3LYIA

Pwwp domain of human bromodomain-containing protein 1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
EPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 1
publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lyiA01
3C4SA 2RO0A 2BUDA 2R5AA 3OY9A 2DIQA 2X4XA 4PLIA 2X35A 4Q5WA 4A4GA 4ZTFA 1KHCA 2LVMA 3OYMA 3OYEA 4C5GA 2K3XA 2O4XB 5C6SA 4UC4A 2LRQA 1MHNA 2EQKA 4E7JA 3E9GA 3OS1A 2XDPA 2LCCA 1G5VA 4NS5A 2O4XA 1WJRA 5J39A 4E7KA 2P0KA 3META 4X34A 3L2RA 2RHYA 2R58A 3MP8A 5KCOA 3EAEA 5KE3A 3PNWC 3OYAA 4E7LA 3FEOA 3MP1A 2BIVA 5M9OA 2EQMA 5KCHA 2YRVA 3L2WA 2E5QA 4IUVA 4BACA 2LTOA 4BD3A 2RI5A 3Q1JA 4BE1A 4QQ6A 3OS0A 2XK0A 2GF7A 3M9QA 4QQDA 4E7IA 2EKOA 4HCZA 3L2UA 4BDYA 3OYKA 3FDRA 2CKKA 2NLUA 2JTFA 2MWPA 4C5IA 3MEVA 4B9XA 2GFAA 3H8ZA 3PFSA 5D6WA 2EQJA 4II1A 3DLMA 3QBYA 2RJFA 4N4IA 3NTHA 4FL6A 3ASKA 4C5HA 2G3RA 3O8VA 1WGSA 4B9WA 5KH6A 2B8AA 1WJSA 3MO8A 4IKFA 1H3ZA 3GOXA 4C5EA 2M16A 3LH0A 3OYFA 3CEYA 3LGLA 3S6WA 3MP6A 5C0MA 2HQXA 3OYNA 2EFIA 3DB3A 1SSFA 2RJCA 2L3RA 2GFUA 5KE2A 3OYCA 4QVZA 4A4HA 3PMIA 1OI1A 3NTKA 3L42A 4BDZA 3OYDA 3H6ZA 2HQEA 5J26A 3LGFA 4BE2A 4LD6A 3FC3A 3S3OA 3SD4A 2X4YA 1OZ2A 2PQWA 3NTIA 3OYJA 2DIGA 3MEWA 3S3MA 3UWNA 3P8DA 4PL6A 4PLLA 3S3NA 3OA6A 3OMCA 4FU6A 1XNIA 4CRIA 3QKJA 4IUUA 3ZEHA 5FRMA 2L89A 2LDMA 2L8DA 2QQRA 2MWOA 3FLGA 2D9TA 2R57A 3P8HA 5D6XA 4Z02A 3QIIA 3OYIA 2QQSA 3OB9A 2WACA 5FROA 3E9FA 3UT1A 2RHZA 5D6YA 3L2VA 1RI0A 2RI2A 2RJDA 3PMTA 4GY5A 1OZ3A 4A4FA 2JZ2A 4QQGA 3OYLA 1WJQA 3QJ6A 4IUPA 4IURA 3BDLA 5FRNA 2RHIA 3LLRA 2R5MA 2FHDA 3ME9A 4N4GA 3DB4A 2DAQA 3LYIA 5IN1A 3LX7A 2M1HA 3OQ5A 4OVAA 4A4EA 2VYTA 3OS2A 3OYBA 1OYXA 2RHUA 2RI3A 5IAYA 4L59A 5CIUA 2BKDN 2M0OA 4E7HA 3L2QA 4N4HA 3OYHA 4ZTJA 4IUQA 4RG2A 2F5KA 1N27A 4BE0A 4EDUA 4QW2A 2EQUA 2RHXA 4IUTA 2K3YA 2X4WA 3OYGA 3OMGA 2RJEA 3F70A 2IG0A 3MEAA 3KUFA 3MEUA 2E6NA
chains in the Genus database with same CATH superfamily
3DKMA 2RO0A 4AFZC 4XQ3A 2DIQA 9ATCB 4GBQA 2QEXQ 1BBZA 5GAN3 2OTLA 2NUTA 3A8GB 4PFZA 1N6AA 1N8RR 2XDPA 4M77E 1QP3A 1BU1A 1AD5A 1NPPA 3OYAA 5HY6A 3CBPA 3GPLA 1WHLA 4BACA 5KYWA 2YUNA 2EYYA 1IB8A 5CQYA 2X4JA 4QVCA 5D6WA 1NEBA 4B6MA 1U5SA 2K6DA 3O5ZA 3RKYA 4BI8B 3NTHA 4ZGDB 1BI3A 1H3ZA 3CC7T 2EJFA 4ATOA 3LH0A 3S6WA 2XDDA 4O5VA 2PVGB 2RQRA 2XDBA 1M3AA 4QVZA 3CD6T 3LH5A 3HSBA 2EYWA 4LDUA 1TG0A 2PU9B 1WXUA 2DIGA 2RF0A 1WA7A 2ZPBB 2CGHA 3G71A 3CCJT 2V1RA 1NLOC 1AEYA 2QQRA 1EIFA 1MMNA 2MWOA 2D9TA 1Q7YR 1JXOA 2FYKA 2LX9A 3L2VA 3CC7A 2RJDA 1T3SA 1ZA1B 3EFOA 1UTIA 4XTVA 3A8HB 3QYHB 4WCIA 4XAXB 2EGAA 2ZZDA 1YI2T 4PJOB 3CD6A 2FL7A 4NL3A 1RAGB 3CCRT 4HCCA 2ECZA 5GAMg 5LJ5f 1N27A 2GCXA 2ZPFB 3HP9A 3VS6A 2WSEE 5L23A 4R0KA 4OMQA 1E6GA 3GBQA 3NGPA 4ZGEB 4DOVA 1X6OA 2E6NA 2X3XD 3WVEB 4FCYA 2R5AA 4M75C 3M58A 2VV5A 5GMKl 2LRQA 1YI2A 2CP7A 4OMOA 5J39A 3OSVA 1AVZC 2E41A 4EMHA 2J7IA 3CCRA 1M90R 4J5YA 5CKHA 4J83A 1JJ2S 3OS5A 5IH2A 5HKCA 1I5OB 2HKQB 3VS3A 1HYOA 4HVUA 1PKTA 4OMPA 2D8JA 1K0XA 2FO0A 3JCMP 3L2ZA 1BCMA 1XQHA 2K4YA 4N4IA 3CC4T 4C5HA 2KE9A 3O8VA 4M7DG 5KH6A 2F1LA 2LT1A 4RTYA 5LJ5g 3UA7A 3G71Q 3JCMW 3X25B 2EJGA 4FT4A 2HQEA 1YJWQ 1ZQ1A 5GAN5 2XICA 3CCLT 1U1SA 4M77B 1OZ2A 1VQNQ 1ZSZB 1SG5A 2Y4XA 2ZAEA 2FRYA 5KYUB 2HQHA 2QAZA 2C0OA 3CC4A 3QIIA 6AT1B 1YBYA 4FIBA 1WX6A 4N0AA 3RESA 3TREA 1UUEA 4M7DC 3PMTA 1OZ3A 2AHJB 2J6OA 1QVPA 1S1NA 3J80E 1C6VX 1NEGA 3RNJA 4OVAA 2VYTA 1OYXA 3CCLA 2LQKA 5J3BA 2QTVA 2VC8A 2EQUA 2K5FA 1RAEB 2XU8A 1Q82U 3JSCA 3HRTA 1UDLA 2CSIA 1UECA 2V1QA 5CKFA 3I5SA 3G4ST 4PLIA 2EYQA 3OYEA 2PUKB 1N9SA 3MCAB 2O4XB 5C6SA 4F7UA 1GRIA 1YCYA 4BY6C 2I2LA 2DVEA 1MMGA 1VQPT 4KH0B 4J8OA 2LQ8A 2KAFA 2DTIA 3OW2S 4HKEA 5KE3A 2YHTA 2K3BA 4XU0A 4M75B 2W10A 1PWTA 3M9QA 5CKEA 3EFRA 3G4SA 1BI1A 2CZ1B 1PHTA 4PNOA 4ANJA 2J6KA 3FRNA 3CCUA 4M78D 1VQPA 4B9WA 1VQ7A 1D0XA 1W6XA 8AT1B 2KVQG 2EFIA 2L3RA 4DBRA 2GFUA 3PMIA 1BI2A 2SEMA 3CCMA 3KBGA 4KGZB 3MHXA 3M4YA 3NTIA 2FZCB 5A0DA 5GAN4 2HD0A 4KT0E 1SRMA 4QT7A 2VGNA 2H3JA 3CXCA 4Z02A 1QVGS 4HA8A 2CT4A 2MI6A 4LDWA 5FROA 4D6WA 2JZ2A 3RMQA 2P0QA 3RIRA 1KHIA 4ELZC 3ME9A 2AZSA 4J9IA 2RD1A 5EC7A 4XU1A 2IPOB 4C92D 1RADB 2GTOA 2L3PA 4N4HA 3CXCP 4JJNK 2RA2A 2GNCA 2YUOA 5LJ3h 3VS4A 5KYXB 2CUBA 4J7IA 2M02A 2XI9A 1NE8A 1N8RU 5LJ3e 5LJ3d 2JMAA 4EMKB 2WSFE 3HKSA 4QKUA 1V1CA 4PJJA 3UF4A 1JJ2A 3CPWS 2RQWA 1WJRA 1BKBA 3EHRA 4DQ2A 3PNWC 2QDYB 1PCXA 3QO3A 4FSXA 1WHGA 1PSFA 2LTOA 3CMAT 3CCUQ 1VQ5T 2GF7A 3JAME 3CQTA 2VKNA 2MYSA 1VQ7Q 2QA4T 3JV3A 3BW1A 3V7SA 2RQVA 5I21A 1UGPB 1D3BA 1G3WA 4M7AB 3D7SB 3CCMQ 4IKFA 3TSZA 2BE7D 1VYTA 3JB9D 5IXBA 4K11A 4A4HA 3H6ZA 5A2QE 2PNIA 4M78F 3CMAA 1G2BA 2J6FA 3EH1A 3SD4A 3DLLA 1W2BS 3EG9B 5FWBA 2QA4A 1QCNA 4LD9K 3UA6A 1MMDA 2COYA 1Q7YU 1Y57A 4F14A 4IUUA 5FRMA 2QQBA 2ZPHB 2ZPIB 5GAMj 3P8HA 3SWNC 4R55A 3ULRB 2RHZA 5D6YA 2YWWA 5CR2A 3GP8A 2LNHB 4KGXB 2X9HA 4PJNA 4M78E 4L59A 4FYYB 1QKXA 2DFUA 4E7ZA 2F5KA 2KXDA 1M1GA 1EZZB 3A1PA 1KC8R 1Q86R 3H9NA 4J9BA 4ZN3A 5KYNA 4C8QG 2IG0A 3KUFA 4LUEA 4C92F 2NUTB 1I07A 2FRWA 1M1KC 4JDSA 2GQIA 2FB7A 1TUGB 4X9DA 1IZ6A 3EH2A 3OS1A 3E19A 3OSSC 2YLCA 3EGXA 1M90U 4J9CA 3EAEA 2DYBA 2KYMA 5IHNA 5KYWB 2RK2A 2XHCA 4JS5A 3I35A 2E64A 1K9AA 1VQLQ 1Y0MA 4WF2A 4C92E 1LPLA 1ZLMA 4E7IA 4F7UF 1JU5C 4A4KA 3QWYA 4B9XA 1O9SA 4KULA 1B3QA 2FEIA 1JRIA 4XU2A 5IHKA 1PD0A 2YRDA 1YIJQ 1B07A 4C5EA 1WPYA 2QK0A 3QG1A 4NOYA 3LGLA 4C0FA 2L5QA 2HSEB 4PJOG 4DBFA 1OI1A 5LJ5e 3ZBDA 2DD5A 4F7UE 2G6FX 3UPUA 1W4SA 5D7UA 2YRCA 2KEAA 4PL6A 2NYSA 2JNGA 2HDAA 1RL2A 5GAOn 3VS7A 3GNFB 3JB9F 5LJ3f 1M2OA 3P8BB 1BK2A 2DE0X 2EGEA 3OYIA 3EFOB 1TOVA 5GANh 2CP2A 3M56A 2QGGA 4IURA 3JCMX 4OB0B 5GANe 1ZUKA 5I11A 5GANd 4BDYA 2M1HA 2YUPA 4PJOC 1ARKA 1KG1A 1WHHA 2L3SA 4F04B 2QYZA 1YNZA 1RLPC 3H0IA 1TS9A 2LJ1A 3J81E 2RHXA 2A3LA 2HEQA 2QGFB 5DY9A 1HJDA 1X2KA 5AT1B 2FPEA 7AT1B 4J7FA 3MEUA 2HKNA 1Y96A 2DM1A 4ZTFA 3VS0A 2E5KA 4C5GA 1M1KR 2K3XA 1VQ8T 1VQ6T 1OU9A 2DK3A 2OTJQ 1VQ4Q 2F2WA 1YJNQ 3E1SA 3CMET 4E7KA 2P0KA 4X34A 1M1FA 3L2RA 2LCSA 1UB4A 2EWNA 1QWFA 3MP1A 5M9OA 5LJ3g 1NYFA 3OYYA 3VS1A 1VQ9A 2LX7A 4BD3A 5GMKh 1X43A 4M77G 3OYKA 3FDRA 1H3HA 1KD1R 5GMKe 1VQ8A 2CT3A 1VQ6A 5CQXA 4JPBW 1U1TA 4Z88A 2EGCA 5FWCA 3CMEA 3N5BB 1M90C 1SEMA 3OYNA 3OYFA 2DX1A 4JRQA 2O88A 1GCQA 1SSFA 3DB3A 1OQKA 5KE2A 1X27A 1VIEA 4BE2A 4LD6A 1HK9A 4M7DD 2COZA 2KRSA 2KDSA 4M77C 1KIKA 4PK4A 3S3NA 3OA6A 1ZSZC 2DL4A 3QYGB 3H41A 2VWFA 1VQOT 2RI2A 2IVWA 3WVDB 1T3LA 2A28A 2K2VA 4FM4B 3RR6A 3FJPA 2X3WD 1UFFA 3OS2A 2HL5C 2AKLA 3OYBA 3BE3A 4FSSA 4MDXA 3M0SA 5I22A 2E4HA 3JCMh 3VUZA 1GFDA 1LJOA 2K3YA 3VV0A 1KQSS 4M75G 3RBBB 1YITQ 3JCMd 4J9GA 2KK4A 1VQOA 2DD4A 3G6ET 4F7UB 2F2XA 4FT2A 1OPLA 2KRMA 3HFNA 3CCQT 1R77A 1CKBA 5I2MA 3EG2A 1VQ9Q 3META 3CCJA 3R6NA 1LNXA 1UGQB 4E7LA 2OTLQ 2E1HA 3X24B 2RK1A 1X6GA 3I55T 3C95A 1VQ6Q 2LC4A 2QI2A 1TUCA 2ED0A 4DEXA 3OS0A 3L2UA 4BI3A 2YLBA 1TTHB 3G6EA 3GF5A 1IGUA 1HXDA 1BYMA 3QBYA 4CC4B 1AWXA 2KROA 1FMKA 5GANf 1IXDA 2GBQA 3SFMA 4HXJA 2M0YA 2HQXA 2EKHA 3EFSA 4RMOA 2D6FA 1RACB 2JW4A 3CBMA 2HMAA 4M78A 4V2SA 2ABLA 1Z9QA 4LDXA 1YFNA 5D6XA 3CCST 2MPXC 1QVFS 2QQSA 2K5LA 5IHIA 4M7DF 2CSQA 4GY5A 1VQKT 1PM3A 3BDLA 1D0ZA 2FHDA 1NYGA 3NFCA 4X9CA 5IAYA 4HT9A 2JM8A 2Z0WA 2H3EB 1KC8U 2KI7A 2ATCB 1Q86U 4JS4A 3CC7Q 2OX7A 4JRIA 4AT1B 4VUBA 4JZ4A 3JCMV 3CD6Q 4JLGA 2RJEA 2KT1A 4M7DE 2VUBA 5GANg 1CSKA 3M57A 4A53A 1G83A 4C92A 3CCJQ 4C8QA 4WTOB 4EMKC 2IIMA 2KNBB 4ZGJB 1VQKA 3E9GA 3TQ7P 2YT6A 4NS5A 4M7AG 1PD1A 2EQIA 1SHGA 3A8OB 1NJIC 2DZ9A 3L2WA 3SHWA 1YI2Q 2QASA 1WFWA 3Q1JA 4JUVA 4DBHA 3SDZA 1Y71A 3CCRQ 3JCMQ 1ZA2B 3E2UA 3CBOA 1D3BB 1OV3A 3MEVA 3JCMc 3PFSA 1RAIB 1ABQA 4JJDA 4E2FB 3INZA 3I56T 2EJ9A 4ZNXA 4JRPA 2G3RA 4M7AC 4HVVA 3VKIA 3MO8A 3GOXA 2MIOA 1AWWA 1PKSA 1C1AA 3OYCA 3TEEA 4J9HA 1DJ7B 4OB2B 3JCMf 3OMCA 5GAN6 1RAHB 4F17A 2NWMA 3JRZA 2CZ0B 3H0HA 3TCJA 2R57A 2HSPA 3I5RA 3E9FA 3UT1A 5KYYA 4OMLA 4PKCC 3KFVA 4LDVA 4FW1A 2PUOB 2A37A 2KBTA 4PJLA 4N4GA 1M3BA 4RTZA 1KQSA 5IN1A 1VQMT 3CC4Q 2LZ6B 3MJXA 2DERA 5FU6B 2JMCA 1U8RA 4CC7A 1TU0B 3M53A 4ELYC 1S72T 1M1KU 2OAWA 1KQSP 3CCLQ 2AZVA 3QDRB 4PFPA 1MMAA 5LJ3j 2JT4A 3EGXB 2MMPA 4UC4A 4E7JA 2E65A 1QLYA 2WSCE 3V8JA 4C8QD 1VQMA 1WQ7A 4EMGA 4Y92A 2QG9B 3JCMg 1KC8C 4D8KA 1Q86C 2LJ3A 1NJIR 1NG2A 3SEMA 1WLPB 1A0NB 2YRVA 2QXFA 2KYBA 1PSEA 2E10A 2RPNA 3LW5E 1UJYA 5GAN8 1S72A 3NPFA 1KD1U 1UHCA 1Z9ZA 1YHQT 4BE1A 2PTKA 2J06A 3URGA 3CCET 1WZOA 2JTFA 2MWPA 2CUDA 2GFAA 3QZ9B 3HRSA 2ESWA 1OPKA 2JXBA 2RJFA 2CDTA 5HCKA 4C0GA 3G4SQ 1SHFA 4BB7A 2E3HA 1JBMA 5L8RE 1SRLA 1IHVA 2JN0A 3REBB 1VQPQ 2V8KA 4XU3A 3JCMJ 1K1ZA 1JJ2P 1QVFA 3CCEA 4HCBA 2LQNA 4PLLA 4PJOD 2KT8A 3ZEHA 2DJQA 2CP5A 1T0JA 4C0ZA 4HT8A 3PT9A 1EFNA 3JCMb 1QVFP 1R0BG 2KGTA 3M59A 1RABB 3LYIA 1VQ5A 1JB0E 4E7SA 4E7HA 3A5ZB 2FZKB 1X6BA 4IUQA 4RG2A 4KGVB 4L6V5 1OEBA 2EIFA 4Z8AA 4EDUA 2J05A 2CP3A 2C06A 1Y96B 1R0CB 2DZCA 1JQQA 2DILA 3OY9A 2CP6A 4A4GA 3OYMA 1QCOA 1YJ9T 1M2VA 1IHWA 1OX8A 1K8AC 3CC2T 1M8MA 3M4GA 3CCVT 2XIDA 3UATA 4FW2A 1GFCA 5KCHA 4XTZA 2D1XA 2GGRA 4MZMA 2LP5A 4C8QF 5GAOq 2A7YA 2EKOA 2FG0A 4RTUA 3OW2A 2NLUA 4FYVB 1UHFA 2O31A 1VUBA 2EQJA 3QZ5B 4E6RA 3ZL7C 1ZX6A 3HHTB 1YWPA 4RG8A 3CC2A 3RMSA 1D1AA 3GNGA 2HL3A 5GAMd 3M0PA 1H641 1NLPC 4CC3A 1Q95G 3CCVA 4DBQA 4OB3B 3C12A 4QVDA 4AFSC 3OW2P 2DA9A 3PTAA 3X20B 5LJ5j 4C8QE 1MV0B 3QDFA 3OYDA 2GTJA 3LGFA 3S3OA 3FC3A 1KD1C 1TXQA 2DRKA 2QEXT 2RMOA 4JLIA 4FU6A 4DOWA 1K0SA 1XJWB 4XTYA 3R6OA 1B34A 2L89A 1YP5A 3CMAQ 2P84A 4N0AC 3JB9I 1VQ5Q 2M51A 1F1BB 4F7UG 2QA4Q 4A4FA 1FWZA 4M7DA 4JJBA 4KUDK 2EPDA 1M5Q1 5GANj 1U06A 2X51A 4PJOF 4C0DB 2A0FB 4D8DA 3JB9J 1QVGA 3OBYA 1E6HA 4OGCA 3QUIA 2AT1B 1MGQA 4AFUC 2VXEA 4LUDA 3V8LA 2JM9A 3X26B 4JJCA 1ZBXA 1J3TA 2DXTA 1I8FA 5DM7R 1QVGP 3GIBA 4PJOE 1GXIE 1WDXA 3PGGA 3JB9H 4M75D 1ABOA 1K8AR 5A0LA 4EIKA 1SPKA 3TVTA 2DBKA 4RCCA 1G3TA 3FIFA 1Q81U 2MAMA 2PVDB 2LT4A 2B86A 3CPWA 4QQDA 1PNJA 3CC2Q 2DXBA 1WIEA 2KR3A 5GMKj 1MUZA 1N5ZA 2O2OA 1W1FA 1UGRB 1ZSGA 1ZHIA 2PZ1A 3ASKA 2B8AA 2CREA 3CPWP 2CP0A 5GAN2 1K9MR 4KH1B 5I2SA 1QW1A 4AMCA 4OB1B 1NBEB 2QQ9A 1C0MA 4M78B 1KQ2A 2V8JA 3PIPA 4OMNA 4M77F 1VOMA 3S3MA 1XNIA 1V29B 3EGDA 1K73U 1W2BA 3OB9A 1AWOA 3RKXA 1WJQA 1WHJA 2OAUA 3DB4A 3RDVA 1KK7A 1OOTA 5CO7A 2RI3A 1YN8A 4L5GA 2W0ZA 8ATCB 2BE9B 1M9SA 5ECAA 1W2BP 1GCPA 2DTHA 5LL6S 3BFMA 4IIOA 4C92B 4C8QB 2X4XA 2QDLA 4HVWA 4MDWA 4LDYA 1QCFA 2LVMA 3QJYA 4J6WA 3QHSA 3U23A 5GAMf 2SRCA 3G71T 3BY7A 2NUPA 2EQKA 2KMTA 1SSHA 1YJWT 2XMFA 1NJIU 1VQNT 1UJ0A 2RHYA 3A8MB 1RAAB 2DL8A 2FPFA 2EQMA 2C0IA 3VU3C 2HAXA 3JCMe 4M7AD 2RI5A 4M75F 4TVRA 4YTLA 3V7RA 2O01E 3PVQA 2KY9A 2XKOC 2YSQA 1KFZA 4O6JA 1M30A 1YJWA 1IREB 3HFOA 2HBPA 1VQNA 2DL3A 2AK5A 1TWBA 3MP6A 2ZPGB 1PC0A 1VQ8Q 2EYZA 2BTTA 1VYVA 4M75E 1LCKA 1Q81C 4BDZA 4GLMA 3OBWA 3CXCS 3REAB 3VRYA 3CMEQ 1UGSB 4ESRA 4J9DA 2PQWA 4ZN1A 4JRKA 3MEWA 2DPPB 1HSQA 2RM4A 4LN2A 3CCQA 4AG1C 1D09B 4LE9A 2F2VA 4AG2C 5KYYB 3SWNA 4Z89A 3IQLA 4FYXB 1FMVA 1VYUA 3PVLA 1RUWA 3I55A 1KJWA 1UGVA 4JZ3A 1I4K1 1X75C 1JEGA 3FJ5A 3QXEB 5FU6C 2NUZA 1WQWA 2D8HA 2V8IA 2CZ7B 1MNDA 1TH7A 1NZ9A 2X4WA 5AYFA 4J6XA 2CZ6B 1K73C 1PRLC 2DRMA 2X35A 4Q5WA 2Y4YA 4X1VA 2HBWA 2E3IA 1AT1B 2QTXA 3RERA 2E70A 2AKKA 2ZCFB 1G5VA 2GQVA 1M8VA 2P4TA 2ROLA 1VQOQ 2JOYA 1AZEA 3HL8A 4RTTA 1PG5B 5DLQE 1V76A 1M27C 3THKA 1G3SA 1GBQA 1R8OB 4OGEA 2E5QA 2AIRB 3CCSA 2FZGB 2VB6A 1MNEA 1SF9A 2K7AA 3H0FA 4II1A 2V26A 5GJVB 1KQ1A 2VASA 1TUDA 4M7AF 3PIOA 1Y07A 1ZUUA 4XTUA 3G6EQ 5GMKi 1IGQA 1QMCA 3CEYA 5C0MA 1AOJA 1IO6A 3VS5A 2RJCA 4XK8E 3CCQQ 2KRNA 4ME7A 1QP2A 4A54A 1YWOA 1Q81R 3M0RA 2RN8A 4OF1A 2P4RA 2X4YA 2ZGWA 2A36A 1WNLA 4MZTA 4KRTA 3P8DA 1M3CA 2D0NA 2COWA 2E12A 3V7CA 2LNVA 1FYNA 3I55Q 4M7AE 3FLGA 3ZFJA 3HPWA 2JS0A 2E6ZA 2BZ8A 2DETA 1GL5A 1HD3A 2DAQA 5CCAA 5GAOm 3CCUT 1D1BA 2M0OA 1VA7A 4CC2A 3V8KA 2YUQA 4PJOA 1LOJA 4XTWA 1VQ7T 4J6YA 3M0TA 1NM7A 3A98A 1PRMC 4IUTA 1Y7XA 1KSWA 3I56A 3OYGA 5EG2A 1U3OA 1D1CA 1G3YA 3MEAA 4R56A 1ZBJA 1M2VB 1B7TA 2BUDA 3CCMT 3EG3A 1K73R 4FYWB 5GAOr 1K8AU 4A63B 2BZYA 4RCBA 1I5LA 2DTOA 3CCSQ 1H92A 2HNIA 3RKWA 4F16A 2MOXA 5CVIA 2RNAA 3MP8A 3FB9A 4NL2A 5KCOA 3SB2A 3AT1B 1VQKQ 3VJPA 4Y28E 2FVUA 4QQ6A 2FPDA 1E7OA 2RB6A 2DL5A 2KXCA 4HCZA 5HK0A 1FX7A 3VUBA 2F5TX 3UDCA 4C5IA 1BI0A 2DL7A 3AHUA 2DVJA 3TSWA 3G1JA 2DYIA 3HRUA 2JTMA 1K9MU 2YDLA 1NPRA 4J9EA 1WI7A 1JXMA 2VXFA 1WJSA 3QPHA 4BUGA 1GCQC 3NMZC 1VIFA 4HCKA 1K76A 2MK5A 3HTRA 4DA4A 1WYXA 4M4ZA 3J7AF 3NTKA 2XD0A 1X2QA 2ENMA 5J26A 1QWEA 2YXYA 1AWJA 2BZXA 1B34B 4M77A 4DEYA 4CRIA 3QKJA 3M0QA 1ZSZA 1BB9A 3A8LB 1CKAA 5KYUA 4M7DB 1I1JA 1LVKA 1FXXA 3L1AA 3EHQA 3M55A 5CKDA 2RHIA 1QQJA 2LQWA 3I56Q 1H8KA 1SKUB 1YHQA 2JUFA 1VQLT 2DO3A 4C0DC 5CIUA 3L2QA 3OYHA 4ZTJA 3I9QA 4E47A 1K4US 1AZGB 3WXMB 2EAYA 3RUXA 1UE9A 1YIJT 5HK3A 1Q82C 5GAOl 3QWXX 1KHCA 2RQUA 1RAFB 4Y91A 2MCNA 4BY6B 1YCSB 2LCCA 1VQLA 2O4XA 1OX9A 2XG8D 4KUIA 3FEOA 1GBRA 3G7ZA 2BIVA 2L2PA 1O75A 2K57A 4OMFB 4M78G 1XOVA 1VQMQ 1YIJA 2DXUA 2LCLA 2CKKA 4M75A 3H8ZA 1W70A 1S72Q 4AFQC 1I81A 4FL6A 3M54A 4XTXA 1BIAA 2L3QA 3LWHA 2KQWA 2M16A 2JS2A 3X28B 1JO8A 1RI9A 3M0UA 2M9UA 3EG0A 2QQAA 2LMJA 4M78C 4P5NA 1MV3A 3EGDB 5CKBA 1YJ9A 2DEQA 3UWNA 4CI0C 5GAMh 1FMWA 2C0TA 4PJMA 3C0CA 5FU7C 2OTJT 2DLPA 1VQ4T 1YJNT 2DMOA 4KBMB 2K9GA 5GAMe 2Y90A 4M77D 4C92G 3ER0A 1YHQQ 1K9MC 1OULA 5FW9A 1X01A 5GJWB 3PE0A 3GLXA 3CCEQ 1RI0A 4QQGA 3OYLA 4MMLA 4IUPA 5FRNA 5FLXE 3NHNA 4RKUE 4A4EA 1X69A 1IRXA 2JJ9A 2CS7A 2BKDN 2D0QB 2I0NA 4RTXA 5CAIA 3VS2A 4BE0A 2O9VA 5DLOA 2OTJA 4ORZA 1VQ4A 3EG1A 4J9FA 1YJNA 2DKGA 3C4SA 1EX4A 1Q82R 4C92C 4MZPA 2NUPB 4C8QC 5KYXA 3KXTA 3LWIA 1WXBA 2KSSA 3C94A 1N8RC 1MHNA 2VGMA 4EMKA 1TSFA 2ZPEB 2MF2A 5IT9E 2RH2A 1RLQC 2DBMA 2QEXA 1BIBA 2DJZA 5GAN7 2H8HA 2R58A 5LJ5h 2RQTA 2L0AA 4IUVA 1D0YA 2DXCA 1AHJB 2F69A 3VYHB 2XK0A 5LJ5d 2DEUA 4IIMA 4BI4A 1BCOA 4EPCA 2A08A 2K5IA 3JB9G 2OI3A 1XTDA 3DLMA 5A0GA 2HCKA 2PVOB 2EVRA 1ZUYA 2JTEA 3BDUA 1WGSA 2CYZB 4LNPA 4RUGA 2K2MA 4M7AA 3MKDA 2O9SA 5GAOp 1YJ9Q 2K79A 2JVVA 5CK9A 1I0CA 2ROTA 1P92A 3L42A 1YITT 1ACMB 3T9NA 1QKWA 3VRZA 2CH4A 3OYJA 4RTWA 2VVKA 1WHMA 3CCVQ 2EW3A 2DNUA 1M4ZA 3MPUB 4LXCA 1UG1A 3EG9A 1WHKA 3EGUA 2EBPA 3SWNB 2LDMA 2L8DA 1VQ9T 1UEBA 1Q7YC 1WXTA 1G8XA 3VYGA 2WACA 4RTVA 2OTLT 2DF6A 2OJ2A 2EYXA 3QJ6A 3QSUA 3LLRA 2R5MA 4MMKA 3M5AA 3LX7A 3OQ5A 2RHUA 1YITA 5IXFA 2P0PA 2HZYA 4OP0A 5FU7B 3TU4K 1N9RA 1T0HA 4QW2A 5GMKm 2CH4W 2ED1A 3CPFA 1OU8A 3OMGA 4GLKA 2LJ0A 3F70A 4OMMA 4PFOA
chains in the Genus database with same CATH topology
3DKMA 2RO0A 1K9MC 2CZ6B 4XQ3A 4C92F 1K73C 2DIQA 3QDRB 2X35A 4Q5WA 2Y4YA 5LJ3j 1M1KC 5GAN3 2OTLA 4JDSA 2QTXA 2FB7A 4X9DA 2MMPA 3A8GB 4UC4A 2E70A 2ZCFB 4E7JA 3RERA 1IZ6A 2E65A 1N6AA 2WSCE 3OS1A 2XDPA 1G5VA 4M77E 2GQVA 3E19A 3V8JA 4C8QD 3OSSC 2YLCA 1VQMA 1M8VA 2P4TA 1WQ7A 4EMGA 1QP3A 1M90U 2JOYA 3HL8A 3CD6A 3JCMg 1KC8C 1NPPA 3EAEA 3OYAA 1Q86C 5DLQE 5HY6A 3CBPA 2RK2A 2XHCA 4JS5A 2YRVA 1G3SA 1R8OB 2E64A 2QXFA 2E5QA 1PSEA 2E10A 3LW5E 4OGEA 5GAN8 3GPLA 4BACA 1S72A 3CCSA 1KD1U 4WF2A 4C92E 4BE1A 1YHQT 5AYFA 4E7IA 3URGA 3CCET 4F7UF 4A4KA 5CQYA 2JTFA 2X4JA 2MWPA 4QVCA 4B9XA 1O9SA 2GFAA 4KULA 3QZ9B 3HRSA 5D6WA 1JRIA 4II1A 4XU2A 1KQ1A 2RJFA 3RKYA 4BI8B 3NTHA 4M7AF 4ZGDB 4C0GA 3PIOA 1Y07A 1BI3A 4XTUA 3CC7T 2EJFA 1H3ZA 4C5EA 4ATOA 5GMKi 1WPYA 3QG1A 3LH0A 4NOYA 3CEYA 3LGLA 3S6WA 4BB7A 5C0MA 4O5VA 2XDDA 4C0FA 1JBMA 2L5QA 2RJCA 2PVGB 4XK8E 2XDBA 4QVZA 5L8RE 4PJOG 3CD6T 1OI1A 5LJ5e 4ME7A 1QP2A 3ZBDA 2DD5A 4A54A 2JN0A 3HSBA 4F7UE 2V8KA 4XU3A 4OF1A 3UPUA 4LDUA 1W4SA 3JCMJ 1QVFA 2X4YA 3CCEA 2PU9B 2DIGA 2ZGWA 4MZTA 1WNLA 4HCBA 2ZPBB 3P8DA 2CGHA 4PL6A 2JNGA 4PLLA 3G71A 3CCJT 2E12A 1RL2A 5GAOn 3GNFB 3JB9F 3V7CA 5LJ3f 2LNVA 3P8BB 4PJOD 4M7AE 3ZEHA 3FLGA 2QQRA 3ZFJA 1EIFA 2MWOA 2D9TA 4M7AD 3OYIA 4C0ZA 3HPWA 4HT8A 3PT9A 2FYKA 5GANh 1N8RU 2LX9A 3M56A 3L2VA 3CC7A 2RJDA 4XTVA 3JCMb 3A8HB 2E6ZA 3QYHB 4IURA 3JCMX 4XAXB 2ZZDA 1YI2T 4OB0B 4PJOB 3M59A 5GANe 2DAQA 3LYIA 5GANd 4BDYA 2M1HA 2FL7A 5CCAA 4NL3A 1JB0E 5GAOm 3CCUT 1VQ5A 4PJOC 4E7HA 1KG1A 2M0OA 3A5ZB 3CCRT 4HCCA 3V8KA 4PJOA 1LOJA 4XTWA 1VQ7T 4IUQA 4RG2A 4J6YA 5LJ5f 5GAMg 4L6V5 2EIFA 1N27A 2GCXA 2ZPFB 4EDUA 3HP9A 3J81E 2RHXA 4IUTA 1Y7XA 2A3LA 2WSEE 3I56A 5DY9A 3OYGA 2C06A 1Y96B 5EG2A 4ZGEB 1G3YA 3MEAA 4DOVA 1X6OA 4J7FA 3MEUA 2E6NA 4R56A 2DZCA 3WVEB 2BUDA 2R5AA 3OY9A 3CCMT 1Y96A 4M75C 4A4GA 4ZTFA 3OYMA 3M58A 1YJ9T 5GAOr 4C5GA 2VV5A 2K3XA 5GMKl 1K8AU 1VQ8T 1VQ6T 2DK3A 2LRQA 1YI2A 4RCBA 1I5LA 2DTOA 1K8AC 3CC2T 3E1SA 5J39A 3OSVA 3CMET 4E7KA 2E41A 4EMHA 2HNIA 2P0KA 3RKWA 4X34A 3CCRA 1M1FA 3M4GA 3L2RA 1UB4A 5CVIA 3CCVT 3MP8A 3FB9A 4NL2A 5KCOA 2EWNA 2XIDA 3SB2A 3MP1A 4J5YA 5CKHA 5M9OA 5KCHA 5LJ3g 4XTZA 3OYYA 4Y28E 3VJPA 4J83A 1JJ2S 3OS5A 2FVUA 1VQ9A 4MZMA 4BD3A 5GMKh 5HKCA 4QQ6A 4C8QF 5GAOq 2RB6A 2A7YA 4M77G 2EKOA 4HCZA 5HK0A 3OYKA 3FDRA 1FX7A 2NLUA 3OW2A 3VUBA 2F5TX 3UDCA 4C5IA 1BI0A 5GMKe 3JCMP 3L2ZA 1VQ8A 1VUBA 1VQ6A 1XQHA 2EQJA 3QZ5B 3AHUA 2K4YA 5CQXA 3HRUA 2JTMA 1K9MU 1NPRA 4N4IA 3CC4T 3HHTB 4C5HA 1U1TA 4RG8A 3CC2A 3O8VA 3RMSA 3CMEA 3N5BB 3GNGA 5GAMd 4M7DG 2VXFA 1H641 5KH6A 1WJSA 1M90C 3QPHA 2LT1A 4BUGA 5LJ5g 3CCVA 3OYFA 1VIFA 3OYNA 4JRQA 4OB3B 3C12A 4QVDA 3DB3A 1SSFA 3JCMW 4DA4A 5KE2A 3PTAA 3X20B 5LJ5j 4C8QE 3X25B 2EJGA 3NTKA 4FT4A 3J7AF 1VIEA 3OYDA 2XD0A 2HQEA 5J26A 3LGFA 4BE2A 4LD6A 1ZQ1A 5GAN5 2XICA 3FC3A 3S3OA 1HK9A 3CCLT 1KD1C 1U1SA 4M77B 4M7DD 1OZ2A 2QEXT 2KDSA 4M77C 4JLIA 2Y4XA 3S3NA 3OA6A 1B34B 4FU6A 4M77A 4DOWA 4CRIA 3QKJA 4XTYA 3QYGB 3R6OA 3A8LB 1B34A 2L89A 3CC4A 3QIIA 4N0AC 3JB9I 1VQOT 1YBYA 4FIBA 4M7DB 4F7UG 4N0AA 3RESA 3TREA 2RI2A 4M7DC 3PMTA 1OZ3A 4A4FA 2IVWA 2AHJB 1FXXA 3L1AA 3WVDB 1QVPA 3M55A 5CKDA 1FWZA 4M7DA 3J80E 2K2VA 4FM4B 4KUDK 1M5Q1 2RHIA 3FJPA 5GANj 1VQLT 4PJOF 3OS2A 1YHQA 2JUFA 4C0DB 4J6XA 4OVAA 2DO3A 3OYBA 2VYTA 1OYXA 4C0DC 3JB9J 1QVGA 5CIUA 3OBYA 3L2QA 3CCLA 3OYHA 4ZTJA 2LQKA 4OGCA 5J3BA 4E47A 3QUIA 4MDXA 1MGQA 3JCMh 2VC8A 2EQUA 3VUZA 3WXMB 2K5FA 2VXEA 2XU8A 1LJOA 2EAYA 3RUXA 1Q82U 2K3YA 3JSCA 3HRTA 3VV0A 1KQSS 3V8LA 4M75G 1YIJT 3X26B 5HK3A 1Q82C 5GAOl 3JCMd 2KK4A 5CKFA 1ZBXA 3G4ST 1VQOA 2DD4A 4PLIA 2DXTA 3G6ET 1I8FA 1KHCA 2EYQA 5DM7R 4F7UB 3OYEA 4FT2A 2PUKB 1N9SA 3GIBA 3MCAB 4Y91A 2O4XB 5C6SA 3HFNA 3CCQT 4PJOE 4F7UA 4BY6B 1GXIE 5I2MA 1YCYA 2LCCA 3PGGA 4BY6C 4M75D 1VQLA 2O4XA 3JB9H 2I2LA 2DVEA 1VQPT 5A0LA 3META 4J8OA 2LQ8A 2XG8D 2KAFA 3CCJA 2DTIA 1LNXA 3OW2S 1UGQB 4HKEA 5KE3A 4E7LA 4KUIA 2YHTA 3FEOA 2E1HA 4RCCA 1G3TA 3G7ZA 2BIVA 3X24B 3FIFA 2RK1A 1Q81U 2MAMA 4XU0A 2PVDB 1O75A 3C95A 3I55T 2LT4A 2K57A 4OMFB 3CPWA 2LC4A 1XOVA 2QI2A 4M75B 4M78G 3OS0A 4QQDA 3M9QA 1YIJA 5CKEA 2DXUA 1QVFS 3L2UA 2LCLA 4BI3A 2YLBA 2DXBA 3EFRA 2CKKA 3G4SA 4M75A 3G6EA 1BI1A 2CZ1B 5GMKj 3GF5A 3H8ZA 4PNOA 1HXDA 1UGRB 1BYMA 3QBYA 3FRNA 1ZHIA 1I81A 3CCUA 4FL6A 3ASKA 4M78D 3M54A 1VQPA 4B9WA 5GANf 1VQ7A 4XTXA 1BIAA 2B8AA 3SFMA 5GAN2 2KQWA 3LWHA 2M16A 2HQXA 2KVQG 5I2SA 2EFIA 1QW1A 3EFSA 3X28B 2L3RA 4OB1B 2GFUA 4RMOA 2QQ9A 3PMIA 1BI2A 2M9UA 4M78B 2QQAA 3CCMA 1KQ2A 2D6FA 3KBGA 2V8JA 3PIPA 4M78C 3MHXA 3M4YA 3CBMA 3NTIA 4M77F 4P5NA 5CKBA 3S3MA 1YJ9A 2DEQA 4M78A 3UWNA 5A0DA 4CI0C 5GAMh 2HD0A 5GAN4 1XNIA 1V29B 5FU7C 4V2SA 4KT0E 2OTJT 1VQ4T 4LDXA 1YJNT 2VGNA 2H3JA 4KBMB 3CXCA 1K73U 5GAMe 2Y90A 4M77D 5D6XA 3ER0A 4Z02A 4C92G 3CCST 1W2BA 4HA8A 1QVGS 2QQSA 2MI6A 3OB9A 4LDWA 5FROA 1X01A 2K5LA 4D6WA 4M7DF 3GLXA 1RI0A 4GY5A 2JZ2A 4QQGA 3OYLA 4MMLA 3RKXA 1WJQA 4IUPA 3RMQA 1VQKT 2P0QA 3BDLA 5FRNA 3RIRA 1KHIA 2OAUA 5FLXE 3ME9A 4ELZC 2FHDA 3DB4A 3NFCA 4RKUE 4X9CA 4A4EA 2RD1A 5CO7A 4XU1A 2RI3A 2CS7A 4C92D 5IAYA 2BKDN 4HT9A 2D0QB 4L5GA 4N4HA 1KC8U 1Q86U 5CAIA 4JS4A 4JRIA 1M9SA 4BE0A 4JJNK 4VUBA 2RA2A 5DLOA 3JCMV 2OTJA 2DTHA 5LL6S 5LJ3h 1VQ4A 4JLGA 2RJEA 1YJNA 2DKGA 3BFMA 3C4SA 4M7DE 4C92B 4J7IA 2VUBA 4C8QB 5GANg 2X4XA 4LDYA 4MDWA 4C92C 2XI9A 1NE8A 3M57A 4MZPA 2LVMA 3QJYA 4J6WA 4A53A 4C8QC 5LJ3d 3QHSA 5LJ3e 4EMKB 5GAMf 3KXTA 4C92A 2WSFE 3LWIA 3G71T 3BY7A 2KSSA 4C8QA 4EMKC 3C94A 1N8RC 3HKSA 4ZGJB 1VQKA 1MHNA 2EQKA 3E9GA 2VGMA 4EMKA 2ZPEB 2MF2A 4NS5A 4M7AG 1JJ2A 2KMTA 3CPWS 5IT9E 1WJRA 2RH2A 1YJWT 1NJIU 1BKBA 2QEXA 1BIBA 2DJZA 1VQNT 5GAN7 2RHYA 2R58A 3A8MB 3A8OB 4DQ2A 1NJIC 5LJ5h 3PNWC 2QDYB 3QO3A 2DZ9A 2EQMA 3L2WA 4FSXA 3VU3C 2HAXA 4IUVA 2DXCA 1AHJB 1PSFA 2LTOA 2F69A 3JCMe 2RI5A 3Q1JA 4JUVA 4M75F 4TVRA 2XK0A 2GF7A 3VYHB 3SDZA 5LJ5d 1VQ5T 3CMAT 1Y71A 4YTLA 3JAME 3JCMQ 4BI4A 4EPCA 2QA4T 3BW1A 2K5IA 3V7SA 3V7RA 3CBOA 1D3BB 3MEVA 3JCMc 2O01E 3PFSA 3JB9G 5I21A 1XTDA 3DLMA 1UGPB 2KY9A 2XKOC 2EJ9A 2PVOB 3INZA 5A0GA 3I56T 1D3BA 1G3WA 4JRPA 4O6JA 4M7AB 2G3RA 3BDUA 1WGSA 1IREB 2CYZB 3HFOA 1YJWA 4M7AC 2HBPA 3VKIA 3MO8A 4IKFA 1VQNA 3GOXA 4M7AA 5GAOp 3MP6A 2ZPGB 3JB9D 2JVVA 3OYCA 5CK9A 4M75E 4A4HA 1Q81C 1P92A 3L42A 4BDZA 3H6ZA 3OBWA 5A2QE 3CXCS 3TEEA 1YITT 4M78F 3T9NA 3CMAA 3SD4A 1DJ7B 1W2BS 1UGSB 3DLLA 2PQWA 4ZN1A 3OYJA 4JRKA 3MEWA 4OB2B 2DPPB 3JCMf 2QA4A 4LD9K 1M4ZA 2RM4A 3OMCA 3CCQA 5GAN6 1Q7YU 3JRZA 2CZ0B 4IUUA 3SWNB 5FRMA 2LDMA 2L8DA 2QQBA 2ZPIB 2ZPHB 3P8HA 2R57A 1UEBA 3SWNC 3TCJA 5GAMj 1VQ9T 1Q7YC 4R55A 3VYGA 2WACA 3E9FA 3UT1A 3SWNA 2RHZA 4PKCC 5D6YA 5CR2A 2OTLT 4LDVA 3GP8A 2PUOB 3QJ6A 3I55A 3QSUA 3LLRA 2R5MA 4MMKA 4N4GA 1KQSA 5IN1A 3M5AA 3LX7A 3OQ5A 4M78E 1VQMT 2RHUA 1YITA 1I4K1 4L59A 2P0PA 1X75C 4OP0A 5FU7B 2F5KA 5FU6B 3TU4K 1N9RA 3QXEB 1U8RA 4QW2A 5FU6C 5GMKm 1WQWA 3CPFA 1M1GA 2V8IA 2CZ7B 1TH7A 3M53A 1NZ9A 2X4WA 4ELYC 3OMGA 4ZN3A 1S72T 4GLKA 3F70A 2IG0A 4C8QG 3KUFA 1M1KU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4S A;  2RO0 A;  2BUD A;  2R5A A;  3OY9 A;  2DIQ A;  2X4X A;  4PLI A;  2X35 A;  4Q5W A;  4A4G A;  4ZTF A;  1KHC A;  2LVM A;  3OYM A;  3OYE A;  4C5G A;  2K3X A;  2O4X B;  5C6S A;  4UC4 A;  2LRQ A;  1MHN A;  2EQK A;  4E7J A;  3E9G A;  3OS1 A;  2XDP A;  2LCC A;  1G5V A;  4NS5 A;  2O4X A;  1WJR A;  5J39 A;  4E7K A;  2P0K A;  3MET A;  4X34 A;  3L2R A;  2RHY A;  2R58 A;  3MP8 A;  5KCO A;  3EAE A;  5KE3 A;  3PNW C;  3OYA A;  4E7L A;  3FEO A;  3MP1 A;  2BIV A;  5M9O A;  2EQM A;  5KCH A;  2YRV A;  3L2W A;  2E5Q A;  4IUV A;  4BAC A;  2LTO A;  4BD3 A;  2RI5 A;  3Q1J A;  4BE1 A;  4QQ6 A;  3OS0 A;  2XK0 A;  2GF7 A;  3M9Q A;  4QQD A;  4E7I A;  2EKO A;  4HCZ A;  3L2U A;  4BDY A;  3OYK A;  3FDR A;  2CKK A;  2NLU A;  2JTF A;  2MWP A;  4C5I A;  3MEV A;  4B9X A;  2GFA A;  3H8Z A;  3PFS A;  5D6W A;  2EQJ A;  4II1 A;  3DLM A;  3QBY A;  2RJF A;  4N4I A;  3NTH A;  4FL6 A;  3ASK A;  4C5H A;  2G3R A;  3O8V A;  1WGS A;  4B9W A;  5KH6 A;  2B8A A;  1WJS A;  3MO8 A;  4IKF A;  1H3Z A;  3GOX A;  4C5E A;  2M16 A;  3LH0 A;  3OYF A;  3CEY A;  3LGL A;  3S6W A;  3MP6 A;  5C0M A;  2HQX A;  3OYN A;  2EFI A;  3DB3 A;  1SSF A;  2RJC A;  2L3R A;  2GFU A;  5KE2 A;  3OYC A;  4QVZ A;  4A4H A;  3PMI A;  1OI1 A;  3NTK A;  3L42 A;  4BDZ A;  3OYD A;  3H6Z A;  2HQE A;  5J26 A;  3LGF A;  4BE2 A;  4LD6 A;  3FC3 A;  3S3O A;  3SD4 A;  2X4Y A;  1OZ2 A;  2PQW A;  3NTI A;  3OYJ A;  2DIG A;  3MEW A;  3S3M A;  3UWN A;  3P8D A;  4PL6 A;  4PLL A;  3S3N A;  3OA6 A;  3OMC A;  4FU6 A;  1XNI A;  4CRI A;  3QKJ A;  4IUU A;  3ZEH A;  5FRM A;  2L89 A;  2LDM A;  2L8D A;  2QQR A;  2MWO A;  3FLG A;  2D9T A;  2R57 A;  3P8H A;  5D6X A;  4Z02 A;  3QII A;  3OYI A;  2QQS A;  3OB9 A;  2WAC A;  5FRO A;  3E9F A;  3UT1 A;  2RHZ A;  5D6Y A;  3L2V A;  1RI0 A;  2RI2 A;  2RJD A;  3PMT A;  4GY5 A;  1OZ3 A;  4A4F A;  2JZ2 A;  4QQG A;  3OYL A;  1WJQ A;  3QJ6 A;  4IUP A;  4IUR A;  3BDL A;  5FRN A;  2RHI A;  3LLR A;  2R5M A;  2FHD A;  3ME9 A;  4N4G A;  3DB4 A;  2DAQ A;  3LYI A;  5IN1 A;  3LX7 A;  2M1H A;  3OQ5 A;  4OVA A;  4A4E A;  2VYT A;  3OS2 A;  3OYB A;  1OYX A;  2RHU A;  2RI3 A;  5IAY A;  4L59 A;  5CIU A;  2BKD N;  2M0O A;  4E7H A;  3L2Q A;  4N4H A;  3OYH A;  4ZTJ A;  4IUQ A;  4RG2 A;  2F5K A;  1N27 A;  4BE0 A;  4EDU A;  4QW2 A;  2EQU A;  2RHX A;  4IUT A;  2K3Y A;  2X4W A;  3OYG A;  3OMG A;  2RJE A;  3F70 A;  2IG0 A;  3MEA A;  3KUF A;  3MEU A;  2E6N A; 
#chains in the Genus database with same CATH topology
 3DKM A;  2RO0 A;  4AFZ C;  4XQ3 A;  2DIQ A;  9ATC B;  4GBQ A;  2QEX Q;  1BBZ A;  5GAN 3;  2OTL A;  2NUT A;  3A8G B;  4PFZ A;  1N6A A;  1N8R R;  2XDP A;  4M77 E;  1QP3 A;  1BU1 A;  1AD5 A;  1NPP A;  3OYA A;  5HY6 A;  3CBP A;  3GPL A;  1WHL A;  4BAC A;  5KYW A;  2YUN A;  2EYY A;  1IB8 A;  5CQY A;  2X4J A;  4QVC A;  5D6W A;  1NEB A;  4B6M A;  1U5S A;  2K6D A;  3O5Z A;  3RKY A;  4BI8 B;  3NTH A;  4ZGD B;  1BI3 A;  1H3Z A;  3CC7 T;  2EJF A;  4ATO A;  3LH0 A;  3S6W A;  2XDD A;  4O5V A;  2PVG B;  2RQR A;  2XDB A;  1M3A A;  4QVZ A;  3CD6 T;  3LH5 A;  3HSB A;  2EYW A;  4LDU A;  1TG0 A;  2PU9 B;  1WXU A;  2DIG A;  2RF0 A;  1WA7 A;  2ZPB B;  2CGH A;  3G71 A;  3CCJ T;  2V1R A;  1NLO C;  1AEY A;  2QQR A;  1EIF A;  1MMN A;  2MWO A;  2D9T A;  1Q7Y R;  1JXO A;  2FYK A;  2LX9 A;  3L2V A;  3CC7 A;  2RJD A;  1T3S A;  1ZA1 B;  3EFO A;  1UTI A;  4XTV A;  3A8H B;  3QYH B;  4WCI A;  4XAX B;  2EGA A;  2ZZD A;  1YI2 T;  4PJO B;  3CD6 A;  2FL7 A;  4NL3 A;  1RAG B;  3CCR T;  4HCC A;  2ECZ A;  5GAM g;  5LJ5 f;  1N27 A;  2GCX A;  2ZPF B;  3HP9 A;  3VS6 A;  2WSE E;  5L23 A;  4R0K A;  4OMQ A;  1E6G A;  3GBQ A;  3NGP A;  4ZGE B;  4DOV A;  1X6O A;  2E6N A;  2X3X D;  3WVE B;  4FCY A;  2R5A A;  4M75 C;  3M58 A;  2VV5 A;  5GMK l;  2LRQ A;  1YI2 A;  2CP7 A;  4OMO A;  5J39 A;  3OSV A;  1AVZ C;  2E41 A;  4EMH A;  2J7I A;  3CCR A;  1M90 R;  4J5Y A;  5CKH A;  4J83 A;  1JJ2 S;  3OS5 A;  5IH2 A;  5HKC A;  1I5O B;  2HKQ B;  3VS3 A;  1HYO A;  4HVU A;  1PKT A;  4OMP A;  2D8J A;  1K0X A;  2FO0 A;  3JCM P;  3L2Z A;  1BCM A;  1XQH A;  2K4Y A;  4N4I A;  3CC4 T;  4C5H A;  2KE9 A;  3O8V A;  4M7D G;  5KH6 A;  2F1L A;  2LT1 A;  4RTY A;  5LJ5 g;  3UA7 A;  3G71 Q;  3JCM W;  3X25 B;  2EJG A;  4FT4 A;  2HQE A;  1YJW Q;  1ZQ1 A;  5GAN 5;  2XIC A;  3CCL T;  1U1S A;  4M77 B;  1OZ2 A;  1VQN Q;  1ZSZ B;  1SG5 A;  2Y4X A;  2ZAE A;  2FRY A;  5KYU B;  2HQH A;  2QAZ A;  2C0O A;  3CC4 A;  3QII A;  6AT1 B;  1YBY A;  4FIB A;  1WX6 A;  4N0A A;  3RES A;  3TRE A;  1UUE A;  4M7D C;  3PMT A;  1OZ3 A;  2AHJ B;  2J6O A;  1QVP A;  1S1N A;  3J80 E;  1C6V X;  1NEG A;  3RNJ A;  4OVA A;  2VYT A;  1OYX A;  3CCL A;  2LQK A;  5J3B A;  2QTV A;  2VC8 A;  2EQU A;  2K5F A;  1RAE B;  2XU8 A;  1Q82 U;  3JSC A;  3HRT A;  1UDL A;  2CSI A;  1UEC A;  2V1Q A;  5CKF A;  3I5S A;  3G4S T;  4PLI A;  2EYQ A;  3OYE A;  2PUK B;  1N9S A;  3MCA B;  2O4X B;  5C6S A;  4F7U A;  1GRI A;  1YCY A;  4BY6 C;  2I2L A;  2DVE A;  1MMG A;  1VQP T;  4KH0 B;  4J8O A;  2LQ8 A;  2KAF A;  2DTI A;  3OW2 S;  4HKE A;  5KE3 A;  2YHT A;  2K3B A;  4XU0 A;  4M75 B;  2W10 A;  1PWT A;  3M9Q A;  5CKE A;  3EFR A;  3G4S A;  1BI1 A;  2CZ1 B;  1PHT A;  4PNO A;  4ANJ A;  2J6K A;  3FRN A;  3CCU A;  4M78 D;  1VQP A;  4B9W A;  1VQ7 A;  1D0X A;  1W6X A;  8AT1 B;  2KVQ G;  2EFI A;  2L3R A;  4DBR A;  2GFU A;  3PMI A;  1BI2 A;  2SEM A;  3CCM A;  3KBG A;  4KGZ B;  3MHX A;  3M4Y A;  3NTI A;  2FZC B;  5A0D A;  5GAN 4;  2HD0 A;  4KT0 E;  1SRM A;  4QT7 A;  2VGN A;  2H3J A;  3CXC A;  4Z02 A;  1QVG S;  4HA8 A;  2CT4 A;  2MI6 A;  4LDW A;  5FRO A;  4D6W A;  2JZ2 A;  3RMQ A;  2P0Q A;  3RIR A;  1KHI A;  4ELZ C;  3ME9 A;  2AZS A;  4J9I A;  2RD1 A;  5EC7 A;  4XU1 A;  2IPO B;  4C92 D;  1RAD B;  2GTO A;  2L3P A;  4N4H A;  3CXC P;  4JJN K;  2RA2 A;  2GNC A;  2YUO A;  5LJ3 h;  3VS4 A;  5KYX B;  2CUB A;  4J7I A;  2M02 A;  2XI9 A;  1NE8 A;  1N8R U;  5LJ3 e;  5LJ3 d;  2JMA A;  4EMK B;  2WSF E;  3HKS A;  4QKU A;  1V1C A;  4PJJ A;  3UF4 A;  1JJ2 A;  3CPW S;  2RQW A;  1WJR A;  1BKB A;  3EHR A;  4DQ2 A;  3PNW C;  2QDY B;  1PCX A;  3QO3 A;  4FSX A;  1WHG A;  1PSF A;  2LTO A;  3CMA T;  3CCU Q;  1VQ5 T;  2GF7 A;  3JAM E;  3CQT A;  2VKN A;  2MYS A;  1VQ7 Q;  2QA4 T;  3JV3 A;  3BW1 A;  3V7S A;  2RQV A;  5I21 A;  1UGP B;  1D3B A;  1G3W A;  4M7A B;  3D7S B;  3CCM Q;  4IKF A;  3TSZ A;  2BE7 D;  1VYT A;  3JB9 D;  5IXB A;  4K11 A;  4A4H A;  3H6Z A;  5A2Q E;  2PNI A;  4M78 F;  3CMA A;  1G2B A;  2J6F A;  3EH1 A;  3SD4 A;  3DLL A;  1W2B S;  3EG9 B;  5FWB A;  2QA4 A;  1QCN A;  4LD9 K;  3UA6 A;  1MMD A;  2COY A;  1Q7Y U;  1Y57 A;  4F14 A;  4IUU A;  5FRM A;  2QQB A;  2ZPH B;  2ZPI B;  5GAM j;  3P8H A;  3SWN C;  4R55 A;  3ULR B;  2RHZ A;  5D6Y A;  2YWW A;  5CR2 A;  3GP8 A;  2LNH B;  4KGX B;  2X9H A;  4PJN A;  4M78 E;  4L59 A;  4FYY B;  1QKX A;  2DFU A;  4E7Z A;  2F5K A;  2KXD A;  1M1G A;  1EZZ B;  3A1P A;  1KC8 R;  1Q86 R;  3H9N A;  4J9B A;  4ZN3 A;  5KYN A;  4C8Q G;  2IG0 A;  3KUF A;  4LUE A;  4C92 F;  2NUT B;  1I07 A;  2FRW A;  1M1K C;  4JDS A;  2GQI A;  2FB7 A;  1TUG B;  4X9D A;  1IZ6 A;  3EH2 A;  3OS1 A;  3E19 A;  3OSS C;  2YLC A;  3EGX A;  1M90 U;  4J9C A;  3EAE A;  2DYB A;  2KYM A;  5IHN A;  5KYW B;  2RK2 A;  2XHC A;  4JS5 A;  3I35 A;  2E64 A;  1K9A A;  1VQL Q;  1Y0M A;  4WF2 A;  4C92 E;  1LPL A;  1ZLM A;  4E7I A;  4F7U F;  1JU5 C;  4A4K A;  3QWY A;  4B9X A;  1O9S A;  4KUL A;  1B3Q A;  2FEI A;  1JRI A;  4XU2 A;  5IHK A;  1PD0 A;  2YRD A;  1YIJ Q;  1B07 A;  4C5E A;  1WPY A;  2QK0 A;  3QG1 A;  4NOY A;  3LGL A;  4C0F A;  2L5Q A;  2HSE B;  4PJO G;  4DBF A;  1OI1 A;  5LJ5 e;  3ZBD A;  2DD5 A;  4F7U E;  2G6F X;  3UPU A;  1W4S A;  5D7U A;  2YRC A;  2KEA A;  4PL6 A;  2NYS A;  2JNG A;  2HDA A;  1RL2 A;  5GAO n;  3VS7 A;  3GNF B;  3JB9 F;  5LJ3 f;  1M2O A;  3P8B B;  1BK2 A;  2DE0 X;  2EGE A;  3OYI A;  3EFO B;  1TOV A;  5GAN h;  2CP2 A;  3M56 A;  2QGG A;  4IUR A;  3JCM X;  4OB0 B;  5GAN e;  1ZUK A;  5I11 A;  5GAN d;  4BDY A;  2M1H A;  2YUP A;  4PJO C;  1ARK A;  1KG1 A;  1WHH A;  2L3S A;  4F04 B;  2QYZ A;  1YNZ A;  1RLP C;  3H0I A;  1TS9 A;  2LJ1 A;  3J81 E;  2RHX A;  2A3L A;  2HEQ A;  2QGF B;  5DY9 A;  1HJD A;  1X2K A;  5AT1 B;  2FPE A;  7AT1 B;  4J7F A;  3MEU A;  2HKN A;  1Y96 A;  2DM1 A;  4ZTF A;  3VS0 A;  2E5K A;  4C5G A;  1M1K R;  2K3X A;  1VQ8 T;  1VQ6 T;  1OU9 A;  2DK3 A;  2OTJ Q;  1VQ4 Q;  2F2W A;  1YJN Q;  3E1S A;  3CME T;  4E7K A;  2P0K A;  4X34 A;  1M1F A;  3L2R A;  2LCS A;  1UB4 A;  2EWN A;  1QWF A;  3MP1 A;  5M9O A;  5LJ3 g;  1NYF A;  3OYY A;  3VS1 A;  1VQ9 A;  2LX7 A;  4BD3 A;  5GMK h;  1X43 A;  4M77 G;  3OYK A;  3FDR A;  1H3H A;  1KD1 R;  5GMK e;  1VQ8 A;  2CT3 A;  1VQ6 A;  5CQX A;  4JPB W;  1U1T A;  4Z88 A;  2EGC A;  5FWC A;  3CME A;  3N5B B;  1M90 C;  1SEM A;  3OYN A;  3OYF A;  2DX1 A;  4JRQ A;  2O88 A;  1GCQ A;  1SSF A;  3DB3 A;  1OQK A;  5KE2 A;  1X27 A;  1VIE A;  4BE2 A;  4LD6 A;  1HK9 A;  4M7D D;  2COZ A;  2KRS A;  2KDS A;  4M77 C;  1KIK A;  4PK4 A;  3S3N A;  3OA6 A;  1ZSZ C;  2DL4 A;  3QYG B;  3H41 A;  2VWF A;  1VQO T;  2RI2 A;  2IVW A;  3WVD B;  1T3L A;  2A28 A;  2K2V A;  4FM4 B;  3RR6 A;  3FJP A;  2X3W D;  1UFF A;  3OS2 A;  2HL5 C;  2AKL A;  3OYB A;  3BE3 A;  4FSS A;  4MDX A;  3M0S A;  5I22 A;  2E4H A;  3JCM h;  3VUZ A;  1GFD A;  1LJO A;  2K3Y A;  3VV0 A;  1KQS S;  4M75 G;  3RBB B;  1YIT Q;  3JCM d;  4J9G A;  2KK4 A;  1VQO A;  2DD4 A;  3G6E T;  4F7U B;  2F2X A;  4FT2 A;  1OPL A;  2KRM A;  3HFN A;  3CCQ T;  1R77 A;  1CKB A;  5I2M A;  3EG2 A;  1VQ9 Q;  3MET A;  3CCJ A;  3R6N A;  1LNX A;  1UGQ B;  4E7L A;  2OTL Q;  2E1H A;  3X24 B;  2RK1 A;  1X6G A;  3I55 T;  3C95 A;  1VQ6 Q;  2LC4 A;  2QI2 A;  1TUC A;  2ED0 A;  4DEX A;  3OS0 A;  3L2U A;  4BI3 A;  2YLB A;  1TTH B;  3G6E A;  3GF5 A;  1IGU A;  1HXD A;  1BYM A;  3QBY A;  4CC4 B;  1AWX A;  2KRO A;  1FMK A;  5GAN f;  1IXD A;  2GBQ A;  3SFM A;  4HXJ A;  2M0Y A;  2HQX A;  2EKH A;  3EFS A;  4RMO A;  2D6F A;  1RAC B;  2JW4 A;  3CBM A;  2HMA A;  4M78 A;  4V2S A;  2ABL A;  1Z9Q A;  4LDX A;  1YFN A;  5D6X A;  3CCS T;  2MPX C;  1QVF S;  2QQS A;  2K5L A;  5IHI A;  4M7D F;  2CSQ A;  4GY5 A;  1VQK T;  1PM3 A;  3BDL A;  1D0Z A;  2FHD A;  1NYG A;  3NFC A;  4X9C A;  5IAY A;  4HT9 A;  2JM8 A;  2Z0W A;  2H3E B;  1KC8 U;  2KI7 A;  2ATC B;  1Q86 U;  4JS4 A;  3CC7 Q;  2OX7 A;  4JRI A;  4AT1 B;  4VUB A;  4JZ4 A;  3JCM V;  3CD6 Q;  4JLG A;  2RJE A;  2KT1 A;  4M7D E;  2VUB A;  5GAN g;  1CSK A;  3M57 A;  4A53 A;  1G83 A;  4C92 A;  3CCJ Q;  4C8Q A;  4WTO B;  4EMK C;  2IIM A;  2KNB B;  4ZGJ B;  1VQK A;  3E9G A;  3TQ7 P;  2YT6 A;  4NS5 A;  4M7A G;  1PD1 A;  2EQI A;  1SHG A;  3A8O B;  1NJI C;  2DZ9 A;  3L2W A;  3SHW A;  1YI2 Q;  2QAS A;  1WFW A;  3Q1J A;  4JUV A;  4DBH A;  3SDZ A;  1Y71 A;  3CCR Q;  3JCM Q;  1ZA2 B;  3E2U A;  3CBO A;  1D3B B;  1OV3 A;  3MEV A;  3JCM c;  3PFS A;  1RAI B;  1ABQ A;  4JJD A;  4E2F B;  3INZ A;  3I56 T;  2EJ9 A;  4ZNX A;  4JRP A;  2G3R A;  4M7A C;  4HVV A;  3VKI A;  3MO8 A;  3GOX A;  2MIO A;  1AWW A;  1PKS A;  1C1A A;  3OYC A;  3TEE A;  4J9H A;  1DJ7 B;  4OB2 B;  3JCM f;  3OMC A;  5GAN 6;  1RAH B;  4F17 A;  2NWM A;  3JRZ A;  2CZ0 B;  3H0H A;  3TCJ A;  2R57 A;  2HSP A;  3I5R A;  3E9F A;  3UT1 A;  5KYY A;  4OML A;  4PKC C;  3KFV A;  4LDV A;  4FW1 A;  2PUO B;  2A37 A;  2KBT A;  4PJL A;  4N4G A;  1M3B A;  4RTZ A;  1KQS A;  5IN1 A;  1VQM T;  3CC4 Q;  2LZ6 B;  3MJX A;  2DER A;  5FU6 B;  2JMC A;  1U8R A;  4CC7 A;  1TU0 B;  3M53 A;  4ELY C;  1S72 T;  1M1K U;  2OAW A;  1KQS P;  3CCL Q;  2AZV A;  3QDR B;  4PFP A;  1MMA A;  5LJ3 j;  2JT4 A;  3EGX B;  2MMP A;  4UC4 A;  4E7J A;  2E65 A;  1QLY A;  2WSC E;  3V8J A;  4C8Q D;  1VQM A;  1WQ7 A;  4EMG A;  4Y92 A;  2QG9 B;  3JCM g;  1KC8 C;  4D8K A;  1Q86 C;  2LJ3 A;  1NJI R;  1NG2 A;  3SEM A;  1WLP B;  1A0N B;  2YRV A;  2QXF A;  2KYB A;  1PSE A;  2E10 A;  2RPN A;  3LW5 E;  1UJY A;  5GAN 8;  1S72 A;  3NPF A;  1KD1 U;  1UHC A;  1Z9Z A;  1YHQ T;  4BE1 A;  2PTK A;  2J06 A;  3URG A;  3CCE T;  1WZO A;  2JTF A;  2MWP A;  2CUD A;  2GFA A;  3QZ9 B;  3HRS A;  2ESW A;  1OPK A;  2JXB A;  2RJF A;  2CDT A;  5HCK A;  4C0G A;  3G4S Q;  1SHF A;  4BB7 A;  2E3H A;  1JBM A;  5L8R E;  1SRL A;  1IHV A;  2JN0 A;  3REB B;  1VQP Q;  2V8K A;  4XU3 A;  3JCM J;  1K1Z A;  1JJ2 P;  1QVF A;  3CCE A;  4HCB A;  2LQN A;  4PLL A;  4PJO D;  2KT8 A;  3ZEH A;  2DJQ A;  2CP5 A;  1T0J A;  4C0Z A;  4HT8 A;  3PT9 A;  1EFN A;  3JCM b;  1QVF P;  1R0B G;  2KGT A;  3M59 A;  1RAB B;  3LYI A;  1VQ5 A;  1JB0 E;  4E7S A;  4E7H A;  3A5Z B;  2FZK B;  1X6B A;  4IUQ A;  4RG2 A;  4KGV B;  4L6V 5;  1OEB A;  2EIF A;  4Z8A A;  4EDU A;  2J05 A;  2CP3 A;  2C06 A;  1Y96 B;  1R0C B;  2DZC A;  1JQQ A;  2DIL A;  3OY9 A;  2CP6 A;  4A4G A;  3OYM A;  1QCO A;  1YJ9 T;  1M2V A;  1IHW A;  1OX8 A;  1K8A C;  3CC2 T;  1M8M A;  3M4G A;  3CCV T;  2XID A;  3UAT A;  4FW2 A;  1GFC A;  5KCH A;  4XTZ A;  2D1X A;  2GGR A;  4MZM A;  2LP5 A;  4C8Q F;  5GAO q;  2A7Y A;  2EKO A;  2FG0 A;  4RTU A;  3OW2 A;  2NLU A;  4FYV B;  1UHF A;  2O31 A;  1VUB A;  2EQJ A;  3QZ5 B;  4E6R A;  3ZL7 C;  1ZX6 A;  3HHT B;  1YWP A;  4RG8 A;  3CC2 A;  3RMS A;  1D1A A;  3GNG A;  2HL3 A;  5GAM d;  3M0P A;  1H64 1;  1NLP C;  4CC3 A;  1Q95 G;  3CCV A;  4DBQ A;  4OB3 B;  3C12 A;  4QVD A;  4AFS C;  3OW2 P;  2DA9 A;  3PTA A;  3X20 B;  5LJ5 j;  4C8Q E;  1MV0 B;  3QDF A;  3OYD A;  2GTJ A;  3LGF A;  3S3O A;  3FC3 A;  1KD1 C;  1TXQ A;  2DRK A;  2QEX T;  2RMO A;  4JLI A;  4FU6 A;  4DOW A;  1K0S A;  1XJW B;  4XTY A;  3R6O A;  1B34 A;  2L89 A;  1YP5 A;  3CMA Q;  2P84 A;  4N0A C;  3JB9 I;  1VQ5 Q;  2M51 A;  1F1B B;  4F7U G;  2QA4 Q;  4A4F A;  1FWZ A;  4M7D A;  4JJB A;  4KUD K;  2EPD A;  1M5Q 1;  5GAN j;  1U06 A;  2X51 A;  4PJO F;  4C0D B;  2A0F B;  4D8D A;  3JB9 J;  1QVG A;  3OBY A;  1E6H A;  4OGC A;  3QUI A;  2AT1 B;  1MGQ A;  4AFU C;  2VXE A;  4LUD A;  3V8L A;  2JM9 A;  3X26 B;  4JJC A;  1ZBX A;  1J3T A;  2DXT A;  1I8F A;  5DM7 R;  1QVG P;  3GIB A;  4PJO E;  1GXI E;  1WDX A;  3PGG A;  3JB9 H;  4M75 D;  1ABO A;  1K8A R;  5A0L A;  4EIK A;  1SPK A;  3TVT A;  2DBK A;  4RCC A;  1G3T A;  3FIF A;  1Q81 U;  2MAM A;  2PVD B;  2LT4 A;  2B86 A;  3CPW A;  4QQD A;  1PNJ A;  3CC2 Q;  2DXB A;  1WIE A;  2KR3 A;  5GMK j;  1MUZ A;  1N5Z A;  2O2O A;  1W1F A;  1UGR B;  1ZSG A;  1ZHI A;  2PZ1 A;  3ASK A;  2B8A A;  2CRE A;  3CPW P;  2CP0 A;  5GAN 2;  1K9M R;  4KH1 B;  5I2S A;  1QW1 A;  4AMC A;  4OB1 B;  1NBE B;  2QQ9 A;  1C0M A;  4M78 B;  1KQ2 A;  2V8J A;  3PIP A;  4OMN A;  4M77 F;  1VOM A;  3S3M A;  1XNI A;  1V29 B;  3EGD A;  1K73 U;  1W2B A;  3OB9 A;  1AWO A;  3RKX A;  1WJQ A;  1WHJ A;  2OAU A;  3DB4 A;  3RDV A;  1KK7 A;  1OOT A;  5CO7 A;  2RI3 A;  1YN8 A;  4L5G A;  2W0Z A;  8ATC B;  2BE9 B;  1M9S A;  5ECA A;  1W2B P;  1GCP A;  2DTH A;  5LL6 S;  3BFM A;  4IIO A;  4C92 B;  4C8Q B;  2X4X A;  2QDL A;  4HVW A;  4MDW A;  4LDY A;  1QCF A;  2LVM A;  3QJY A;  4J6W A;  3QHS A;  3U23 A;  5GAM f;  2SRC A;  3G71 T;  3BY7 A;  2NUP A;  2EQK A;  2KMT A;  1SSH A;  1YJW T;  2XMF A;  1NJI U;  1VQN T;  1UJ0 A;  2RHY A;  3A8M B;  1RAA B;  2DL8 A;  2FPF A;  2EQM A;  2C0I A;  3VU3 C;  2HAX A;  3JCM e;  4M7A D;  2RI5 A;  4M75 F;  4TVR A;  4YTL A;  3V7R A;  2O01 E;  3PVQ A;  2KY9 A;  2XKO C;  2YSQ A;  1KFZ A;  4O6J A;  1M30 A;  1YJW A;  1IRE B;  3HFO A;  2HBP A;  1VQN A;  2DL3 A;  2AK5 A;  1TWB A;  3MP6 A;  2ZPG B;  1PC0 A;  1VQ8 Q;  2EYZ A;  2BTT A;  1VYV A;  4M75 E;  1LCK A;  1Q81 C;  4BDZ A;  4GLM A;  3OBW A;  3CXC S;  3REA B;  3VRY A;  3CME Q;  1UGS B;  4ESR A;  4J9D A;  2PQW A;  4ZN1 A;  4JRK A;  3MEW A;  2DPP B;  1HSQ A;  2RM4 A;  4LN2 A;  3CCQ A;  4AG1 C;  1D09 B;  4LE9 A;  2F2V A;  4AG2 C;  5KYY B;  3SWN A;  4Z89 A;  3IQL A;  4FYX B;  1FMV A;  1VYU A;  3PVL A;  1RUW A;  3I55 A;  1KJW A;  1UGV A;  4JZ3 A;  1I4K 1;  1X75 C;  1JEG A;  3FJ5 A;  3QXE B;  5FU6 C;  2NUZ A;  1WQW A;  2D8H A;  2V8I A;  2CZ7 B;  1MND A;  1TH7 A;  1NZ9 A;  2X4W A;  5AYF A;  4J6X A;  2CZ6 B;  1K73 C;  1PRL C;  2DRM A;  2X35 A;  4Q5W A;  2Y4Y A;  4X1V A;  2HBW A;  2E3I A;  1AT1 B;  2QTX A;  3RER A;  2E70 A;  2AKK A;  2ZCF B;  1G5V A;  2GQV A;  1M8V A;  2P4T A;  2ROL A;  1VQO Q;  2JOY A;  1AZE A;  3HL8 A;  4RTT A;  1PG5 B;  5DLQ E;  1V76 A;  1M27 C;  3THK A;  1G3S A;  1GBQ A;  1R8O B;  4OGE A;  2E5Q A;  2AIR B;  3CCS A;  2FZG B;  2VB6 A;  1MNE A;  1SF9 A;  2K7A A;  3H0F A;  4II1 A;  2V26 A;  5GJV B;  1KQ1 A;  2VAS A;  1TUD A;  4M7A F;  3PIO A;  1Y07 A;  1ZUU A;  4XTU A;  3G6E Q;  5GMK i;  1IGQ A;  1QMC A;  3CEY A;  5C0M A;  1AOJ A;  1IO6 A;  3VS5 A;  2RJC A;  4XK8 E;  3CCQ Q;  2KRN A;  4ME7 A;  1QP2 A;  4A54 A;  1YWO A;  1Q81 R;  3M0R A;  2RN8 A;  4OF1 A;  2P4R A;  2X4Y A;  2ZGW A;  2A36 A;  1WNL A;  4MZT A;  4KRT A;  3P8D A;  1M3C A;  2D0N A;  2COW A;  2E12 A;  3V7C A;  2LNV A;  1FYN A;  3I55 Q;  4M7A E;  3FLG A;  3ZFJ A;  3HPW A;  2JS0 A;  2E6Z A;  2BZ8 A;  2DET A;  1GL5 A;  1HD3 A;  2DAQ A;  5CCA A;  5GAO m;  3CCU T;  1D1B A;  2M0O A;  1VA7 A;  4CC2 A;  3V8K A;  2YUQ A;  4PJO A;  1LOJ A;  4XTW A;  1VQ7 T;  4J6Y A;  3M0T A;  1NM7 A;  3A98 A;  1PRM C;  4IUT A;  1Y7X A;  1KSW A;  3I56 A;  3OYG A;  5EG2 A;  1U3O A;  1D1C A;  1G3Y A;  3MEA A;  4R56 A;  1ZBJ A;  1M2V B;  1B7T A;  2BUD A;  3CCM T;  3EG3 A;  1K73 R;  4FYW B;  5GAO r;  1K8A U;  4A63 B;  2BZY A;  4RCB A;  1I5L A;  2DTO A;  3CCS Q;  1H92 A;  2HNI A;  3RKW A;  4F16 A;  2MOX A;  5CVI A;  2RNA A;  3MP8 A;  3FB9 A;  4NL2 A;  5KCO A;  3SB2 A;  3AT1 B;  1VQK Q;  3VJP A;  4Y28 E;  2FVU A;  4QQ6 A;  2FPD A;  1E7O A;  2RB6 A;  2DL5 A;  2KXC A;  4HCZ A;  5HK0 A;  1FX7 A;  3VUB A;  2F5T X;  3UDC A;  4C5I A;  1BI0 A;  2DL7 A;  3AHU A;  2DVJ A;  3TSW A;  3G1J A;  2DYI A;  3HRU A;  2JTM A;  1K9M U;  2YDL A;  1NPR A;  4J9E A;  1WI7 A;  1JXM A;  2VXF A;  1WJS A;  3QPH A;  4BUG A;  1GCQ C;  3NMZ C;  1VIF A;  4HCK A;  1K76 A;  2MK5 A;  3HTR A;  4DA4 A;  1WYX A;  4M4Z A;  3J7A F;  3NTK A;  2XD0 A;  1X2Q A;  2ENM A;  5J26 A;  1QWE A;  2YXY A;  1AWJ A;  2BZX A;  1B34 B;  4M77 A;  4DEY A;  4CRI A;  3QKJ A;  3M0Q A;  1ZSZ A;  1BB9 A;  3A8L B;  1CKA A;  5KYU A;  4M7D B;  1I1J A;  1LVK A;  1FXX A;  3L1A A;  3EHQ A;  3M55 A;  5CKD A;  2RHI A;  1QQJ A;  2LQW A;  3I56 Q;  1H8K A;  1SKU B;  1YHQ A;  2JUF A;  1VQL T;  2DO3 A;  4C0D C;  5CIU A;  3L2Q A;  3OYH A;  4ZTJ A;  3I9Q A;  4E47 A;  1K4U S;  1AZG B;  3WXM B;  2EAY A;  3RUX A;  1UE9 A;  1YIJ T;  5HK3 A;  1Q82 C;  5GAO l;  3QWX X;  1KHC A;  2RQU A;  1RAF B;  4Y91 A;  2MCN A;  4BY6 B;  1YCS B;  2LCC A;  1VQL A;  2O4X A;  1OX9 A;  2XG8 D;  4KUI A;  3FEO A;  1GBR A;  3G7Z A;  2BIV A;  2L2P A;  1O75 A;  2K57 A;  4OMF B;  4M78 G;  1XOV A;  1VQM Q;  1YIJ A;  2DXU A;  2LCL A;  2CKK A;  4M75 A;  3H8Z A;  1W70 A;  1S72 Q;  4AFQ C;  1I81 A;  4FL6 A;  3M54 A;  4XTX A;  1BIA A;  2L3Q A;  3LWH A;  2KQW A;  2M16 A;  2JS2 A;  3X28 B;  1JO8 A;  1RI9 A;  3M0U A;  2M9U A;  3EG0 A;  2QQA A;  2LMJ A;  4M78 C;  4P5N A;  1MV3 A;  3EGD B;  5CKB A;  1YJ9 A;  2DEQ A;  3UWN A;  4CI0 C;  5GAM h;  1FMW A;  2C0T A;  4PJM A;  3C0C A;  5FU7 C;  2OTJ T;  2DLP A;  1VQ4 T;  1YJN T;  2DMO A;  4KBM B;  2K9G A;  5GAM e;  2Y90 A;  4M77 D;  4C92 G;  3ER0 A;  1YHQ Q;  1K9M C;  1OUL A;  5FW9 A;  1X01 A;  5GJW B;  3PE0 A;  3GLX A;  3CCE Q;  1RI0 A;  4QQG A;  3OYL A;  4MML A;  4IUP A;  5FRN A;  5FLX E;  3NHN A;  4RKU E;  4A4E A;  1X69 A;  1IRX A;  2JJ9 A;  2CS7 A;  2BKD N;  2D0Q B;  2I0N A;  4RTX A;  5CAI A;  3VS2 A;  4BE0 A;  2O9V A;  5DLO A;  2OTJ A;  4ORZ A;  1VQ4 A;  3EG1 A;  4J9F A;  1YJN A;  2DKG A;  3C4S A;  1EX4 A;  1Q82 R;  4C92 C;  4MZP A;  2NUP B;  4C8Q C;  5KYX A;  3KXT A;  3LWI A;  1WXB A;  2KSS A;  3C94 A;  1N8R C;  1MHN A;  2VGM A;  4EMK A;  1TSF A;  2ZPE B;  2MF2 A;  5IT9 E;  2RH2 A;  1RLQ C;  2DBM A;  2QEX A;  1BIB A;  2DJZ A;  5GAN 7;  2H8H A;  2R58 A;  5LJ5 h;  2RQT A;  2L0A A;  4IUV A;  1D0Y A;  2DXC A;  1AHJ B;  2F69 A;  3VYH B;  2XK0 A;  5LJ5 d;  2DEU A;  4IIM A;  4BI4 A;  1BCO A;  4EPC A;  2A08 A;  2K5I A;  3JB9 G;  2OI3 A;  1XTD A;  3DLM A;  5A0G A;  2HCK A;  2PVO B;  2EVR A;  1ZUY A;  2JTE A;  3BDU A;  1WGS A;  2CYZ B;  4LNP A;  4RUG A;  2K2M A;  4M7A A;  3MKD A;  2O9S A;  5GAO p;  1YJ9 Q;  2K79 A;  2JVV A;  5CK9 A;  1I0C A;  2ROT A;  1P92 A;  3L42 A;  1YIT T;  1ACM B;  3T9N A;  1QKW A;  3VRZ A;  2CH4 A;  3OYJ A;  4RTW A;  2VVK A;  1WHM A;  3CCV Q;  2EW3 A;  2DNU A;  1M4Z A;  3MPU B;  4LXC A;  1UG1 A;  3EG9 A;  1WHK A;  3EGU A;  2EBP A;  3SWN B;  2LDM A;  2L8D A;  1VQ9 T;  1UEB A;  1Q7Y C;  1WXT A;  1G8X A;  3VYG A;  2WAC A;  4RTV A;  2OTL T;  2DF6 A;  2OJ2 A;  2EYX A;  3QJ6 A;  3QSU A;  3LLR A;  2R5M A;  4MMK A;  3M5A A;  3LX7 A;  3OQ5 A;  2RHU A;  1YIT A;  5IXF A;  2P0P A;  2HZY A;  4OP0 A;  5FU7 B;  3TU4 K;  1N9R A;  1T0H A;  4QW2 A;  5GMK m;  2CH4 W;  2ED1 A;  3CPF A;  1OU8 A;  3OMG A;  4GLK A;  2LJ0 A;  3F70 A;  4OMM A;  4PFO A; 
#chains in the Genus database with same CATH homology
 3DKM A;  2RO0 A;  1K9M C;  2CZ6 B;  4XQ3 A;  4C92 F;  1K73 C;  2DIQ A;  3QDR B;  2X35 A;  4Q5W A;  2Y4Y A;  5LJ3 j;  1M1K C;  5GAN 3;  2OTL A;  4JDS A;  2QTX A;  2FB7 A;  4X9D A;  2MMP A;  3A8G B;  4UC4 A;  2E70 A;  2ZCF B;  4E7J A;  3RER A;  1IZ6 A;  2E65 A;  1N6A A;  2WSC E;  3OS1 A;  2XDP A;  1G5V A;  4M77 E;  2GQV A;  3E19 A;  3V8J A;  4C8Q D;  3OSS C;  2YLC A;  1VQM A;  1M8V A;  2P4T A;  1WQ7 A;  4EMG A;  1QP3 A;  1M90 U;  2JOY A;  3HL8 A;  3CD6 A;  3JCM g;  1KC8 C;  1NPP A;  3EAE A;  3OYA A;  1Q86 C;  5DLQ E;  5HY6 A;  3CBP A;  2RK2 A;  2XHC A;  4JS5 A;  2YRV A;  1G3S A;  1R8O B;  2E64 A;  2QXF A;  2E5Q A;  1PSE A;  2E10 A;  3LW5 E;  4OGE A;  5GAN 8;  3GPL A;  4BAC A;  1S72 A;  3CCS A;  1KD1 U;  4WF2 A;  4C92 E;  4BE1 A;  1YHQ T;  5AYF A;  4E7I A;  3URG A;  3CCE T;  4F7U F;  4A4K A;  5CQY A;  2JTF A;  2X4J A;  2MWP A;  4QVC A;  4B9X A;  1O9S A;  2GFA A;  4KUL A;  3QZ9 B;  3HRS A;  5D6W A;  1JRI A;  4II1 A;  4XU2 A;  1KQ1 A;  2RJF A;  3RKY A;  4BI8 B;  3NTH A;  4M7A F;  4ZGD B;  4C0G A;  3PIO A;  1Y07 A;  1BI3 A;  4XTU A;  3CC7 T;  2EJF A;  1H3Z A;  4C5E A;  4ATO A;  5GMK i;  1WPY A;  3QG1 A;  3LH0 A;  4NOY A;  3CEY A;  3LGL A;  3S6W A;  4BB7 A;  5C0M A;  4O5V A;  2XDD A;  4C0F A;  1JBM A;  2L5Q A;  2RJC A;  2PVG B;  4XK8 E;  2XDB A;  4QVZ A;  5L8R E;  4PJO G;  3CD6 T;  1OI1 A;  5LJ5 e;  4ME7 A;  1QP2 A;  3ZBD A;  2DD5 A;  4A54 A;  2JN0 A;  3HSB A;  4F7U E;  2V8K A;  4XU3 A;  4OF1 A;  3UPU A;  4LDU A;  1W4S A;  3JCM J;  1QVF A;  2X4Y A;  3CCE A;  2PU9 B;  2DIG A;  2ZGW A;  4MZT A;  1WNL A;  4HCB A;  2ZPB B;  3P8D A;  2CGH A;  4PL6 A;  2JNG A;  4PLL A;  3G71 A;  3CCJ T;  2E12 A;  1RL2 A;  5GAO n;  3GNF B;  3JB9 F;  3V7C A;  5LJ3 f;  2LNV A;  3P8B B;  4PJO D;  4M7A E;  3ZEH A;  3FLG A;  2QQR A;  3ZFJ A;  1EIF A;  2MWO A;  2D9T A;  4M7A D;  3OYI A;  4C0Z A;  3HPW A;  4HT8 A;  3PT9 A;  2FYK A;  5GAN h;  1N8R U;  2LX9 A;  3M56 A;  3L2V A;  3CC7 A;  2RJD A;  4XTV A;  3JCM b;  3A8H B;  2E6Z A;  3QYH B;  4IUR A;  3JCM X;  4XAX B;  2ZZD A;  1YI2 T;  4OB0 B;  4PJO B;  3M59 A;  5GAN e;  2DAQ A;  3LYI A;  5GAN d;  4BDY A;  2M1H A;  2FL7 A;  5CCA A;  4NL3 A;  1JB0 E;  5GAO m;  3CCU T;  1VQ5 A;  4PJO C;  4E7H A;  1KG1 A;  2M0O A;  3A5Z B;  3CCR T;  4HCC A;  3V8K A;  4PJO A;  1LOJ A;  4XTW A;  1VQ7 T;  4IUQ A;  4RG2 A;  4J6Y A;  5LJ5 f;  5GAM g;  4L6V 5;  2EIF A;  1N27 A;  2GCX A;  2ZPF B;  4EDU A;  3HP9 A;  3J81 E;  2RHX A;  4IUT A;  1Y7X A;  2A3L A;  2WSE E;  3I56 A;  5DY9 A;  3OYG A;  2C06 A;  1Y96 B;  5EG2 A;  4ZGE B;  1G3Y A;  3MEA A;  4DOV A;  1X6O A;  4J7F A;  3MEU A;  2E6N A;  4R56 A;  2DZC A;  3WVE B;  2BUD A;  2R5A A;  3OY9 A;  3CCM T;  1Y96 A;  4M75 C;  4A4G A;  4ZTF A;  3OYM A;  3M58 A;  1YJ9 T;  5GAO r;  4C5G A;  2VV5 A;  2K3X A;  5GMK l;  1K8A U;  1VQ8 T;  1VQ6 T;  2DK3 A;  2LRQ A;  1YI2 A;  4RCB A;  1I5L A;  2DTO A;  1K8A C;  3CC2 T;  3E1S A;  5J39 A;  3OSV A;  3CME T;  4E7K A;  2E41 A;  4EMH A;  2HNI A;  2P0K A;  3RKW A;  4X34 A;  3CCR A;  1M1F A;  3M4G A;  3L2R A;  1UB4 A;  5CVI A;  3CCV T;  3MP8 A;  3FB9 A;  4NL2 A;  5KCO A;  2EWN A;  2XID A;  3SB2 A;  3MP1 A;  4J5Y A;  5CKH A;  5M9O A;  5KCH A;  5LJ3 g;  4XTZ A;  3OYY A;  4Y28 E;  3VJP A;  4J83 A;  1JJ2 S;  3OS5 A;  2FVU A;  1VQ9 A;  4MZM A;  4BD3 A;  5GMK h;  5HKC A;  4QQ6 A;  4C8Q F;  5GAO q;  2RB6 A;  2A7Y A;  4M77 G;  2EKO A;  4HCZ A;  5HK0 A;  3OYK A;  3FDR A;  1FX7 A;  2NLU A;  3OW2 A;  3VUB A;  2F5T X;  3UDC A;  4C5I A;  1BI0 A;  5GMK e;  3JCM P;  3L2Z A;  1VQ8 A;  1VUB A;  1VQ6 A;  1XQH A;  2EQJ A;  3QZ5 B;  3AHU A;  2K4Y A;  5CQX A;  3HRU A;  2JTM A;  1K9M U;  1NPR A;  4N4I A;  3CC4 T;  3HHT B;  4C5H A;  1U1T A;  4RG8 A;  3CC2 A;  3O8V A;  3RMS A;  3CME A;  3N5B B;  3GNG A;  5GAM d;  4M7D G;  2VXF A;  1H64 1;  5KH6 A;  1WJS A;  1M90 C;  3QPH A;  2LT1 A;  4BUG A;  5LJ5 g;  3CCV A;  3OYF A;  1VIF A;  3OYN A;  4JRQ A;  4OB3 B;  3C12 A;  4QVD A;  3DB3 A;  1SSF A;  3JCM W;  4DA4 A;  5KE2 A;  3PTA A;  3X20 B;  5LJ5 j;  4C8Q E;  3X25 B;  2EJG A;  3NTK A;  4FT4 A;  3J7A F;  1VIE A;  3OYD A;  2XD0 A;  2HQE A;  5J26 A;  3LGF A;  4BE2 A;  4LD6 A;  1ZQ1 A;  5GAN 5;  2XIC A;  3FC3 A;  3S3O A;  1HK9 A;  3CCL T;  1KD1 C;  1U1S A;  4M77 B;  4M7D D;  1OZ2 A;  2QEX T;  2KDS A;  4M77 C;  4JLI A;  2Y4X A;  3S3N A;  3OA6 A;  1B34 B;  4FU6 A;  4M77 A;  4DOW A;  4CRI A;  3QKJ A;  4XTY A;  3QYG B;  3R6O A;  3A8L B;  1B34 A;  2L89 A;  3CC4 A;  3QII A;  4N0A C;  3JB9 I;  1VQO T;  1YBY A;  4FIB A;  4M7D B;  4F7U G;  4N0A A;  3RES A;  3TRE A;  2RI2 A;  4M7D C;  3PMT A;  1OZ3 A;  4A4F A;  2IVW A;  2AHJ B;  1FXX A;  3L1A A;  3WVD B;  1QVP A;  3M55 A;  5CKD A;  1FWZ A;  4M7D A;  3J80 E;  2K2V A;  4FM4 B;  4KUD K;  1M5Q 1;  2RHI A;  3FJP A;  5GAN j;  1VQL T;  4PJO F;  3OS2 A;  1YHQ A;  2JUF A;  4C0D B;  4J6X A;  4OVA A;  2DO3 A;  3OYB A;  2VYT A;  1OYX A;  4C0D C;  3JB9 J;  1QVG A;  5CIU A;  3OBY A;  3L2Q A;  3CCL A;  3OYH A;  4ZTJ A;  2LQK A;  4OGC A;  5J3B A;  4E47 A;  3QUI A;  4MDX A;  1MGQ A;  3JCM h;  2VC8 A;  2EQU A;  3VUZ A;  3WXM B;  2K5F A;  2VXE A;  2XU8 A;  1LJO A;  2EAY A;  3RUX A;  1Q82 U;  2K3Y A;  3JSC A;  3HRT A;  3VV0 A;  1KQS S;  3V8L A;  4M75 G;  1YIJ T;  3X26 B;  5HK3 A;  1Q82 C;  5GAO l;  3JCM d;  2KK4 A;  5CKF A;  1ZBX A;  3G4S T;  1VQO A;  2DD4 A;  4PLI A;  2DXT A;  3G6E T;  1I8F A;  1KHC A;  2EYQ A;  5DM7 R;  4F7U B;  3OYE A;  4FT2 A;  2PUK B;  1N9S A;  3GIB A;  3MCA B;  4Y91 A;  2O4X B;  5C6S A;  3HFN A;  3CCQ T;  4PJO E;  4F7U A;  4BY6 B;  1GXI E;  5I2M A;  1YCY A;  2LCC A;  3PGG A;  4BY6 C;  4M75 D;  1VQL A;  2O4X A;  3JB9 H;  2I2L A;  2DVE A;  1VQP T;  5A0L A;  3MET A;  4J8O A;  2LQ8 A;  2XG8 D;  2KAF A;  3CCJ A;  2DTI A;  1LNX A;  3OW2 S;  1UGQ B;  4HKE A;  5KE3 A;  4E7L A;  4KUI A;  2YHT A;  3FEO A;  2E1H A;  4RCC A;  1G3T A;  3G7Z A;  2BIV A;  3X24 B;  3FIF A;  2RK1 A;  1Q81 U;  2MAM A;  4XU0 A;  2PVD B;  1O75 A;  3C95 A;  3I55 T;  2LT4 A;  2K57 A;  4OMF B;  3CPW A;  2LC4 A;  1XOV A;  2QI2 A;  4M75 B;  4M78 G;  3OS0 A;  4QQD A;  3M9Q A;  1YIJ A;  5CKE A;  2DXU A;  1QVF S;  3L2U A;  2LCL A;  4BI3 A;  2YLB A;  2DXB A;  3EFR A;  2CKK A;  3G4S A;  4M75 A;  3G6E A;  1BI1 A;  2CZ1 B;  5GMK j;  3GF5 A;  3H8Z A;  4PNO A;  1HXD A;  1UGR B;  1BYM A;  3QBY A;  3FRN A;  1ZHI A;  1I81 A;  3CCU A;  4FL6 A;  3ASK A;  4M78 D;  3M54 A;  1VQP A;  4B9W A;  5GAN f;  1VQ7 A;  4XTX A;  1BIA A;  2B8A A;  3SFM A;  5GAN 2;  2KQW A;  3LWH A;  2M16 A;  2HQX A;  2KVQ G;  5I2S A;  2EFI A;  1QW1 A;  3EFS A;  3X28 B;  2L3R A;  4OB1 B;  2GFU A;  4RMO A;  2QQ9 A;  3PMI A;  1BI2 A;  2M9U A;  4M78 B;  2QQA A;  3CCM A;  1KQ2 A;  2D6F A;  3KBG A;  2V8J A;  3PIP A;  4M78 C;  3MHX A;  3M4Y A;  3CBM A;  3NTI A;  4M77 F;  4P5N A;  5CKB A;  3S3M A;  1YJ9 A;  2DEQ A;  4M78 A;  3UWN A;  5A0D A;  4CI0 C;  5GAM h;  2HD0 A;  5GAN 4;  1XNI A;  1V29 B;  5FU7 C;  4V2S A;  4KT0 E;  2OTJ T;  1VQ4 T;  4LDX A;  1YJN T;  2VGN A;  2H3J A;  4KBM B;  3CXC A;  1K73 U;  5GAM e;  2Y90 A;  4M77 D;  5D6X A;  3ER0 A;  4Z02 A;  4C92 G;  3CCS T;  1W2B A;  4HA8 A;  1QVG S;  2QQS A;  2MI6 A;  3OB9 A;  4LDW A;  5FRO A;  1X01 A;  2K5L A;  4D6W A;  4M7D F;  3GLX A;  1RI0 A;  4GY5 A;  2JZ2 A;  4QQG A;  3OYL A;  4MML A;  3RKX A;  1WJQ A;  4IUP A;  3RMQ A;  1VQK T;  2P0Q A;  3BDL A;  5FRN A;  3RIR A;  1KHI A;  2OAU A;  5FLX E;  3ME9 A;  4ELZ C;  2FHD A;  3DB4 A;  3NFC A;  4RKU E;  4X9C A;  4A4E A;  2RD1 A;  5CO7 A;  4XU1 A;  2RI3 A;  2CS7 A;  4C92 D;  5IAY A;  2BKD N;  4HT9 A;  2D0Q B;  4L5G A;  4N4H A;  1KC8 U;  1Q86 U;  5CAI A;  4JS4 A;  4JRI A;  1M9S A;  4BE0 A;  4JJN K;  4VUB A;  2RA2 A;  5DLO A;  3JCM V;  2OTJ A;  2DTH A;  5LL6 S;  5LJ3 h;  1VQ4 A;  4JLG A;  2RJE A;  1YJN A;  2DKG A;  3BFM A;  3C4S A;  4M7D E;  4C92 B;  4J7I A;  2VUB A;  4C8Q B;  5GAN g;  2X4X A;  4LDY A;  4MDW A;  4C92 C;  2XI9 A;  1NE8 A;  3M57 A;  4MZP A;  2LVM A;  3QJY A;  4J6W A;  4A53 A;  4C8Q C;  5LJ3 d;  3QHS A;  5LJ3 e;  4EMK B;  5GAM f;  3KXT A;  4C92 A;  2WSF E;  3LWI A;  3G71 T;  3BY7 A;  2KSS A;  4C8Q A;  4EMK C;  3C94 A;  1N8R C;  3HKS A;  4ZGJ B;  1VQK A;  1MHN A;  2EQK A;  3E9G A;  2VGM A;  4EMK A;  2ZPE B;  2MF2 A;  4NS5 A;  4M7A G;  1JJ2 A;  2KMT A;  3CPW S;  5IT9 E;  1WJR A;  2RH2 A;  1YJW T;  1NJI U;  1BKB A;  2QEX A;  1BIB A;  2DJZ A;  1VQN T;  5GAN 7;  2RHY A;  2R58 A;  3A8M B;  3A8O B;  4DQ2 A;  1NJI C;  5LJ5 h;  3PNW C;  2QDY B;  3QO3 A;  2DZ9 A;  2EQM A;  3L2W A;  4FSX A;  3VU3 C;  2HAX A;  4IUV A;  2DXC A;  1AHJ B;  1PSF A;  2LTO A;  2F69 A;  3JCM e;  2RI5 A;  3Q1J A;  4JUV A;  4M75 F;  4TVR A;  2XK0 A;  2GF7 A;  3VYH B;  3SDZ A;  5LJ5 d;  1VQ5 T;  3CMA T;  1Y71 A;  4YTL A;  3JAM E;  3JCM Q;  4BI4 A;  4EPC A;  2QA4 T;  3BW1 A;  2K5I A;  3V7S A;  3V7R A;  3CBO A;  1D3B B;  3MEV A;  3JCM c;  2O01 E;  3PFS A;  3JB9 G;  5I21 A;  1XTD A;  3DLM A;  1UGP B;  2KY9 A;  2XKO C;  2EJ9 A;  2PVO B;  3INZ A;  5A0G A;  3I56 T;  1D3B A;  1G3W A;  4JRP A;  4O6J A;  4M7A B;  2G3R A;  3BDU A;  1WGS A;  1IRE B;  2CYZ B;  3HFO A;  1YJW A;  4M7A C;  2HBP A;  3VKI A;  3MO8 A;  4IKF A;  1VQN A;  3GOX A;  4M7A A;  5GAO p;  3MP6 A;  2ZPG B;  3JB9 D;  2JVV A;  3OYC A;  5CK9 A;  4M75 E;  4A4H A;  1Q81 C;  1P92 A;  3L42 A;  4BDZ A;  3H6Z A;  3OBW A;  5A2Q E;  3CXC S;  3TEE A;  1YIT T;  4M78 F;  3T9N A;  3CMA A;  3SD4 A;  1DJ7 B;  1W2B S;  1UGS B;  3DLL A;  2PQW A;  4ZN1 A;  3OYJ A;  4JRK A;  3MEW A;  4OB2 B;  2DPP B;  3JCM f;  2QA4 A;  4LD9 K;  1M4Z A;  2RM4 A;  3OMC A;  3CCQ A;  5GAN 6;  1Q7Y U;  3JRZ A;  2CZ0 B;  4IUU A;  3SWN B;  5FRM A;  2LDM A;  2L8D A;  2QQB A;  2ZPI B;  2ZPH B;  3P8H A;  2R57 A;  1UEB A;  3SWN C;  3TCJ A;  5GAM j;  1VQ9 T;  1Q7Y C;  4R55 A;  3VYG A;  2WAC A;  3E9F A;  3UT1 A;  3SWN A;  2RHZ A;  4PKC C;  5D6Y A;  5CR2 A;  2OTL T;  4LDV A;  3GP8 A;  2PUO B;  3QJ6 A;  3I55 A;  3QSU A;  3LLR A;  2R5M A;  4MMK A;  4N4G A;  1KQS A;  5IN1 A;  3M5A A;  3LX7 A;  3OQ5 A;  4M78 E;  1VQM T;  2RHU A;  1YIT A;  1I4K 1;  4L59 A;  2P0P A;  1X75 C;  4OP0 A;  5FU7 B;  2F5K A;  5FU6 B;  3TU4 K;  1N9R A;  3QXE B;  1U8R A;  4QW2 A;  5FU6 C;  5GMK m;  1WQW A;  3CPF A;  1M1G A;  2V8I A;  2CZ7 B;  1TH7 A;  3M53 A;  1NZ9 A;  2X4W A;  4ELY C;  3OMG A;  4ZN3 A;  1S72 T;  4GLK A;  3F70 A;  2IG0 A;  4C8Q G;  3KUF A;  1M1K U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...