S39A 5JQ9A 3MWAA 3NOEA 3RU8X 1IWBA 2E6DA 4QQ3A 5HQEA 4KESA 2BODX 2WXDM 2XZ9A 2ZE3A 1XINA 4ICNA 4XISA 1CCWB 3M47A 1IR1A 4QDPA 2AMGA 4PBEA 4C6QA 1E0TA 4LW7A 4J1OA 1JF5A 1QHZA 1UD5A 5HJYA 1DWIM 4XD5A 3MUXA 1H7OA 1Z44A 3M0KA 3ATZA 4HA4A 3CU2A 4I8DA 2NLYA 3WUFA 2C16A 1ADOA 5D2YA 4QJ3B 4W86A 1K4GA 3H21A 5LIUX 3EB4A 1UKQA 3VMPA 2CNCA 3WQCA 1MFUA 3B8WA 1R85A 2A6LA 2Q8LA 3E74A 1CEOA 1BF6A 3RCMA 4Q4SA 3WQDA 1S2VA 3VNMA 2WC3A 1CECA 1JR1A 4H6KA 2OO0A 4ECLA 1OT2A 3A3XA 4MHBA 2GWNA 1WOBA 4GJ1A 1R2TA 4IIGA 4NJHA 2QCMA 4JIHA 1LQAA 1U1UA 3E5BA 2GWGA 3QY8A 4DWSD 2EAWA 5AY7A 3FHQA 3DG6A 4JN7A 3R5EA 3LGEA 2ZX8A 1ZBKA 3OLDA 3IUIA 3SDOA 1SJAA 1SMAA 3VIGA 1GQNA 1MUWA 4JL2A 2CHOA 4KKXA 3HA1A 3S2CA 2X2GA 1Z6KA 4ASTA 2ZZ3A 1P4CA 4JHMA 1JAKA 3L23A 1RV8A 3VOJA 2DT1A 2OJPA 2XWDA 1MZHA 4GUGA 3W76A 3BW3A 1RK5A 4CNOA 4OT7A 2PDIA 3AO0A 1EX1A 3ZLFA 2QCGA 3ARQA 1NEYA 4H19A 3W6LA 3CBWA 1FA2A 1GZGA 4O18A 3THUA 1D2KA 1OG6A 1W5QA 2Y7FA 3RX3A 4L1WA 1RCQA 1ISYA 3HURA 3C0SA 1FWGC 4NYYA 3TQVA 4A35A 4ML9A 3V35A 3WH9A 2ZTKA 1KCZA 3HMJG 4S1FA 3LQLA 1XR2A 1R3SA 2YCKX 4W85A 3PY2A 3HG3A 3ME3A 2QF8A 2V5BA 4ZB0A 3UA3A 1HVXA 1F05A 4IHCA 2X40A 1TE1A 4PYSA 4XBKA 3F2BA 2VEPA 4WY0B 1V4YA 3CHEA 2XSBA 1YE6A 3CYJA 2DT2A 2QMJA 5A6MA 3VIIA 2JKPA 3G0XA 2ZUMA 2IKHA 2PUZA 4C90A 3RFAA 4FLRA 2NW0A 5CPTA 3PAJA 1X6LA 1EEPA 1G4EA 4FIRA 1IEQA 1BXCA 4IPJA 1OG0A 4Y7EA 4Z0JA 3WFAA 4Y9AA 4CNTA 2YL6A 3MO7A 3UCQA 4DZ5A 1JRBA 2ZWYA 1XRTA 2NXHA 4J3UA 2UY5A 4LF1A 1OD0A 3UG8A 2PDLA 1TV2A 4LUIA 2NUWA 3UPMA 1JUBA 3FY1A 1ODZA 1FWWA 1WV2A 3S1WA 3UR8A 2A7PA 1FDYA 4HNLA 3QLLA 4LCRA 3HQOA 4GYPC 3XIMA 4GKLA 4B5NA 4QHRA 3ZJKA 2CC0A 1AZ2A 1W91A 1YPIA 3Q37A 4LOCA 3O15A 4A4AA 3WJXA 1A3HA 4H8UA 4J2MA 1OIFA 3O2LA 3MP3A 2EG7A 2ZRZA 4K8HA 5H8PA 4MIMA 3LHUA 5J04A 2PWGA 4AVNA 3AUJA 3N6QA 3MY9A 2IQ0A 1EA0A 2TMDA 4HBKA 4FOKA 4LAZA 3GFXA 3H55A 1ZJAA 3S3GA 4FP1A 2H90A 3OHIA 1LWHA 3SURA 4GY0A 3ALGA 4HZMA 4AXKA 1SZRA 5AYIA 1XYAA 1QI5A 2CHRA 2VR2A 5G5IA 4PTWA 4B9ZA 1OEPA 3NGFA 4XO6A 3KS6A 5A2AA 3C6CA 3L4WA 3SM0A 3TYDA 3MDUA 4PSPA 2ZZ1A 3CPRA 4H9TA 4ZL1A 2QAFA 3HG5A 2JGQA 1GVIA 5F4WA 5FJTA 3K1DA 3P3BA 2VFHA 1YDYA 4PCSA 1ZAHA 4NJIA 4PMVA 3I3DA 2Z2AA 4PC8A 1UOKA 4G9PA 3GD6A 4JY9A 3MO4A 1AH4A 1EDGA 1CGWA 3NQCA 2GVYA 3PUGA 5KEZA 4WZHA 2OR2A 2FHCA 5XIMA 1V6YA 2HVNA 3VNDA 3CEUA 1OFBA 4HU8A 2E9LA 3ARWA 4M7TA 1KXQA 3USZA 4HT3A 1XLEA 1Z42A 2FHFA 3BC9A 1A4LA 3A4XA 3L5MA 3T08A 2GZXA 1HKKA 3DIPA 4QG9A 2J7CA 1OFDA 5D9PA 1HF6A 1TRDA 3DUGA 1WO2A 3RR4A 4AF0B 3HPAA 3FEMA 2O7QA 1ENUA 3FJNA 4JTSA 2W62A 3CAWA 4JDBA 3PJXA 3PUEA 1ZENA 1MW2A 5AYYA 2X1TA 1UUOA 3SUVA 4AD3A 3HJEA 4A3YA 2PTZA 2DJLA 4ZOCA 4ACZA 2EJAA 4AZIA 3BICA 4Z1BA 4JX6A 2YLAA 3MHGA 2QJHA 4MGGA 3LSCA 4UOJA 1RD5A 1B3ZA 1A5UA 5C6MA 1B57A 1AH3A 2O4MA 1K7FA 3UNDA 4FF7A 4QGCA 4QE5A 1Z32X 1VH7A 5FKYA 4AZHA 1S5WA 1LUCB 2E67A 1UZDA 3LU2A 2D22A 3CUGA 4PUUA 4GXPA 2PDQA 3HPXA 4GQQA 1O1HA 4K2SA 4E0CA 1EGVA 3IJ7A 3THQA 1MUMA 4RZ4A 1PKMA 1XSIA 4AVFA 2QKFA 4D6GA 4HN8A 1VLIA 4ZBCA 3UY7A 1NY1A 2RFGA 5LIKX 1SO4A 2E09A 1PZ3A 3OVPA 2BVTA 4YPJA 2CETA 3BZGA 3JZEA 3PTDA 1BRLA 3WLNA 1HKWA 5FJOA 4CCZA 4XKMA 2PD9A 4YXGA 4H9XA 2CYGA 5BMXA 2ZICA 1B4EA 1H5YA 1J2WA 3IGUA 4QJ5B 3S4TA 3W0KA 1I45A 3TW7A 1X7IA 4PUEA 3B4YA 4M1BA 3UXKA 2CZVA 1QUMA 2GL5A 3LPOA 8CGTA 4M82A 3KBMA 1L6FA 1FWTA 1UROA 3P8IA 1T41A 3GDLA 3L0NA 5JVLA 5E9AA 3C8NA 5C71A 3KDOA 1NH6A 1XYLA 3CPGA 3KLLA 3GU9A 3KVKA 3EAUA 5DY3A 3WF1A 2X09A 2VENA 4Y9OA 4FXJA 3QHOA 2WYSA 4GOAA 2F2KA 3GBDA 3LLFA 3FW6A 1V6WA 4GO8A 3EGJA 5L6UA 5FF7A 2G3JA 2VEKA 1DQUA 4IPIA 4A2RA 4IUOA 3ZS4A 2D3LA 1Y8BA 1EL3A 5CJMA 3ZWSA 5F2IA 1C8QA 1KFLA 2OU4A 5T91A 4IG2A 4MLRA 5KSWA 4IXHA 1VAHA 3HTWA 4R7JA 3UJ2A 5FEXA 4A29A 2PS2A 3TOPA 2YXXA 1TTQA 4ZO8A 1UCWA 1WCGA 3LCWA 3AXHA 2R1LA 4UZUA 1E40A 3AXIA 1H49A 5AN7A 4URIA 2WNZA 4O14A 1BSIA 2VWTA 5BYWA 1W1ZA 4MMWA 9CGTA 3WMSA 2GGGA 3ITOA 3W1PA 4HYRA 3RRXA 4GRSA 1P0BA 3IV3A 1KC7A 4Z1YA 5C70A 2GQAA 2R9RA 5ABEA 3TC7A 1AJ2A 3NPVA 4B2DD 3CUFA 5IOBA 2ZUNA 1LLWA 5D04C 5I09A 4OOZA 1V03A 3LUTA 4WOZA 1DBTA 3EWYA 2KZHA 3GTIA 4YTRA 5SWUA 1HFBA 4NX5A 1M65A 3C4UA 3SRFA 3NWRA 1GVEA 1LZOA 4GIAA 4E2BA 1R86A 3FYPA 3WBAA 5AVNA 2XIBA 4OQVA 4UNIA 4S2CA 3VGFA 3VC5A 3BAYA 3QW4B 1HTIA 3ZMRA 3WH6A 3PBGA 4YHGA 1HL8A 4GYPA 3UVIA 2W5FA 3B9AA 3WNKA 4DO4A 3IIVA 4PUJA 3O1NA 3D5HA 4MYXA 2PURA 1Z7AA 2WBKA 3L0KA 4EX4A 5JXQA 2CFFA 3EYPA 3HGSA 3P0WA 1WUFA 2YJQA 4AIUA 2VT0A 3C2VA 1YNPA 3OLIA 2BP1A 3TX9A 1L8NA 1VFSA 4Q8TA 1CENA 1RBLA 4QIUA 3W2UA 4AAJA 4KCWA 4C60A 4FNPA 4O8RA 1PX4A 1J6PA 4CQBA 2FH8A 3W83A 1I2QA 4XK2A 2GPTA 3GIQA 4GFIA 3BCDA 4O4WA 3DHUA 3OO2A 5TF0A 3GXNA 1B3WA 4DIAA 3RU6A 2PLCA 4LS0A 3BH4A 1UR9A 2IMRA 3LV5A 1CT5A 1DQWA 4XD3A 1BSLA 4V1YA 1LT7A 3O9NA 1S38A 1XBVA 4RPQA 3H22A 2A6NA 3FVMA 1K8XA 5FF0A 3R58A 3I65A 3EEGA 1XFCA 3AS0A 4IQEA 2OMAA 3TYEA 4M5PA 1WKYA 3TTQA 2YCIX 1J2BA 3W2NA 3DKJA 2TPSA 4N02A 3PBYA 3LGDA 4IFRA 1KCKA 4ZQOA 3LD5A 1Y5XA 4Z08A 4BFAA 4GFSA 3QFEA 2HVMA 3W24A 1SZEA 3DX5A 3GW3A 4H2HA 1XXXA 1T96A 1CXHA 2HROA 1OCQA 3WQPA 1YIXA 3FN9A 4E8DA 2XINA 3KE0A 3VAVA 4FLSA 3EDJA 3VIJA 2FGLA 1XLJA 4DBSA 1BD0A 1U5VA 2PU0A 3OA3A 1ESWA 1W5PA 1ZCOA 1BGGA 2FH6A 2HPMA 1B9ZA 2F2HA 5J8LA 1LL4A 4GZ7A 3RMJA 4KGLA 3AIEA 1SUXA 3W9ZA 3MTWA 2G96A 2ISWA 2EG6A 1P1XA 4AB4A 3MANA 4IPPA 2PWHA 1TX2A 4UTIA 1JZ2A 1Q66A 4QLLA 1UPMB 3N14A 4YL2A 1OGBA 1KGXA 3BLIA 2C13A 3V7PA 4BR1A 1C8YA 2ZOXA 1QPOA 4ZTYA 1KBLA 3BAXA 4QLKA 1JZ6A 1B31A 4GK8A 1DXEA 2QAPA 3WKZA 3GNPA 2Z4GA 4K1GA 4QISA 3W7EA 1JQVA 5JUVA 1WDSA 4NZCA 4LNYA 4DAFA 4JZ5A 3R79A 3W7CA 2A1YA 5I3DA 2E9BA 4E8GA 1EO5A 1FH8A 3R4IA 1SVDA 3HQNA 3WEZA 1XG4A 2PE4A 3VCRA 2F6XA 1W3JA 1ZB5A 2D23A 1PTDA 1H2JA 2BB0A 1E9IA 1W1PA 4JTTA 3H23A 4LVAA 1FCBA 1AVAA 1CW2A 3AU2A 2D0GA 3AIRA 3V75A 4YNGA 1X39A 3GNDA 1RH9A 4YTQA 1LBMA 3IIZA 2TYSA 5LSMA 4YMZA 3WZ0E 2IXUA 3ERPA 3GAYA 3VKAA 3POHA 2YCLB 1XCWA 4EWJA 3NXLA 2V5DA 3UP8A 1VKFA 1QHOA 4XAPA 1CB2A 1AA1B 1NDYA 1TPEA 4ZSUA 5GJMA 4MAZA 5IFTA 1K8YA 1AFSA 4YVXA 3QKZA 4YYCA 4ZQCA 4AMAA 5HUOA 2G97A 1XYZA 4PRWA 4P61A 1LG2A 1M5WA 3TJXA 4W5UA 2XFRA 2OB3A 3LY0A 3AFBA 2ZRYA 2ATSA 3OYZA 4Q7BA 1XCXA 4IF2A 5IDIA 1ODUA 3VM7A 1YXDA 4HSHA 4C7GA 1NFBA 4EACA 4QE1A 1ZNNA 2PP0A 3CV1A 4O17A 3WJWA 3CL8A 3V0SA 3VGDA 3IWPA 4DYJA 2C18A 2ALRA 1HJQA 4RNHA 4G1NA 3AUOA 2H8ZA 4C6PA 5D8ZA 5A2CA 4Y9MA 2INZA 1AQMA 1YHTA 5LIWX 1FWEC 1QWKA 3TYZA 1UWIA 4LPCA 3OG2A 1RVGA 1XDMA 3R94A 2YPIA 3WEOA 4UC5A 2AMXA 4N9DA 5KZDA 3DG7A 3LLXA 1MFVA 1QBBA 2G3FA 4Z1DA 5E0CA 3RYSA 1XX1A 2PDNA 3AMCA 2VVSA 1UJQA 2VGGA 2DVUA 1GQLA 1P7TB 4Y2WA 3VOHA 4JQ1A 4UNLA 3AOFA 3RG6A 3UYIA 1H3GA 1KM6A 1Q6FA 1JPMA 1YDVA 1KBKA 4OVXA 3NQDA 1PHQA 4R53A 1P48A 1GNXA 4MWAC 2PDYA 2XGZA 3IV8A 1V8EA 1L6GA 1VJZA 2VO5A 2JFEX 3OBAA 3B8IA 3RUBL 3OVRA 4GX9A 1OX5A 1Q7ZA 1XD1A 5LXEA 3GW0A 2FDSA 1UD2A 5K9DA 1VBUA 1CI1A 3ARRA 2RGMA 1TA3B 3RDKA 2WO5A 4LBUA 3PTKA 3SCQA 5LHEA 1OFPA 3VZXA 1PCKA 4JDYA 2EEXA 3E0IA 4RNIA 3VE9A 4C6OA 1OSEA 3LCGA 3NR0A 1EQPA 1JULA 4GQRA 5I77A 2QVNA 3BW4A 2HXTA 2OT1A 1QAPA 3MUY1 2HQAA 4NNCA 5HJXA 3VPLA 4FZIA 1UR2A 3APGA 4G7EB 1T0OA 1KBJA 3SCPA 1TB3A 1ME8A 4A8LA 4REQB 1GW9A 3MU7A 3DFPA 5CJNA 3KOYA 3VABA 1AJZA 2V5LA 4LRTA 2F61A 5BXSA 2QYGA 3BV7A 2EPMX 3O6AA 4YU1A 2J9XA 1W3KA 1ITQA 3SN0A 4PE8A 1DJWA 4Y9NA 3CHVA 4JTRA 2P3ZA 2ZUUA 3KBNA 1KA9F 2VMFA 3GSMA 1UHVA 3W88A 1FY6A 1P6CA 3W1MA 3NM3A 4K6AA 3W1TA 2HRWA 3LM3A 3SRKA 2BWGA 2YDSA 3HV9A 3VTRA 1FHDA 3G77A 5DCBA 4GISA 3QKEA 1G01A 1KM5A 2J78A 3GFZA 2C1HA 5RUBA 1HP4A 5FJPA 5ABFB 2RAGA 3L9CA 3LLDA 2V63A 2REQA 3K5XA 2QR6A 3U2OA 1PE1A 3VNIA 4U3CA 3L4YA 3ZR5A 3W1LA 1GQIA 4LAOA 3BQ6A 3VDBA 2PMQA 1LRTA 2PCQA 4E4PA 3L4XA 1FWCC 3BURA 4KH2A 3KRBA 3TC3A 2C8NA 3E3HA 3G1RA 3VIOA 1UR4A 1TREA 2QQ6A 1EGMA 4WKHA 1W3NA 2CBVA 1Q6CA 5D33A 5CPQA 1AQFA 3EWBX 4M6UA 2HCVA 4D6HA 1P6WA 4V33A 1HJSA 4GJJA 1B5TA 4ZCWA 7REQB 6CGTA 1V6TA 2VFFA 1BLIA 1XGZA 2W67A 2CU0A 4HJFA 1KRBC 3ATYA 3PK7A 1U2YA 3UZXA 1V0NA 3MHFA 1QXLA 3NDOA 3T2OA 5KINA 4Q8MA 1K9TA 3E2SA 4JICA 2HV5A 4ZFCA 3WLSA 1QPRA 5A8GA 4JFUA 1JIBA 1CBGA 2WZEA 4HN4A 1IGSA 4C1NB 4JTFA 3PVFA 3T07A 1PVNA 3GC4A 1JAEA 2WZIA 4D6IA 2Q6ZA 1P0DA 3H24A 1FOBA 1TMQA 3OB8A 3W7GA 1FX6A 4GUHA 5K7JA 1JDCA 5HDRA 2X7VA 4OZOA 2IPGA 4WF7A 1POJA 1B4KA 4MADA 4JXCA 1KQZA 3SN4A 4HU0A 2A7NA 3VGBA 4AC1X 3QM3A 4DZIA 4A2SA 4KFPA 3LV6A 2DT3A 2FB3A 3T0TA 3TTSA 2O7SA 7A3HA 5CH9A 1GJPA 3CHDA 4DF0A 1YPXA 1Q6RA 5BXTA 3DYOA 4MWAB 4YVPA 3CHFA 1V6VA 1S2AA 1TUFA 3NCOA 4IGNA 2WVTA 1BWLA 4O12A 1V93A 3TA6A 5AHMA 3ALFA 6XIAA 1KM1A 5IBXC 2OSXA 2V3FA 3LRLA 4MF4A 2GGEA 4TTGA 3O6DA 2C19A 3UYCA 4ROQA 3SJNA 4X9YA 3RLGA 1G7UA 3BOFA 1FFRA 3VX0A 7ODCA 3IJLA 1PZ1A 1T5AA 4IIEA 1SW3A 3IVSA 4LVDA 4JTJA 1SSDA 2QCHA 3ARVA 3WK0A 2HMCA 4K3ZA 3KZPA 4DY1A 3C0QA 1F07A 4O1DA 3MSRA 4Q7IA 4O1FA 3WF3A 1R3QA 3UCDA 4H7CA 1Z3NA 1HT6A 1WDWA 4O16A 3WIJA 1VFHA 1ELSA 1SU5A 2GSJA 4XD4A 3L2IA 5G4WA 2V82A 3RRAA 1GG1A 4XTDA 2HNHA 1MEWA 1GOWA 3W53A 1BTCA 4S3EA 4QNWA 1F3EA 4ZENA 1UW9A 4C1NA 3J7HA 1H1ZA 1A0CA 1WOAA 2PAJA 1C92A 1Q4WA 6TIMA 5EMLA 1V7YA 4IGSA 1CB7B 1OD8A 4I9JA 1WPCA 3VCNA 3CLWA 3CLMA 4LT9A 1KNWA 1QT1A 4JCMA 2D24A 1R3RA 2ISFA 1QI4A 1F4AA 3WD0A 3TAKA 5CSSA 2VXNA 3P62A 3WLJA 4JNZA 2WVUA 3M0LA 4ZQRA 3REQA 4LGXA 3OPSA 1IIHA 3N18A 2E6FA 5DEZA 4PB5A 5HPCA 1IZJA 3GHTA 1JNDA 3L66A 3BSHA 3CB3A 1OX4A 3U8GA 3WNOA 2WQPA 6REQB 4ILSA 3WD2A 2IW0A 2A2IA 4JPGA 4FB7A 2JQXA 2OCZA 5L9FA 4PCTA 2ZTJA 2ZUWA 3NGJA 4GPNA 3NZRA 4MWAA 4DB7A 2E4TA 2A3LA 3VCCA 1LOLA 1VCVA 4IIFA 5A6SA 2VCBA 3PFRA 2ZE0A 3AYVA 5CKSA 2HNEA 2VRKA 2A5HA 4H9VA 4BQ5A 4D2JA 4GQGA 1VJIA 3Q67A 3HO8A 4F0KA 1O68A 4HTYA 1RVKA 3EX6A 1GQKA 4V15A 3TTEA 3IJ9A 4HYVA 1KM2A 3OBEA 1JGIA 3WL0A 3AJXA 1HL9A 2BVWA 1PJ9A 4AIOA 1TKKA 2VEFA 1MUCA 1EJSC 3GVQA 4NZ4A 1DWHM 2ZC8A 3S42A 2AKZA 4H9MA 4GWEA 1UZ4A 2AOSA 3R13A 5HANA 3WLKX 3HM7A 3IEBA 2RKXA 2PDJA 3ONBA 4MJ4A 4LYKA 3R25A 3LEPA 4X22A 1TPWA 4J2PA 4GGHA 3B8VA 4AVOA 1TWSA 3U4AA 1IE7C 3QPZA 3MKKA 5BRPA 2WSPA 2DORA 3NM1A 4GZIA 4M6VA 3TH6A 1RXOB 4Z2IA 4GY1A 1EUNA 3GIYA 2TODA 4MWAD 2CXGA 1GHSA 2H3BA 4LUJA 3LERA 4AD0A 1GVFA 5C54A 5FL0A 4PULA 1HKMA 3A9BA 3OJGA 1FCVA 3OBKA 2B81A 3PULA 2CEQA 2XSAA 5LKYA 1H4PA 4U5KA 1C8VA 3GS6A 3NNTA 4Q8QA 1VCGA 2CPUA 3RGTA 1OY0A 4LRSA 4PMRA 2ZZ5A 3NZGA 6REQA 4PH6A 3U48A 4WQ6A 3FA3A 3N19B 3WDQA 3HBLA 3RM9A 2WSKA 2QCDA 2VFGA 3W86A 4WXYA 2ASHA 4UFIA 1QOQA 4F79A 4OIFA 3APTA 3IJQA 5I3JA 2ZRUA 3P93A 3N12A 2BZNA 5EBAA 1BG4A 1FXQA 1GKPA 5H1WA 1O12A 1RQBA 2CLKA 3UR2A 1DWGM 2W27A 1DORA 3VDAA 2XUCA 1BWVA 2G3NA 5E6YA 4I9TA 3WF4A 1I6NA 1NOUA 4JTQA 4DXKA 4BHYA 1UR8A 2UWFA 2FZDA 1KM3A 3AMLA 5FF2A 1AW2A 2CLOA 2ANUA 1Q7QA 3W74A 2EGZA 2VQTA 4GI9A 2E5BA 1CXEA 4OGZA 3T6CA 1K70A 4AX7A 4BI5A 4OV9A 4FMVA 3KW3A 4C7DA 4OTKA 2BTMA 2AGKA 2GSHA 1DXFA 2YL9A 3T8LA 1IEWA 3AYTA 4GNJA 3WDRA 3QN3A 4PUNA 3EA2A 2PEVA 3E38A 5DFAA 2D0FA 3A22A 3AHZA 4UMAA 2ONEA 2ABAA 2DSZA 2VZUA 3ZR4A 2QF7A 1KRAC 5K4XA 1H1YA 2BVDA 4LBRA 4Y90A 5CBIA 1M04A 1HO4A 4GUFA 4IPLA 4IJRA 4RK8A 1XKJA 3PC0A 2VI0A 3QGKC 4TTUA 1HUVA 2IKIA 2OXNA 3EEZA 3T09A 4LWWA 3GDRA 2R91A 4GO9A 4AZCB 5LIYX 2P1FA 2CKSA 5J5DA 4INFA 2E68A 3QYQA 3EOEA 3EA1A 1Z48A 4PMJA 4IP5A 3SQSA 1VBHA 5AC8A 4BEUA 1A5CA 2VZOA 2POZA 2YFOA 5IBXA 4PRRA 4OFCA 3RLHA 2X1IA 4MUZA 5LNVA 2ESCA 3F5JA 5BWAA 2PBGA 2YA2A 4PUWA 3ITVA 3T42A 2WZHA 5LXXA 1LRNA 5CSRA 3CWOX 2G50A 3WX7A 1XF0A 2GDUA 2YXOA 5HMEA 1BVWA 4PTMA 3WQGA 3GNXA 2VYOA 3W22A 3RX2A 1EX5A 3MI2A 2J7BA 3AMDA 5EMJA 3GHUA 4MNLA 4XAYA 4GD0A 2V3GA 3WNPA 1K3UA 4GBDA 1F6YA 3SUUA 1FWBC 2WZTA 1OCJA 2R1KA 4DO5A 2X0YA 4LXFA 3PWIA 1LROA 3VIKA 3VE7A 3UZWA 3O06A 4GYKA 4L4PA 3A4AA 3W71A 5E09A 3C86A 1ECQA 4WHBA 2Z7GA 3W7JA 2XN1A 3R1ZA 3MJMA 3ITTA 1GVSA 2I56A 5HAOA 4XG1A 3P81A 3QV6A 4PFHA 3TZNA 5D2TA 4C6CA 2OWXA 3WQ6A 3NIYA 1SFJA 3COTA 1E5NA 2H9AB 3KWSA 4JIRA 3PJTA 1F61A 1ME9A 1J96A 3WDJA 4MOZA 1G67A 4DVOA 1GOMA 3L68A 4IXXA 2XU2A 3TONA 2XISA 1TYGA 2E25A 3IGHX 4G2DA 4HPHA 4LANA 2NSOA 3BSMA 3O07A 5J5RA 4QRNA 1BYCA 4Q33A 2RDWA 3TW6A 1LJYA 3BPWA 2XFYA 3LDVA 2OEMA 3CT7A 2XJ7A 4RDVA 2GFTA 1VFTA 5CBJA 3BAIA 4M0XA 3AIVA 4X63A 3ZT6A 4NZ3A 1TMHA 3DHPA 4A6GA 1AG1O 2XH0A 1I0DA 4KWWA 3VKJA 2V6AA 3ENLA 4L9XA 1TTJA 1GYNA 1T6MA 4E2VA 3IJIA 1E1CB 8A3HA 4L1XA 3CC1A 4FK9A 3AXMA 4NU7A 4M1RA 3BVJA 2NQ5A 1W9DM 2QIWA 4DPPA 3W7RA 3VKCA 2FTWA 1XISA 3UPBA 4LVFA 2O9TA 4IWWA 3R0UA 3GNRA 1I4NA 3QR1A 1JRCA 5T9CE 1NF0A 3Q58A 1CGTA 3W02A 5FA5A 1FTXA 4DWDA 3IRSA 1O5RA 2EQDA 5DXXA 3R8HA 4XVDA 3UQNA 2GK1A 5BROA 2ZRWA 3STGA 2DW6A 5FEZA 5M3WA 3S1VA 4F4RA 1WQ5A 3ZVHB 4D8LA 1POKA 2J13A 3QTPA 1Q2SA 2J7DA 3KDNA 3PZQA 3P60A 1REQA 1SJCA 7TAAA 2O9PA 4LY8A 4RNFA 3GVWA 3B40A 3P5YA 5I5RA 2ZA2A 4XZLX 4XTIA 4J3XA 2FZMA 3BO9A 3M07A 2DVTA 4HNOA 4S3CA 3TCEA 1ZLPA 4J3ZA 4NNBA 4FPSA 4UCFA 1OIMA 4B5WA 4DBUA 3SZ8A 1JCXA 1WNOA 4DYEA 4IZGA 3PR2A 1KRCC 4ORMA 2CBUA 2J25A 3UWEA 2DH3A 1FWDC 4S3GA 1V3HA 3H2MA 2Y7EA 2FHBA 5D8WA 3S83A 1H50A 5CGMA 1PB0A 1DJYA 3E0VA 3TXVA 1YLVA 4LV9A 3C0LA 4Q4RA 1UP3A 4UTWC 4EXQA 1MXDA 2NVCA 2DSKA 5EBUA 3WLQA 5IM51 3T0BA 4ZO7A 3G1AA 3LNMA 3M16A 1JYVA 1DXIA 4KMQA 4N4PA 5DT5A 4JS3A 3RIKA 4R3UA 3HG4A 3HPSA 4EANA 1V51A 3THDA 3WLLA 1GTEA 2GJXA 2F7FA 3EOUA 4P8UA 1TX0A 1UWUA 2PODA 3Q4DA 3WL1A 5CLTA 4W8LA 3O0FA 4V2XA 1NIUA 2I5IA 1C9DA 2G5WA 3ES8A 2CKRA 1BHGA 4BEQA 1W56A 3DN5A 1EH9A 4B5XA 3WH8A 1B3OA 4ADTA 1BYBA 2BOFX 2PWVA 5DELA 2FTYA 4X3ZA 4NAFA 3OG3A 4XUYA 1J12A 1CPUA 4DJDC 1R47A 4QDWA 2GDQA 3LCHA 1US3A 4LF2A 1TG7A 2BY3A 3L0GA 3AZRA 3DZ1A 1L9WA 3A3WA 2X7WA 4DXVA 4UQBA 1TWWA 2HSAA 1VS1A 2OKOA 3GG0A 1VZWA 1BVNP 4O19A 1I9CB 3BXWA 5CC5A 1DHKA 1KFEA 4WSKA 4B4FA 2F6UA 5G1TA 3NQ8A 3C8FA 3QBUA 4UR7A 3ZVHA 4PMOA 3F03K 1ZJBA 4X61A 1FWAC 2XH4A 4B91A 4YJ5A 4ENLA 5AVHA 1Z89A 4FAMA 1XP3A 3P2VA 1M03A 3QGAC 4JQAA 3BARA 5HXMA 4I8YA 2VTFA 2FPYA 2VCAA 1TZ9A 3B9OA 2OFJA 1HJXA 1OYAA 3V5OA 4DX3A 4MNJA 4BZYA 1GJWA 1V3IA 2HZGA 5AC7A 4WXZA 3TCSA 4JTHA 5FAJA 3M7SA 1H0GA 4GYJA 5CPNA 1BQCA 1JI1A 4O1EA 4MJMA 2QUNA 4MYAA 1ZCCA 5A6JA 2FIQA 1S5TA 3PHAA 4L80A 1UC5A 3WENA 4PCPA 5I6SA 1KKOA 2PP3A 1W0MA 4MG4A 1MQPA 1E51A 3UXDA 1LYXA 3UFYA 1AD4A 3T7VA 3CV6A 1W9PA 4RXGA 3DEQA 1LTDA 5KZ6A 3OVGA 4U10A 2PLMA 1DJQA 3EMCA 3CZGA 1Q13A 1KXVA 3IANA 4PUDA 2W66A 1ZY9A 3QLDA 4KRUA 1H5VA 3LG3A 3DBNA 1H51A 2JEQA 3TEVA 3NQ2A 4JOMA 1EWEA 5G2WA 4HOXA 3KX6A 4EPBC 4ZE4A 2NX3A 4AZ6A 3W2KA 1NF7A 3GIPA 3KAOA 5EY5A 1BVZA 1S2CA 1J6OA 1Q6LA 1F74A 2VCCA 2IQDA 1J0YA 2I14A 1Y7VA 5LNWA 3GBEA 4C6NA 1TVLA 4DQWA 3N15A 3FOKA 5DF0A 4U3AA 2FTPA 1DP0A 1PDZA 3ZO9A 2J9YA 4AEOA 1SGJA 4I9AA 1FWIC 3E49A 4ZO9A 3LCLA 4IMGA 4LB4A 2V5CA 3KLKA 2J27A 3IAPA 5HULA 3MP4A 2C1IA 4WCJA 4DJEC 1KRMA 1HO1A 1TPUA 3U5YA 4FOUA 4CD6A 1W1IE 3LM7A 1UWAA 3GY1A 3CUXA 1EQCA 3HGJA 3M5XA 1BWKA 3QMSA 1F7BA 3BOXA 2WHJA 4C6KA 2OVLA 3S1UA 1XCFA 3LRMA 5H2ZA 1X38A 1W1TA 3D0CA 5A8MA 4JKKA 1EPXA 3C2EA 3PAOA 3LXCA 4PEEA 4AIEA 1QCWA 3NQ6A 4NZ5A 3TYUA 1VYPX 2WZMA 1QJWA 1U1JA 3RILA 3V5FA 1HN1A 4LAUA 1JF6A 1Q2RA 5C7HA 1LOQA 4DZAA 3MMTA 4FNUA 4BQ3A 1RA5A 1TJ1A 1W8SA 3IAQA 3S2LA 3CIWA 5K9XA 2EKCA 3W85A 1B2YA 4D72A 1XLCA 1T8XA 3R0DA 3A6OA 3PZUA 5BW6A 3A4JA 1MWOA 5F4SA 5CG0A 1WA3A 5G1YA 4IICA 4QJ1A 3QMTA 4D8ZA 4RE3A 2QPXA 1B0IA 1QVBA 4R5EA 4EAMA 3ZFHA 5BOFA 2OWWA 4MSSA 1TV4A 4HNNA 1OADA 4HK6A 1OCNA 3MSYA 3B4UA 3H2NA 2HE5A 1JDAA 1GHRA 4DM2A 3CAVA 1S2UA 4H4IA 4CUCA 1N7KA 3CTTA 1TJPA 4FHAA 3GLCA 4D8AA 3UZZA 3B8TA 1R46A 4YTTA 3URAA 4UUIA 4I90A 4HHMA 4O1AA 3OHMB 3S8HA 3U7BA 3F4VA 4UMBA 2V81A 1D7KA 4RE4A 1QNQA 2NQJA 3NQGA 4L56A 3SIZA 4PMDA 3EX3A 3AQUA 2PTWA 1A5MC 2FB2A 2CESA 1JDEA 4GIEA 2PDHA 1I2RA 1TWZA 1RUSA 3UPWA 5F4XA 2QCFA 5C5YA 1W2VA 2I16A 1MRAA 4HSOA 2QDDA 3N17A 1HGWA 2Z0IA 4FXSA 1FP9A 1JZ7A 4A3UA 1CYGA 2ZC1A 4FI4A 2GGJA 4P7NA 3USBA 1PX8A 4UTWA 1ZQ5A 3PZIA 3WEMA 4R7WA 4UNKA 1VEOA 4XV0A 1YTDA 3L5LA 3WY1A 2A3CA 1J01A 1PKNA 4DN1A 3G1HA 3MUZ1 1FUYA 3N34A 1CX9A 1N55A 4KWOA 3GVVA 4LH8A 4RZ6A 2J4GA 2Y5EA 4Z1CA 2FYMA 1J4EA 4P7OA 3PN8A 3NPWA 1E4IA 3MKVA 1A80A 3VD9A 3VUSA 1H60A 4ES4A 1CGXA 1PSCA 2ICSA 4LVGA 1J0KA 4KFNA 1OF6A 1ZP4A 4XWUA 1ZJIA 1NP2A 1ISXA 4L61A 4C6LA 3BTNA 3IARA 3WMLA 3ZWTA 3GUWA 3S47A 1AUSL 3NO3A 1CLKA 4IGHA 3S5SA 1H7NA 1V7AA 2CITA 2X1UA 5ECVA 3O05A 2H3DA 3WK1A 2VKZG 1WE5A 2QCEA 3VUPA 4MB1A 4H9ZA 6PTDA 2HK0A 3G3DA 2TSYA 4JBRA 2C0HA 3WD4A 3XINA 4DUWA 5FESA 1E0UA 1J8VA 4DLMA 3DCPA 5M03A 3TSBA 5HNRA 3QZ6A 3H2FA 1PWMA 2VC7A 1ZSXA 2QV5A 4JIEA 3LMYA 4DO6A 2YX0A 3UY8A 3OU8A 2J7HA 3PBUA 2HEJA 2HE8A 3O6YX 4HP5A 4GY7A 5D02A 1XGDA 5B80A 1AL7A 4PFMA 1YBQA 1Z9AA 3S2JA 3UF9A 3NOYA 3IVUA 3A23A 1VF8A 4Q6JA 1N8IA 4NUWA 1LBFA 4FO4A 3S1XA 3GTNA 3LHWA 5C9WA 1MEIA 4IIHA 2PFHA 5DRCA 2J8GA 3P61A 1O66A 5FF3A 3RPMA 1QWGA 4KIRA 1Q3NA 1HX0A 2WJZA 3PF3A 3V4BA 4E2DA 4RDYA 3SCUA 2RH9A 3A24A 4PMYA 2PB1A 3GXDA 5M2FX 4DJDD 3JRKA 1QHPA 1YRRA 3S9ZA 5EMYA 3K30A 3UZJA 4TXEA 3WMCA 1MZRA 3OGRA 1Z41A 3KL5A 3K4DA 4KEVA 4OBRA 1M7XA 3GWQA 5ECUA 2EPHA 4XD6A 5TBOA 3TR9A 3BLFA 1KBIA 3CH9A 4DEFA 4S3FA 2X0SA 1VHNA 1XIBA 1DJZA 3Q94A 2X41A 2D20A 2ZADA 2CLHA 3H4GA 4ROPA 3EDDA 3GKAA 3PG8A 2OT0A 3AU6A 2PGFA 3DECA 1B30A 1WAWA 2TAAA 3OLGA 4MM1A 4JFSA 4AY7A 3LBOA 5AYZA 3WBWA 2PA6A 1GOQA 2Z7KA 1QATA 1W3TA 1YPFA 3SJ3A 4DXXA 1K6WA 3EMZA 1FH7A 1K4HA 1KWGA 2QUUA 2Z24A 4AC7C 4DJEA 4P7LA 4WKFA 4DBDA 2PF8A 2WSQA 3N9KA 2FJUB 4DM1A 4TX6A 3KTSA 3EA3A 3C52A 2FMOA 2Y5SA 3FDKA 4UZSA 1TV7A 1U5HA 2W9MA 4UXDA 4H9UA 1LRQA 1WZLA 5AHFA 3V3WA 3M0JA 1MW0A 2V38A 1WAUA 2VRQA 3PJWA 3AAMA 1KFJA 1BGAA 2OKTA 3ZLHA 3ABZA 1MW3A 3NA8A 1D3GA 3PBVA 1SO3A 3JR2A 2L5HA 4NXKA 2BY2A 3ARTA 2VGIA 2GVEA 4XBJA 5C7VA 3WJYA 3RITA 1UKTA 5C9ZA 2OOFA 4AY8A 4W4QA 1R2RA 2DW7A 3KHJA 3W6MA 2CXEA 1I60A 2D3NA 2Z00A 3POCA 4NI3A 4GQ0A 4MY1A 1W2PA 3UJFA 4WRHA 4WJEA 4ZE5A 4FLOA 4LQ1A 1XH1A 2VDGA 4PZVA 4ERGA 3QQ1A 2DIEA 2P0IA 3DHFA 2WOQA 4B3LA 1UA3A 4Q3MA 4DJED 2QCLA 4W87A 1W9VA 3CS2A 4I7WA 4CVUA 2WC7A 3SADA 4H3DA 3QVQA 3EX4A 4R9XA 3LBMA 1V0KA 4YWSA 1I0BA 4U31A 3TN4A 1A5OC 4MDPA 1XLDA 4DNMA 5A3HA 4PCNA 2ZDSA 3KOWA 2O4QA 1MW1A 3CL7A 1SQ7A 2BGNE 1OCBA 1KW1A 3LS9A 1TFVA 4WR3A 5BOOA 3KWXA 3NDZA 1XM3A 3PUOA 1K9FA 1T40A 4YTSA 3W23A 1OT1A 1XW8A 3BCFA 5G2HA 5BOEA 1DYSA 3T81A 3VGHA 3GTHA 4E3TA 1LM1A 1P6BA 4PTNA 1XBZA 3BMXA 5I24A 3BGJA 4RR4A 2W79A 2YYTA 2YW4A 1YKWA 2CLMA 2OLSA 1T99A 2J74A 2WAGA 2ZXDA 3R10A 4IMDA 1NWRA 1XBXA 5AZ1A 4EF8A 1JEZA 1G4TA 2RJHA 1MMFA 1DKWA 3IGSA 4GZJA 4POCA 3UZYA 4AWUA 4GCAA 3UERA 4TMBA 4BI6A 2X8RA 2GGHA 1CTNA 2W4XA 4WKAA 4F2UA 2DSUA 4GE8A 3LBCA 1LLZA 1MXSA 1ITCA 3GDBA 4K68A 1SO6A 2DVXA 1QPNA 1GPFA 3IIXA 3H70A 2OYMA 4DBEA 3RO6A 2V2DA 2HS8A 4JTCA 2CHNA 3QMRA 5DCEA 1VLWA 2G37A 3FA4A 4NRSA 1HVQA 4WK9A 1O6IA 1JCLA 1IR2A 1H1NA 2JKAA 3SEPA 4YYFA 5DY2A 3EXTA 5G4HC 4RKAA 2Y70A 4CNNA 3W1AA 1A3WA 4UMCA 1J18A 1W5MA 4RE2A 1DJIA 4WUIA 3P84A 4CCDA 2HBXA 5ABTA 3VOIA 2PDMA 5F1UA 1A49A 3WG6A 1DJXA 3HGRA 1WKDA 4TVCA 3G18A 3P7YA 3H2EA 4V28A 4NIRA 4H8HA 2J66A 1E1EA 2INEA 1QW9A 2QMKA 3QY6A 4QFUA 2FFCA 3G22A 3ARZA 5DRIA 4HTBA 5CBBA 9RUBA 1PKYA 3WELA 4WSJA 4XSMA 1I1XA 4AWSA 3WNNA 5GNXA 1J5SA 3MPGA 3ABXA 3H2CA 2PZNA 4KFOA 1XS2A 3BGGA 3LPFA 2G3IA 2VD8A 1Q8JA 4UCGA 3CZJA 1RCXB 3ANVA 1EFZA 3CK5A 3B0VC 1S3TC 4J28A 3PM6A 4JR5A 1E72M 1AZ1A 2FZNA 2YKKA 1YEYA 3W26A 1VBGA 5FEPA 1Q5MA 1K9DA 3VX1A 3I7RA 1FDJA 4Z2GA 2CLPA 1BTMA 2BXYA 2PWFA 1UR3M 3GK0A 3CZEA 4AZGA 1EDTA 5CAHA 1R6WA 4HNTA 2OQHA 4XBSA 3W7DA 3VZYA 5HR6A 1OJXA 4FLQA 4FNTA 3P8JA 2ACQA 3VGGA 3UWZA 4EPEC 1E15A 3K8KA 3GXTA 3GDMA 3D6NA 3E12A 2QJJA 5AB3A 1DWFM 1E5JA 4XKYB 5M1TA 2AQOA 2VD9A 4EAYA 1F6PA 1J79A 3H2OA 2P53A 2R6OA 3GTFA 3W25A 3IJ6A 1MSSA 1B3VA 4A8NA 2DFAA 3QSTA 1FWSA 1VPYA 3MW7A 1JDFA 1WDPA 3UCCA 4ACYA 4RPPA 1E3ZA 3PZNA 3FGCB 1A4MA 1ICSA 5F7UA 2A79A 4CQ9A 1M7PA 1O1ZA 1SO5A 5A69A 1V3JA 5AHLA 4J3WA 1TMLA 4JHZA 3GG8A 1HJWA 2Z6IA 3IIOA 3HG2A 4XQ6A 3QGVA 1WKFA 1U30A 3CMGA 3QFWA 3WQ8A 1B90A 5AYXA 1PAMA 1BAGA 1FCUA 1W5NA 2DZTA 5BMWA 3GKFA 5C9UA 1B1YA 5DXYA 3R8GA 4HNVA 1DIDA 5BCAA 3AC0A 4H04A 1Q6OA 4KRZA 4MKNA 1B3YA 2C91A 4NAEB 1MVYA 4GZEA 5E0FA 4V1XA 2BBFA 1JFXA 3KM8A 3ELFA 2OOGA 2NT0A 2J75A 1VPXA 1VYSX 3Q45A 4P8XA 3RO8A 2VM8A 2PI6A 4F48A 4ML4A 2D69A 2OZ0A 3KRZA 1XH0A 3WF2A 1WKEA 3O0KA 4UOQA 1W6TA 1F3TA 3M44A 1B9BA 1X96A 4E5TA 3MZ2A 1W3IA 2CLIA 1KFBA 4Q22A 2EKGA 4UB9A 1QNOA 2VFDA 3OQ8A 4HD5A 4C7FA 3VIHA 2YGYA 1KCLA 4RUBA 5JBEA 4EE9A 3WBXA 4S3KA 4XAGA 4WY0A 1SR9A 2ZKMX 1JCYA 1GOKA 2VUYA 4QQUA 1EC8A 1UIPA 2O9OA 4OWGA 4ZR8A 4HNUA 3E0LA 2YYUA 4W9TA 4AISA 3TMQA 4RCXA 3LTYA 1RSCA 4AFYA 5HQMA 1IXQA 4L4OA 2OYKA 2GVGA 5CZKA 1E9YB 3CAKA 1OWQA 2BOGX 3Q65A 4UTLA 3NL6A 4FSAA 3C2YA 4C6MA 4EIVA 1X7FA 1C9WA 3BMWA 1EC9A 1PUDA 1RY0A 2SFPA 4YVVA 2ZA3A 1QO5A 3NO5A 2VL4A 3LI0A 3NG3A 2NWRA 3I4KA 4GVHA 1KBBA 4UTFA 1XI3A 4JTUA 4YTUA 3T9PA 3T2PA 4HCHA 1XH2A 3CEPA 3MP5A 3K2GA 2CERA 1BKHA 3FGCA 1ZU8A 5BWFA 1RQHA 4R85A 1EHNA 5CZ0A 1YQ2A 3AXXA 3R12A 4F2BA 3KCOA 4GH3A 2B7NA 3JZUA 3INPA 4XIAA 1XLIA 2HXUA 3QW3A 4KERA 3KZSA 1M53A 3NL3A 3ZR6A 1TIMA 1OYBA 3RN6A 1F8MA 2X05A 4KCTA 3CMFA 4US6A 4Z2HA 4L7ZA 2BHYA 2R82A 4EOUA 4Z2JA 3DENA 3PZOA 3SY8A 4X0VA 3T4CA 3K1GA 3PS7A 2J8TA 4FALA 4NVTA 4FOJA 1GT8A 3RPTA 4AIBA 3BG3A 2DZPA 3KVJA 1UP0A 5EPDA 1EIBA 1US2A 4L6DA 1ADDA 2XGIA 3SGZA 3H8AA 1HKIA 3NL5A 3KBJA 9XIAA 3ZJ7A 2WCAA 2PCEA 2CZFA 4TR9A 2LLEA 4S3BA 5M17A 3UWWA 2E6YA 5I3HA 3BQ5A 3UU0A 1RBAA 4KEMA 4PTXA 5TIMA 2DEPA 2OODA 4OV4A 4QDMA 3QRHA 1D8WA 2IPFA 2AL2B 2WMIB 1KFKA 5DMNA 3GH7A 3QOKA 3R2GA 1OC7A 4NNAA 4MB3A 3O6CA 3CQHA 2Q3RA 4IFKB 4J3TA 4WX2A 5LA2A 3MYPA 3SGGA 1ONXA 3GXFA 4FR6A 1VEPA 1XQLA 3AS1A 3WYZA 3TXZA 3LZ3A 4EXBA 5EMMA 2ABBA 3PBWA 3TN3A 2NZLA 3EWXA 4IQJA 3TDFA 2XVGA 1E6PA 5FJUA 4S23A 2F8QA 4B2DA 2NXGA 3MI6A 5F2LA 3IUDA 4UIOA 3C5QA 5I3IA 3I6TA 3B04A 1CGVA 3W4RA 4WLCA 4BKNA 4X60A 4PODA 4LUTB 1QPQA 2FJKA 2Q71A 4O0KA 1G0CA 3BAKA 1EBGA 4AZBA 3ZJ8A 4P2VA 3NEVA 1OHLA 3S6DA 1XDJA 4FF5A 3CL6A 1PZ2A 2TRSA 2ZIDA 3EKGA 3AHVA 3E6EA 2XWEA 4AF0A 3ABRA 3M0VA 4B5VA 1X1ZA 3KFTA 1TPC1 5HNTA 4HIBA 2JBMA 2X30A 2DP3A 2PBOA 4OKDA 3UG3A 4D9PA 4PA8A 1WZAA 1M1BA 1GVRA 4K1WA 3KL3A 4EPDC 3UJSA 1XYFA 3UD6A 3FCPA 3CT2A 3TJLA 3STCA 1WUEA 3P14A 3WK2A 4A21A 4I5RA 1A50A 3KTCA 5JIWA 2NUXA 4PSRA 4O0QA 4PMZA 5EYWA 3W38A 2XN0A 3MI3A 1GW1A 1R8LA 3FEQA 4M7SA 1JYWA 3ZZ1A 4NL1A 2E1DA 2B7QA 4HVXA 3MBDA 2VR5A 3M64A 1S1RA 3TYAA 1O60A 1QRQA 2FDMA 3FDGA 6ENLA 3BMVA 2P5NA 4M81A 1LUCA 1CGYA 4HYWA 2AL2A 3GVRA 4O1BA 2QIIA 4KQNA 4RXFA 4ONVA 3QV9A 2WJDA 1C29A 4PUKA 4B3KA 3W72A 4UFKA 3BG5A 3VMNA 3BAWA 3THCA 2OLAA 2I5GA 4LU0A 3RK8A 3ZLGA 1S5NA 3WFZA 3ITXA 3GM8A 3WQ4A 3WLPA 3MDWA 4LV4A 1FVPA 2HDJA 1Q6QA 3WFLA 1HG3A 3EXRA 2QJIA 1PYMA 1UBSA 1TPVA 3M5YA 1EXPA 2V3EA 1K7EA 1UIOA 4FX8A 3O7UA 4AX6A 3O16A 2JEPA 3CM4A 2PF0A 3MJYA 4QCFA 3M0XA 3W27A 1IF2A 2Z27A 2NX1A 1QNPA 5E93A 1WBHA 2BY0A 4OU1A 4GG9A 3M4HA 5U7SA 3W1RA 3CWHA 3OOQA 1KXHA 3GNNA 4KCVA 4Q4KA 2NQ9A 4PMNA 3C61A 1N82A 3AJ7A 3TJIA 1GVOA 3I68A 2XM1A 3UJEA 5FJRA 5BRBA 1JZ3A 3ANUA 4JKLA 1T7LA 3EKZA 3BAJA 5KZMA 3WQVA 1V3MA 3F4WA 3FAXA 3W7QA 1VCFA 1FH9A 4FXRA 4WGXA 3RJXA 3ZSTA 3RXZA 3BWWA 4NYUA 1TR9A 2C79A 4GBUA 1W8GA 1JGMA 5GVJA 2VR4A 5GJNA 3NZPA 5JH2A 1XDLA 3QZAA 5GPRA 4E3VA 5D2VA 1AH0A 3PTQA 5B7YA 1BPLB 3IPWA 2V0TA 2Z1WA 4DF2A 4JTIA 1OK6A 1H62A 3QTGA 7TIMA 2WM1A 1DHPA 2A7RA 1RD6A 4PEKA 1A0DA 3GZ3A 4YIWA 3I4EA 4BA0A 2PTXA 1QK2A 4WD0A 2FVLA 3PSWA 2QGYA 1ZGDA 4RZ5A 2PLKA 1HXJA 2R24A 3M41A 1IEVA 1H09A 4GYFA 3SUSA 3MB9A 1CDGA 1L2QA 4D71A 3PB2A 4WDXA 3N13A 4QAIA 1UR0A 3QV8A 4IJBA 4Q8WA 4OE7A 5C2XA 5I23A 2YW3A 4O10A 4PUMA 3BJSA 4NZ1A 2DU2A 4ZOBA 1K02A 3CZ8A 3MWCA 1RBOB 1LF1A 2PDUA 5DANA 1ZHAA 3U3HA 3ZXWA 1NFPA 4LJ3A 3RHGA 3WH5A 3BJTA 1PCWA 3LCXA 3BANA 2JIWA 3W7KA 1SW0A 3NFUA 3VNLA 2HJPA 1P43A 1R87A 3FS2A 1WDRA 5GNZA 3EPOA 1TPFA 1I2OA 1HP5A 3URBA 5DO8A 3VINA 3U6WA 2FFIA 1U1HA 2Z1SA 1MNSA 3KVMA 3W87A 1IQ8A 4ZB5A 3W73A 2VX5A 4XZBA 4CNUA 3B8UA 1E43A 4LNCA 1TWDA 1LCOA 4TIMA 5PTDA 1TV8A 3GYEA 5MF5A 2CZDA 4BS0A 8XIAA 3MCOA 3STEA 2YL8A 3F1QA 4G8TA 4CN1A 4S38A 3K46A 2BY1A 2O56A 2OEKA 2QDEA 4TMCA 1OINA 3KVLA 2YOCA 3B3DA 1M7JA 1NELA 5FIPA 1OFOA 3CIXA 1KR1A 1EUAA 4MPKA 2WK2A 4W84A 4NILA 4AUBA 2XIJA 4H01A 1M41A 1EYWA 1GUVA 2YCEA 2DH2A 1PKLA 3LOTA 3DC8A 2PC4A 3G6LA 1SPQA 1E4NA 1RZMA 4O52A 1RP9A 3FYOA 4JIQA 4LEQA 1BG9A 4MNMA 2DZWA 3VILA 1LOSA 3TZFA 3N2MA 1MYRA 1JZ4A 4B92A 3KP0A 1FCQA 3VKDA 3RM4A 2PWUA 1QW8A 5A6KA 4IP7A 3L12A 4IP4A 3I3EA 3SUWA 1RHCA 5K2ZA 4FX6M 1BXBA 4WJXA 3LPPA 2DPEA 3N29A 3FXYA 2OZTA 5EFDA 3PB0A 2FVKA 3BOLA 3AYSA 1KR0A 4RV3A 3BW2A 4GHRA 1R30A 2Y62A 2VELA 3DKLA 3ABQA 3I6RA 1VB9A 3A3HA 3ARUA 5I78A 3VZZA 1A5AA 5MKGB 2NV2A 2ZRVA 3I3BA 2A3HA 5EKYA 1WDQA 4C6EA 5C8BB 4I6VA 5A94A 3AIBA 3DERA 3JW7A 5MHBA 1ZBCA 3UXIA 2XN2A 1J0JA 2WMHA 4X2RA 4B5SA 2BFGA 2FGBA 2E6AA 2OSWA 1FHVA 4IGMA 1LL6A 3HFTA 2JIEA 3T0DA 2WNWA 3EPMA 3P0XA 2QPUA 3S9YA 2J62A 2VJXA 1D9EA 3VU2A 4DI9A 4GIYA 2VGFA 2MUCA 3ZT7A 2OZ8A 3PPCA 4HHHA 4IIBA 3GX9A 4JY8A 4CQAA 5LGZA 1OQFA 2DZUA 5HWJA 1UD8A 2GJLA 2E77A 4B5UA 1K6AA 2PDKA 4K7VA 3GH5A 3KRUA 4AEEA 4GIRA 2FKPA 1AMYA 1X8CA 2NXIA 1VJSA 4NJGA 5IHRA 2WSRA 1Q6GA 1JPDX 3U7VA 4HZ7A 2QW5A 3UR5A 3AZTA 3WD1A 4IQDA 2VP8A 3N1AA 3GFYA 1BEUA 1V79A 5AOUA 2VUNA 2F6KA 1ISWA 3ITLA 3GB6A 3UG4A 5HQLA 5CPMA 4YN5A 3B0YA 4IMAA 4U2ZA 4TO8A 2YCLA 3FFSA 1CIUA 1OK4A 3H2AA 2ATMA 2C1GA 2G3MA 4NX0A 4O13A 1WDDA 3TC6A 4Q4PA 3FNDA 3GZAA 3H54A 4ZA0A 4D6EA 1FWRA 4HOWA 2E5DA 5I3FA 3QC3A 1IZCA 4O28A 4L4MA 4LVBA 1S5VA 1NQKA 1EF3A 4WDWA 2ZUTA 3JVAA 4FS9A 3MUAA 1QNVA 5MKGA 3SFWA 4UTKA 4MFDA 2QNEA 3VOFA 5BRQA 1JNEA 4CN4A 3TUUA 2F9RA 1QFEA 5CPOA 2NT1A 4R34A 1P0NA 4H9YA 1ME7A 4J27A 4F2TA 1PEZA 4MVAA 5I03A 1KTNA 8XIMA 2RHGA 1A5NC 3ARSA 3PPFA 3T40A 4L4LA 4M8UA 2FVMA 3B05A 7ENLA 1SFLA 1X6UA 1VBRA 5H8MA 1VRXA 2QZRA 5BNKA 2C3ZA 2F84A 3TW9A 1E3XA 2QUTA 1M68A 3CB8A 3OQEA 1P7TA 1FDZA 2NVAA 1MQRA 3ONCA 5E6ZA 2DQXA 3C2OA 4NSBA 4GUIA 1RAKA 4XVEA 1TE6A 4YS1A 3WMBA 3WJZA 4H8VA 2OSYA 1HIZA 5CPLA 4YCOA 4UR9A 1WX0A 4HB7A 2EG8A 2VEGA 4QX4A 1W32A 2Y89A 5AYBA 1UQZA 3AMGA 3CO4A 2HTMA 5A6AA 1E6XM 3MS8A 3K13A 4M3PA 3A13A 2I17A 4FX7A 4ZMGA 2P3EA 1TA3A 1NAL1 1Z69A 3QR0A 4ZXLA 4TX8A 3PJUA 5JMUA 3G1YA 4GVFA 3P74A 3UZ5A 1VIWA 4DUXA 2Z2BA 3CGTA 3SCTA 3KL0A 3PPGA 1JQXA 3G3MA 5F1VA 1PTGA 2E40A 1SR0A 2PZ0A 1GEHA 3N2BA 1JVNA 3ABOA 4OJYA 4TX9A 3DI1A 4G7EA 3B0PA 4GJIA 4ZQMA 1W1A1 4REQA 1G4SA 2OG9A 2V68A 3O8AA 1UUQA 1IT7A 1X1OA 2RGLA 1EP3A 3MZNA 3WBEA 4Z2LA 3V18A 1CWYA 4JN6A 6TAAA 2BX7A 3E02A 4JFWA 3LTSA 4DNHA 3BLKA 1Y5WA 3GR4A 3UXLA 2VEIA 3W2JA 4OBSA 5FSDC 2J47A 2QS8A 2NVDA 5IRPA 4UQ9A 2C71A 4MWAE 4DHGA 2CLFA 4KWUA 2PSNA 2OYLA 5AZ0A 3W29A 4A3HA 5EFFA 1QK0A 1UWTA 4PMQA 3OIHA 4J3VA 2QJGA 4D1JA 1V6XA 3QYSA 4ADSA 4ZOAA 4ZQNA 2WMFA 4RLIA 1T8QA 2WHMA 1EKOA 2EBNA 3ARPA 2C15A 3TROA 5ABFA 3GO2A 1X98A 4TOQA 2A3AA 4YCPA 2GDVA 1DV7A 1ZP3A 1EOMA 3GHRA 3JUGA 2CCRA 3WD3A 1QMLA 3NQEA 4XB3A 1VRDA 2V8ZA 1PS9A 4TQTA 1LWJA 1ZS2A 1UUMA 1ZRQA 4HCDA 4PL1A 3FLUA 3SECA 1X97A 1E6NA 4C5ZA 4I6KA 1JFHA 2ZX7A 3ZSSA 4C6BA 3CQIA 3LHVA 4F8XA 7PTDA 3DFSA 3KOFA 5HATA 4W5ZA 3S6TA 3CTLA 3IUHA 7REQA 2FLIA 4AD4A 1TUXA 3D3AA 2IPWA 3P80A 2I57A 4AW7A 1L2UA 2PGWA 4ZB2A 3TOYA 4WEVX 4ACZB 3P6LA 3TAOA 1RP8A 4MJZA 5C9RA 3FAWA 3SY5A 4BJHA 4UTJA 2F38A 3QOMA 2UY2A 2QJMA 4H41A 3HB9A 1SMDA 4QSHA 1EC7A 1IIGA 1CZ1A 1PO9A 1ONRA 1FQ0A 4RDWA 4X0NA 4EF9A 4R7OA 5EL1A 4C5YA 3PZVA 3TFCA 3WNLA 4AYSA 2JF6A 1UKSA 1P0EA 4BY3A 1F3WA 3PWGA 4LYRA 3QJAA 1JDDA 4F40A 1FFQA 6ALDA 1QTWA 3KEHA 4A3QA 2Z2UA 5U4NA 2P0OA 5FD0A 3VFLA 2IUZA 1LG1A 1N2VA 2A0NA 3APYA 4AEFA 1XSJA 1MEHA 3MKCA 4JTAA 1NTHA 3ZT5A 2QPSA 2HWGA 5HOSA 3GHSA 3U9IA 2ZXAA 5DMLA 3MVIA 4GC4A 1PTAA 4Z42C 1ZL1A 5AECA 1V77A 5D9OA 4G6CA 6A3HA 3AIUA 2PDPA 1BRLB 2OGJA 5BXRA 4R27A 5M5DA 4FNRA 1EZWA 3NQBA 1FWNA 3RX4A 2ACSA 3W6YA 2NV9A 2VZTA 3DH7A 2YBUA 3ZM8A 3F2DA 3IK2A 1EDQA 5EMKA 3A12A 1OFEA 2A85A 2YL5A 4IOTA 1E70M 3O3RA 2A21A 1UH2A 2V3DA 2AAAA 4JAWA 1RALA 3MMWA 3SCRA 1KFCA 1XLFA 2W63A 3NYDA 4GXWA 2BASA 3OODA 4QG8A 3HPFA 4MZ8A 1UWSA 3TLQA 1E56A 2G4FA 4JIIX 3N4FA 1GG0A 4UTTC 4AHOA 5TD4A 2GJNA 4AU0A 3M0YA 3QHNA 3MMDA 3AHXA 5D32A 5D30A 1XRVA 3EMQA 1YDNA 3NQ7A 3LN3A 4JTDA 4XZWA 3AICA 1WBJA 2WW5A 3L65A 3DFQA 1U83A 4A8RA 2Z28A 3TQPA 4IG2B 2FZBA 2VFIA 1FWHC 1ISZA 1H11A 1TJRA 3HGOA 5FJIA 3HIJA 3QPEA 4HJWA 4OUEA 4B15A 1NWSA 2BGQA 2WJEA 3G1XA 1J5TA 1IWAA 4H00A 3EWCA 1U5JA 1E0WA 1XYBA 1E6ZA 3DI0A 4HHPA 2IKJA 1EP2A 2WKLA 2XVPA 3WNMA 2EPKX 2QULA 4Y8EA 3E9AA 4PMXA 1UBPC 2P50A 2PWDA 1JYXA 1D7FA 1O94A 3FJ4A 5HWNA 1Q8AA 5D03A 2PDFA 2OTDA 3NO1A 3UGRA 1YTEA 2FMNA 2CBJA 4G7FA 5CXPA 1EJXC 3VDCA 3QQ0A 1F9CA 3QXBA 1ZALA 4LCQA 3OW1A 1V08A 1JD9A 1GEQA 5HA7A 5FJJA 3TNBA 3BG9A 1HJUA 3A4WA 2RDUA 3MV01 4C65A 2XGBA 5I3KA 3GNOA 1Y0EA 3UA4A 3OEXA 1BYAA 3UW6A 1L6YA 2Y24A 2ON3A 3F4CA 3E0FA 1NDWA 1S2TA 5ENLA 3MCNA 5TNVA 3WLIA 3KHDA 1V5XA 3DAQA 2PWEA 1EB3A 4AD2A 4PB3A 5FL1A 4PCFA 2FZ9A 4Y6GA 2X1SA 2VURA 1F2JA 4QTGA 4GI6A 3CO8A 3TFXA 4FXFA 1XC6A 2J88A 1XPGA 4HPXA 1TO3A 4JNYA 3VFCA 3QC0A 3W7NA 4KPLA 3PBMA 3QSRA 3M43A 4QR6A 4QS6A 1GJUA 2JF7A 1EXBA 1FRBA 1G94A 2NWSA 4IH3A 1K8CA 5CSUA 2UY4A 1HL2A 1JCJA 5BZAA 2GJPA 1TWIA 1J0ZA 3WO8A 1A0EA 2OQYA 3GE7A 3F7JA 3N6HA 4NF7A 2XFWA 1Z8AA 1NU5A 1EYEA 4RL3A 1R2SA 1ZAIA 1XHGA 4LBSA 4FNSA 2YBTA 2YLLA 2EPLX 5G2IA 3CNYA 4JX4A 1I2NA 5CLWA 3N11A 3QHMA 3MQTA 3EB3A 4MFEA 1XG3A 3HJZA 2WKGA 3ZIZA 2QCCA 4GX8A 5HJLA 1G7VA 4S2BA 2GYIA 4JQ2A 1QDSA 3EWUA 4GNKB 1FHLA 1JCNA 2BSLA 3LPGA 4IIDA 5E1QA 3UWYA 4BF5A 4UFHA 3VK5A 2BHZA 4KW2A 3DFHA 3T2QA 1ZFJA 3PP7A 4J40A 1JG9A 1EOKA 3ZVIA 1TPB1 2I9UA 1TCDA 3OZOA 2ZXBA 3GQYA 3CQJA 4GUJA 5GJPA 1DEDA 4O4VA 1OFAA 3LQGA 5EGRA 1VFMA 2WV8A 2C14A 1EJVC 3W70A 3SCOA 1J93A 1S2WA 2HBVA 2VGBA 3WLOA 3EDFA 2J77A 1SSGA 2PU1A 3HOJA 4JIPA 5FF4A 3WLTA 1VD6A 1E73M 1QPKA 1O5XA 2R1PA 4Q8VA 1TRIA 3I7QA 1KD0A 3EDEA 3NTYA 1DWJM 1QNRA 2DZBA 3W7MA 3LNPA 3G5EA 4GNVA 3CIVA 4H1ZA 1SJDA 4NXSA 3K8LA 2BS9A 3UWQA 3M6DA 1NDZA 1NWUA 2PP1A 1YX1A 2H8XA 2FQIA 5REQB 3N3TA 4S3JA 5CAKA 1ZTVA 5I0DA 3UETA 4ICMA 4LS1A 3VXGA 1E71M 3VIFA 4L5ZA 4KEUA 1N8FA 3E2VA 4HK5A 1KGWA 4TVUA 1HQTA 3B9DA 1A5BA 3VNKA 5A8PA 3R43A 1JUKA 4EK7A 3R7MA 3NQMA 4CEXC 1ZAJA 1ITXA 1B54A 5AC4A 1VENA 3MT1A 3SY1A 4DJFC 3RLVA 1UH4A 3CYVA 3KRSA 4LUSB 4N7QA 2INFA 4EWND 4PGLA 1VFLA 4C6IA 1EJWC 3GXIA 5HMFA 3F4DA 3QPYA 2VRJA 5D09A 1WZKA 2E3ZA 2PC8A 4J7RA 3IS4A 4LX4A 5AC5A 4AZ7A 1I2PA 3A5FA 1K9EA 4AZCA 4K36A 4M56A 2Q02A 3BL3A 1FWJC 1KO0A 1YW1A 2E5CA 3UNTA 3CJPA 4WGHA 1F3XA 1DVJA 2ODOA 5CZTA 4XZIA 4B3ZA 3FKRA 3ORWA 3TA9A 4ADUA 3V36A 1XIDA 2OLHA 4N6EA 4CQ8A 2DZSA 4UTTA 1RJQA 2BDQA 5A1AA 1AQ0A 2VC6A 2Y6ZA 4UQAA 4MNKA 3KS5A 3NSMA 5AFDA 1PZ0A 3V0UA 2ZDRA 1NARA 4XO7A 1XWYA 4JEQA 1JCTA 2V9DA 2BXZA 1IYXA 1WXZA 3HPZA 1NDVA 2X2YA 3A64A 4LFYA 3DGBA 3N9SA 5DX7A 4KT2A 1L8PA 2GUYA 1KWKA 1JD7A 2QGHA 2W3ZA 1XLBA 3TWBA 4P7QA 2O92A 3G2GA 4NG3A 1L0PA 5FCZA 2BG5A 5JH1A 1OVDA 2J6XA 2PTDA 3G1SA 5D37A 4CGTA 3D46A 5REQA 4U28A 4F0RA 1AW1A 9XIMA 3M1ZA 5LHFA 1CXKA 1EZ2A 3HFYA 2H9AA 4B5TA 4W8AA 2OX4A 3UT0A 3G0SA 3LHTA 4O11A 4N6FA 2YZ5A 3GTXA 2W6RA 1SW7A 1VEMA 3M0MA 4IL0A 1G9HA 1VFFA 3M0IA 4BQ2A 2CWXA 5A6LA 1N8WA 2ZUVA 3MC5A 2XIIA 3TWAA 2G0WA 5B7ZA 3BGAA 4UWMA 4LUSA 2R1NA 2YBVA 5E0KA 2ADAA 4YWIA 1MXGA 2GUUA 1ZJHA 4K38A 4HMEA 1DQXA 3FXGA 1LDCA 2OPJA 4DI8A 4B4HA 4CCEA 3RF9A 2HK1A 3PSVA 3GAKA 1DOSA 4F66A 2XH7A 1R5YA 3VNJA 3F5LA 1YTKA 4KCUA 1AW5A 4XAFA 3TLLA 1QI0A 4N9EA 1VBJA 3PNUA 4WVXA 3NDYA 4S39A 3G1DA 3HMCA 2CLLA 4JTLA 5D2WA 3W1UA 4CU7A 2XZ7A 8TIMA 3W82A 3T4WA 4QROA 5DMYA 1E1CA 3LCIA 3QF0A 1F5ZA 5FEWA 4YHEA 3W81A 1NOFA 1TQXA 3M5VA 1Q65A 3ECQA 3CASA 4HPGA 2ZX6A 3O63A 2ACRA 2GJRA 3LMZA 2HS6A 4GABA 3KCLA 3UEQA 3AS2A 3SCSA 1DJGA 1BFNA 5I07A 2GGIA 2OZ3A 4A05A 3A47A 4QNEA 3SRDA 1EF2A 5CCZA 3H26A 1E0VA 3W2MA 2GQ8A 3STFA 4DELA 3VI2A 1GOIA 2Z29A 4HNCA 2BGSA 5ABHA 3RR1A 1EA9C 1X1NA 1ZBWA 1XV8A 1G5AA 1XLGA 2R1MA 4B90A 3OZPA 4NZJA 1QO2A 2Y85A 4IISA 1OX6A 1OZMA 3NL2A 4Q8UA 3N04A 2QEZA 3G1FA 1UMYA 1F8IA 5HBFA 1MQQA 4F9DA 3RCNA 4KWVA 1OFQA 5JU6A 2REQB 1XIHA 1XC4A 2OELA 2EJ1A 3WDPP 2XYLA 4D6DA 1UB3A 4ZGYA 2B31A 2NQHA 4IX0A 3B8DA 3N25A 4QEHA 4XX6A 5C2CA 1K03A 1KLZA 4K8EA 3WK3A 2Z1BA 2X16A 3C2FA 3DOPA 4N9CA 2IQTA 1XUUA 1AQHA 2POTA 4P5UA 2CW6A 4ERIA 4QM1A 4N4QA 3ABSA 4C1LA 3WQ5A 1LT8A 1W9UA 1L6SA 1RCOB 4MAVA 1UG6A 3SGUA 5LA0A 1I8JA 4QE4A 3MBFA 1DE6A 4EPKA 1TV5A 4UQEA 2R8WA 4K37A 4MPQA 4PR4A 1BKSA 3MSDA 2D73A 8RUCA 3BLOA 3SSZA 3IVTA 2GQ9A 4NJKA 1TPH1 2PDWA 2D2GA 2DJXA 4IMEA 5AKQA 4CKQA 4ZSTA 4XZHA 3LZ5A 2AAMA 2WNQA 4RV8A 2PD5A 1XIIA 1NQ6A 1P5BA 1VP5A 3EX2A 1W37A 2WANA 4CNPA 4CQCA 1PBGA