3LYIA

Pwwp domain of human bromodomain-containing protein 1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
b'EPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
molecule keywords Bromodomain-containing protein 1
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lyiA01
1WJQA 2IG0A 3OB9A 3H6ZA 3EAEA 2XK0A 2LTOA 4A4GA 4BE1A 4E7HA 4QVZA 3OY9A 2O4XB 4HCZA 4BE2A 4E7LA 2BKDN 2RI3A 4II1A 3M9QA 3PNWC 4IURA 2YRVA 4FU6A 2EQUA 2CKKA 2LDMA 2RHYA 4C5EA 3OYFA 2R57A 1N27A 2LVMA 3LGLA 4B9XA 1OZ2A 2WACA 2P0KA 2RJCA 3MEAA 4IUQA 3LLRA 5KE2A 1G5VA 2M0OA 4IUVA 3MEVA 2X4XA 5J39A 3DLMA 2X4WA 4UC4A 5M9OA 4ZTFA 1RI0A 2MWOA 4N4GA 3QKJA 3OA6A 3FC3A 2PQWA 3QJ6A 4E7IA 3LX7A 4X34A 3OYBA 5KCHA 3QBYA 4QQDA 5FRNA 4Q5WA 3OYNA 5KH6A 5D6YA 3OYLA 4ZTJA 3C4SA 3ZEHA 3DB4A 4FL6A 2MWPA 3LYIA 1H3ZA 2HQXA 4BDZA 2NLUA 3S3OA 2QQSA 2E6NA 2GF7A 2RJDA 2RO0A 2E5QA 3DB3A 3MP6A 2R58A 3CEYA 3OYCA 2DAQA 2RHXA 3LH0A 4BE0A 3S3NA 2G3RA 2RJEA 3MP8A 4L59A 4A4EA 2B8AA 2DIGA 4IUUA 4NS5A 4A4HA 3MEUA 4PLIA 2X4YA 3OMCA 2RI2A 4B9WA 4C5IA 5D6XA 5IN1A 3QIIA 3SD4A 4C5HA 3OYDA 2FHDA 2K3XA 3FDRA 3PMIA 3OYEA 3S3MA 3OYMA 2BIVA 2M1HA 5KE3A 3FLGA 3OS1A 4E7JA 2EKOA 4CRIA 2BUDA 1KHCA 2VYTA 1WGSA 2GFAA 4BD3A 2EQMA 3MP1A 1MHNA 2XDPA 3ASKA 3OYGA 2X35A 4QW2A 3META 3UWNA 2HQEA 4PLLA 2LCCA 3ME9A 2EFIA 4LD6A 3FEOA 2EQJA 2K3YA 5D6WA 2RJFA 2R5AA 2O4XA 2JZ2A 3OYIA 3OYAA 3LGFA 3S6WA 4E7KA 5IAYA 2RI5A 5J26A 4IKFA 3NTIA 2JTFA 2L8DA 4Z02A 4QQ6A 3P8HA 4EDUA 2LRQA 4C5GA 4QQGA 3MEWA 1OZ3A 2EQKA 2RHZA 1OYXA 2L3RA 5FROA 3OQ5A 1XNIA 3O8VA 3UT1A 3OYKA 3H8ZA 2M16A 3NTKA 3GOXA 3L2VA 2GFUA 3MO8A 3OMGA 3OYJA 3F70A 2D9TA 2QQRA 3Q1JA 3E9FA 4GY5A 5C0MA 3BDLA 3L42A 3L2WA 2R5MA 3P8DA 4A4FA 4BDYA 3L2QA 3PMTA 5FRMA 1SSFA 3L2RA 4RG2A 1WJRA 4OVAA 3NTHA 2RHUA 3L2UA 4BACA 3OYHA 2DIQA 3OS0A 2L89A 2RHIA 4IUPA 3KUFA 5CIUA 5KCOA 1OI1A 4N4HA 4N4IA 1WJSA 2F5KA 5C6SA 4IUTA 3E9GA 3PFSA 4PL6A 3OS2A
chains in the Genus database with same CATH superfamily
1PHTA 1WHKA 2XK0A 4A4GA 3ZFJA 3H41A 3P8BB 2BKDN 2KBTA 1JXOA 1KC8R 1OPKA 1NEBA 2A0FB 4J9BA 2LT1A 1ZBJA 1VOMA 4ESRA 4M7DB 2CP7A 4AG2C 2PQWA 2COWA 1BU1A 2OJ2A 3G1JA 1U1TA 3EG9B 2LP5A 2VKNA 3PGGA 1FWZA 4XTYA 1YITA 2WSEE 2NLUA 3R6NA 1VYTA 1FMKA 2CP0A 4ME7A 3MP6A 3PTAA 2Y4XA 1FYNA 3LH0A 2ZCFB 3PIOA 4AFZC 3I55A 5KYYB 1OPLA 2LJ0A 1VQ5T 2QTVA 1T0JA 4B9WA 2DLPA 5GAMg 2MAMA 4M77F 2HMAA 2BIVA 2NUTA 4JRQA 2K3BA 2XG8D 4JUVA 4C92G 1BI1A 4J9FA 3D7SB 5HKCA 2ROLA 1JB0E 1OULA 1PRMC 2DTHA 2V26A 2PNIA 3RDVA 1EZZB 4JRKA 4A54A 1D3BB 1NJIC 3FIFA 3CCSA 3JCMW 2KRMA 4QT7A 3OBWA 3G71Q 4HT9A 1C6VX 1KQSA 3TCJA 2W10A 4RTUA 2EQKA 3DKMA 3OQ5A 1XNIA 3TVTA 1JQQA 2DRKA 3HFNA 1VQNQ 1YWOA 3L2WA 1VQMQ 1N8RC 1K9MC 3CC7Q 1Q7YC 4CC3A 4F14A 4M78C 2A37A 4XTVA 3OYHA 3EHRA 1TTHB 2QGFB 1UGQB 2H3JA 4IUTA 1VYVA 4M75F 2ZPFB 2CP6A 3LH5A 9ATCB 1PCXA 2MF2A 2ZPHB 1T3SA 1HJDA 3CC4A 4M4ZA 2LDMA 2D1XA 2R57A 1BIAA 2LQWA 2P0KA 5GMKi 2KGTA 4OB0B 3DLMA 5AT1B 1RI9A 1V76A 3OSSC 3OYNA 3C4SA 1G2BA 1Y71A 4BDZA 2HL5C 4HVUA 2F5TX 4C92F 1VQ5Q 1PD0A 2ATCB 2E41A 1RAAB 3CCRT 3CCVT 1W2BS 4C8QF 3SFMA 2KK4A 5KYXB 3OSVA 1GBQA 4A4HA 3UA6A 2EGAA 1VQLT 1TUGB 3A8MB 1M5Q1 2FHDA 3PMIA 1M2VA 4FYWB 3I56T 2OTLT 1D3BA 2M1HA 4BUGA 1GL5A 1RLPC 2O9SA 4LDUA 4RKUE 5J3BA 1UGVA 2GFAA 3JSCA 1YJNA 1NZ9A 2W0ZA 3RMSA 2BZYA 1M9SA 1H641 3M56A 4YTLA 2CUDA 3H0HA 2E64A 3NMZC 4M77A 3CCMT 5CKEA 2K3YA 4M78E 1QW1A 2R5AA 4E47A 5FW9A 4E7KA 1UFFA 2E5KA 4C8QB 4IKFA 3U23A 3NTIA 2ENMA 3EFSA 3EGUA 4QQGA 1I81A 1OYXA 3H8ZA 3NTKA 3OW2S 1KK7A 1UUEA 3CCLT 5I11A 5FLXE 1N5ZA 2A7YA 1IB8A 3RESA 3CD6A 1W70A 1W2BP 2VASA 3QPHA 1RUWA 2EJFA 2GQIA 1KJWA 1AZGB 2KI7A 2F2WA 3OB9A 3H6ZA 5D7UA 3SDZA 5GJWB 2QI2A 1GFCA 4MMLA 4IURA 4KGZB 1XTDA 3G6ET 2YWWA 3QWYA 3VS7A 2WACA 1K73R 3LLRA 2M0OA 1IGQA 2E3IA 4OB2B 4M75A 3OA6A 1TH7A 3OYBA 5KYXA 2E4HA 5KH6A 3A8LB 1VIEA 1KQSP 3CCRQ 2L5QA 1NPRA 4J83A 5FU6B 2DX1A 1UHCA 1ZX6A 3UATA 1VQLQ 2RHXA 1NBEB 3S3NA 2AZVA 1M3AA 3I56Q 5GANd 2OTLQ 4RTVA 2PTKA 3M57A 4PNOA 2DYBA 1RLQC 1D1AA 1UGPB 2VXEA 1IRXA 3JCMc 2CSIA 3OYDA 2K57A 4C92A 1M1KU 4P5NA 2HSPA 2HEQA 3RNJA 4C8QA 3HHTB 3CCMQ 1Q82C 2EYWA 2DBKA 2JVVA 2I0NA 1UG1A 1UDLA 4BY6B 4JPBW 1FX7A 3G4SA 4HKEA 3E1SA 4ELZC 3CCLQ 5KYNA 3HTRA 3JB9G 1D1BA 1VQ9T 3THKA 2DXCA 1N9SA 5CK9A 2ZPBB 1F1BB 3EH1A 3WXMB 2COZA 1WJRA 2QEXT 5GAOp 3QUIA 1JBMA 3KUFA 5CIUA 5LJ3f 3SB2A 1PSFA 5CKDA 2RM4A 2XICA 4PL6A 1BI2A 1VQ6T 4BE2A 2JTMA 3JCMg 5LJ5d 2CKKA 1NLPC 4MZTA 3TU4K 1A0NB 4ZN3A 1Q82R 5J39A 2X4WA 2MCNA 4ZTFA 1RI0A 4LUDA 4E7IA 1V1CA 2JM8A 1X6BA 5GANh 1G3SA 4M77D 4Q5WA 3OYLA 4ZTJA 3M0UA 2DERA 4M78B 3OBYA 4AT1B 2E6NA 3UDCA 1U5SA 2KT8A 1AHJB 2QASA 3VRYA 5GAMe 1WIEA 2F69A 1FXXA 2EWNA 5GAOl 4DEYA 3S3MA 5LJ3j 3M0TA 1ABQA 1FMVA 2VXFA 5EG2A 1Y96B 1GFDA 1MMGA 2GQVA 4F7UG 2NUZA 2RD1A 4OGEA 4DOWA 1VQ7T 4PLLA 4LD6A 1JEGA 3V8JA 5D6WA 2K79A 1X43A 4M77C 1VQ9Q 4JRPA 1YITT 4QQ6A 3V7CA 3H0FA 1YBYA 2FPDA 1PC0A 4DBFA 1YNZA 3I55T 3JCMV 4XAXB 1Q81R 4PJOG 2QEXQ 4OF1A 3BDLA 2R5MA 3JRZA 1YHQA 1KQ1A 4F04B 2D0QB 4DA4A 5LJ5h 3HP9A 3L2UA 2A3LA 2QDYB 1TUCA 3CCET 1VQ6Q 3CCUA 1T0HA 2KAFA 3PFSA 2K6DA 2HD0A 3O5ZA 3CBPA 1VQPA 2LTOA 4QVZA 2YUPA 3GF5A 2F2XA 4II1A 3CCST 4X9DA 5I22A 2HCKA 4FU6A 2PVGB 3TQ7P 4JS4A 2A08A 4IUQA 2CP2A 1KG1A 3VS5A 1VA7A 3QJ6A 1VQKA 2EYQA 1UHFA 2JJ9A 2QQAA 4M75C 1D0XA 1PKSA 2EVRA 1FMWA 4FL6A 3LYIA 1UGRB 1W4SA 2JS0A 3EFOB 2RJDA 1M90R 4Y92A 3INZA 4BE0A 2H8HA 4M77E 2PUKB 1K76A 3BE3A 3M4YA 2QG9B 2KSSA 3SD4A 2L3PA 1ZBXA 1WXTA 1VQ7Q 4CRIA 2FPFA 3C12A 1WGSA 4C92C 1BBZA 1X69A 4FSSA 5GMKl 4C8QC 2CS7A 3QO3A 2Y90A 2AT1B 1OEBA 4PJOF 4FW1A 1YITQ 2KVQG 2O4XA 2HKNA 3M0RA 1VQOA 2VUBA 3IQLA 4EDUA 3I55Q 1JJ2A 1AT1B 1KC8C 1I1JA 2I2LA 4XK8E 3UT1A 3EHQA 4Z89A 3EGXA 4HCCA 1YN8A 2LJ3A 1ZHIA 3F70A 1B07A 1QKWA 2P4TA 1AEYA 4BDYA 3CCEQ 3M55A 2D0NA 2FZKB 1TG0A 3RUXA 4OVAA 4VUBA 1LCKA 4M75E 2RHIA 4FSXA 4LDWA 3CCSQ 4DEXA 3QHSA 3LWHA 4JZ4A 4CI0C 1BI3A 1YWPA 2FB7A 1TWBA 3I9QA 1AWOA 4CC4B 4C0FA 4A53A 2CZ7B 3MEAA 4LNPA 1QVFS 4J7IA 5GAN7 5GMKh 2M02A 4J9EA 2AKLA 2K4YA 5CQYA 3LX7A 4JLIA 1YCSB 2CSQA 2MOXA 4C92E 4AMCA 1H3ZA 1Y0MA 3HRUA 3J81E 2JS2A 3HPWA 5IT9E 1PG5B 1AZEA 3RKXA 1VQ4A 2JOYA 2OTJT 4MZPA 1IREB 1WHHA 4OMFB 1QVGS 4NS5A 4OGCA 3UF4A 2RI2A 4KRTA 1AVZC 3FRNA 5FWBA 1SRMA 3OYYA 2EKOA 2CT3A 2YRDA 2EAYA 1E7OA 5FU7C 4BY6C 2DL7A 4QW2A 1ARKA 2KXCA 1JO8A 5HK3A 4QVCA 4BI4A 3CC2T 2E12A 2X51A 2D8JA 4AFSC 1QVFP 2C0IA 4F17A 3KFVA 3TSWA 2HDAA 2FO0A 2K2MA 4PJOA 4HVVA 1VYUA 4E6RA 3SHWA 2J7IA 2DD4A 3OMGA 3E9FA 4XTWA 4JJBA 4RTZA 2DXUA 1M2VB 1NJIU 1O75A 1Q86R 4KUDK 5A0DA 2D6FA 2DK3A 2FEIA 4EIKA 4QVDA 5GAOq 3GP8A 1XJWB 4BACA 3M58A 1QVGP 5IXFA 2BE9B 4C0GA 4NL3A 4PJLA 4ORZA 1QKXA 2WSCE 1YJ9A 3VKIA 2PU9B 5M9OA 3CXCA 3M4GA 3JCMe 4BE1A 4M77B 3CCJA 4E7SA 1VQ8A 1H3HA 5DM7R 3X20B 4B9XA 1N8RU 1SHFA 4K11A 1K9MU 3BW1A 1YJWA 1Q7YU 2X4JA 1YI2Q 3CBMA 2X9HA 3EG2A 2PVDB 2DJQA 3VUZA 3DB4A 1SRLA 2KXDA 2OTJQ 1K0SA 2YUQA 2FL7A 1JJ2P 3JB9D 1HD3A 2HKQB 4M7AG 4EMKB 4Y91A 3A8OB 2DAQA 5CKBA 8AT1B 2RJEA 3MP8A 1BIBA 4PLIA 4ZNXA 3G7ZA 4C0DC 1WYXA 2PZ1A 5KE3A 3RERA 5IH2A 3JAME 2VWFA 5ECAA 3CPWA 4XU2A 2KNBB 5GANf 3CC2Q 1Y07A 1NM7A 4M75B 1VIFA 3TREA 2AZSA 4KBMB 1G3YA 1AD5A 2ZPEB 2L3SA 2QTXA 2SRCA 2CGHA 1QCNA 1S72T 2DL5A 3OYKA 2EBPA 1K73C 1OU9A 2GFUA 1G3WA 3JCMQ 3J7AF 2O2OA 5I2MA 2CP3A 3KXTA 1W1FA 1Z9ZA 3M0SA 4C92B 3PVLA 4OMOA 1QQJA 2KY9A 2O9VA 3NTHA 3I35A 3A98A 1N6AA 4X1VA 3A8HB 2L89A 1KQSS 1OI1A 2GCXA 3REAB 1YIJT 1OX9A 5L23A 2B86A 3OYFA 2EQUA 5GANj 1U06A 4B6MA 4OB1B 5GAMd 1OZ2A 2HSEB 2BZ8A 5L8RE 2XU8A 4EMKA 3FC3A 2ED0A 3MJXA 1VQNA 1SSHA 3VJPA 2V1RA 2O31A 2ZPGB 2H3EB 1VQMA 2QDLA 5LJ5f 1YHQT 1ZSGA 3CC7A 5CR2A 2DILA 1UEBA 2F2VA 2LQ8A 3CBOA 1WI7A 3QSUA 3VYGA 4L5GA 4OP0A 4PJOD 1SPKA 3CCQA 1OX8A 2DTIA 2BE7D 1VQPT 2HL3A 1WFWA 1X6OA 1PKTA 4XU0A 1ZSZA 3CCVQ 1Q95G 3M5AA 1MHNA 1I8FA 4F16A 2VVKA 2KRSA 2E70A 2BTTA 2G6FX 5IHIA 4PKCC 1UECA 7AT1B 1YFNA 4M78G 2KRNA 1X2QA 4J6XA 2P4RA 1S72Q 2AKKA 2L8DA 1VQ5A 3P8HA 4PFPA 2KYMA 1RAHB 4C0ZA 3NHNA 4JJNK 1OZ3A 3O8VA 4FM4B 1I4K1 2MMPA 2AHJB 2EQIA 3BFMA 1MMNA 3E2UA 1Q82U 1RADB 5LJ5j 2GTJA 2YT6A 1KFZA 4PJOC 3VS6A 2NUPA 1EFNA 5FU7B 5GAOn 1GBRA 4JS5A 2QK0A 5DLQE 5GAMh 3EG1A 4OMQA 2DE0X 4XQ3A 5KCOA 1YIJQ 2OAUA 1QCFA 4E7HA 3EAEA 2CUBA 3PNWC 5LJ3g 5GAN4 3CPWP 2RHYA 3FJ5A 4J7FA 4MMKA 2J06A 2V8KA 3VV0A 2RMOA 2X4XA 2EPDA 3EG3A 4N4GA 1CSKA 4X34A 2GTOA 1I07A 4F7UE 2VV5A 3RR6A 5D6YA 2JW4A 4A4KA 1NYGA 2EGCA 4J6WA 2ZAEA 3G6EQ 2E5QA 1QP3A 3OYCA 1KD1U 2EKHA 1ZA1B 1MNDA 1ACMB 1IGUA 2XI9A 3MEUA 4ZGJB 1JU5C 2FZCB 2X4YA 5D6XA 1PNJA 3E19A 3SWNA 1IHWA 2MI6A 4PJMA 2C0OA 1Q81C 2O01E 2BUDA 1KHCA 3QYHB 3V8LA 4BD3A 4PJOE 3H9NA 1M1KR 1G3TA 2QXFA 3META 1K8AU 4J6YA 2BZXA 4LE9A 2COYA 3X25B 4AFQC 2E6ZA 2RQVA 4R56A 4LXCA 2RK1A 3BY7A 4FYVB 2VB6A 2RHZA 3I5SA 3C0CA 3EGDA 2JTEA 2OI3A 2JNGA 3I56A 4C0DB 3V7RA 4Y28E 3JB9F 2CREA 2QQRA 3FB9A 1M1GA 1T3LA 3JB9J 1IHVA 3PMTA 4J9DA 3CCMA 4XTXA 1M90C 1AOJA 3RKYA 4RTWA 4HCBA 1BB9A 2P84A 1BCOA 4E7ZA 5GMKj 2O4XB 4RCCA 3M9QA 2EIFA 2QQBA 3CCLA 2MPXC 2RJCA 1CKAA 2DTOA 3QKJA 3EGXB 1TSFA 1X27A 4QQDA 2CP5A 3VU3C 4EMKC 1GRIA 1WNLA 1LNXA 2LQNA 3EH2A 2ABLA 3C95A 3DB3A 1RAFB 4DBHA 1H8KA 2DETA 2NYSA 1QLYA 4XU1A 4A63B 4JZ3A 4A4EA 4WF2A 5KYWA 3CCJT 3A8GB 2LT4A 2QAZA 1VQ8T 2E65A 4ZGEB 1M8VA 1CKBA 2EQMA 2JM9A 2DEUA 4F7UF 1ZSZC 2HZYA 4JLGA 2LCSA 3X28B 1OOTA 2WSFE 5CKHA 2ROTA 3TSZA 3CMEA 5DY9A 2F1LA 3CQTA 1K9AA 5IHKA 1NLOC 2JUFA 1HSQA 4J8OA 3QYGB 4NL2A 1LVKA 4RG8A 2K5FA 3JCMd 3CC4T 2CZ0B 2CZ1B 2DZ9A 3GOXA 4M7DG 4OB3B 2KYBA 3P8DA 1UB4A 4PFOA 2FPEA 4M7AD 2KROA 1QCOA 1ZUYA 4F7UB 3ULRB 3L2RA 1E6GA 2RHUA 3R6OA 4JJCA 1I0CA 2YUNA 1KC8U 1M30A 1Z9QA 3ZBDA 4WCIA 2RQUA 2MYSA 2FYKA 2CH4A 1G8XA 4Z88A 1VQ9A 4LDVA 2ESWA 2FRYA 2LVMA 2QA4A 2J6FA 2X3WD 1MV3A 5GAN6 4D6WA 4PJOB 3AT1B 4HA8A 4FT2A 2DXTA 2RF0A 1YJNT 2QEXA 1QWEA 1NYFA 3HL8A 2DD5A 2NWMA 3RMQA 2QQSA 1TS9A 5A0LA 5KYUA 4ATOA 4V2SA 4O5VA 1VQ6A 1N9RA 1X75C 3CCJQ 1JRIA 4XU3A 2YDLA 1VQ8Q 1M8MA 1WXBA 3T9NA 3SWNC 3VUBA 3MP1A 2RNAA 1Q86C 2IIMA 2K2VA 1D0YA 4JJDA 1MNEA 3REBB 4M7DF 3HRTA 3CD6T 2EFIA 3JCMh 3CMAA 1M3BA 1MMAA 2EQJA 1W6XA 2RJFA 1WHGA 2HBWA 5AYFA 2DL8A 4MDWA 3S6WA 1MMDA 1WDXA 3CC4Q 4LDXA 1RL2A 2KQWA 2XIDA 4WTOB 2DO3A 4F7UA 5FROA 1X2KA 3GLXA 4L6V5 4FIBA 1B7TA 3EG0A 1SG5A 2DFUA 2ECZA 1UGSB 3NFCA 2V8JA 3CCQT 4GY5A 1VQ7A 1KIKA 4A4FA 1V29B 3ZL7C 1UTIA 1WQ7A 1WXUA 4N4IA 1NPPA 2RPNA 4M75G 1YI2T 2HNIA 2MIOA 1JJ2S 4HVWA 4R55A 3OS2A 4M7AE 5LJ3e 1WHMA 3JCMX 3OY9A 4HCZA 4E7LA 3V7SA 2K5LA 1W2BA 2KEAA 2DKGA 1YJNQ 2LNVA 4IUVA 3MEVA 1WZOA 4UC4A 2K7AA 4FW2A 2GNCA 4M78D 3QBYA 1PSEA 4AG1C 2L3QA 5CQXA 4EPCA 2YLCA 3JB9I 3CCEA 3VS1A 4PK4A 4MDXA 3S3OA 5GAMf 1U8RA 4C8QG 5GMKe 5GAN8 3G4ST 1PWTA 4OMLA 1X01A 4OMNA 4L59A 3HSBA 4IUUA 5CKFA 4LD9K 4RUGA 2K9GA 1DJ7B 1H92A 2E3HA 3OYMA 1GCQA 1M27C 2DMOA 3CD6Q 3OW2A 1S1NA 4N0AA 1IO6A 1WQWA 4TVRA 3NPFA 2J6KA 2HQEA 2DF6A 3ME9A 3DLLA 1D09B 3BDUA 3X26B 3VS3A 4ZGDB 5GANg 1Y57A 1R0CB 2LRQA 4C5GA 3MEWA 4GLMA 1LPLA 4PJNA 4M7DA 3CCQQ 1U1SA 3N5BB 1AWJA 2C06A 1AWXA 3PT9A 2EGEA 1ZUUA 3UPUA 1SF9A 1ZUKA 3EG9A 5GAMj 3Q1JA 3L42A 1BK2A 2YSQA 3GBQA 1B3QA 4KUIA 2RK2A 1TOVA 1RAEB 1ZSZB 1QP2A 2DZCA 1YCYA 2LMJA 5KYYA 3PIPA 1NJIR 5C6SA 1M3CA 1WJQA 1K73U 1PD1A 1RACB 3JCMJ 4C5EA 3LGLA 1BCMA 4HCKA 1UJYA 4ANJA 5A2QE 8ATCB 5GAN3 2IVWA 1N8RR 2VGMA 5FRNA 1K9MR 1Q7YR 1K0XA 2NUPB 2MWPA 2RN8A 3G4SQ 3CXCS 2GF7A 1MUZA 3G71A 4BI8B 1WPYA 1VUBA 4KH0B 2MK5A 4M7AF 1M1FA 5IHNA 4FYYB 1WHLA 5LJ5g 3OMCA 2CYZB 5IN1A 4C5HA 3GNFB 2KR3A 4E7JA 4LUEA 4DQ2A 4PJJA 2J6OA 3EFRA 2YUOA 3L1AA 2ZGWA 2X35A 2XHCA 3L2ZA 4FCYA 1XQHA 2LJ1A 2DBMA 1YI2A 1RAIB 3FEOA 2QGGA 4KT0E 3NGPA 4XTUA 2C0TA 4RCBA 2E1HA 4Z8AA 3CCUT 2O88A 2OTJA 5J26A 2AK5A 4M7AB 2JTFA 2RQRA 3VYHB 1TXQA 2EJGA 2DM1A 3CPWS 2LX7A 2YRCA 3MKDA 5CCAA 2EYYA 2D9TA 5C0MA 4QKUA 4GBQA 4DOVA 2OX7A 3OS5A 4X9CA 3SWNB 3CXCP 2XD0A 1R77A 2Z0WA 2A28A 4JDSA 1K4US 3A5ZB 1VQKT 4RTTA 3RKWA 4XTZA 1SHGA 2KMTA 2DEQA 2AIRB 1GXIE 3HFOA 3CC2A 2F5KA 3QZ5B 3E9GA 2DNUA 3QG1A 6AT1B 1GCPA 2RI3A 3MCAB 3CMET 4GLKA 4LN2A 5HY6A 3OW2P 3WVEB 2XMFA 1N27A 3M0QA 3EGDB 3MHXA 1LOJA 1U3OA 1M1KC 3ZEHA 2YHTA 2X3XD 2HQXA 1I5OB 1NEGA 2HBPA 3X24B 1O9SA 3RBBB 2D8HA 4M7DD 2M0YA 1VQOT 1HK9A 2GBQA 1QWFA 5GAN5 2PVOB 3OYEA 3HKSA 1YHQQ 2CH4W 2YLBA 4J9IA 3JCMb 1X6GA 3A1PA 1GCQC 3VS0A 4M7AA 2XDPA 3ASKA 3OYGA 2QA4T 3CCUQ 2QQ9A 4N0AC 2J05A 4IIOA 3VRZA 2XDDA 1VQPQ 4DBQA 3OYAA 3I5RA 5CVIA 1ABOA 2K5IA 1WLPB 4M78F 1J3TA 1P92A 3GNGA 2SEMA 3RIRA 4PFZA 1I5LA 1M2OA 1Q81U 3L2VA 4M7DC 2DL3A 1SEMA 3MO8A 1VQKQ 2KDSA 1KD1C 5KYWB 1Y7XA 5GAN2 3L2QA 4EMHA 4DBRA 3PE0A 3CCRA 3CCVA 1QMCA 3JCMf 4IUPA 2RB6A 4MZMA 1C1AA 3CMEQ 2CZ6B 1VQLA 4C5IA 2JXBA 4RTYA 3CMAT 2IG0A 1VQ4T 2LCLA 1ZQ1A 4ZN1A 2OTLA 4KGXB 1S72A 1K8AC 3URGA 2E10A 2HQHA 1HYOA 4J9GA 3QDFA 2M51A 4NOYA 2M9UA 5KCHA 1BYMA 1PRLC 4BB7A 1M90U 1WHJA 2L0AA 2EYZA 2FVUA 1TU0B 1RAGB 1TUDA 1VQOQ 1R0BG 3V8KA 3QZ9B 1IXDA 2RO0A 1OU8A 2CDTA 2YXYA 5GAOm 1NE8A 2IPOB 3ER0A 2ZZDA 4J5YA 2DA9A 1XOVA 2OAWA 1YIJA 1G83A 1JXMA 2B8AA 2VC8A 1MGQA 4ELYC 5CO7A 3QDRB 3QIIA 2V1QA 1KD1R 3LW5E 3FDRA 3OS1A 2QA4Q 2DVEA 4LDYA 4M7DE 2VYTA 2A36A 3WVDB 4OMMA 4M75D 5DLOA 1B34B 3VS4A 2DXBA 1UJ0A 3M54A 2FRWA 3SEMA 2ZPIB 2LCCA 2RA2A 3UA7A 1R8OB 3JV3A 1M4ZA 5GANe 2JZ2A 2JN0A 2P0PA 5IAYA 5FWCA 3KBGA 1WA7A 5IXBA 1YJ9T 3G6EA 2GGRA 1D1CA 3GIBA 1K8AR 1KQ2A 4Z02A 5A0GA 4CC2A 5KYUB 2RQWA 2ED1A 3TEEA 3J80E 4J9HA 1D0ZA 1K1ZA 2DVJA 4KULA 5LJ3d 2M16A 1C0MA 4D8KA 3JCMP 3OYJA 4C92D 1RABB 1YJWT 1OV3A 3FJPA 4C8QD 4M78A 1QVFA 5FRMA 4R0KA 1SKUB 1KHIA 4RMOA 1MV0B 2JMAA 3CMAQ 1VQ4Q 3OS0A 4OMPA 1WX6A 3C94A 5I21A 1HXDA 4RTXA 1NG2A 1ZLMA 2LZ6B 4KGVB 1Y96A 3QXEB 2YRVA 2PUOB 4IIMA 1QVGA 4FYXB 2P0QA 3CPFA 5KE2A 1G5VA 5I2SA 1BKBA 2DPPB 2MWOA 4O6JA 3HRSA 1E6HA 1UE9A 2CT4A 4HXJA 2RQTA 5CAIA 2XDBA 2HAXA 1LJOA 3PVQA 4BI3A 2R58A 3CEYA 5LJ5e 1EIFA 2LNHB 2G3RA 3VS2A 1AWWA 2DIGA 1B34A 2EYXA 2QYZA 1BI0A 2JT4A 4AFUC 3M53A 4KH1B 2K3XA 1KSWA 2Y4YA 5GMKm 3FLGA 2FZGB 2L2PA 5GJVB 2LC4A 2EW3A 5GAOr 2DJZA 2LQKA 4EMGA 3UWNA 5HCKA 3MPUB 4M7AC 1YJ9Q 5LJ3h 2NUTB 2KE9A 3OYIA 3LGFA 3M0PA 5LL6S 2RI5A 1YP5A 1PM3A 4M77G 5EC7A 3M59A 1OQKA 2VGNA 2XKOC 4J9CA 2DRMA 4FT4A 2L3RA 5HK0A 3G71T 1YJWQ 2FG0A 1QVPA 3GPLA 2LX9A 2RH2A 3JB9H 3AHUA 2KT1A 1Q86U 3H0IA 1EX4A 3LWIA 1IZ6A 4JRIA 1ZA2B 3EFOA 1SSFA 2DL4A 4CC7A 2V8IA 4D8DA 1VQNT 4RG2A 2EJ9A 3QJYA 2JMCA 4HT8A 5FU6C 1VQMT 2DIQA 2DYIA 3CC7T 4N4HA 1WJSA 3QWXX 4E2FB 4C8QE
chains in the Genus database with same CATH topology
1WJQA 4E7HA 3CBPA 1VQPA 3EAEA 2XK0A 2LTOA 4A4GA 3ZFJA 1K73U 4QVZA 3GF5A 2BKDN 3P8BB 4II1A 3PNWC 3CCST 5LJ3g 4X9DA 4FU6A 2PVGB 5GAN4 2RHYA 4C5EA 3JCMJ 4JS4A 3LGLA 4J7FA 2LT1A 4IUQA 4MMKA 2V8KA 3VV0A 2X4XA 1KG1A 4M7DB 5A2QE 4N4GA 2PQWA 3QJ6A 4X34A 5GAN3 2IVWA 1VQ5A 1VQKA 2EYQA 2VGMA 5FRNA 4F7UE 2VV5A 2QQAA 5D6YA 4M75C 1U1TA 4A4KA 4FL6A 2MWPA 1UGRB 1FWZA 1W4SA 3LYIA 3PGGA 4J6WA 2WSEE 2NLUA 4XTYA 3CXCS 1YITA 2GF7A 2RJDA 4ME7A 2E5QA 3G71A 4BI8B 3MP6A 1QP3A 1WPYA 3OYCA 3INZA 1VUBA 2Y4XA 3PTAA 1KD1U 4BE0A 3LH0A 4M7AF 1M1FA 4M77E 2ZCFB 4ZGEB 2PUKB 3PIOA 3I55A 5LJ5g 1VQ5T 2XI9A 3MEUA 4ZGJB 3M4YA 2X4YA 2CYZB 3OMCA 2KSSA 4B9WA 5GAMg 5D6XA 5IN1A 3SD4A 3E19A 3SWNA 4C5HA 2MAMA 2MI6A 4M77F 1ZBXA 3GNFB 2BIVA 1Q81C 4E7JA 4JRQA 2O01E 4CRIA 2BUDA 2XG8D 1KHCA 3C12A 3QYHB 3V8LA 4DQ2A 1WGSA 4JUVA 4C92C 1BI1A 3EFRA 4BD3A 4C92G 4PJOE 3L1AA 2ZGWA 2X35A 2XHCA 3L2ZA 1G3TA 2QXFA 3META 1XQHA 2CS7A 3QO3A 4C8QC 5HKCA 1JB0E 5GMKl 1YI2A 2DTHA 2Y90A 1K8AU 3FEOA 4J6YA 4PJOF 4KT0E 4XTUA 4JRKA 4A54A 1D3BB 4RCBA 2KVQG 2O4XA 1NJIC 2E1HA 3FIFA 3CCSA 3JCMW 3X25B 3CCUT 4HT9A 3OBWA 2OTJA 2E6ZA 5J26A 1VQOA 1KQSA 2VUBA 4M7AB 4R56A 3TCJA 2JTFA 2RK1A 3BY7A 4EDUA 3VYHB 2EQKA 1JJ2A 2RHZA 3DKMA 3OQ5A 1XNIA 1KC8C 2I2LA 4XK8E 3UT1A 2EJGA 2JNGA 3I56A 4HCCA 4C0DB 3V7RA 3HFNA 4Y28E 3CPWS 3JB9F 1ZHIA 5CCAA 3F70A 2D9TA 2QQRA 5C0MA 3FB9A 1M1GA 4DOVA 3L2WA 3OS5A 4X9CA 3SWNB 2XD0A 3JB9J 2P4TA 1N8RC 4BDYA 3PMTA 4JDSA 1K9MC 1M8VA 1Q7YC 3A5ZB 3M55A 1VQKT 3RKWA 3RUXA 4XTZA 4OVAA 2KMTA 4M78C 2DEQA 4VUBA 3CCMA 4XTVA 3OYHA 4M75E 1GXIE 2RHIA 3HFOA 3CC2A 4XTXA 1UGQB 4FSXA 4LDWA 1M90C 3CMAT 2F5KA 2H3JA 4IUTA 3QZ5B 3QHSA 3E9GA 3RKYA 3LWHA 4CI0C 1BI3A 4M75F 2ZPFB 3QG1A 4HCBA 5GMKj 2MF2A 2FB7A 2O4XB 4RCCA 2RI3A 2ZPHB 3M9QA 3MCAB 4GLKA 3CMET 5HY6A 2EIFA 3CC4A 2QQBA 2LDMA 3WVEB 2R57A 1N27A 1BIAA 4C0FA 3CCLA 4A53A 2CZ7B 2P0KA 2RJCA 3MEAA 1QVFS 5GMKi 4J7IA 5GAN7 4OB0B 5GMKh 2DTOA 3DLMA 3MHXA 2K4YA 3QKJA 5CQYA 3LX7A 4JLIA 1LOJA 4QQDA 3OSSC 3VU3C 3OYNA 4C92E 4EMKC 1M1KC 1WNLA 3C4SA 1LNXA 3ZEHA 2YHTA 1Y71A 1H3ZA 2HQXA 4BDZA 3HRUA 3J81E 5IT9E 3HPWA 2F5TX 4C92F 3C95A 3RKXA 2HBPA 3X24B 1O9SA 3DB3A 2E41A 3CCRT 1VQ4A 3CCVT 2JOYA 1W2BS 4C8QF 3SFMA 4M7DD 4MZPA 1IREB 4XU1A 1HK9A 2KK4A 1VQOT 4OMFB 3OSVA 4A4EA 1QVGS 4NS5A 4A4HA 4OGCA 2RI2A 4WF2A 1VQLT 5GAN5 3A8MB 2PVOB 1M5Q1 2FHDA 3OYEA 3PMIA 3CCJT 3HKSA 3FRNA 3I56T 2OTLT 3A8GB 1D3BA 2M1HA 4BUGA 2LT4A 2YLBA 3OYYA 4C8QE 2EKOA 3JCMb 1VQ8T 4M7AA 2E65A 4LDUA 4RKUE 5J3BA 2GFAA 3JSCA 2EQMA 2EAYA 4BY6C 1NZ9A 2XDPA 3ASKA 5FU7C 4QW2A 3RMSA 3OYGA 1YJNA 2QA4T 1M9SA 4F7UF 1H641 3M56A 4JLGA 3X28B 2QQ9A 4N0AC 4YTLA 2E64A 2WSFE 5CKHA 4M77A 3CCMT 5CKEA 2K3YA 4M78E 2XDDA 1QW1A 2R5AA 4QVCA 5HK3A 4BI4A 4E47A 3OYAA 3CMEA 3CC2T 5DY9A 4E7KA 5CVIA 4C8QB 2E12A 4IKFA 2K5IA 3NTIA 4M78F 3EFSA 1P92A 3GNGA 4QQGA 1I81A 2JUFA 4J8OA 4NL2A 3QYGB 3RIRA 1Q81U 1OYXA 1I5LA 4RG8A 2K5FA 3H8ZA 3JCMd 4PJOA 3CC4T 2CZ0B 2CZ1B 2DZ9A 3NTKA 3GOXA 3OW2S 3L2VA 4M7DC 4M7DG 2DD4A 3CCLT 3MO8A 3OMGA 2KDSA 4OB3B 1KD1C 3E9FA 5GAN2 1Y7XA 4XTWA 5FLXE 3P8DA 1UB4A 2A7YA 4M7AD 2DXUA 3L2QA 4F7UB 4EMHA 1NJIU 1O75A 3RESA 3L2RA 4KUDK 5A0DA 2D6FA 3CD6A 2DK3A 3CCRA 2RHUA 3R6OA 4QVDA 5GAOq 3CCVA 3GP8A 4BACA 3M58A 3JCMf 4IUPA 4C0GA 2RB6A 4NL3A 3QPHA 2EJFA 4MZMA 2WSCE 2CZ6B 3VKIA 1YJ9A 1KC8U 1VQLA 2PU9B 3ZBDA 4C5IA 5M9OA 3CXCA 3M4GA 2IG0A 3OB9A 3H6ZA 4M77B 2FYKA 3SDZA 3JCMe 3CCJA 4BE1A 1VQ4T 2LCLA 1ZQ1A 4ZN1A 2OTLA 2QI2A 1S72A 1VQ8A 4MMLA 1K8AC 4IURA 3URGA 1VQ9A 2E10A 1XTDA 3G6ET 4LDVA 2LVMA 3X20B 4B9XA 5DM7R 1N8RU 2WACA 1K9MU 2QA4A 3BW1A 3LLRA 1YJWA 1Q7YU 2M0OA 5GAN6 4NOYA 2X4JA 4OB2B 4M75A 4D6WA 2M9UA 3OA6A 4PJOB 3CBMA 4HA8A 1TH7A 4FT2A 5KCHA 3OYBA 2PVDB 1BYMA 2DXTA 4BB7A 1YJNT 1M90U 2QEXA 5KH6A 3A8LB 1VIEA 2FVUA 3HL8A 3VUZA 3DB4A 2L5QA 1NPRA 2DD5A 4J83A 3RMQA 2QQSA 3V8KA 2FL7A 5FU6B 3QZ9B 5A0LA 2RO0A 3JB9D 4ATOA 4M7AG 4V2SA 4EMKB 4Y91A 5GAOm 1NE8A 3A8OB 2DAQA 3ER0A 2RHXA 2ZZDA 4J5YA 4O5VA 5CKBA 1XOVA 3S3NA 1VQ6A 1YIJA 1N9RA 2RJEA 1X75C 3MP8A 2B8AA 2VC8A 1MGQA 4ELYC 1BIBA 5GANd 3M57A 4PNOA 4PLIA 5CO7A 1JRIA 4XU3A 1UGPB 3QDRB 3G7ZA 2VXEA 3QIIA 4C0DC 3JCMc 3OYDA 3LW5E 3FDRA 2K57A 4C92A 3T9NA 3OS1A 5KE3A 1M1KU 4P5NA 2DVEA 3RERA 4LDYA 3SWNC 3JAME 4M7DE 2VYTA 3VUBA 4C8QA 3WVDB 4M75D 3HHTB 5DLOA 3CPWA 3MP1A 1Q82C 1B34B 4XU2A 2DXBA 1Q86C 2K2VA 3M54A 5GANf 2ZPIB 4M7DF 1Y07A 2LCCA 2EFIA 3HRTA 3JCMh 3CD6T 2JVVA 3CMAA 2RA2A 4M75B 2EQJA 1R8OB 2RJFA 1M4ZA 1VIFA 2JZ2A 2JN0A 5AYFA 4BY6B 5GANe 3TREA 4MDWA 3S6WA 2P0PA 4KBMB 5IAYA 3KBGA 1G3YA 1FX7A 3G4SA 1YJ9T 3G6EA 3GIBA 4HKEA 3E1SA 1KQ2A 4Z02A 4LDXA 1RL2A 2KQWA 2XIDA 2ZPEB 5A0GA 2DO3A 4ELZC 4F7UA 3TEEA 3J80E 5FROA 2QTXA 2CGHA 1S72T 3OYKA 3GLXA 4L6V5 3JB9G 4FIBA 1VQ9T 2DXCA 4KULA 2M16A 5LJ3d 3JCMP 1K73C 1N9SA 2GFUA 4C92D 1G3WA 2ZPBB 5CK9A 1UGSB 3NFCA 3JCMQ 2V8JA 3OYJA 3CCQT 5I2MA 4GY5A 1YJWT 3J7AF 3KXTA 1VQ7A 3FJPA 3WXMB 4A4FA 1V29B 4M78A 4C8QD 1QVFA 5FRMA 4C92B 2KY9A 1WJRA 1KHIA 4RMOA 2QEXT 3NTHA 5GAOp 3QUIA 1JBMA 1N6AA 1WQ7A 3A8HB 3OS0A 2L89A 1KQSS 3KUFA 5CIUA 5LJ3f 3SB2A 1PSFA 1OI1A 4N4IA 1NPPA 4M75G 2GCXA 3C94A 5I21A 1HXDA 5CKDA 1YI2T 2HNIA 2RM4A 2XICA 1JJ2S 4PL6A 4R55A 3OS2A 4M7AE 1BI2A 5LJ3e 3JCMX 3OY9A 1VQ6T 4HCZA 4BE2A 4E7LA 1YIJT 2JTMA 3JCMg 3V7SA 2K5LA 1W2BA 1Y96A 3QXEB 5LJ5d 2YRVA 3OYFA 2EQUA 2CKKA 5GANj 2PUOB 1QVGA 4OB1B 5GAMd 1OZ2A 4MZTA 3TU4K 2P0QA 3CPFA 2DKGA 5L8RE 4ZN3A 2LNVA 5I2SA 4IUVA 3MEVA 5KE2A 5J39A 1G5VA 2XU8A 2X4WA 1BKBA 2DPPB 4UC4A 4EMKA 1RI0A 2MWOA 3FC3A 4ZTFA 4O6JA 4E7IA 4M78D 3QBYA 1G3SA 1PSEA 3HRSA 5GANh 4M77D 3VJPA 4Q5WA 1VQNA 2ZPGB 3OYLA 4ZTJA 5CQXA 4EPCA 1VQMA 5CAIA 2YLCA 5LJ5f 3JB9I 3CCEA 1YHQT 4M78B 3CC7A 3OBYA 5CR2A 4MDXA 3S3OA 5GAMf 2XDBA 2E6NA 1U8RA 2HAXA 1UEBA 2LQ8A 1LJOA 3CBOA 4C8QG 3UDCA 5GMKe 4BI3A 2R58A 3CEYA 3QSUA 5LJ5e 1EIFA 5GAN8 1AHJB 2OTJT 2G3RA 3G4ST 3VYGA 5GAMe 4L5GA 1X01A 4OP0A 4L59A 3HSBA 4PJOD 2DIGA 1B34A 4IUUA 5CKFA 4LD9K 2F69A 3CCQA 1BI0A 1FXXA 3M53A 2EWNA 2DTIA 1DJ7B 5GAOl 2K3XA 1VQPT 3S3MA 2Y4YA 3OYMA 5GMKm 3FLGA 5LJ3j 1X6OA 2VXFA 2LC4A 5EG2A 5GAOr 1Y96B 4XU0A 3OW2A 2DJZA 2GQVA 2LQKA 4N0AA 4F7UG 2RD1A 3M5AA 4OGEA 4DOWA 1MHNA 1VQ7T 4EMGA 1I8FA 1WQWA 4TVRA 3UWNA 2HQEA 4PLLA 3ME9A 4LD6A 2E70A 4M7AC 5LJ3h 3DLLA 3V8JA 5D6WA 4PKCC 3BDUA 3X26B 3OYIA 3LGFA 4M78G 5LL6S 4J6XA 2RI5A 4M77G 4M77C 3M59A 4ZGDB 5GANg 2VGNA 4JRPA 2L8DA 1YITT 4QQ6A 3P8HA 3V7CA 2LRQA 2XKOC 4C0ZA 4C5GA 4JJNK 3MEWA 1OZ3A 4FT4A 2L3RA 5HK0A 3G71T 3O8VA 3GPLA 1U1SA 1QVPA 3N5BB 4M7DA 1YBYA 4FM4B 1I4K1 2C06A 2RH2A 2LX9A 2MMPA 2AHJB 3AHUA 3BFMA 1Q82U 3PT9A 3JB9H 5LJ5j 3I55T 1Q86U 3UPUA 3JCMV 4XAXB 4PJOG 5GAMj 4PJOC 3Q1JA 3LWIA 4OF1A 1IZ6A 3BDLA 3L42A 2R5MA 3JRZA 1YHQA 1KQ1A 4JRIA 4KUIA 2RK2A 2D0QB 1SSFA 4DA4A 1VQNT 2V8IA 5FU7B 5GAOn 4RG2A 5LJ5h 2EJ9A 3QJYA 3HP9A 3L2UA 2A3LA 4JS5A 2QDYB 5DLQE 4HT8A 5FU6C 5GAMh 1VQMT 1QP2A 2DIQA 2DZCA 1YCYA 4XQ3A 5KCOA 3CCET 3CC7T 3CCUA 4N4HA 1WJSA 3PIPA 5C6SA 2KAFA 2OAUA 3PFSA 2HD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJQ A;  2IG0 A;  3OB9 A;  3H6Z A;  3EAE A;  2XK0 A;  2LTO A;  4A4G A;  4BE1 A;  4E7H A;  4QVZ A;  3OY9 A;  2O4X B;  4HCZ A;  4BE2 A;  4E7L A;  2BKD N;  2RI3 A;  4II1 A;  3M9Q A;  3PNW C;  4IUR A;  2YRV A;  4FU6 A;  2EQU A;  2CKK A;  2LDM A;  2RHY A;  4C5E A;  3OYF A;  2R57 A;  1N27 A;  2LVM A;  3LGL A;  4B9X A;  1OZ2 A;  2WAC A;  2P0K A;  2RJC A;  3MEA A;  4IUQ A;  3LLR A;  5KE2 A;  1G5V A;  2M0O A;  4IUV A;  3MEV A;  2X4X A;  5J39 A;  3DLM A;  2X4W A;  4UC4 A;  5M9O A;  4ZTF A;  1RI0 A;  2MWO A;  4N4G A;  3QKJ A;  3OA6 A;  3FC3 A;  2PQW A;  3QJ6 A;  4E7I A;  3LX7 A;  4X34 A;  3OYB A;  5KCH A;  3QBY A;  4QQD A;  5FRN A;  4Q5W A;  3OYN A;  5KH6 A;  5D6Y A;  3OYL A;  4ZTJ A;  3C4S A;  3ZEH A;  3DB4 A;  4FL6 A;  2MWP A;  3LYI A;  1H3Z A;  2HQX A;  4BDZ A;  2NLU A;  3S3O A;  2QQS A;  2E6N A;  2GF7 A;  2RJD A;  2RO0 A;  2E5Q A;  3DB3 A;  3MP6 A;  2R58 A;  3CEY A;  3OYC A;  2DAQ A;  2RHX A;  3LH0 A;  4BE0 A;  3S3N A;  2G3R A;  2RJE A;  3MP8 A;  4L59 A;  4A4E A;  2B8A A;  2DIG A;  4IUU A;  4NS5 A;  4A4H A;  3MEU A;  4PLI A;  2X4Y A;  3OMC A;  2RI2 A;  4B9W A;  4C5I A;  5D6X A;  5IN1 A;  3QII A;  3SD4 A;  4C5H A;  3OYD A;  2FHD A;  2K3X A;  3FDR A;  3PMI A;  3OYE A;  3S3M A;  3OYM A;  2BIV A;  2M1H A;  5KE3 A;  3FLG A;  3OS1 A;  4E7J A;  2EKO A;  4CRI A;  2BUD A;  1KHC A;  2VYT A;  1WGS A;  2GFA A;  4BD3 A;  2EQM A;  3MP1 A;  1MHN A;  2XDP A;  3ASK A;  3OYG A;  2X35 A;  4QW2 A;  3MET A;  3UWN A;  2HQE A;  4PLL A;  2LCC A;  3ME9 A;  2EFI A;  4LD6 A;  3FEO A;  2EQJ A;  2K3Y A;  5D6W A;  2RJF A;  2R5A A;  2O4X A;  2JZ2 A;  3OYI A;  3OYA A;  3LGF A;  3S6W A;  4E7K A;  5IAY A;  2RI5 A;  5J26 A;  4IKF A;  3NTI A;  2JTF A;  2L8D A;  4Z02 A;  4QQ6 A;  3P8H A;  4EDU A;  2LRQ A;  4C5G A;  4QQG A;  3MEW A;  1OZ3 A;  2EQK A;  2RHZ A;  1OYX A;  2L3R A;  5FRO A;  3OQ5 A;  1XNI A;  3O8V A;  3UT1 A;  3OYK A;  3H8Z A;  2M16 A;  3NTK A;  3GOX A;  3L2V A;  2GFU A;  3MO8 A;  3OMG A;  3OYJ A;  3F70 A;  2D9T A;  2QQR A;  3Q1J A;  3E9F A;  4GY5 A;  5C0M A;  3BDL A;  3L42 A;  3L2W A;  2R5M A;  3P8D A;  4A4F A;  4BDY A;  3L2Q A;  3PMT A;  5FRM A;  1SSF A;  3L2R A;  4RG2 A;  1WJR A;  4OVA A;  3NTH A;  2RHU A;  3L2U A;  4BAC A;  3OYH A;  2DIQ A;  3OS0 A;  2L89 A;  2RHI A;  4IUP A;  3KUF A;  5CIU A;  5KCO A;  1OI1 A;  4N4H A;  4N4I A;  1WJS A;  2F5K A;  5C6S A;  4IUT A;  3E9G A;  3PFS A;  4PL6 A;  3OS2 A; 
#chains in the Genus database with same CATH topology
 1PHT A;  1WHK A;  2XK0 A;  4A4G A;  3ZFJ A;  3H41 A;  3P8B B;  2BKD N;  2KBT A;  1JXO A;  1KC8 R;  1OPK A;  1NEB A;  2A0F B;  4J9B A;  2LT1 A;  1ZBJ A;  1VOM A;  4ESR A;  4M7D B;  2CP7 A;  4AG2 C;  2PQW A;  2COW A;  1BU1 A;  2OJ2 A;  3G1J A;  1U1T A;  3EG9 B;  2LP5 A;  2VKN A;  3PGG A;  1FWZ A;  4XTY A;  1YIT A;  2WSE E;  2NLU A;  3R6N A;  1VYT A;  1FMK A;  2CP0 A;  4ME7 A;  3MP6 A;  3PTA A;  2Y4X A;  1FYN A;  3LH0 A;  2ZCF B;  3PIO A;  4AFZ C;  3I55 A;  5KYY B;  1OPL A;  2LJ0 A;  1VQ5 T;  2QTV A;  1T0J A;  4B9W A;  2DLP A;  5GAM g;  2MAM A;  4M77 F;  2HMA A;  2BIV A;  2NUT A;  4JRQ A;  2K3B A;  2XG8 D;  4JUV A;  4C92 G;  1BI1 A;  4J9F A;  3D7S B;  5HKC A;  2ROL A;  1JB0 E;  1OUL A;  1PRM C;  2DTH A;  2V26 A;  2PNI A;  3RDV A;  1EZZ B;  4JRK A;  4A54 A;  1D3B B;  1NJI C;  3FIF A;  3CCS A;  3JCM W;  2KRM A;  4QT7 A;  3OBW A;  3G71 Q;  4HT9 A;  1C6V X;  1KQS A;  3TCJ A;  2W10 A;  4RTU A;  2EQK A;  3DKM A;  3OQ5 A;  1XNI A;  3TVT A;  1JQQ A;  2DRK A;  3HFN A;  1VQN Q;  1YWO A;  3L2W A;  1VQM Q;  1N8R C;  1K9M C;  3CC7 Q;  1Q7Y C;  4CC3 A;  4F14 A;  4M78 C;  2A37 A;  4XTV A;  3OYH A;  3EHR A;  1TTH B;  2QGF B;  1UGQ B;  2H3J A;  4IUT A;  1VYV A;  4M75 F;  2ZPF B;  2CP6 A;  3LH5 A;  9ATC B;  1PCX A;  2MF2 A;  2ZPH B;  1T3S A;  1HJD A;  3CC4 A;  4M4Z A;  2LDM A;  2D1X A;  2R57 A;  1BIA A;  2LQW A;  2P0K A;  5GMK i;  2KGT A;  4OB0 B;  3DLM A;  5AT1 B;  1RI9 A;  1V76 A;  3OSS C;  3OYN A;  3C4S A;  1G2B A;  1Y71 A;  4BDZ A;  2HL5 C;  4HVU A;  2F5T X;  4C92 F;  1VQ5 Q;  1PD0 A;  2ATC B;  2E41 A;  1RAA B;  3CCR T;  3CCV T;  1W2B S;  4C8Q F;  3SFM A;  2KK4 A;  5KYX B;  3OSV A;  1GBQ A;  4A4H A;  3UA6 A;  2EGA A;  1VQL T;  1TUG B;  3A8M B;  1M5Q 1;  2FHD A;  3PMI A;  1M2V A;  4FYW B;  3I56 T;  2OTL T;  1D3B A;  2M1H A;  4BUG A;  1GL5 A;  1RLP C;  2O9S A;  4LDU A;  4RKU E;  5J3B A;  1UGV A;  2GFA A;  3JSC A;  1YJN A;  1NZ9 A;  2W0Z A;  3RMS A;  2BZY A;  1M9S A;  1H64 1;  3M56 A;  4YTL A;  2CUD A;  3H0H A;  2E64 A;  3NMZ C;  4M77 A;  3CCM T;  5CKE A;  2K3Y A;  4M78 E;  1QW1 A;  2R5A A;  4E47 A;  5FW9 A;  4E7K A;  1UFF A;  2E5K A;  4C8Q B;  4IKF A;  3U23 A;  3NTI A;  2ENM A;  3EFS A;  3EGU A;  4QQG A;  1I81 A;  1OYX A;  3H8Z A;  3NTK A;  3OW2 S;  1KK7 A;  1UUE A;  3CCL T;  5I11 A;  5FLX E;  1N5Z A;  2A7Y A;  1IB8 A;  3RES A;  3CD6 A;  1W70 A;  1W2B P;  2VAS A;  3QPH A;  1RUW A;  2EJF A;  2GQI A;  1KJW A;  1AZG B;  2KI7 A;  2F2W A;  3OB9 A;  3H6Z A;  5D7U A;  3SDZ A;  5GJW B;  2QI2 A;  1GFC A;  4MML A;  4IUR A;  4KGZ B;  1XTD A;  3G6E T;  2YWW A;  3QWY A;  3VS7 A;  2WAC A;  1K73 R;  3LLR A;  2M0O A;  1IGQ A;  2E3I A;  4OB2 B;  4M75 A;  3OA6 A;  1TH7 A;  3OYB A;  5KYX A;  2E4H A;  5KH6 A;  3A8L B;  1VIE A;  1KQS P;  3CCR Q;  2L5Q A;  1NPR A;  4J83 A;  5FU6 B;  2DX1 A;  1UHC A;  1ZX6 A;  3UAT A;  1VQL Q;  2RHX A;  1NBE B;  3S3N A;  2AZV A;  1M3A A;  3I56 Q;  5GAN d;  2OTL Q;  4RTV A;  2PTK A;  3M57 A;  4PNO A;  2DYB A;  1RLQ C;  1D1A A;  1UGP B;  2VXE A;  1IRX A;  3JCM c;  2CSI A;  3OYD A;  2K57 A;  4C92 A;  1M1K U;  4P5N A;  2HSP A;  2HEQ A;  3RNJ A;  4C8Q A;  3HHT B;  3CCM Q;  1Q82 C;  2EYW A;  2DBK A;  2JVV A;  2I0N A;  1UG1 A;  1UDL A;  4BY6 B;  4JPB W;  1FX7 A;  3G4S A;  4HKE A;  3E1S A;  4ELZ C;  3CCL Q;  5KYN A;  3HTR A;  3JB9 G;  1D1B A;  1VQ9 T;  3THK A;  2DXC A;  1N9S A;  5CK9 A;  2ZPB B;  1F1B B;  3EH1 A;  3WXM B;  2COZ A;  1WJR A;  2QEX T;  5GAO p;  3QUI A;  1JBM A;  3KUF A;  5CIU A;  5LJ3 f;  3SB2 A;  1PSF A;  5CKD A;  2RM4 A;  2XIC A;  4PL6 A;  1BI2 A;  1VQ6 T;  4BE2 A;  2JTM A;  3JCM g;  5LJ5 d;  2CKK A;  1NLP C;  4MZT A;  3TU4 K;  1A0N B;  4ZN3 A;  1Q82 R;  5J39 A;  2X4W A;  2MCN A;  4ZTF A;  1RI0 A;  4LUD A;  4E7I A;  1V1C A;  2JM8 A;  1X6B A;  5GAN h;  1G3S A;  4M77 D;  4Q5W A;  3OYL A;  4ZTJ A;  3M0U A;  2DER A;  4M78 B;  3OBY A;  4AT1 B;  2E6N A;  3UDC A;  1U5S A;  2KT8 A;  1AHJ B;  2QAS A;  3VRY A;  5GAM e;  1WIE A;  2F69 A;  1FXX A;  2EWN A;  5GAO l;  4DEY A;  3S3M A;  5LJ3 j;  3M0T A;  1ABQ A;  1FMV A;  2VXF A;  5EG2 A;  1Y96 B;  1GFD A;  1MMG A;  2GQV A;  4F7U G;  2NUZ A;  2RD1 A;  4OGE A;  4DOW A;  1VQ7 T;  4PLL A;  4LD6 A;  1JEG A;  3V8J A;  5D6W A;  2K79 A;  1X43 A;  4M77 C;  1VQ9 Q;  4JRP A;  1YIT T;  4QQ6 A;  3V7C A;  3H0F A;  1YBY A;  2FPD A;  1PC0 A;  4DBF A;  1YNZ A;  3I55 T;  3JCM V;  4XAX B;  1Q81 R;  4PJO G;  2QEX Q;  4OF1 A;  3BDL A;  2R5M A;  3JRZ A;  1YHQ A;  1KQ1 A;  4F04 B;  2D0Q B;  4DA4 A;  5LJ5 h;  3HP9 A;  3L2U A;  2A3L A;  2QDY B;  1TUC A;  3CCE T;  1VQ6 Q;  3CCU A;  1T0H A;  2KAF A;  3PFS A;  2K6D A;  2HD0 A;  3O5Z A;  3CBP A;  1VQP A;  2LTO A;  4QVZ A;  2YUP A;  3GF5 A;  2F2X A;  4II1 A;  3CCS T;  4X9D A;  5I22 A;  2HCK A;  4FU6 A;  2PVG B;  3TQ7 P;  4JS4 A;  2A08 A;  4IUQ A;  2CP2 A;  1KG1 A;  3VS5 A;  1VA7 A;  3QJ6 A;  1VQK A;  2EYQ A;  1UHF A;  2JJ9 A;  2QQA A;  4M75 C;  1D0X A;  1PKS A;  2EVR A;  1FMW A;  4FL6 A;  3LYI A;  1UGR B;  1W4S A;  2JS0 A;  3EFO B;  2RJD A;  1M90 R;  4Y92 A;  3INZ A;  4BE0 A;  2H8H A;  4M77 E;  2PUK B;  1K76 A;  3BE3 A;  3M4Y A;  2QG9 B;  2KSS A;  3SD4 A;  2L3P A;  1ZBX A;  1WXT A;  1VQ7 Q;  4CRI A;  2FPF A;  3C12 A;  1WGS A;  4C92 C;  1BBZ A;  1X69 A;  4FSS A;  5GMK l;  4C8Q C;  2CS7 A;  3QO3 A;  2Y90 A;  2AT1 B;  1OEB A;  4PJO F;  4FW1 A;  1YIT Q;  2KVQ G;  2O4X A;  2HKN A;  3M0R A;  1VQO A;  2VUB A;  3IQL A;  4EDU A;  3I55 Q;  1JJ2 A;  1AT1 B;  1KC8 C;  1I1J A;  2I2L A;  4XK8 E;  3UT1 A;  3EHQ A;  4Z89 A;  3EGX A;  4HCC A;  1YN8 A;  2LJ3 A;  1ZHI A;  3F70 A;  1B07 A;  1QKW A;  2P4T A;  1AEY A;  4BDY A;  3CCE Q;  3M55 A;  2D0N A;  2FZK B;  1TG0 A;  3RUX A;  4OVA A;  4VUB A;  1LCK A;  4M75 E;  2RHI A;  4FSX A;  4LDW A;  3CCS Q;  4DEX A;  3QHS A;  3LWH A;  4JZ4 A;  4CI0 C;  1BI3 A;  1YWP A;  2FB7 A;  1TWB A;  3I9Q A;  1AWO A;  4CC4 B;  4C0F A;  4A53 A;  2CZ7 B;  3MEA A;  4LNP A;  1QVF S;  4J7I A;  5GAN 7;  5GMK h;  2M02 A;  4J9E A;  2AKL A;  2K4Y A;  5CQY A;  3LX7 A;  4JLI A;  1YCS B;  2CSQ A;  2MOX A;  4C92 E;  4AMC A;  1H3Z A;  1Y0M A;  3HRU A;  3J81 E;  2JS2 A;  3HPW A;  5IT9 E;  1PG5 B;  1AZE A;  3RKX A;  1VQ4 A;  2JOY A;  2OTJ T;  4MZP A;  1IRE B;  1WHH A;  4OMF B;  1QVG S;  4NS5 A;  4OGC A;  3UF4 A;  2RI2 A;  4KRT A;  1AVZ C;  3FRN A;  5FWB A;  1SRM A;  3OYY A;  2EKO A;  2CT3 A;  2YRD A;  2EAY A;  1E7O A;  5FU7 C;  4BY6 C;  2DL7 A;  4QW2 A;  1ARK A;  2KXC A;  1JO8 A;  5HK3 A;  4QVC A;  4BI4 A;  3CC2 T;  2E12 A;  2X51 A;  2D8J A;  4AFS C;  1QVF P;  2C0I A;  4F17 A;  3KFV A;  3TSW A;  2HDA A;  2FO0 A;  2K2M A;  4PJO A;  4HVV A;  1VYU A;  4E6R A;  3SHW A;  2J7I A;  2DD4 A;  3OMG A;  3E9F A;  4XTW A;  4JJB A;  4RTZ A;  2DXU A;  1M2V B;  1NJI U;  1O75 A;  1Q86 R;  4KUD K;  5A0D A;  2D6F A;  2DK3 A;  2FEI A;  4EIK A;  4QVD A;  5GAO q;  3GP8 A;  1XJW B;  4BAC A;  3M58 A;  1QVG P;  5IXF A;  2BE9 B;  4C0G A;  4NL3 A;  4PJL A;  4ORZ A;  1QKX A;  2WSC E;  1YJ9 A;  3VKI A;  2PU9 B;  5M9O A;  3CXC A;  3M4G A;  3JCM e;  4BE1 A;  4M77 B;  3CCJ A;  4E7S A;  1VQ8 A;  1H3H A;  5DM7 R;  3X20 B;  4B9X A;  1N8R U;  1SHF A;  4K11 A;  1K9M U;  3BW1 A;  1YJW A;  1Q7Y U;  2X4J A;  1YI2 Q;  3CBM A;  2X9H A;  3EG2 A;  2PVD B;  2DJQ A;  3VUZ A;  3DB4 A;  1SRL A;  2KXD A;  2OTJ Q;  1K0S A;  2YUQ A;  2FL7 A;  1JJ2 P;  3JB9 D;  1HD3 A;  2HKQ B;  4M7A G;  4EMK B;  4Y91 A;  3A8O B;  2DAQ A;  5CKB A;  8AT1 B;  2RJE A;  3MP8 A;  1BIB A;  4PLI A;  4ZNX A;  3G7Z A;  4C0D C;  1WYX A;  2PZ1 A;  5KE3 A;  3RER A;  5IH2 A;  3JAM E;  2VWF A;  5ECA A;  3CPW A;  4XU2 A;  2KNB B;  5GAN f;  3CC2 Q;  1Y07 A;  1NM7 A;  4M75 B;  1VIF A;  3TRE A;  2AZS A;  4KBM B;  1G3Y A;  1AD5 A;  2ZPE B;  2L3S A;  2QTX A;  2SRC A;  2CGH A;  1QCN A;  1S72 T;  2DL5 A;  3OYK A;  2EBP A;  1K73 C;  1OU9 A;  2GFU A;  1G3W A;  3JCM Q;  3J7A F;  2O2O A;  5I2M A;  2CP3 A;  3KXT A;  1W1F A;  1Z9Z A;  3M0S A;  4C92 B;  3PVL A;  4OMO A;  1QQJ A;  2KY9 A;  2O9V A;  3NTH A;  3I35 A;  3A98 A;  1N6A A;  4X1V A;  3A8H B;  2L89 A;  1KQS S;  1OI1 A;  2GCX A;  3REA B;  1YIJ T;  1OX9 A;  5L23 A;  2B86 A;  3OYF A;  2EQU A;  5GAN j;  1U06 A;  4B6M A;  4OB1 B;  5GAM d;  1OZ2 A;  2HSE B;  2BZ8 A;  5L8R E;  2XU8 A;  4EMK A;  3FC3 A;  2ED0 A;  3MJX A;  1VQN A;  1SSH A;  3VJP A;  2V1R A;  2O31 A;  2ZPG B;  2H3E B;  1VQM A;  2QDL A;  5LJ5 f;  1YHQ T;  1ZSG A;  3CC7 A;  5CR2 A;  2DIL A;  1UEB A;  2F2V A;  2LQ8 A;  3CBO A;  1WI7 A;  3QSU A;  3VYG A;  4L5G A;  4OP0 A;  4PJO D;  1SPK A;  3CCQ A;  1OX8 A;  2DTI A;  2BE7 D;  1VQP T;  2HL3 A;  1WFW A;  1X6O A;  1PKT A;  4XU0 A;  1ZSZ A;  3CCV Q;  1Q95 G;  3M5A A;  1MHN A;  1I8F A;  4F16 A;  2VVK A;  2KRS A;  2E70 A;  2BTT A;  2G6F X;  5IHI A;  4PKC C;  1UEC A;  7AT1 B;  1YFN A;  4M78 G;  2KRN A;  1X2Q A;  4J6X A;  2P4R A;  1S72 Q;  2AKK A;  2L8D A;  1VQ5 A;  3P8H A;  4PFP A;  2KYM A;  1RAH B;  4C0Z A;  3NHN A;  4JJN K;  1OZ3 A;  3O8V A;  4FM4 B;  1I4K 1;  2MMP A;  2AHJ B;  2EQI A;  3BFM A;  1MMN A;  3E2U A;  1Q82 U;  1RAD B;  5LJ5 j;  2GTJ A;  2YT6 A;  1KFZ A;  4PJO C;  3VS6 A;  2NUP A;  1EFN A;  5FU7 B;  5GAO n;  1GBR A;  4JS5 A;  2QK0 A;  5DLQ E;  5GAM h;  3EG1 A;  4OMQ A;  2DE0 X;  4XQ3 A;  5KCO A;  1YIJ Q;  2OAU A;  1QCF A;  4E7H A;  3EAE A;  2CUB A;  3PNW C;  5LJ3 g;  5GAN 4;  3CPW P;  2RHY A;  3FJ5 A;  4J7F A;  4MMK A;  2J06 A;  2V8K A;  3VV0 A;  2RMO A;  2X4X A;  2EPD A;  3EG3 A;  4N4G A;  1CSK A;  4X34 A;  2GTO A;  1I07 A;  4F7U E;  2VV5 A;  3RR6 A;  5D6Y A;  2JW4 A;  4A4K A;  1NYG A;  2EGC A;  4J6W A;  2ZAE A;  3G6E Q;  2E5Q A;  1QP3 A;  3OYC A;  1KD1 U;  2EKH A;  1ZA1 B;  1MND A;  1ACM B;  1IGU A;  2XI9 A;  3MEU A;  4ZGJ B;  1JU5 C;  2FZC B;  2X4Y A;  5D6X A;  1PNJ A;  3E19 A;  3SWN A;  1IHW A;  2MI6 A;  4PJM A;  2C0O A;  1Q81 C;  2O01 E;  2BUD A;  1KHC A;  3QYH B;  3V8L A;  4BD3 A;  4PJO E;  3H9N A;  1M1K R;  1G3T A;  2QXF A;  3MET A;  1K8A U;  4J6Y A;  2BZX A;  4LE9 A;  2COY A;  3X25 B;  4AFQ C;  2E6Z A;  2RQV A;  4R56 A;  4LXC A;  2RK1 A;  3BY7 A;  4FYV B;  2VB6 A;  2RHZ A;  3I5S A;  3C0C A;  3EGD A;  2JTE A;  2OI3 A;  2JNG A;  3I56 A;  4C0D B;  3V7R A;  4Y28 E;  3JB9 F;  2CRE A;  2QQR A;  3FB9 A;  1M1G A;  1T3L A;  3JB9 J;  1IHV A;  3PMT A;  4J9D A;  3CCM A;  4XTX A;  1M90 C;  1AOJ A;  3RKY A;  4RTW A;  4HCB A;  1BB9 A;  2P84 A;  1BCO A;  4E7Z A;  5GMK j;  2O4X B;  4RCC A;  3M9Q A;  2EIF A;  2QQB A;  3CCL A;  2MPX C;  2RJC A;  1CKA A;  2DTO A;  3QKJ A;  3EGX B;  1TSF A;  1X27 A;  4QQD A;  2CP5 A;  3VU3 C;  4EMK C;  1GRI A;  1WNL A;  1LNX A;  2LQN A;  3EH2 A;  2ABL A;  3C95 A;  3DB3 A;  1RAF B;  4DBH A;  1H8K A;  2DET A;  2NYS A;  1QLY A;  4XU1 A;  4A63 B;  4JZ3 A;  4A4E A;  4WF2 A;  5KYW A;  3CCJ T;  3A8G B;  2LT4 A;  2QAZ A;  1VQ8 T;  2E65 A;  4ZGE B;  1M8V A;  1CKB A;  2EQM A;  2JM9 A;  2DEU A;  4F7U F;  1ZSZ C;  2HZY A;  4JLG A;  2LCS A;  3X28 B;  1OOT A;  2WSF E;  5CKH A;  2ROT A;  3TSZ A;  3CME A;  5DY9 A;  2F1L A;  3CQT A;  1K9A A;  5IHK A;  1NLO C;  2JUF A;  1HSQ A;  4J8O A;  3QYG B;  4NL2 A;  1LVK A;  4RG8 A;  2K5F A;  3JCM d;  3CC4 T;  2CZ0 B;  2CZ1 B;  2DZ9 A;  3GOX A;  4M7D G;  4OB3 B;  2KYB A;  3P8D A;  1UB4 A;  4PFO A;  2FPE A;  4M7A D;  2KRO A;  1QCO A;  1ZUY A;  4F7U B;  3ULR B;  3L2R A;  1E6G A;  2RHU A;  3R6O A;  4JJC A;  1I0C A;  2YUN A;  1KC8 U;  1M30 A;  1Z9Q A;  3ZBD A;  4WCI A;  2RQU A;  2MYS A;  2FYK A;  2CH4 A;  1G8X A;  4Z88 A;  1VQ9 A;  4LDV A;  2ESW A;  2FRY A;  2LVM A;  2QA4 A;  2J6F A;  2X3W D;  1MV3 A;  5GAN 6;  4D6W A;  4PJO B;  3AT1 B;  4HA8 A;  4FT2 A;  2DXT A;  2RF0 A;  1YJN T;  2QEX A;  1QWE A;  1NYF A;  3HL8 A;  2DD5 A;  2NWM A;  3RMQ A;  2QQS A;  1TS9 A;  5A0L A;  5KYU A;  4ATO A;  4V2S A;  4O5V A;  1VQ6 A;  1N9R A;  1X75 C;  3CCJ Q;  1JRI A;  4XU3 A;  2YDL A;  1VQ8 Q;  1M8M A;  1WXB A;  3T9N A;  3SWN C;  3VUB A;  3MP1 A;  2RNA A;  1Q86 C;  2IIM A;  2K2V A;  1D0Y A;  4JJD A;  1MNE A;  3REB B;  4M7D F;  3HRT A;  3CD6 T;  2EFI A;  3JCM h;  3CMA A;  1M3B A;  1MMA A;  2EQJ A;  1W6X A;  2RJF A;  1WHG A;  2HBW A;  5AYF A;  2DL8 A;  4MDW A;  3S6W A;  1MMD A;  1WDX A;  3CC4 Q;  4LDX A;  1RL2 A;  2KQW A;  2XID A;  4WTO B;  2DO3 A;  4F7U A;  5FRO A;  1X2K A;  3GLX A;  4L6V 5;  4FIB A;  1B7T A;  3EG0 A;  1SG5 A;  2DFU A;  2ECZ A;  1UGS B;  3NFC A;  2V8J A;  3CCQ T;  4GY5 A;  1VQ7 A;  1KIK A;  4A4F A;  1V29 B;  3ZL7 C;  1UTI A;  1WQ7 A;  1WXU A;  4N4I A;  1NPP A;  2RPN A;  4M75 G;  1YI2 T;  2HNI A;  2MIO A;  1JJ2 S;  4HVW A;  4R55 A;  3OS2 A;  4M7A E;  5LJ3 e;  1WHM A;  3JCM X;  3OY9 A;  4HCZ A;  4E7L A;  3V7S A;  2K5L A;  1W2B A;  2KEA A;  2DKG A;  1YJN Q;  2LNV A;  4IUV A;  3MEV A;  1WZO A;  4UC4 A;  2K7A A;  4FW2 A;  2GNC A;  4M78 D;  3QBY A;  1PSE A;  4AG1 C;  2L3Q A;  5CQX A;  4EPC A;  2YLC A;  3JB9 I;  3CCE A;  3VS1 A;  4PK4 A;  4MDX A;  3S3O A;  5GAM f;  1U8R A;  4C8Q G;  5GMK e;  5GAN 8;  3G4S T;  1PWT A;  4OML A;  1X01 A;  4OMN A;  4L59 A;  3HSB A;  4IUU A;  5CKF A;  4LD9 K;  4RUG A;  2K9G A;  1DJ7 B;  1H92 A;  2E3H A;  3OYM A;  1GCQ A;  1M27 C;  2DMO A;  3CD6 Q;  3OW2 A;  1S1N A;  4N0A A;  1IO6 A;  1WQW A;  4TVR A;  3NPF A;  2J6K A;  2HQE A;  2DF6 A;  3ME9 A;  3DLL A;  1D09 B;  3BDU A;  3X26 B;  3VS3 A;  4ZGD B;  5GAN g;  1Y57 A;  1R0C B;  2LRQ A;  4C5G A;  3MEW A;  4GLM A;  1LPL A;  4PJN A;  4M7D A;  3CCQ Q;  1U1S A;  3N5B B;  1AWJ A;  2C06 A;  1AWX A;  3PT9 A;  2EGE A;  1ZUU A;  3UPU A;  1SF9 A;  1ZUK A;  3EG9 A;  5GAM j;  3Q1J A;  3L42 A;  1BK2 A;  2YSQ A;  3GBQ A;  1B3Q A;  4KUI A;  2RK2 A;  1TOV A;  1RAE B;  1ZSZ B;  1QP2 A;  2DZC A;  1YCY A;  2LMJ A;  5KYY A;  3PIP A;  1NJI R;  5C6S A;  1M3C A;  1WJQ A;  1K73 U;  1PD1 A;  1RAC B;  3JCM J;  4C5E A;  3LGL A;  1BCM A;  4HCK A;  1UJY A;  4ANJ A;  5A2Q E;  8ATC B;  5GAN 3;  2IVW A;  1N8R R;  2VGM A;  5FRN A;  1K9M R;  1Q7Y R;  1K0X A;  2NUP B;  2MWP A;  2RN8 A;  3G4S Q;  3CXC S;  2GF7 A;  1MUZ A;  3G71 A;  4BI8 B;  1WPY A;  1VUB A;  4KH0 B;  2MK5 A;  4M7A F;  1M1F A;  5IHN A;  4FYY B;  1WHL A;  5LJ5 g;  3OMC A;  2CYZ B;  5IN1 A;  4C5H A;  3GNF B;  2KR3 A;  4E7J A;  4LUE A;  4DQ2 A;  4PJJ A;  2J6O A;  3EFR A;  2YUO A;  3L1A A;  2ZGW A;  2X35 A;  2XHC A;  3L2Z A;  4FCY A;  1XQH A;  2LJ1 A;  2DBM A;  1YI2 A;  1RAI B;  3FEO A;  2QGG A;  4KT0 E;  3NGP A;  4XTU A;  2C0T A;  4RCB A;  2E1H A;  4Z8A A;  3CCU T;  2O88 A;  2OTJ A;  5J26 A;  2AK5 A;  4M7A B;  2JTF A;  2RQR A;  3VYH B;  1TXQ A;  2EJG A;  2DM1 A;  3CPW S;  2LX7 A;  2YRC A;  3MKD A;  5CCA A;  2EYY A;  2D9T A;  5C0M A;  4QKU A;  4GBQ A;  4DOV A;  2OX7 A;  3OS5 A;  4X9C A;  3SWN B;  3CXC P;  2XD0 A;  1R77 A;  2Z0W A;  2A28 A;  4JDS A;  1K4U S;  3A5Z B;  1VQK T;  4RTT A;  3RKW A;  4XTZ A;  1SHG A;  2KMT A;  2DEQ A;  2AIR B;  1GXI E;  3HFO A;  3CC2 A;  2F5K A;  3QZ5 B;  3E9G A;  2DNU A;  3QG1 A;  6AT1 B;  1GCP A;  2RI3 A;  3MCA B;  3CME T;  4GLK A;  4LN2 A;  5HY6 A;  3OW2 P;  3WVE B;  2XMF A;  1N27 A;  3M0Q A;  3EGD B;  3MHX A;  1LOJ A;  1U3O A;  1M1K C;  3ZEH A;  2YHT A;  2X3X D;  2HQX A;  1I5O B;  1NEG A;  2HBP A;  3X24 B;  1O9S A;  3RBB B;  2D8H A;  4M7D D;  2M0Y A;  1VQO T;  1HK9 A;  2GBQ A;  1QWF A;  5GAN 5;  2PVO B;  3OYE A;  3HKS A;  1YHQ Q;  2CH4 W;  2YLB A;  4J9I A;  3JCM b;  1X6G A;  3A1P A;  1GCQ C;  3VS0 A;  4M7A A;  2XDP A;  3ASK A;  3OYG A;  2QA4 T;  3CCU Q;  2QQ9 A;  4N0A C;  2J05 A;  4IIO A;  3VRZ A;  2XDD A;  1VQP Q;  4DBQ A;  3OYA A;  3I5R A;  5CVI A;  1ABO A;  2K5I A;  1WLP B;  4M78 F;  1J3T A;  1P92 A;  3GNG A;  2SEM A;  3RIR A;  4PFZ A;  1I5L A;  1M2O A;  1Q81 U;  3L2V A;  4M7D C;  2DL3 A;  1SEM A;  3MO8 A;  1VQK Q;  2KDS A;  1KD1 C;  5KYW B;  1Y7X A;  5GAN 2;  3L2Q A;  4EMH A;  4DBR A;  3PE0 A;  3CCR A;  3CCV A;  1QMC A;  3JCM f;  4IUP A;  2RB6 A;  4MZM A;  1C1A A;  3CME Q;  2CZ6 B;  1VQL A;  4C5I A;  2JXB A;  4RTY A;  3CMA T;  2IG0 A;  1VQ4 T;  2LCL A;  1ZQ1 A;  4ZN1 A;  2OTL A;  4KGX B;  1S72 A;  1K8A C;  3URG A;  2E10 A;  2HQH A;  1HYO A;  4J9G A;  3QDF A;  2M51 A;  4NOY A;  2M9U A;  5KCH A;  1BYM A;  1PRL C;  4BB7 A;  1M90 U;  1WHJ A;  2L0A A;  2EYZ A;  2FVU A;  1TU0 B;  1RAG B;  1TUD A;  1VQO Q;  1R0B G;  3V8K A;  3QZ9 B;  1IXD A;  2RO0 A;  1OU8 A;  2CDT A;  2YXY A;  5GAO m;  1NE8 A;  2IPO B;  3ER0 A;  2ZZD A;  4J5Y A;  2DA9 A;  1XOV A;  2OAW A;  1YIJ A;  1G83 A;  1JXM A;  2B8A A;  2VC8 A;  1MGQ A;  4ELY C;  5CO7 A;  3QDR B;  3QII A;  2V1Q A;  1KD1 R;  3LW5 E;  3FDR A;  3OS1 A;  2QA4 Q;  2DVE A;  4LDY A;  4M7D E;  2VYT A;  2A36 A;  3WVD B;  4OMM A;  4M75 D;  5DLO A;  1B34 B;  3VS4 A;  2DXB A;  1UJ0 A;  3M54 A;  2FRW A;  3SEM A;  2ZPI B;  2LCC A;  2RA2 A;  3UA7 A;  1R8O B;  3JV3 A;  1M4Z A;  5GAN e;  2JZ2 A;  2JN0 A;  2P0P A;  5IAY A;  5FWC A;  3KBG A;  1WA7 A;  5IXB A;  1YJ9 T;  3G6E A;  2GGR A;  1D1C A;  3GIB A;  1K8A R;  1KQ2 A;  4Z02 A;  5A0G A;  4CC2 A;  5KYU B;  2RQW A;  2ED1 A;  3TEE A;  3J80 E;  4J9H A;  1D0Z A;  1K1Z A;  2DVJ A;  4KUL A;  5LJ3 d;  2M16 A;  1C0M A;  4D8K A;  3JCM P;  3OYJ A;  4C92 D;  1RAB B;  1YJW T;  1OV3 A;  3FJP A;  4C8Q D;  4M78 A;  1QVF A;  5FRM A;  4R0K A;  1SKU B;  1KHI A;  4RMO A;  1MV0 B;  2JMA A;  3CMA Q;  1VQ4 Q;  3OS0 A;  4OMP A;  1WX6 A;  3C94 A;  5I21 A;  1HXD A;  4RTX A;  1NG2 A;  1ZLM A;  2LZ6 B;  4KGV B;  1Y96 A;  3QXE B;  2YRV A;  2PUO B;  4IIM A;  1QVG A;  4FYX B;  2P0Q A;  3CPF A;  5KE2 A;  1G5V A;  5I2S A;  1BKB A;  2DPP B;  2MWO A;  4O6J A;  3HRS A;  1E6H A;  1UE9 A;  2CT4 A;  4HXJ A;  2RQT A;  5CAI A;  2XDB A;  2HAX A;  1LJO A;  3PVQ A;  4BI3 A;  2R58 A;  3CEY A;  5LJ5 e;  1EIF A;  2LNH B;  2G3R A;  3VS2 A;  1AWW A;  2DIG A;  1B34 A;  2EYX A;  2QYZ A;  1BI0 A;  2JT4 A;  4AFU C;  3M53 A;  4KH1 B;  2K3X A;  1KSW A;  2Y4Y A;  5GMK m;  3FLG A;  2FZG B;  2L2P A;  5GJV B;  2LC4 A;  2EW3 A;  5GAO r;  2DJZ A;  2LQK A;  4EMG A;  3UWN A;  5HCK A;  3MPU B;  4M7A C;  1YJ9 Q;  5LJ3 h;  2NUT B;  2KE9 A;  3OYI A;  3LGF A;  3M0P A;  5LL6 S;  2RI5 A;  1YP5 A;  1PM3 A;  4M77 G;  5EC7 A;  3M59 A;  1OQK A;  2VGN A;  2XKO C;  4J9C A;  2DRM A;  4FT4 A;  2L3R A;  5HK0 A;  3G71 T;  1YJW Q;  2FG0 A;  1QVP A;  3GPL A;  2LX9 A;  2RH2 A;  3JB9 H;  3AHU A;  2KT1 A;  1Q86 U;  3H0I A;  1EX4 A;  3LWI A;  1IZ6 A;  4JRI A;  1ZA2 B;  3EFO A;  1SSF A;  2DL4 A;  4CC7 A;  2V8I A;  4D8D A;  1VQN T;  4RG2 A;  2EJ9 A;  3QJY A;  2JMC A;  4HT8 A;  5FU6 C;  1VQM T;  2DIQ A;  2DYI A;  3CC7 T;  4N4H A;  1WJS A;  3QWX X;  4E2F B;  4C8Q E; 
#chains in the Genus database with same CATH homology
 1WJQ A;  4E7H A;  3CBP A;  1VQP A;  3EAE A;  2XK0 A;  2LTO A;  4A4G A;  3ZFJ A;  1K73 U;  4QVZ A;  3GF5 A;  2BKD N;  3P8B B;  4II1 A;  3PNW C;  3CCS T;  5LJ3 g;  4X9D A;  4FU6 A;  2PVG B;  5GAN 4;  2RHY A;  4C5E A;  3JCM J;  4JS4 A;  3LGL A;  4J7F A;  2LT1 A;  4IUQ A;  4MMK A;  2V8K A;  3VV0 A;  2X4X A;  1KG1 A;  4M7D B;  5A2Q E;  4N4G A;  2PQW A;  3QJ6 A;  4X34 A;  5GAN 3;  2IVW A;  1VQ5 A;  1VQK A;  2EYQ A;  2VGM A;  5FRN A;  4F7U E;  2VV5 A;  2QQA A;  5D6Y A;  4M75 C;  1U1T A;  4A4K A;  4FL6 A;  2MWP A;  1UGR B;  1FWZ A;  1W4S A;  3LYI A;  3PGG A;  4J6W A;  2WSE E;  2NLU A;  4XTY A;  3CXC S;  1YIT A;  2GF7 A;  2RJD A;  4ME7 A;  2E5Q A;  3G71 A;  4BI8 B;  3MP6 A;  1QP3 A;  1WPY A;  3OYC A;  3INZ A;  1VUB A;  2Y4X A;  3PTA A;  1KD1 U;  4BE0 A;  3LH0 A;  4M7A F;  1M1F A;  4M77 E;  2ZCF B;  4ZGE B;  2PUK B;  3PIO A;  3I55 A;  5LJ5 g;  1VQ5 T;  2XI9 A;  3MEU A;  4ZGJ B;  3M4Y A;  2X4Y A;  2CYZ B;  3OMC A;  2KSS A;  4B9W A;  5GAM g;  5D6X A;  5IN1 A;  3SD4 A;  3E19 A;  3SWN A;  4C5H A;  2MAM A;  2MI6 A;  4M77 F;  1ZBX A;  3GNF B;  2BIV A;  1Q81 C;  4E7J A;  4JRQ A;  2O01 E;  4CRI A;  2BUD A;  2XG8 D;  1KHC A;  3C12 A;  3QYH B;  3V8L A;  4DQ2 A;  1WGS A;  4JUV A;  4C92 C;  1BI1 A;  3EFR A;  4BD3 A;  4C92 G;  4PJO E;  3L1A A;  2ZGW A;  2X35 A;  2XHC A;  3L2Z A;  1G3T A;  2QXF A;  3MET A;  1XQH A;  2CS7 A;  3QO3 A;  4C8Q C;  5HKC A;  1JB0 E;  5GMK l;  1YI2 A;  2DTH A;  2Y90 A;  1K8A U;  3FEO A;  4J6Y A;  4PJO F;  4KT0 E;  4XTU A;  4JRK A;  4A54 A;  1D3B B;  4RCB A;  2KVQ G;  2O4X A;  1NJI C;  2E1H A;  3FIF A;  3CCS A;  3JCM W;  3X25 B;  3CCU T;  4HT9 A;  3OBW A;  2OTJ A;  2E6Z A;  5J26 A;  1VQO A;  1KQS A;  2VUB A;  4M7A B;  4R56 A;  3TCJ A;  2JTF A;  2RK1 A;  3BY7 A;  4EDU A;  3VYH B;  2EQK A;  1JJ2 A;  2RHZ A;  3DKM A;  3OQ5 A;  1XNI A;  1KC8 C;  2I2L A;  4XK8 E;  3UT1 A;  2EJG A;  2JNG A;  3I56 A;  4HCC A;  4C0D B;  3V7R A;  3HFN A;  4Y28 E;  3CPW S;  3JB9 F;  1ZHI A;  5CCA A;  3F70 A;  2D9T A;  2QQR A;  5C0M A;  3FB9 A;  1M1G A;  4DOV A;  3L2W A;  3OS5 A;  4X9C A;  3SWN B;  2XD0 A;  3JB9 J;  2P4T A;  1N8R C;  4BDY A;  3PMT A;  4JDS A;  1K9M C;  1M8V A;  1Q7Y C;  3A5Z B;  3M55 A;  1VQK T;  3RKW A;  3RUX A;  4XTZ A;  4OVA A;  2KMT A;  4M78 C;  2DEQ A;  4VUB A;  3CCM A;  4XTV A;  3OYH A;  4M75 E;  1GXI E;  2RHI A;  3HFO A;  3CC2 A;  4XTX A;  1UGQ B;  4FSX A;  4LDW A;  1M90 C;  3CMA T;  2F5K A;  2H3J A;  4IUT A;  3QZ5 B;  3QHS A;  3E9G A;  3RKY A;  3LWH A;  4CI0 C;  1BI3 A;  4M75 F;  2ZPF B;  3QG1 A;  4HCB A;  5GMK j;  2MF2 A;  2FB7 A;  2O4X B;  4RCC A;  2RI3 A;  2ZPH B;  3M9Q A;  3MCA B;  4GLK A;  3CME T;  5HY6 A;  2EIF A;  3CC4 A;  2QQB A;  2LDM A;  3WVE B;  2R57 A;  1N27 A;  1BIA A;  4C0F A;  3CCL A;  4A53 A;  2CZ7 B;  2P0K A;  2RJC A;  3MEA A;  1QVF S;  5GMK i;  4J7I A;  5GAN 7;  4OB0 B;  5GMK h;  2DTO A;  3DLM A;  3MHX A;  2K4Y A;  3QKJ A;  5CQY A;  3LX7 A;  4JLI A;  1LOJ A;  4QQD A;  3OSS C;  3VU3 C;  3OYN A;  4C92 E;  4EMK C;  1M1K C;  1WNL A;  3C4S A;  1LNX A;  3ZEH A;  2YHT A;  1Y71 A;  1H3Z A;  2HQX A;  4BDZ A;  3HRU A;  3J81 E;  5IT9 E;  3HPW A;  2F5T X;  4C92 F;  3C95 A;  3RKX A;  2HBP A;  3X24 B;  1O9S A;  3DB3 A;  2E41 A;  3CCR T;  1VQ4 A;  3CCV T;  2JOY A;  1W2B S;  4C8Q F;  3SFM A;  4M7D D;  4MZP A;  1IRE B;  4XU1 A;  1HK9 A;  2KK4 A;  1VQO T;  4OMF B;  3OSV A;  4A4E A;  1QVG S;  4NS5 A;  4A4H A;  4OGC A;  2RI2 A;  4WF2 A;  1VQL T;  5GAN 5;  3A8M B;  2PVO B;  1M5Q 1;  2FHD A;  3OYE A;  3PMI A;  3CCJ T;  3HKS A;  3FRN A;  3I56 T;  2OTL T;  3A8G B;  1D3B A;  2M1H A;  4BUG A;  2LT4 A;  2YLB A;  3OYY A;  4C8Q E;  2EKO A;  3JCM b;  1VQ8 T;  4M7A A;  2E65 A;  4LDU A;  4RKU E;  5J3B A;  2GFA A;  3JSC A;  2EQM A;  2EAY A;  4BY6 C;  1NZ9 A;  2XDP A;  3ASK A;  5FU7 C;  4QW2 A;  3RMS A;  3OYG A;  1YJN A;  2QA4 T;  1M9S A;  4F7U F;  1H64 1;  3M56 A;  4JLG A;  3X28 B;  2QQ9 A;  4N0A C;  4YTL A;  2E64 A;  2WSF E;  5CKH A;  4M77 A;  3CCM T;  5CKE A;  2K3Y A;  4M78 E;  2XDD A;  1QW1 A;  2R5A A;  4QVC A;  5HK3 A;  4BI4 A;  4E47 A;  3OYA A;  3CME A;  3CC2 T;  5DY9 A;  4E7K A;  5CVI A;  4C8Q B;  2E12 A;  4IKF A;  2K5I A;  3NTI A;  4M78 F;  3EFS A;  1P92 A;  3GNG A;  4QQG A;  1I81 A;  2JUF A;  4J8O A;  4NL2 A;  3QYG B;  3RIR A;  1Q81 U;  1OYX A;  1I5L A;  4RG8 A;  2K5F A;  3H8Z A;  3JCM d;  4PJO A;  3CC4 T;  2CZ0 B;  2CZ1 B;  2DZ9 A;  3NTK A;  3GOX A;  3OW2 S;  3L2V A;  4M7D C;  4M7D G;  2DD4 A;  3CCL T;  3MO8 A;  3OMG A;  2KDS A;  4OB3 B;  1KD1 C;  3E9F A;  5GAN 2;  1Y7X A;  4XTW A;  5FLX E;  3P8D A;  1UB4 A;  2A7Y A;  4M7A D;  2DXU A;  3L2Q A;  4F7U B;  4EMH A;  1NJI U;  1O75 A;  3RES A;  3L2R A;  4KUD K;  5A0D A;  2D6F A;  3CD6 A;  2DK3 A;  3CCR A;  2RHU A;  3R6O A;  4QVD A;  5GAO q;  3CCV A;  3GP8 A;  4BAC A;  3M58 A;  3JCM f;  4IUP A;  4C0G A;  2RB6 A;  4NL3 A;  3QPH A;  2EJF A;  4MZM A;  2WSC E;  2CZ6 B;  3VKI A;  1YJ9 A;  1KC8 U;  1VQL A;  2PU9 B;  3ZBD A;  4C5I A;  5M9O A;  3CXC A;  3M4G A;  2IG0 A;  3OB9 A;  3H6Z A;  4M77 B;  2FYK A;  3SDZ A;  3JCM e;  3CCJ A;  4BE1 A;  1VQ4 T;  2LCL A;  1ZQ1 A;  4ZN1 A;  2OTL A;  2QI2 A;  1S72 A;  1VQ8 A;  4MML A;  1K8A C;  4IUR A;  3URG A;  1VQ9 A;  2E10 A;  1XTD A;  3G6E T;  4LDV A;  2LVM A;  3X20 B;  4B9X A;  5DM7 R;  1N8R U;  2WAC A;  1K9M U;  2QA4 A;  3BW1 A;  3LLR A;  1YJW A;  1Q7Y U;  2M0O A;  5GAN 6;  4NOY A;  2X4J A;  4OB2 B;  4M75 A;  4D6W A;  2M9U A;  3OA6 A;  4PJO B;  3CBM A;  4HA8 A;  1TH7 A;  4FT2 A;  5KCH A;  3OYB A;  2PVD B;  1BYM A;  2DXT A;  4BB7 A;  1YJN T;  1M90 U;  2QEX A;  5KH6 A;  3A8L B;  1VIE A;  2FVU A;  3HL8 A;  3VUZ A;  3DB4 A;  2L5Q A;  1NPR A;  2DD5 A;  4J83 A;  3RMQ A;  2QQS A;  3V8K A;  2FL7 A;  5FU6 B;  3QZ9 B;  5A0L A;  2RO0 A;  3JB9 D;  4ATO A;  4M7A G;  4V2S A;  4EMK B;  4Y91 A;  5GAO m;  1NE8 A;  3A8O B;  2DAQ A;  3ER0 A;  2RHX A;  2ZZD A;  4J5Y A;  4O5V A;  5CKB A;  1XOV A;  3S3N A;  1VQ6 A;  1YIJ A;  1N9R A;  2RJE A;  1X75 C;  3MP8 A;  2B8A A;  2VC8 A;  1MGQ A;  4ELY C;  1BIB A;  5GAN d;  3M57 A;  4PNO A;  4PLI A;  5CO7 A;  1JRI A;  4XU3 A;  1UGP B;  3QDR B;  3G7Z A;  2VXE A;  3QII A;  4C0D C;  3JCM c;  3OYD A;  3LW5 E;  3FDR A;  2K57 A;  4C92 A;  3T9N A;  3OS1 A;  5KE3 A;  1M1K U;  4P5N A;  2DVE A;  3RER A;  4LDY A;  3SWN C;  3JAM E;  4M7D E;  2VYT A;  3VUB A;  4C8Q A;  3WVD B;  4M75 D;  3HHT B;  5DLO A;  3CPW A;  3MP1 A;  1Q82 C;  1B34 B;  4XU2 A;  2DXB A;  1Q86 C;  2K2V A;  3M54 A;  5GAN f;  2ZPI B;  4M7D F;  1Y07 A;  2LCC A;  2EFI A;  3HRT A;  3JCM h;  3CD6 T;  2JVV A;  3CMA A;  2RA2 A;  4M75 B;  2EQJ A;  1R8O B;  2RJF A;  1M4Z A;  1VIF A;  2JZ2 A;  2JN0 A;  5AYF A;  4BY6 B;  5GAN e;  3TRE A;  4MDW A;  3S6W A;  2P0P A;  4KBM B;  5IAY A;  3KBG A;  1G3Y A;  1FX7 A;  3G4S A;  1YJ9 T;  3G6E A;  3GIB A;  4HKE A;  3E1S A;  1KQ2 A;  4Z02 A;  4LDX A;  1RL2 A;  2KQW A;  2XID A;  2ZPE B;  5A0G A;  2DO3 A;  4ELZ C;  4F7U A;  3TEE A;  3J80 E;  5FRO A;  2QTX A;  2CGH A;  1S72 T;  3OYK A;  3GLX A;  4L6V 5;  3JB9 G;  4FIB A;  1VQ9 T;  2DXC A;  4KUL A;  2M16 A;  5LJ3 d;  3JCM P;  1K73 C;  1N9S A;  2GFU A;  4C92 D;  1G3W A;  2ZPB B;  5CK9 A;  1UGS B;  3NFC A;  3JCM Q;  2V8J A;  3OYJ A;  3CCQ T;  5I2M A;  4GY5 A;  1YJW T;  3J7A F;  3KXT A;  1VQ7 A;  3FJP A;  3WXM B;  4A4F A;  1V29 B;  4M78 A;  4C8Q D;  1QVF A;  5FRM A;  4C92 B;  2KY9 A;  1WJR A;  1KHI A;  4RMO A;  2QEX T;  3NTH A;  5GAO p;  3QUI A;  1JBM A;  1N6A A;  1WQ7 A;  3A8H B;  3OS0 A;  2L89 A;  1KQS S;  3KUF A;  5CIU A;  5LJ3 f;  3SB2 A;  1PSF A;  1OI1 A;  4N4I A;  1NPP A;  4M75 G;  2GCX A;  3C94 A;  5I21 A;  1HXD A;  5CKD A;  1YI2 T;  2HNI A;  2RM4 A;  2XIC A;  1JJ2 S;  4PL6 A;  4R55 A;  3OS2 A;  4M7A E;  1BI2 A;  5LJ3 e;  3JCM X;  3OY9 A;  1VQ6 T;  4HCZ A;  4BE2 A;  4E7L A;  1YIJ T;  2JTM A;  3JCM g;  3V7S A;  2K5L A;  1W2B A;  1Y96 A;  3QXE B;  5LJ5 d;  2YRV A;  3OYF A;  2EQU A;  2CKK A;  5GAN j;  2PUO B;  1QVG A;  4OB1 B;  5GAM d;  1OZ2 A;  4MZT A;  3TU4 K;  2P0Q A;  3CPF A;  2DKG A;  5L8R E;  4ZN3 A;  2LNV A;  5I2S A;  4IUV A;  3MEV A;  5KE2 A;  5J39 A;  1G5V A;  2XU8 A;  2X4W A;  1BKB A;  2DPP B;  4UC4 A;  4EMK A;  1RI0 A;  2MWO A;  3FC3 A;  4ZTF A;  4O6J A;  4E7I A;  4M78 D;  3QBY A;  1G3S A;  1PSE A;  3HRS A;  5GAN h;  4M77 D;  3VJP A;  4Q5W A;  1VQN A;  2ZPG B;  3OYL A;  4ZTJ A;  5CQX A;  4EPC A;  1VQM A;  5CAI A;  2YLC A;  5LJ5 f;  3JB9 I;  3CCE A;  1YHQ T;  4M78 B;  3CC7 A;  3OBY A;  5CR2 A;  4MDX A;  3S3O A;  5GAM f;  2XDB A;  2E6N A;  1U8R A;  2HAX A;  1UEB A;  2LQ8 A;  1LJO A;  3CBO A;  4C8Q G;  3UDC A;  5GMK e;  4BI3 A;  2R58 A;  3CEY A;  3QSU A;  5LJ5 e;  1EIF A;  5GAN 8;  1AHJ B;  2OTJ T;  2G3R A;  3G4S T;  3VYG A;  5GAM e;  4L5G A;  1X01 A;  4OP0 A;  4L59 A;  3HSB A;  4PJO D;  2DIG A;  1B34 A;  4IUU A;  5CKF A;  4LD9 K;  2F69 A;  3CCQ A;  1BI0 A;  1FXX A;  3M53 A;  2EWN A;  2DTI A;  1DJ7 B;  5GAO l;  2K3X A;  1VQP T;  3S3M A;  2Y4Y A;  3OYM A;  5GMK m;  3FLG A;  5LJ3 j;  1X6O A;  2VXF A;  2LC4 A;  5EG2 A;  5GAO r;  1Y96 B;  4XU0 A;  3OW2 A;  2DJZ A;  2GQV A;  2LQK A;  4N0A A;  4F7U G;  2RD1 A;  3M5A A;  4OGE A;  4DOW A;  1MHN A;  1VQ7 T;  4EMG A;  1I8F A;  1WQW A;  4TVR A;  3UWN A;  2HQE A;  4PLL A;  3ME9 A;  4LD6 A;  2E70 A;  4M7A C;  5LJ3 h;  3DLL A;  3V8J A;  5D6W A;  4PKC C;  3BDU A;  3X26 B;  3OYI A;  3LGF A;  4M78 G;  5LL6 S;  4J6X A;  2RI5 A;  4M77 G;  4M77 C;  3M59 A;  4ZGD B;  5GAN g;  2VGN A;  4JRP A;  2L8D A;  1YIT T;  4QQ6 A;  3P8H A;  3V7C A;  2LRQ A;  2XKO C;  4C0Z A;  4C5G A;  4JJN K;  3MEW A;  1OZ3 A;  4FT4 A;  2L3R A;  5HK0 A;  3G71 T;  3O8V A;  3GPL A;  1U1S A;  1QVP A;  3N5B B;  4M7D A;  1YBY A;  4FM4 B;  1I4K 1;  2C06 A;  2RH2 A;  2LX9 A;  2MMP A;  2AHJ B;  3AHU A;  3BFM A;  1Q82 U;  3PT9 A;  3JB9 H;  5LJ5 j;  3I55 T;  1Q86 U;  3UPU A;  3JCM V;  4XAX B;  4PJO G;  5GAM j;  4PJO C;  3Q1J A;  3LWI A;  4OF1 A;  1IZ6 A;  3BDL A;  3L42 A;  2R5M A;  3JRZ A;  1YHQ A;  1KQ1 A;  4JRI A;  4KUI A;  2RK2 A;  2D0Q B;  1SSF A;  4DA4 A;  1VQN T;  2V8I A;  5FU7 B;  5GAO n;  4RG2 A;  5LJ5 h;  2EJ9 A;  3QJY A;  3HP9 A;  3L2U A;  2A3L A;  4JS5 A;  2QDY B;  5DLQ E;  4HT8 A;  5FU6 C;  5GAM h;  1VQM T;  1QP2 A;  2DIQ A;  2DZC A;  1YCY A;  4XQ3 A;  5KCO A;  3CCE T;  3CC7 T;  3CCU A;  4N4H A;  1WJS A;  3PIP A;  5C6S A;  2KAF A;  2OAU A;  3PFS A;  2HD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...