3LYIA

Pwwp domain of human bromodomain-containing protein 1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
EPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Bromodomain-containing protein 1
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lyiA01
2EQKA 2RHZA 2DIGA 2GF7A 3LH0A 3PMIA 3LGLA 4IUTA 3ME9A 5M9OA 3PMTA 2D9TA 5KCOA 4IUQA 3MEVA 3OMGA 3P8DA 3OYGA 1OI1A 4BDYA 2MWPA 4BE2A 3OS0A 2RJCA 4BD3A 2L89A 4A4FA 3OYLA 5FRNA 3EAEA 4UC4A 3L2QA 4ZTJA 1H3ZA 2EQJA 1WGSA 4BE1A 3OS2A 4IUPA 2EKOA 2K3XA 4LD6A 3ASKA 2M0OA 3MO8A 4Z02A 3E9GA 2DIQA 2BIVA 4E7HA 2QQRA 4QQ6A 5FROA 2LDMA 2B8AA 3H6ZA 4NS5A 2BUDA 3NTIA 3OYMA 1RI0A 2F5KA 4IKFA 2WACA 2RHYA 3OYDA 2VYTA 4QQDA 3UT1A 3OS1A 2EQUA 3OYFA 2PQWA 1OZ2A 3OYJA 1WJSA 2GFAA 3CEYA 4BACA 3OA6A 4EDUA 5D6YA 4A4EA 2GFUA 2IG0A 1OYXA 5FRMA 1G5VA 2P0KA 2RO0A 2RI3A 2FHDA 2RJEA 2EQMA 3DB3A 3FEOA 4CRIA 4BDZA 3QBYA 3META 1WJRA 3OB9A 5KE2A 3Q1JA 2X4YA 3ZEHA 5C0MA 3SD4A 4B9WA 1XNIA 5CIUA 2R58A 3M9QA 4ZTFA 3MP1A 4N4HA 4E7KA 4C5HA 3OY9A 1N27A 3P8HA 3OYCA 2K3YA 2NLUA 2R5AA 2RJDA 4C5IA 3QKJA 4A4GA 2E5QA 2JTFA 2YRVA 2XDPA 5J39A 3OYBA 4PLLA 4HCZA 3O8VA 1OZ3A 3L2UA 2G3RA 2O4XA 3LLRA 3BDLA 3L2WA 4IUUA 4II1A 4PL6A 2M1HA 3OYAA 4BE0A 4X34A 2X4XA 5D6WA 2QQSA 4IURA 4L59A 5IN1A 2RJFA 3L2VA 4OVAA 5D6XA 2EFIA 1WJQA 1MHNA 3DB4A 3FDRA 2JZ2A 3KUFA 3PNWC 3QJ6A 5J26A 3S3NA 4QQGA 2R5MA 4QVZA 4N4IA 4E7IA 3DLMA 2RHXA 3L42A 3LGFA 3OQ5A 3L2RA 3S3MA 3PFSA 1KHCA 2XK0A 3OYEA 2X35A 3MP8A 2CKKA 2RI2A 3FLGA 3OMCA 3OYKA 3S6WA 2RI5A 2L8DA 4QW2A 3OYNA 5KE3A 5KH6A 2E6NA 4FL6A 3E9FA 3C4SA 2M16A 4FU6A 2L3RA 2LRQA 4B9XA 2HQEA 4N4GA 3MP6A 3QIIA 4RG2A 3F70A 3LX7A 5KCHA 3FC3A 2LVMA 4C5EA 3S3OA 3OYIA 5IAYA 4GY5A 3NTHA 2MWOA 3LYIA 2RHIA 4IUVA 2DAQA 4A4HA 2X4WA 2RHUA 3MEAA 3MEWA 5C6SA 3NTKA 2LTOA 2O4XB 4E7LA 4C5GA 4PLIA 2LCCA 2HQXA 4Q5WA 3GOXA 1SSFA 2BKDN 3MEUA 3OYHA 4E7JA 2R57A 3H8ZA 3UWNA
chains in the Genus database with same CATH superfamily
3AHUA 2F2VA 3J80E 3ZFJA 2DBKA 3OYGA 3RBBB 4JJBA 5FU7B 2KRNA 2V8KA 1KQSS 2VXEA 5FU6B 1SRLA 1IZ6A 4UC4A 1SSHA 3I55Q 1QVFP 4ME7A 1I81A 2OTLQ 1C6VX 3UF4A 1WLPB 4IIOA 1QLYA 3OYDA 2VYTA 4EMGA 4RTTA 2KMTA 1RAHB 3CCEA 2LZ6B 1X6OA 4OMOA 4BI8B 1VQ4A 1OV3A 3V7CA 3EGDA 4L5GA 1SRMA 5HCKA 3HSBA 1CKAA 2QQBA 1U1TA 3EGDB 2KK4A 3CCST 2RJDA 1S72Q 2JTFA 3CCMT 1RL2A 1KQ1A 1OPLA 5IH2A 4LXCA 4PL6A 4FIBA 3KUFA 3BE3A 1PM3A 2JW4A 4PJOD 2EIFA 2CSIA 3H0FA 2RA2A 1WA7A 2XK0A 4KT0E 4JJDA 1W2BP 4DA4A 4QW2A 1E6GA 4FL6A 4A4KA 4M77A 2AKKA 1B7TA 1VQ8Q 2RD1A 5FWCA 1TUDA 4PJOB 2ESWA 2PU9B 2HSPA 2K7AA 3LX7A 4QVCA 3I56Q 3FC3A 4M77B 2LP5A 1YITA 2L2PA 1K8AC 3NTKA 1Q86R 2ECZA 3CCJQ 4PJNA 2NWMA 2O2OA 1AZGB 1IREB 3EGUA 3JB9G 1KFZA 4JRKA 2RB6A 4AMCA 4FYWB 1NEGA 2D6FA 1HSQA 2OX7A 1VQKQ 5IHNA 1WXBA 4AFUC 1WIEA 1VQOT 5CKEA 3OYLA 2PTKA 1Y71A 5LJ5d 2RQUA 4DBFA 4E7HA 1D0YA 3CC7T 1NPRA 3JRZA 3EGXA 1RABB 1H641 4HCKA 2CH4W 5EG2A 3EGXB 1VYVA 4Y91A 4BACA 3URGA 1SKUB 3MJXA 3VV0A 3LWHA 3QPHA 4M77D 2NUZA 4HXJA 2FHDA 2BTTA 2KROA 5KE2A 3UPUA 4ZTFA 2DL3A 1M1KC 5I2SA 1JJ2P 2PVGB 2E10A 2DE0X 2YWWA 3OYBA 2G3RA 5CR2A 2J6KA 4C8QF 1ZA1B 2M1HA 3FB9A 4LDUA 3OYAA 2QQSA 3L2VA 2ED0A 2PVDB 3V8JA 2FPFA 3JSCA 2QTVA 1Q7YU 2HBPA 1QCNA 4M78E 2XHCA 4C92E 3RKXA 1VA7A 1Q82R 2J7IA 4BI4A 3C95A 2VKNA 1IHWA 4Z89A 5LJ5e 4N4GA 4N0AC 1ZA2B 2H3EB 4HA8A 2KRSA 5KCHA 2LVMA 2DA9A 1SEMA 1FXXA 2DAQA 2DLPA 2RHUA 3O5ZA 1YCYA 2V26A 1I5LA 3M58A 9ATCB 1R8OB 3M55A 2A28A 4DEYA 3MEUA 2R57A 3EFRA 4PJLA 3CC2T 3UA6A 5FU7C 4XTWA 4BY6B 1NLPC 4DBHA 3U23A 3QG1A 3OS0A 1YIJA 3CCSA 2KSSA 2JMAA 3AT1B 2V8JA 3EAEA 2EPDA 2GBQA 3CBOA 4IUPA 2HL5C 3JCMX 4LD6A 1VQ6A 1VQ4T 1VUBA 3G4SQ 2DRKA 2BUDA 3NTIA 1NEBA 1GCQA 3HFNA 1ABQA 3SHWA 1QWEA 4JRPA 3E2UA 1JO8A 4C8QC 2YUQA 3CC4Q 4IIMA 1BCMA 3VS1A 2EYXA 2FPEA 4C0FA 2V1RA 4OB1B 1NPPA 2E5KA 1PCXA 3LH5A 3OB9A 4F14A 3SD4A 5GAMe 1RI9A 2DEUA 2JM9A 2CZ6B 4WF2A 4M7AA 3M54A 3MP1A 4PNOA 3CMET 3VS6A 3OY9A 3A8OB 4FYVB 1HD3A 2JM8A 2BZ8A 1M2VA 2K79A 2P4RA 3QKJA 4A4GA 3OBWA 3CCLQ 4O5VA 4MMLA 2HCKA 2L5QA 4C92F 2CDTA 4M75D 4CC2A 1JB0E 4II1A 3X26B 2K4YA 4IURA 4L59A 4XTUA 3MHXA 3DB4A 2JZ2A 3S3NA 4LDWA 3SDZA 1VQ7Q 3T9NA 2EGEA 3L42A 4OMFB 4NL3A 3CCUT 1V29B 3QYHB 3CCVA 3S6WA 2RH2A 4HCCA 5A0GA 4M78A 3J7AF 2SEMA 1BB9A 1RLQC 7AT1B 3CXCP 1T0HA 2KT8A 1TS9A 1FMKA 3EG2A 2KQWA 2MWOA 3QWYA 3GIBA 4A4HA 1BK2A 2YLCA 2EVRA 2OTJA 1RAAB 1MMNA 1YWOA 4XU1A 4C8QE 3ZBDA 3ME9A 5CKHA 2D9TA 1YJNT 3GBQA 3MEVA 1B07A 1OI1A 1JU5C 1VQMA 3ER0A 1AWXA 1K4US 2E41A 3MKDA 4EMKC 4ELYC 4RTWA 2RM4A 1H3ZA 2EQJA 1X01A 1SPKA 1YHQT 3SWNB 4LUDA 4PJOE 1G3YA 1O9SA 5FWBA 1IXDA 2DX1A 1K73R 4R0KA 5GANh 2COWA 1NZ9A 2D8JA 1QCFA 4JZ3A 1B3QA 3L2ZA 4HVUA 3PVQA 2ZPIB 3HPWA 5L8RE 4R55A 3OYFA 2QEXA 1ZBXA 2A36A 2GFUA 1WHMA 2YDLA 2DNUA 2EKHA 4J9IA 3VRYA 2DYIA 1PHTA 3HL8A 3CPWS 1VQ9Q 2HKQB 2LX9A 2YLBA 1X2KA 2AZVA 4C92C 5AYFA 1WDXA 2BZYA 4KBMB 4EMHA 2CP6A 4KULA 4M7AC 1VQPA 3RKWA 2CYZB 3QJ6A 1K73U 4MDWA 1K1ZA 4F7UE 4XK8E 2X4JA 4E7IA 5FW9A 3G1JA 5GMKj 4J7IA 5LJ5g 3OYKA 3FLGA 1AHJB 1TH7A 2D0QB 2ZAEA 2P0PA 1K8AU 3OYNA 1JJ2A 1XTDA 2EWNA 2J06A 4EPCA 4B6MA 5EC7A 4JS5A 1PSFA 4C5EA 1W2BS 3LYIA 1M27C 2YT6A 4J9HA 4M7AB 3X24B 3PTAA 1VQOQ 2D1XA 4LDXA 2BKDN 1LJOA 3P8DA 2DZCA 4HT8A 2EQKA 5M9OA 1NM7A 4M75C 1LPLA 3EG1A 4KUDK 4N0AA 2DJQA 2A37A 2VGMA 4BDYA 4QT7A 2MWPA 2IVWA 1ARKA 2O01E 1D09B 2L89A 3KXTA 1O75A 3RR6A 2EKOA 2ATCB 4J6WA 1K73C 3UATA 1HK9A 3JAME 1UECA 1YCSB 3N5BB 3CCQT 1AVZC 1P92A 1YNZA 2RNAA 4AG1C 1UJ0A 3QO3A 4KGXB 3UT1A 2JJ9A 5GAOn 1OU8A 4BDZA 3BY7A 2L3SA 5A0LA 5GAN4 3ZEHA 1TOVA 4NL2A 2XG8D 3P8HA 1LNXA 2BZXA 2HEQA 3OYCA 5GMKl 4C5IA 1UHFA 4FYXB 2P84A 1N9RA 2GTOA 1M3CA 5DLOA 3CMEQ 2FG0A 1ZSZA 1DJ7B 3M0QA 2EJGA 2RHXA 4XU0A 1VQOA 2PZ1A 1D0XA 3SWNA 2FZKB 2PUOB 1FX7A 2XU8A 2YUOA 1SHGA 3RIRA 1VQ9T 3E9FA 2SRCA 1ZQ1A 2XD0A 2HQEA 2A08A 3QIIA 2O9VA 3A98A 3V8KA 1N5ZA 3JCMP 1PRMC 2EGAA 1ZUUA 4E7ZA 2QEXT 3MEAA 3RNJA 4KRTA 4M7DE 3X28B 3HKSA 1UEBA 2K9GA 2F69A 2EBPA 3OSVA 3PMIA 1VQPQ 4ZGJB 2Y4XA 5GAMf 4OB0B 5LJ3j 5CQXA 2KXDA 3CBMA 4J6XA 2KR3A 3NHNA 3UDCA 2JUFA 1QW1A 2MIOA 2YXYA 4KH0B 1M90U 4J9FA 4C92G 1Q7YC 2KI7A 1XQHA 2W10A 3FEOA 4M7AE 1RAIB 3L1AA 5A0DA 1YFNA 2VGNA 5GAMd 1X6BA 2KEAA 1QVGS 2DXTA 1N27A 1YIJT 3TEEA 4HT9A 2CSQA 2ZPBB 2LJ1A 5GAOm 4E2FB 3ULRB 3REBB 1I07A 2CP0A 2B86A 5KYUA 1SG5A 4P5NA 2AK5A 2DO3A 1V76A 2DL5A 3WVDB 1K9MC 2NUPA 5GAOp 2R5MA 2HNIA 4QVZA 3TQ7P 2OTJQ 2MYSA 2X35A 3M4YA 4BB7A 3OW2P 2CP2A 1R77A 2JTMA 2VUBA 5KH6A 2K5LA 4F7UF 1K9AA 1H8KA 2OAWA 1SHFA 4X9CA 1VIEA 2AZSA 1X2QA 2DTIA 1I8FA 3CCVQ 5C6SA 1VQ5A 1YHQA 4C5GA 1OX8A 4F04B 3RESA 1SSFA 5GAOq 2JNGA 2LQNA 4RKUE 3GLXA 4OB2B 1ZSZC 1YJWQ 1VQ8T 2RHZA 3RMQA 2DZ9A 2PUKB 3I56T 1ZUKA 3H0HA 1CSKA 3JCMf 2DF6A 3RKYA 1BCOA 3CCRA 3CCLA 3A5ZB 4ZTJA 4XAXB 3OS2A 2FRYA 2K3XA 2JT4A 2EYZA 1YBYA 1PD1A 4J7FA 1K9MR 4CI0C 3H9NA 3M0UA 2JXBA 4ATOA 3CCQA 1IO6A 3CC4A 1M3AA 3CCQQ 1Q82U 3CEYA 1YJ9T 1WHLA 1TXQA 3A8HB 5GAN5 2KY9A 3DKMA 4M77F 5FRMA 1C1AA 2RJEA 2EQMA 1Z9QA 3EG9B 2E3IA 5CQYA 1AWWA 2X4YA 1D1BA 3SFMA 2H8HA 1QP2A 1XNIA 2DTHA 1WYXA 3JCMW 1VQ6Q 2QASA 2R5AA 2NLUA 3OS5A 1K8AR 5KYWA 2YRVA 5I22A 3CCRQ 3L2UA 1NBEB 1OPKA 3TREA 1WXUA 2C0IA 1M30A 2EFIA 5KYNA 2WSEE 2AKLA 2FYKA 2QQ9A 1YJWA 4KUIA 1U1SA 2E64A 3FJPA 5GJVB 3L2RA 1KQ2A 1YHQQ 1VQ5Q 3QZ9B 2GCXA 2KT1A 3JCMJ 1PRLC 2AIRB 4ZGEB 1JBMA 4ZNXA 1LCKA 2I2LA 2VWFA 4IUVA 1YWPA 2BE9B 4M7DD 4JDSA 1MNDA 2VB6A 3QUIA 3EG0A 4IUTA 2DIGA 2GF7A 4QKUA 1IHVA 2KDSA 3PGGA 5GANe 4XTVA 3JB9I 4C8QB 4PJJA 1QVPA 4J9GA 4M78D 3L2QA 1ZHIA 4PFOA 4LUEA 2OJ2A 3H6ZA 2F5TX 2JTEA 1QVFS 2OI3A 4E7SA 3SB2A 2DERA 1KC8C 5GAN6 5KYXA 1JEGA 2RHYA 4Y28E 1HYOA 1N8RR 3OA6A 2IG0A 1V1CA 3M0RA 3DB3A 2GQVA 5KYYA 5FU6C 3SEMA 1GBRA 4JLIA 5DLQE 5CKBA 2V8IA 1I5OB 3CC4T 3V7SA 1FYNA 2E5QA 2EJFA 3JCMg 1U8RA 1BU1A 3EHQA 1G83A 2X4XA 1QVFA 2QA4T 2DFUA 3QSUA 5GMKm 1TUCA 1WJQA 2QGFB 3FDRA 3EH1A 4QQGA 3OQ5A 5HK0A 3OYEA 1KHCA 3CCJA 2RQRA 2CZ1B 2K5FA 4EMKA 2DBMA 2Z0WA 2E3HA 5KE3A 2HAXA 3I56A 2M16A 1I1JA 4L6V5 1T3LA 2L3RA 4B9XA 2DEQA 4KGZB 1VQ8A 2E70A 3VUBA 3GNGA 1TTHB 1E7OA 2GQIA 1Y96B 2ED1A 1EIFA 5LJ5j 1KJWA 4WCIA 1W1FA 3H8ZA 4M77E 4JS4A 1EZZB 5CAIA 3EHRA 1N8RC 1PC0A 4M75A 2DVEA 4ANJA 5LJ5h 3CMEA 1BBZA 4BD3A 5I21A 5IHIA 3WVEB 8AT1B 3JCMV 2YRCA 1Q81C 2LQKA 4K11A 1OEBA 2DL8A 3ASKA 3M5AA 2CREA 3GP8A 2DIQA 2QQRA 2A3LA 5FROA 4RTXA 1M5Q1 4DOVA 1VQMT 4AFSC 2CH4A 3H41A 4JRQA 4JRIA 2I0NA 1XOVA 3QXEB 4ZN1A 3I55T 3M53A 1ZSZB 2EQUA 1R0BG 1JRIA 2KNBB 2ZPEB 4FSSA 4A4EA 4PK4A 2QDLA 4OMPA 1WQ7A 2RI3A 1VQNT 1NYGA 2C0TA 2DXUA 1W4SA 4M75G 4RG8A 4PJOA 3JCMc 4BI3A 2OTLA 1Y7XA 3QJYA 2HKNA 5FLXE 2XDPA 3VYGA 2OTJT 3M56A 1JXOA 1BKBA 4OVAA 1UGSB 1UGRB 1TU0B 1S1NA 4E47A 2JN0A 2D8HA 2LJ0A 5J3BA 4M7DB 1M8VA 2RI5A 1AWJA 4D8DA 3CD6T 1GFDA 1VQLA 3QHSA 2E12A 3MP6A 4M7AG 1N6AA 1W2BA 2EJ9A 2W0ZA 3OYIA 1YI2T 2VV5A 1SF9A 5IXBA 2XICA 4OF1A 1M90C 1RACB 4YTLA 2CT4A 3GOXA 3OYHA 4M7AD 3G71T 2DPPB 2ROLA 4VUBA 3UWNA 5KYYB 2COZA 2XIDA 1D3BA 1MMDA 3EFOB 3PMTA 3VS4A 3HTRA 1AT1B 3JB9J 4CC3A 1EFNA 3R6NA 4JPBW 5DM7R 2M0YA 2G6FX 5CCAA 4A4FA 3HFOA 1UGVA 4E6RA 3M0PA 2DVJA 1KK7A 4O6JA 2K6DA 1HXDA 1ZBJA 3CXCS 3CD6A 3E9GA 1VQ9A 2BIVA 1AWOA 4A53A 4C0DB 4ZN3A 4MDXA 4A63B 1AZEA 1UFFA 1K0XA 2CZ7B 3V8LA 2FZCB 2WACA 2QEXQ 3SWNC 3FIFA 2ABLA 4M7DC 2GFAA 3LW5E 3JCMb 1EX4A 1WQWA 1BI2A 3CC7Q 3HRSA 3QBYA 1BIBA 3CC2Q 1B34A 2LCLA 1VQPT 4B9WA 1C0MA 5GAN8 1BI1A 3M9QA 3A1PA 1WHKA 2WSFE 1UDLA 2DD4A 3M0SA 2GGRA 5J39A 3CMAA 2FB7A 1QKXA 2QTXA 3LLRA 3NMZC 1QMCA 1IRXA 1VQMQ 4LN2A 1AOJA 3THKA 2CGHA 1ZX6A 3IQLA 3R6OA 1QP3A 2E65A 2Y4YA 4ZGDB 4ELZC 3FJ5A 3S3MA 1M1KU 2X9HA 1F1BB 2ZCFB 2LT4A 2GNCA 2KGTA 3M4GA 1MMGA 2HD0A 4QVDA 4J83A 4RG2A 1YI2A 4PJOC 4LE9A 2YRDA 2X4WA 4OB3B 3G6EQ 1RUWA 3CMAT 1Q95G 1VQ7A 4E7JA 2LJ3A 1X6GA 2CP5A 2KYBA 2K57A 3LGLA 3RERA 1X69A 3KBGA 2DKGA 4IUQA 2DL7A 3G4ST 2K2MA 2H3JA 3M0TA 3JB9D 1IGQA 4DQ2A 3HRUA 4J6YA 1WNLA 2RJCA 2DD5A 2QYZA 1Q86U 1TG0A 5L23A 4XQ3A 2KRMA 2K3BA 1KC8U 4C8QG 1UUEA 4LD9K 5GAMh 3CCET 1CKBA 4C92B 3OYMA 2A7YA 4A54A 1WPYA 2LNVA 4M75B 4M7DF 4OMLA 3VKIA 4X9DA 2PQWA 3OYJA 4GLMA 4JLGA 2HZYA 5GAN7 4J9EA 2RO0A 3V7RA 1U5SA 3ZL7C 3G4SA 2HL3A 1QCOA 3FRNA 3I5SA 2QQAA 1VIFA 2JS0A 2J05A 2K3YA 4C0GA 2EW3A 2LNHB 1TWBA 2ZPHB 3CPWP 2MF2A 3CCSQ 1YIJQ 1WXTA 4IUUA 4BE0A 4PFPA 2L3PA 2RJFA 2DRMA 2P0QA 5LJ3f 2HMAA 4N4IA 4Z88A 2QDYB 2K2VA 2LCSA 3OMCA 5GANf 1YJNA 4FW2A 4FU6A 2YHTA 1K0SA 2DXCA 1PNJA 4OMQA 1M2VB 4D6WA 4GY5A 3C94A 1G3WA 3VYHB 1GXIE 3CQTA 3TCJA 2XI9A 2O4XB 3CCUQ 3VS2A 3JB9H 3JV3A 1OU9A 2DL4A 3P8BB 4M7DA 3LH0A 1MMAA 3I35A 1OULA 3BW1A 2MCNA 1FMVA 2RF0A 3QZ5B 8ATCB 1KD1U 4XTZA 3QYGB 5CK9A 4BE1A 4Z8AA 2ZGWA 2ROTA 4Z02A 1W6XA 4M75F 3GF5A 4QQ6A 3OW2A 2B8AA 2VASA 3VS5A 1K76A 1QKWA 2MK5A 1RI0A 4HCBA 2F5KA 4C0DC 1BI3A 1NG2A 3BFMA 1OZ2A 3HHTB 5CKDA 3WXMB 3M57A 5GANj 4LNPA 3M59A 1WJRA 2DJZA 1M1FA 2EYYA 1VQLT 5CIUA 1G8XA 2EQIA 1GRIA 4N4HA 1ABOA 4E7KA 1PKTA 4PLLA 4HCZA 1UTIA 1X27A 1K9MU 3OSSC 2D0NA 1VQ6T 4M7AF 3VRZA 4FM4B 1IB8A 2DXBA 4X34A 1VQKA 4WTOB 1BI0A 4JZ4A 5I2MA 1UG1A 2KVQG 4OGCA 4RTVA 1MNEA 2M51A 4JJNK 1G2BA 1MHNA 3INZA 2BE7D 1D0ZA 2E4HA 3DLMA 4C92A 3CCRT 2DETA 1YITQ 4XTYA 3CBPA 3CCMA 3C12A 3C4SA 3TSWA 1ZSGA 2ZPGB 2ENMA 2LRQA 3E1SA 2MI6A 1QVGA 1VQNA 1GL5A 2DM1A 2NUTB 1KQSA 2CT3A 1Y0MA 1NJIU 2L0AA 3C0CA 5IT9E 5ECAA 2MAMA 4DBQA 4C8QD 3NGPA 4OMNA 2YSQA 1U3OA 4RTUA 5KCOA 5HK3A 1D3BB 3OMGA 1BIAA 3A8LB 1KSWA 4RMOA 4FCYA 5GAMg 2YUPA 4KH1B 4M78F 2JOYA 4MMKA 4HKEA 1S72A 4Y92A 2F2WA 4M78C 5GAMj 2FEIA 3EFOA 4XTXA 2LDMA 1BYMA 3G7ZA 3JCMd 1ZLMA 1VQ4Q 2F2XA 5IHKA 2LX7A 3CCEQ 2O88A 4RCCA 1AEYA 2HQHA 2VXFA 4BY6C 1X75C 3PE0A 3H0IA 1KD1C 2QG9B 5GANg 4OP0A 4CRIA 2PNIA 3RUXA 1G3SA 1WHHA 1JXMA 2CZ0B 1MUZA 4FSXA 3VS3A 4F7UA 4KGVB 4RTYA 3PIOA 1Q81U 2OTLT 2LQWA 3I55A 4JJCA 3MPUB 1M2OA 1FWZA 1OZ3A 2DTOA 4MZPA 2E6ZA 2O4XA 3CCVT 3EFSA 1PWTA 2PVOB 4FYYB 4RCBA 4LDYA 2IPOB 4FT4A 2VVKA 2X51A 3VUZA 1JJ2S 5LJ3h 4AFZC 1X43A 2CS7A 3PNWC 3JB9F 3J81E 4M78G 4DOWA 4V2SA 4M78B 2NYSA 4GLKA 1KHIA 2EYQA 3MP8A 3PVLA 2RPNA 4ORZA 4LDVA 1VQNQ 4PKCC 3F70A 3S3OA 3OW2S 1VOMA 3CCMQ 1UHCA 1UGPB 2A0FB 5A2QE 2FO0A 1WX6A 1FMWA 1Q86C 1M90R 3REAB 2KBTA 3GPLA 1Q81R 2MOXA 1KD1R 5LJ3g 2COYA 3EH2A 4OGEA 2WSCE 2LC4A 3JCMe 1PG5B 2KE9A 2C06A 1WGSA 1B34B 1M1KR 2O9SA 4C8QA 2RQVA 2QA4A 4FT2A 1WFWA 5HY6A 2X3WD 2XDBA 2P4TA 2GTJA 1LVKA 2FVUA 3OS1A 2OAUA 5AT1B 1N9SA 1TSFA 4JUVA 5D6YA 3CCLT 1Q82C 1VQKT 5GMKh 2QK0A 2FL7A 2JMCA 2YUNA 3OYYA 3Q1JA 2RN8A 5C0MA 1PSEA 1NYFA 1KIKA 2ZZDA 1GCPA 4BUGA 4AFQC 2QGGA 2E1HA 2EGCA 1G3TA 2FPDA 3L2WA 2AT1B 1UE9A 4M4ZA 5IN1A 4OMMA 4F16A 5GAN3 5D6XA 3X25B 1UJYA 1AD5A 2LMJA 5J26A 1W70A 2DILA 2J6FA 1D1CA 1S72T 2EAYA 3LGFA 3X20B 1YJ9A 1KQSP 3CCUA 5CKFA 2CKKA 2RI2A 2RMOA 2VC8A 3G71A 2L8DA 1ZUYA 4M77G 4GBQA 3QDFA 2MMPA 3BDUA 1YJNQ 5KYUB 3TU4K 3I5RA 5IAYA 3VS7A 4E7LA 2KXCA 2LTOA 2CUDA 3VS0A 4MZTA 4NOYA 3MCAB 2HDAA 4ESRA 2RQTA 1QQJA 1M4ZA 2HBWA 4PJOF 2LQ8A 3VU3C 3GNFB 2K5IA 1RAEB 3QWXX 2X3XD 3CCJT 1M8MA 4TVRA 5FRNA 1WI7A 1RAGB 3CPFA 4RUGA 1OX9A 6AT1B 3HP9A 2RK2A 3A8MB 3CXCA 4HVVA 4J5YA 5CVIA 1KG1A 3MO8A 4C92D 1GCQC 1Y07A 4J9CA 1A0NB 1M3BA 5CO7A 4AT1B 4J9BA 2AHJB 2F1LA 1U06A 3A8GB 2HSEB 4PFZA 1VYTA 4IKFA 2RQWA 4QQDA 3G6ET 1WJSA 4CC7A 1QVGP 4EIKA 1VQ7T 4F7UG 1G5VA 2Y90A 2CP3A 1MV3A 4DBRA 2R58A 5GANd 5LL6S 2KYMA 4FW1A 5GAN2 1M9SA 1MV0B 1ACMB 3O8VA 2DMOA 5GAOl 3BDLA 1UGQB 1IGUA 5D6WA 4J9DA 1WHJA 1H3HA 4M77C 3DLLA 3CPWA 3KFVA 4XU3A 3HRTA 1VYUA 4J8OA 3PFSA 2JVVA 5D7UA 3G6EA 4R56A 5LJ3e 1OQKA 1D1AA 2MPXC 2XKOC 1N8RU 1T0JA 2E6NA 1NJIC 1YI2Q 1NE8A 4HVWA 3EG3A 1PKSA 5KYWB 1QWFA 3NTHA 3G71Q 2LT1A 4CC4B 1WHGA 1NLOC 2CUBA 1YJ9Q 5DY9A 4PJOG 2IIMA 2C0OA 1MGQA 2DYBA 3E19A 3VJPA 4X1VA 2QAZA 3JCMQ 4BE2A 5KYXB 3QDRB 1TUGB 1PD0A 4AG2C 4DEXA 1NJIR 3TVTA 3CMAQ 5IXFA 1LOJA 2M0OA 2O31A 3JCMh 1UB4A 3NFCA 4NS5A 2L3QA 1GBQA 5HKCA 3CC2A 3CC7A 1OOTA 3NPFA 5GJWB 1YJWT 4PJMA 1VQ5T 1YITT 1KC8R 4EDUA 2EYWA 1JQQA 1OYXA 4RTZA 2P0KA 5GMKi 1HJDA 3META 3I9QA 2XDDA 2QA4Q 1XJWB 4C0ZA 3CD6Q 1Y96A 3UA7A 1WZOA 4C5HA 4M7DG 1M1GA 4EMKB 3PT9A 2QXFA 3EG9A 4F17A 5LJ3d 2ZPFB 2NUPB 3PIPA 2NUTA 1YN8A 5GMKe 4F7UB 1I4K1 2M02A 1I0CA 1E6HA 1Y57A 1YP5A 2KAFA 5I11A 3TSZA 2V1QA 3D7SB 4D8KA 3RDVA 2QI2A 1RAFB 2DK3A 4M75E 1Q7YR 2M9UA 1GFCA 3LWIA 2CP7A 1RADB 2XMFA 1VQLQ 3OBYA 2JS2A 1J3TA 2RK1A 1H92A 3RMSA 2FZGB 2RHIA 1T3SA 3MEWA 1RLPC 4MZMA 5GAOr 4PLIA 2LCCA 1Z9ZA 2HQXA 2FRWA 4Q5WA 5LJ5f 2J6OA 1R0CB 4XU2A
chains in the Genus database with same CATH topology
4JS4A 2DZCA 4HT8A 2EQKA 3AHUA 5M9OA 4M75C 3J80E 4KUDK 3ZFJA 4N0AA 5KCOA 5HK3A 1D3BB 5CAIA 1N8RC 2VGMA 3OMGA 3OYGA 4BDYA 2MWPA 1BIAA 4M75A 2DVEA 3A8LB 2IVWA 2O01E 5LJ5h 4RMOA 3CMEA 5FU7B 4BD3A 5I21A 5GAMg 3WVEB 2V8KA 2L89A 4M78F 1KQSS 3KXTA 2JOYA 2VXEA 4MMKA 4HKEA 1IZ6A 4UC4A 5FU6B 3JCMV 1S72A 1Q81C 2LQKA 4ME7A 1O75A 1I81A 2EKOA 4M78C 5GAMj 3ASKA 4J6WA 3M5AA 1K73C 4XTXA 3GP8A 2DIQA 2QQRA 2A3LA 5FROA 2LDMA 1BYMA 3G7ZA 1HK9A 3JCMd 3JAME 1M5Q1 4DOVA 3N5BB 3CCQT 1VQMT 1P92A 4JRQA 4JRIA 1XOVA 4RCCA 3QXEB 4ZN1A 2VXFA 4BY6C 3OYDA 3I55T 2VYTA 3QO3A 1X75C 3M53A 3UT1A 2EQUA 4EMGA 5GAOn 1JRIA 2ZPEB 1KD1C 4A4EA 2KMTA 1WQ7A 3CCEA 4BI8B 1X6OA 2RI3A 4OP0A 4CRIA 5GANg 4BDZA 1VQNT 3BY7A 1VQ4A 3V7CA 5A0LA 5GAN4 3RUXA 1G3SA 3ZEHA 2DXUA 4L5GA 2CZ0B 3HSBA 1W4SA 4M75G 4RG8A 2QQBA 4PJOA 3JCMc 4BI3A 2OTLA 4FSXA 1U1TA 4NL2A 4F7UA 2XG8D 1Y7XA 3PIOA 3QJYA 3P8HA 2KK4A 3CCST 1Q81U 1LNXA 2OTLT 3OYCA 5GMKl 2RJDA 4C5IA 3I55A 2JTFA 5FLXE 2XDPA 3VYGA 2OTJT 1FWZA 1N9RA 1OZ3A 3M56A 2DTOA 4MZPA 2E6ZA 5DLOA 1RL2A 3CCMT 2O4XA 3CCVT 3EFSA 1KQ1A 2PVOB 4PL6A 4RCBA 4LDYA 4FT4A 1BKBA 1JJ2S 3VUZA 4OVAA 5LJ3h 1DJ7B 4FIBA 2CS7A 3KUFA 3PNWC 3JB9F 1UGSB 3J81E 4M78G 1UGRB 2EIFA 4PJOD 4DOWA 2EJGA 2RA2A 4E47A 4M78B 2JN0A 2RHXA 4GLKA 4V2SA 4XU0A 2XK0A 1VQOA 1KHIA 2EYQA 3MP8A 4KT0E 5J3BA 3SWNA 2PUOB 1FX7A 2XU8A 4M7DB 1M8VA 2RI5A 4DA4A 4QW2A 3RIRA 1VQ9T 4A4KA 4FL6A 4LDVA 3E9FA 4M77A 3CD6T 1VQLA 2RD1A 1ZQ1A 2XD0A 3QHSA 4PKCC 2HQEA 4PJOB 2E12A 2PU9B 3MP6A 4M7AG 1N6AA 3QIIA 1W2BA 3F70A 3LX7A 4QVCA 3V8KA 2EJ9A 3FC3A 4M77B 3S3OA 3OYIA 3JCMP 1YI2T 3OW2S 2VV5A 2QEXT 1YITA 3MEAA 1K8AC 2XICA 3NTKA 4OF1A 1UGPB 5A2QE 1M90C 4M7DE 4YTLA 3GOXA 3OYHA 4M7AD 3G71T 1IREB 3X28B 2DPPB 1UEBA 3HKSA 4VUBA 3UWNA 3JB9G 2XIDA 2F69A 1Q86C 4JRKA 1D3BA 2RB6A 3OSVA 3PMIA 3GPLA 4ZGJB 3PMTA 2D6FA 5LJ3g 3JB9J 4OGEA 2Y4XA 2WSCE 2LC4A 3JCMe 5DM7R 5GAMf 4OB0B 1VQOT 5CKEA 5CCAA 5LJ3j 4A4FA 3OYLA 3HFOA 5CQXA 2C06A 1WGSA 3CBMA 4J6XA 3UDCA 1B34B 1Y71A 4O6JA 4C8QA 5LJ5d 1HXDA 3CXCS 3CD6A 3E9GA 2JUFA 1VQ9A 2BIVA 4E7HA 2QA4A 4A53A 4C0DB 1QW1A 4FT2A 1NPRA 3JRZA 3CC7T 4ZN3A 5HY6A 4MDXA 1H641 2XDBA 2P4TA 2CZ7B 1M90U 3V8LA 2WACA 4C92G 2FVUA 5EG2A 3SWNC 3OS1A 2OAUA 3FIFA 4M7DC 4Y91A 2GFAA 4BACA 3LW5E 1N9SA 3URGA 3VV0A 3JCMb 4JUVA 3QPHA 3LWHA 5D6YA 3CCLT 1Q7YC 4M77D 1Q82C 1VQKT 1XQHA 5GMKh 3FEOA 1WQWA 2FHDA 4M7AE 1BI2A 2FL7A 3HRSA 3L1AA 3QBYA 1BIBA 2VGNA 1B34A 3OYYA 5A0DA 3Q1JA 5KE2A 5C0MA 2LCLA 5GAMd 1VQPT 4B9WA 1PSEA 5GAN8 1BI1A 3M9QA 3UPUA 4ZTFA 2ZZDA 1QVGS 2WSFE 2DXTA 1N27A 4BUGA 2DD4A 5I2SA 1M1KC 1YIJT 2PVGB 2E10A 5J39A 2E1HA 3TEEA 1G3TA 3CMAA 3OYBA 4HT9A 2ZPBB 2FB7A 2G3RA 2QTXA 3LLRA 5GAOm 5CR2A 4C8QF 3L2WA 3FB9A 2M1HA 4LDUA 3OYAA 2CGHA 2QQSA 4P5NA 5IN1A 2DO3A 3L2VA 5GAN3 5D6XA 3X25B 3WVDB 5J26A 3R6OA 1QP3A 1K9MC 5GAOp 2E65A 2R5MA 2HNIA 4QVZA 2Y4YA 1S72T 2EAYA 2PVDB 3V8JA 4ZGDB 3LGFA 4ELZC 3JSCA 3X20B 3S3MA 1YJ9A 1M1KU 1Q7YU 2HBPA 3CCUA 2X35A 5CKFA 3M4YA 2CKKA 2RI2A 2XHCA 4M78E 4BB7A 4C92E 2VC8A 3G71A 3RKXA 2L8DA 2JTMA 2VUBA 2ZCFB 5KH6A 2K5LA 4BI4A 3C95A 2LT4A 4M77G 4F7UF 3M4GA 5LJ5e 2HD0A 4N4GA 4N0AC 4QVDA 4J83A 2MMPA 3BDUA 4HA8A 4RG2A 4X9CA 1YI2A 5KCHA 4PJOC 2LVMA 3TU4K 1VIEA 5IAYA 2DTIA 1FXXA 1I8FA 2DAQA 2X4WA 2RHUA 5C6SA 4E7LA 1YHQA 4OB3B 1YCYA 2LTOA 1VQ5A 4C5GA 1I5LA 3M58A 1R8OB 3RESA 3M55A 3CMAT 1VQ7A 1SSFA 3MEUA 5GAOq 4E7JA 2JNGA 4MZTA 4RKUE 2R57A 3GLXA 3EFRA 4OB2B 4NOYA 1VQ8T 3CC2T 2RHZA 2K57A 3MCAB 4XTWA 5FU7C 2DZ9A 3LGLA 3RMQA 4BY6B 3RERA 2PUKB 3KBGA 2DKGA 3I56T 4IUQA 3G4ST 2H3JA 1M4ZA 3QG1A 4PJOF 3JB9D 2LQ8A 3VU3C 3GNFB 3OS0A 1YIJA 3CCSA 2K5IA 4DQ2A 2KSSA 3HRUA 4J6YA 1WNLA 3JCMf 2RJCA 3RKYA 3CCJT 2DD5A 4TVRA 2V8JA 3CCRA 1Q86U 3CCLA 3EAEA 3CPFA 5FRNA 4XQ3A 3A5ZB 4ZTJA 3HP9A 4XAXB 2RK2A 3A8MB 3OS2A 3CBOA 4IUPA 3JCMX 3CXCA 1KC8U 2K3XA 4J5YA 4LD6A 5CVIA 4C8QG 1VQ4T 1VQ6A 1KG1A 4LD9K 3MO8A 4C92D 5GAMh 3CCET 1Y07A 1VUBA 1YBYA 2BUDA 5CO7A 4C92B 3NTIA 4J7FA 3OYMA 2AHJB 3HFNA 3A8GB 4CI0C 2A7YA 4A54A 4JRPA 1WPYA 2LNVA 4M75B 4C8QC 4IKFA 4ATOA 4M7DF 3CCQA 3VKIA 4QQDA 3CC4A 4X9DA 2PQWA 3OYJA 3G6ET 1WJSA 4JLGA 5GAN7 3CEYA 1Q82U 4C0FA 1YJ9T 3A8HB 5GAN5 2KY9A 3DKMA 4OB1B 4M77F 4F7UG 1VQ7T 1NPPA 5FRMA 1G5VA 2RO0A 3V7RA 2RJEA 2EQMA 2Y90A 5CQYA 3OB9A 2X4YA 3SD4A 3SFMA 5GAMe 3G4SA 1QP2A 1XNIA 2CZ6B 4WF2A 4M7AA 2DTHA 2R58A 5GANd 5LL6S 5GAN2 3FRNA 3M54A 3MP1A 1M9SA 4PNOA 2QQAA 3JCMW 3CMET 1VIFA 3OY9A 3A8OB 2K3YA 2NLUA 2R5AA 3OS5A 3QKJA 4A4GA 2YRVA 3OBWA 3O8VA 4C0GA 4O5VA 4MMLA 3L2UA 2L5QA 2ZPHB 4C92F 5GAOl 4M75D 2MF2A 3BDLA 1JB0E 4IUUA 4II1A 1UGQB 3TREA 3X26B 4BE0A 5D6WA 2K4YA 4IURA 4L59A 2RJFA 2P0QA 2EFIA 4XTUA 5LJ3f 3MHXA 2WSEE 2FYKA 3DB4A 2JZ2A 2QQ9A 4M77C 3CPWA 3DLLA 3S3NA 1YJWA 4LDWA 4KUIA 4XU3A 3SDZA 1U1SA 4N4IA 3HRTA 2E64A 2QDYB 3FJPA 3T9NA 3L42A 3L2RA 1KQ2A 2K2VA 3PFSA 2JVVA 4J8OA 4OMFB 4NL3A 3G6EA 4R56A 3OMCA 1V29B 3QZ9B 3QYHB 3CCUT 2GCXA 2RH2A 3S6WA 5LJ3e 3CCVA 4HCCA 2XKOC 5A0GA 3JCMJ 1N8RU 4M78A 2E6NA 3J7AF 1NJIC 5GANf 1YJNA 4FU6A 2YHTA 1NE8A 4ZGEB 1JBMA 2DXCA 2I2LA 4D6WA 3C94A 2KQWA 2MWOA 1G3WA 3NTHA 4GY5A 3VYHB 3TCJA 3GIBA 4IUVA 1GXIE 2XI9A 4A4HA 2LT1A 2O4XB 2YLCA 4M7DD 2OTJA 4JDSA 4XU1A 5DY9A 3QUIA 3JB9H 4PJOG 3P8BB 4C8QE 4M7DA 3ZBDA 3LH0A 1MGQA 2DIGA 2GF7A 3E19A 4IUTA 3VJPA 3ME9A 5CKHA 2D9TA 1YJNT 2KDSA 3MEVA 3PGGA 5GANe 3P8DA 3JCMQ 1OI1A 4XTVA 4BE2A 3BW1A 3QDRB 3ER0A 1VQMA 3JB9I 3QZ5B 2E41A 1KD1U 4XTZA 4C8QB 1QVPA 4M78D 4ELYC 4EMKC 3QYGB 2RM4A 3L2QA 1H3ZA 2EQJA 5CK9A 1LOJA 4BE1A 1X01A 2ZGWA 1ZHIA 1YHQT 3SWNB 2M0OA 4PJOE 4Z02A 3JCMh 1G3YA 4M75F 1O9SA 1UB4A 3GF5A 4QQ6A 3OW2A 2B8AA 3H6ZA 2F5TX 3NFCA 4NS5A 5GANh 1NZ9A 5HKCA 3CC2A 1RI0A 4HCBA 3CC7A 2F5KA 1QVFS 4C0DC 1BI3A 3SB2A 3BFMA 1KC8C 5GAN6 3L2ZA 2RHYA 1YJWT 2ZPIB 3HPWA 1VQ5T 5L8RE 4Y28E 4R55A 3OYFA 2QEXA 1OZ2A 1YITT 1ZBXA 3HHTB 5CKDA 3OA6A 4EDUA 2GFUA 2IG0A 1OYXA 3WXMB 3M57A 2P0KA 3DB3A 5GANj 2GQVA 5GMKi 3M59A 3META 1WJRA 5FU6C 2DJZA 1M1FA 2XDDA 4JLIA 1VQLT 5DLQE 3HL8A 4C0ZA 5CIUA 3CPWS 5CKBA 2V8IA 1Y96A 4N4HA 4E7KA 2LX9A 4C5HA 2YLBA 4M7DG 3CC4T 1M1GA 3V7SA 4EMKB 2E5QA 3PT9A 2EJFA 4C92C 3JCMg 2QXFA 4PLLA 4HCZA 5AYFA 1K9MU 3OSSC 1VQ6T 4KBMB 1U8RA 4M7AF 5LJ3d 2ZPFB 4FM4B 4EMHA 2DXBA 4X34A 2X4XA 3PIPA 2QA4T 1VQKA 1QVFA 4KULA 1BI0A 5I2MA 5GMKe 4M7AC 3QSUA 5GMKm 4F7UB 2KVQG 4OGCA 1I4K1 1WJQA 1VQPA 3RKWA 4JJNK 2CYZB 1MHNA 3FDRA 3INZA 3QJ6A 1K73U 4MDWA 4F7UE 4QQGA 2KAFA 4XK8E 2X4JA 4E7IA 3DLMA 4C92A 3OQ5A 3CCRT 5HK0A 3OYEA 1KHCA 5GMKj 3CCJA 4J7IA 5LJ5g 3OYKA 3FLGA 1AHJB 1TH7A 2CZ1B 2D0QB 2K5FA 2QI2A 4XTYA 3CBPA 2P0PA 4EMKA 3CCMA 1K8AU 3OYNA 5KE3A 2DK3A 4M75E 3C12A 1JJ2A 2HAXA 2M9UA 1XTDA 2EWNA 2M16A 3C4SA 3I56A 3LWIA 2ZPGB 4L6V5 2L3RA 2LRQA 3E1SA 4B9XA 4EPCA 2MI6A 2DEQA 1QVGA 1VQNA 4JS5A 1VQ8A 2E70A 3VUBA 3OBYA 1PSFA 3GNGA 4C5EA 2RK1A 1KQSA 1W2BS 3RMSA 3LYIA 2RHIA 1Y96B 3MEWA 4MZMA 4M7AB 1EIFA 5GAOr 1NJIU 3X24B 4PLIA 2LCCA 2HQXA 5LJ5j 3PTAA 4Q5WA 5IT9E 5LJ5f 4LDXA 2BKDN 1LJOA 2MAMA 4XU2A 4C8QD 3H8ZA 4M77E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQK A;  2RHZ A;  2DIG A;  2GF7 A;  3LH0 A;  3PMI A;  3LGL A;  4IUT A;  3ME9 A;  5M9O A;  3PMT A;  2D9T A;  5KCO A;  4IUQ A;  3MEV A;  3OMG A;  3P8D A;  3OYG A;  1OI1 A;  4BDY A;  2MWP A;  4BE2 A;  3OS0 A;  2RJC A;  4BD3 A;  2L89 A;  4A4F A;  3OYL A;  5FRN A;  3EAE A;  4UC4 A;  3L2Q A;  4ZTJ A;  1H3Z A;  2EQJ A;  1WGS A;  4BE1 A;  3OS2 A;  4IUP A;  2EKO A;  2K3X A;  4LD6 A;  3ASK A;  2M0O A;  3MO8 A;  4Z02 A;  3E9G A;  2DIQ A;  2BIV A;  4E7H A;  2QQR A;  4QQ6 A;  5FRO A;  2LDM A;  2B8A A;  3H6Z A;  4NS5 A;  2BUD A;  3NTI A;  3OYM A;  1RI0 A;  2F5K A;  4IKF A;  2WAC A;  2RHY A;  3OYD A;  2VYT A;  4QQD A;  3UT1 A;  3OS1 A;  2EQU A;  3OYF A;  2PQW A;  1OZ2 A;  3OYJ A;  1WJS A;  2GFA A;  3CEY A;  4BAC A;  3OA6 A;  4EDU A;  5D6Y A;  4A4E A;  2GFU A;  2IG0 A;  1OYX A;  5FRM A;  1G5V A;  2P0K A;  2RO0 A;  2RI3 A;  2FHD A;  2RJE A;  2EQM A;  3DB3 A;  3FEO A;  4CRI A;  4BDZ A;  3QBY A;  3MET A;  1WJR A;  3OB9 A;  5KE2 A;  3Q1J A;  2X4Y A;  3ZEH A;  5C0M A;  3SD4 A;  4B9W A;  1XNI A;  5CIU A;  2R58 A;  3M9Q A;  4ZTF A;  3MP1 A;  4N4H A;  4E7K A;  4C5H A;  3OY9 A;  1N27 A;  3P8H A;  3OYC A;  2K3Y A;  2NLU A;  2R5A A;  2RJD A;  4C5I A;  3QKJ A;  4A4G A;  2E5Q A;  2JTF A;  2YRV A;  2XDP A;  5J39 A;  3OYB A;  4PLL A;  4HCZ A;  3O8V A;  1OZ3 A;  3L2U A;  2G3R A;  2O4X A;  3LLR A;  3BDL A;  3L2W A;  4IUU A;  4II1 A;  4PL6 A;  2M1H A;  3OYA A;  4BE0 A;  4X34 A;  2X4X A;  5D6W A;  2QQS A;  4IUR A;  4L59 A;  5IN1 A;  2RJF A;  3L2V A;  4OVA A;  5D6X A;  2EFI A;  1WJQ A;  1MHN A;  3DB4 A;  3FDR A;  2JZ2 A;  3KUF A;  3PNW C;  3QJ6 A;  5J26 A;  3S3N A;  4QQG A;  2R5M A;  4QVZ A;  4N4I A;  4E7I A;  3DLM A;  2RHX A;  3L42 A;  3LGF A;  3OQ5 A;  3L2R A;  3S3M A;  3PFS A;  1KHC A;  2XK0 A;  3OYE A;  2X35 A;  3MP8 A;  2CKK A;  2RI2 A;  3FLG A;  3OMC A;  3OYK A;  3S6W A;  2RI5 A;  2L8D A;  4QW2 A;  3OYN A;  5KE3 A;  5KH6 A;  2E6N A;  4FL6 A;  3E9F A;  3C4S A;  2M16 A;  4FU6 A;  2L3R A;  2LRQ A;  4B9X A;  2HQE A;  4N4G A;  3MP6 A;  3QII A;  4RG2 A;  3F70 A;  3LX7 A;  5KCH A;  3FC3 A;  2LVM A;  4C5E A;  3S3O A;  3OYI A;  5IAY A;  4GY5 A;  3NTH A;  2MWO A;  3LYI A;  2RHI A;  4IUV A;  2DAQ A;  4A4H A;  2X4W A;  2RHU A;  3MEA A;  3MEW A;  5C6S A;  3NTK A;  2LTO A;  2O4X B;  4E7L A;  4C5G A;  4PLI A;  2LCC A;  2HQX A;  4Q5W A;  3GOX A;  1SSF A;  2BKD N;  3MEU A;  3OYH A;  4E7J A;  2R57 A;  3H8Z A;  3UWN A; 
#chains in the Genus database with same CATH topology
 3AHU A;  2F2V A;  3J80 E;  3ZFJ A;  2DBK A;  3OYG A;  3RBB B;  4JJB A;  5FU7 B;  2KRN A;  2V8K A;  1KQS S;  2VXE A;  5FU6 B;  1SRL A;  1IZ6 A;  4UC4 A;  1SSH A;  3I55 Q;  1QVF P;  4ME7 A;  1I81 A;  2OTL Q;  1C6V X;  3UF4 A;  1WLP B;  4IIO A;  1QLY A;  3OYD A;  2VYT A;  4EMG A;  4RTT A;  2KMT A;  1RAH B;  3CCE A;  2LZ6 B;  1X6O A;  4OMO A;  4BI8 B;  1VQ4 A;  1OV3 A;  3V7C A;  3EGD A;  4L5G A;  1SRM A;  5HCK A;  3HSB A;  1CKA A;  2QQB A;  1U1T A;  3EGD B;  2KK4 A;  3CCS T;  2RJD A;  1S72 Q;  2JTF A;  3CCM T;  1RL2 A;  1KQ1 A;  1OPL A;  5IH2 A;  4LXC A;  4PL6 A;  4FIB A;  3KUF A;  3BE3 A;  1PM3 A;  2JW4 A;  4PJO D;  2EIF A;  2CSI A;  3H0F A;  2RA2 A;  1WA7 A;  2XK0 A;  4KT0 E;  4JJD A;  1W2B P;  4DA4 A;  4QW2 A;  1E6G A;  4FL6 A;  4A4K A;  4M77 A;  2AKK A;  1B7T A;  1VQ8 Q;  2RD1 A;  5FWC A;  1TUD A;  4PJO B;  2ESW A;  2PU9 B;  2HSP A;  2K7A A;  3LX7 A;  4QVC A;  3I56 Q;  3FC3 A;  4M77 B;  2LP5 A;  1YIT A;  2L2P A;  1K8A C;  3NTK A;  1Q86 R;  2ECZ A;  3CCJ Q;  4PJN A;  2NWM A;  2O2O A;  1AZG B;  1IRE B;  3EGU A;  3JB9 G;  1KFZ A;  4JRK A;  2RB6 A;  4AMC A;  4FYW B;  1NEG A;  2D6F A;  1HSQ A;  2OX7 A;  1VQK Q;  5IHN A;  1WXB A;  4AFU C;  1WIE A;  1VQO T;  5CKE A;  3OYL A;  2PTK A;  1Y71 A;  5LJ5 d;  2RQU A;  4DBF A;  4E7H A;  1D0Y A;  3CC7 T;  1NPR A;  3JRZ A;  3EGX A;  1RAB B;  1H64 1;  4HCK A;  2CH4 W;  5EG2 A;  3EGX B;  1VYV A;  4Y91 A;  4BAC A;  3URG A;  1SKU B;  3MJX A;  3VV0 A;  3LWH A;  3QPH A;  4M77 D;  2NUZ A;  4HXJ A;  2FHD A;  2BTT A;  2KRO A;  5KE2 A;  3UPU A;  4ZTF A;  2DL3 A;  1M1K C;  5I2S A;  1JJ2 P;  2PVG B;  2E10 A;  2DE0 X;  2YWW A;  3OYB A;  2G3R A;  5CR2 A;  2J6K A;  4C8Q F;  1ZA1 B;  2M1H A;  3FB9 A;  4LDU A;  3OYA A;  2QQS A;  3L2V A;  2ED0 A;  2PVD B;  3V8J A;  2FPF A;  3JSC A;  2QTV A;  1Q7Y U;  2HBP A;  1QCN A;  4M78 E;  2XHC A;  4C92 E;  3RKX A;  1VA7 A;  1Q82 R;  2J7I A;  4BI4 A;  3C95 A;  2VKN A;  1IHW A;  4Z89 A;  5LJ5 e;  4N4G A;  4N0A C;  1ZA2 B;  2H3E B;  4HA8 A;  2KRS A;  5KCH A;  2LVM A;  2DA9 A;  1SEM A;  1FXX A;  2DAQ A;  2DLP A;  2RHU A;  3O5Z A;  1YCY A;  2V26 A;  1I5L A;  3M58 A;  9ATC B;  1R8O B;  3M55 A;  2A28 A;  4DEY A;  3MEU A;  2R57 A;  3EFR A;  4PJL A;  3CC2 T;  3UA6 A;  5FU7 C;  4XTW A;  4BY6 B;  1NLP C;  4DBH A;  3U23 A;  3QG1 A;  3OS0 A;  1YIJ A;  3CCS A;  2KSS A;  2JMA A;  3AT1 B;  2V8J A;  3EAE A;  2EPD A;  2GBQ A;  3CBO A;  4IUP A;  2HL5 C;  3JCM X;  4LD6 A;  1VQ6 A;  1VQ4 T;  1VUB A;  3G4S Q;  2DRK A;  2BUD A;  3NTI A;  1NEB A;  1GCQ A;  3HFN A;  1ABQ A;  3SHW A;  1QWE A;  4JRP A;  3E2U A;  1JO8 A;  4C8Q C;  2YUQ A;  3CC4 Q;  4IIM A;  1BCM A;  3VS1 A;  2EYX A;  2FPE A;  4C0F A;  2V1R A;  4OB1 B;  1NPP A;  2E5K A;  1PCX A;  3LH5 A;  3OB9 A;  4F14 A;  3SD4 A;  5GAM e;  1RI9 A;  2DEU A;  2JM9 A;  2CZ6 B;  4WF2 A;  4M7A A;  3M54 A;  3MP1 A;  4PNO A;  3CME T;  3VS6 A;  3OY9 A;  3A8O B;  4FYV B;  1HD3 A;  2JM8 A;  2BZ8 A;  1M2V A;  2K79 A;  2P4R A;  3QKJ A;  4A4G A;  3OBW A;  3CCL Q;  4O5V A;  4MML A;  2HCK A;  2L5Q A;  4C92 F;  2CDT A;  4M75 D;  4CC2 A;  1JB0 E;  4II1 A;  3X26 B;  2K4Y A;  4IUR A;  4L59 A;  4XTU A;  3MHX A;  3DB4 A;  2JZ2 A;  3S3N A;  4LDW A;  3SDZ A;  1VQ7 Q;  3T9N A;  2EGE A;  3L42 A;  4OMF B;  4NL3 A;  3CCU T;  1V29 B;  3QYH B;  3CCV A;  3S6W A;  2RH2 A;  4HCC A;  5A0G A;  4M78 A;  3J7A F;  2SEM A;  1BB9 A;  1RLQ C;  7AT1 B;  3CXC P;  1T0H A;  2KT8 A;  1TS9 A;  1FMK A;  3EG2 A;  2KQW A;  2MWO A;  3QWY A;  3GIB A;  4A4H A;  1BK2 A;  2YLC A;  2EVR A;  2OTJ A;  1RAA B;  1MMN A;  1YWO A;  4XU1 A;  4C8Q E;  3ZBD A;  3ME9 A;  5CKH A;  2D9T A;  1YJN T;  3GBQ A;  3MEV A;  1B07 A;  1OI1 A;  1JU5 C;  1VQM A;  3ER0 A;  1AWX A;  1K4U S;  2E41 A;  3MKD A;  4EMK C;  4ELY C;  4RTW A;  2RM4 A;  1H3Z A;  2EQJ A;  1X01 A;  1SPK A;  1YHQ T;  3SWN B;  4LUD A;  4PJO E;  1G3Y A;  1O9S A;  5FWB A;  1IXD A;  2DX1 A;  1K73 R;  4R0K A;  5GAN h;  2COW A;  1NZ9 A;  2D8J A;  1QCF A;  4JZ3 A;  1B3Q A;  3L2Z A;  4HVU A;  3PVQ A;  2ZPI B;  3HPW A;  5L8R E;  4R55 A;  3OYF A;  2QEX A;  1ZBX A;  2A36 A;  2GFU A;  1WHM A;  2YDL A;  2DNU A;  2EKH A;  4J9I A;  3VRY A;  2DYI A;  1PHT A;  3HL8 A;  3CPW S;  1VQ9 Q;  2HKQ B;  2LX9 A;  2YLB A;  1X2K A;  2AZV A;  4C92 C;  5AYF A;  1WDX A;  2BZY A;  4KBM B;  4EMH A;  2CP6 A;  4KUL A;  4M7A C;  1VQP A;  3RKW A;  2CYZ B;  3QJ6 A;  1K73 U;  4MDW A;  1K1Z A;  4F7U E;  4XK8 E;  2X4J A;  4E7I A;  5FW9 A;  3G1J A;  5GMK j;  4J7I A;  5LJ5 g;  3OYK A;  3FLG A;  1AHJ B;  1TH7 A;  2D0Q B;  2ZAE A;  2P0P A;  1K8A U;  3OYN A;  1JJ2 A;  1XTD A;  2EWN A;  2J06 A;  4EPC A;  4B6M A;  5EC7 A;  4JS5 A;  1PSF A;  4C5E A;  1W2B S;  3LYI A;  1M27 C;  2YT6 A;  4J9H A;  4M7A B;  3X24 B;  3PTA A;  1VQO Q;  2D1X A;  4LDX A;  2BKD N;  1LJO A;  3P8D A;  2DZC A;  4HT8 A;  2EQK A;  5M9O A;  1NM7 A;  4M75 C;  1LPL A;  3EG1 A;  4KUD K;  4N0A A;  2DJQ A;  2A37 A;  2VGM A;  4BDY A;  4QT7 A;  2MWP A;  2IVW A;  1ARK A;  2O01 E;  1D09 B;  2L89 A;  3KXT A;  1O75 A;  3RR6 A;  2EKO A;  2ATC B;  4J6W A;  1K73 C;  3UAT A;  1HK9 A;  3JAM E;  1UEC A;  1YCS B;  3N5B B;  3CCQ T;  1AVZ C;  1P92 A;  1YNZ A;  2RNA A;  4AG1 C;  1UJ0 A;  3QO3 A;  4KGX B;  3UT1 A;  2JJ9 A;  5GAO n;  1OU8 A;  4BDZ A;  3BY7 A;  2L3S A;  5A0L A;  5GAN 4;  3ZEH A;  1TOV A;  4NL2 A;  2XG8 D;  3P8H A;  1LNX A;  2BZX A;  2HEQ A;  3OYC A;  5GMK l;  4C5I A;  1UHF A;  4FYX B;  2P84 A;  1N9R A;  2GTO A;  1M3C A;  5DLO A;  3CME Q;  2FG0 A;  1ZSZ A;  1DJ7 B;  3M0Q A;  2EJG A;  2RHX A;  4XU0 A;  1VQO A;  2PZ1 A;  1D0X A;  3SWN A;  2FZK B;  2PUO B;  1FX7 A;  2XU8 A;  2YUO A;  1SHG A;  3RIR A;  1VQ9 T;  3E9F A;  2SRC A;  1ZQ1 A;  2XD0 A;  2HQE A;  2A08 A;  3QII A;  2O9V A;  3A98 A;  3V8K A;  1N5Z A;  3JCM P;  1PRM C;  2EGA A;  1ZUU A;  4E7Z A;  2QEX T;  3MEA A;  3RNJ A;  4KRT A;  4M7D E;  3X28 B;  3HKS A;  1UEB A;  2K9G A;  2F69 A;  2EBP A;  3OSV A;  3PMI A;  1VQP Q;  4ZGJ B;  2Y4X A;  5GAM f;  4OB0 B;  5LJ3 j;  5CQX A;  2KXD A;  3CBM A;  4J6X A;  2KR3 A;  3NHN A;  3UDC A;  2JUF A;  1QW1 A;  2MIO A;  2YXY A;  4KH0 B;  1M90 U;  4J9F A;  4C92 G;  1Q7Y C;  2KI7 A;  1XQH A;  2W10 A;  3FEO A;  4M7A E;  1RAI B;  3L1A A;  5A0D A;  1YFN A;  2VGN A;  5GAM d;  1X6B A;  2KEA A;  1QVG S;  2DXT A;  1N27 A;  1YIJ T;  3TEE A;  4HT9 A;  2CSQ A;  2ZPB B;  2LJ1 A;  5GAO m;  4E2F B;  3ULR B;  3REB B;  1I07 A;  2CP0 A;  2B86 A;  5KYU A;  1SG5 A;  4P5N A;  2AK5 A;  2DO3 A;  1V76 A;  2DL5 A;  3WVD B;  1K9M C;  2NUP A;  5GAO p;  2R5M A;  2HNI A;  4QVZ A;  3TQ7 P;  2OTJ Q;  2MYS A;  2X35 A;  3M4Y A;  4BB7 A;  3OW2 P;  2CP2 A;  1R77 A;  2JTM A;  2VUB A;  5KH6 A;  2K5L A;  4F7U F;  1K9A A;  1H8K A;  2OAW A;  1SHF A;  4X9C A;  1VIE A;  2AZS A;  1X2Q A;  2DTI A;  1I8F A;  3CCV Q;  5C6S A;  1VQ5 A;  1YHQ A;  4C5G A;  1OX8 A;  4F04 B;  3RES A;  1SSF A;  5GAO q;  2JNG A;  2LQN A;  4RKU E;  3GLX A;  4OB2 B;  1ZSZ C;  1YJW Q;  1VQ8 T;  2RHZ A;  3RMQ A;  2DZ9 A;  2PUK B;  3I56 T;  1ZUK A;  3H0H A;  1CSK A;  3JCM f;  2DF6 A;  3RKY A;  1BCO A;  3CCR A;  3CCL A;  3A5Z B;  4ZTJ A;  4XAX B;  3OS2 A;  2FRY A;  2K3X A;  2JT4 A;  2EYZ A;  1YBY A;  1PD1 A;  4J7F A;  1K9M R;  4CI0 C;  3H9N A;  3M0U A;  2JXB A;  4ATO A;  3CCQ A;  1IO6 A;  3CC4 A;  1M3A A;  3CCQ Q;  1Q82 U;  3CEY A;  1YJ9 T;  1WHL A;  1TXQ A;  3A8H B;  5GAN 5;  2KY9 A;  3DKM A;  4M77 F;  5FRM A;  1C1A A;  2RJE A;  2EQM A;  1Z9Q A;  3EG9 B;  2E3I A;  5CQY A;  1AWW A;  2X4Y A;  1D1B A;  3SFM A;  2H8H A;  1QP2 A;  1XNI A;  2DTH A;  1WYX A;  3JCM W;  1VQ6 Q;  2QAS A;  2R5A A;  2NLU A;  3OS5 A;  1K8A R;  5KYW A;  2YRV A;  5I22 A;  3CCR Q;  3L2U A;  1NBE B;  1OPK A;  3TRE A;  1WXU A;  2C0I A;  1M30 A;  2EFI A;  5KYN A;  2WSE E;  2AKL A;  2FYK A;  2QQ9 A;  1YJW A;  4KUI A;  1U1S A;  2E64 A;  3FJP A;  5GJV B;  3L2R A;  1KQ2 A;  1YHQ Q;  1VQ5 Q;  3QZ9 B;  2GCX A;  2KT1 A;  3JCM J;  1PRL C;  2AIR B;  4ZGE B;  1JBM A;  4ZNX A;  1LCK A;  2I2L A;  2VWF A;  4IUV A;  1YWP A;  2BE9 B;  4M7D D;  4JDS A;  1MND A;  2VB6 A;  3QUI A;  3EG0 A;  4IUT A;  2DIG A;  2GF7 A;  4QKU A;  1IHV A;  2KDS A;  3PGG A;  5GAN e;  4XTV A;  3JB9 I;  4C8Q B;  4PJJ A;  1QVP A;  4J9G A;  4M78 D;  3L2Q A;  1ZHI A;  4PFO A;  4LUE A;  2OJ2 A;  3H6Z A;  2F5T X;  2JTE A;  1QVF S;  2OI3 A;  4E7S A;  3SB2 A;  2DER A;  1KC8 C;  5GAN 6;  5KYX A;  1JEG A;  2RHY A;  4Y28 E;  1HYO A;  1N8R R;  3OA6 A;  2IG0 A;  1V1C A;  3M0R A;  3DB3 A;  2GQV A;  5KYY A;  5FU6 C;  3SEM A;  1GBR A;  4JLI A;  5DLQ E;  5CKB A;  2V8I A;  1I5O B;  3CC4 T;  3V7S A;  1FYN A;  2E5Q A;  2EJF A;  3JCM g;  1U8R A;  1BU1 A;  3EHQ A;  1G83 A;  2X4X A;  1QVF A;  2QA4 T;  2DFU A;  3QSU A;  5GMK m;  1TUC A;  1WJQ A;  2QGF B;  3FDR A;  3EH1 A;  4QQG A;  3OQ5 A;  5HK0 A;  3OYE A;  1KHC A;  3CCJ A;  2RQR A;  2CZ1 B;  2K5F A;  4EMK A;  2DBM A;  2Z0W A;  2E3H A;  5KE3 A;  2HAX A;  3I56 A;  2M16 A;  1I1J A;  4L6V 5;  1T3L A;  2L3R A;  4B9X A;  2DEQ A;  4KGZ B;  1VQ8 A;  2E70 A;  3VUB A;  3GNG A;  1TTH B;  1E7O A;  2GQI A;  1Y96 B;  2ED1 A;  1EIF A;  5LJ5 j;  1KJW A;  4WCI A;  1W1F A;  3H8Z A;  4M77 E;  4JS4 A;  1EZZ B;  5CAI A;  3EHR A;  1N8R C;  1PC0 A;  4M75 A;  2DVE A;  4ANJ A;  5LJ5 h;  3CME A;  1BBZ A;  4BD3 A;  5I21 A;  5IHI A;  3WVE B;  8AT1 B;  3JCM V;  2YRC A;  1Q81 C;  2LQK A;  4K11 A;  1OEB A;  2DL8 A;  3ASK A;  3M5A A;  2CRE A;  3GP8 A;  2DIQ A;  2QQR A;  2A3L A;  5FRO A;  4RTX A;  1M5Q 1;  4DOV A;  1VQM T;  4AFS C;  2CH4 A;  3H41 A;  4JRQ A;  4JRI A;  2I0N A;  1XOV A;  3QXE B;  4ZN1 A;  3I55 T;  3M53 A;  1ZSZ B;  2EQU A;  1R0B G;  1JRI A;  2KNB B;  2ZPE B;  4FSS A;  4A4E A;  4PK4 A;  2QDL A;  4OMP A;  1WQ7 A;  2RI3 A;  1VQN T;  1NYG A;  2C0T A;  2DXU A;  1W4S A;  4M75 G;  4RG8 A;  4PJO A;  3JCM c;  4BI3 A;  2OTL A;  1Y7X A;  3QJY A;  2HKN A;  5FLX E;  2XDP A;  3VYG A;  2OTJ T;  3M56 A;  1JXO A;  1BKB A;  4OVA A;  1UGS B;  1UGR B;  1TU0 B;  1S1N A;  4E47 A;  2JN0 A;  2D8H A;  2LJ0 A;  5J3B A;  4M7D B;  1M8V A;  2RI5 A;  1AWJ A;  4D8D A;  3CD6 T;  1GFD A;  1VQL A;  3QHS A;  2E12 A;  3MP6 A;  4M7A G;  1N6A A;  1W2B A;  2EJ9 A;  2W0Z A;  3OYI A;  1YI2 T;  2VV5 A;  1SF9 A;  5IXB A;  2XIC A;  4OF1 A;  1M90 C;  1RAC B;  4YTL A;  2CT4 A;  3GOX A;  3OYH A;  4M7A D;  3G71 T;  2DPP B;  2ROL A;  4VUB A;  3UWN A;  5KYY B;  2COZ A;  2XID A;  1D3B A;  1MMD A;  3EFO B;  3PMT A;  3VS4 A;  3HTR A;  1AT1 B;  3JB9 J;  4CC3 A;  1EFN A;  3R6N A;  4JPB W;  5DM7 R;  2M0Y A;  2G6F X;  5CCA A;  4A4F A;  3HFO A;  1UGV A;  4E6R A;  3M0P A;  2DVJ A;  1KK7 A;  4O6J A;  2K6D A;  1HXD A;  1ZBJ A;  3CXC S;  3CD6 A;  3E9G A;  1VQ9 A;  2BIV A;  1AWO A;  4A53 A;  4C0D B;  4ZN3 A;  4MDX A;  4A63 B;  1AZE A;  1UFF A;  1K0X A;  2CZ7 B;  3V8L A;  2FZC B;  2WAC A;  2QEX Q;  3SWN C;  3FIF A;  2ABL A;  4M7D C;  2GFA A;  3LW5 E;  3JCM b;  1EX4 A;  1WQW A;  1BI2 A;  3CC7 Q;  3HRS A;  3QBY A;  1BIB A;  3CC2 Q;  1B34 A;  2LCL A;  1VQP T;  4B9W A;  1C0M A;  5GAN 8;  1BI1 A;  3M9Q A;  3A1P A;  1WHK A;  2WSF E;  1UDL A;  2DD4 A;  3M0S A;  2GGR A;  5J39 A;  3CMA A;  2FB7 A;  1QKX A;  2QTX A;  3LLR A;  3NMZ C;  1QMC A;  1IRX A;  1VQM Q;  4LN2 A;  1AOJ A;  3THK A;  2CGH A;  1ZX6 A;  3IQL A;  3R6O A;  1QP3 A;  2E65 A;  2Y4Y A;  4ZGD B;  4ELZ C;  3FJ5 A;  3S3M A;  1M1K U;  2X9H A;  1F1B B;  2ZCF B;  2LT4 A;  2GNC A;  2KGT A;  3M4G A;  1MMG A;  2HD0 A;  4QVD A;  4J83 A;  4RG2 A;  1YI2 A;  4PJO C;  4LE9 A;  2YRD A;  2X4W A;  4OB3 B;  3G6E Q;  1RUW A;  3CMA T;  1Q95 G;  1VQ7 A;  4E7J A;  2LJ3 A;  1X6G A;  2CP5 A;  2KYB A;  2K57 A;  3LGL A;  3RER A;  1X69 A;  3KBG A;  2DKG A;  4IUQ A;  2DL7 A;  3G4S T;  2K2M A;  2H3J A;  3M0T A;  3JB9 D;  1IGQ A;  4DQ2 A;  3HRU A;  4J6Y A;  1WNL A;  2RJC A;  2DD5 A;  2QYZ A;  1Q86 U;  1TG0 A;  5L23 A;  4XQ3 A;  2KRM A;  2K3B A;  1KC8 U;  4C8Q G;  1UUE A;  4LD9 K;  5GAM h;  3CCE T;  1CKB A;  4C92 B;  3OYM A;  2A7Y A;  4A54 A;  1WPY A;  2LNV A;  4M75 B;  4M7D F;  4OML A;  3VKI A;  4X9D A;  2PQW A;  3OYJ A;  4GLM A;  4JLG A;  2HZY A;  5GAN 7;  4J9E A;  2RO0 A;  3V7R A;  1U5S A;  3ZL7 C;  3G4S A;  2HL3 A;  1QCO A;  3FRN A;  3I5S A;  2QQA A;  1VIF A;  2JS0 A;  2J05 A;  2K3Y A;  4C0G A;  2EW3 A;  2LNH B;  1TWB A;  2ZPH B;  3CPW P;  2MF2 A;  3CCS Q;  1YIJ Q;  1WXT A;  4IUU A;  4BE0 A;  4PFP A;  2L3P A;  2RJF A;  2DRM A;  2P0Q A;  5LJ3 f;  2HMA A;  4N4I A;  4Z88 A;  2QDY B;  2K2V A;  2LCS A;  3OMC A;  5GAN f;  1YJN A;  4FW2 A;  4FU6 A;  2YHT A;  1K0S A;  2DXC A;  1PNJ A;  4OMQ A;  1M2V B;  4D6W A;  4GY5 A;  3C94 A;  1G3W A;  3VYH B;  1GXI E;  3CQT A;  3TCJ A;  2XI9 A;  2O4X B;  3CCU Q;  3VS2 A;  3JB9 H;  3JV3 A;  1OU9 A;  2DL4 A;  3P8B B;  4M7D A;  3LH0 A;  1MMA A;  3I35 A;  1OUL A;  3BW1 A;  2MCN A;  1FMV A;  2RF0 A;  3QZ5 B;  8ATC B;  1KD1 U;  4XTZ A;  3QYG B;  5CK9 A;  4BE1 A;  4Z8A A;  2ZGW A;  2ROT A;  4Z02 A;  1W6X A;  4M75 F;  3GF5 A;  4QQ6 A;  3OW2 A;  2B8A A;  2VAS A;  3VS5 A;  1K76 A;  1QKW A;  2MK5 A;  1RI0 A;  4HCB A;  2F5K A;  4C0D C;  1BI3 A;  1NG2 A;  3BFM A;  1OZ2 A;  3HHT B;  5CKD A;  3WXM B;  3M57 A;  5GAN j;  4LNP A;  3M59 A;  1WJR A;  2DJZ A;  1M1F A;  2EYY A;  1VQL T;  5CIU A;  1G8X A;  2EQI A;  1GRI A;  4N4H A;  1ABO A;  4E7K A;  1PKT A;  4PLL A;  4HCZ A;  1UTI A;  1X27 A;  1K9M U;  3OSS C;  2D0N A;  1VQ6 T;  4M7A F;  3VRZ A;  4FM4 B;  1IB8 A;  2DXB A;  4X34 A;  1VQK A;  4WTO B;  1BI0 A;  4JZ4 A;  5I2M A;  1UG1 A;  2KVQ G;  4OGC A;  4RTV A;  1MNE A;  2M51 A;  4JJN K;  1G2B A;  1MHN A;  3INZ A;  2BE7 D;  1D0Z A;  2E4H A;  3DLM A;  4C92 A;  3CCR T;  2DET A;  1YIT Q;  4XTY A;  3CBP A;  3CCM A;  3C12 A;  3C4S A;  3TSW A;  1ZSG A;  2ZPG B;  2ENM A;  2LRQ A;  3E1S A;  2MI6 A;  1QVG A;  1VQN A;  1GL5 A;  2DM1 A;  2NUT B;  1KQS A;  2CT3 A;  1Y0M A;  1NJI U;  2L0A A;  3C0C A;  5IT9 E;  5ECA A;  2MAM A;  4DBQ A;  4C8Q D;  3NGP A;  4OMN A;  2YSQ A;  1U3O A;  4RTU A;  5KCO A;  5HK3 A;  1D3B B;  3OMG A;  1BIA A;  3A8L B;  1KSW A;  4RMO A;  4FCY A;  5GAM g;  2YUP A;  4KH1 B;  4M78 F;  2JOY A;  4MMK A;  4HKE A;  1S72 A;  4Y92 A;  2F2W A;  4M78 C;  5GAM j;  2FEI A;  3EFO A;  4XTX A;  2LDM A;  1BYM A;  3G7Z A;  3JCM d;  1ZLM A;  1VQ4 Q;  2F2X A;  5IHK A;  2LX7 A;  3CCE Q;  2O88 A;  4RCC A;  1AEY A;  2HQH A;  2VXF A;  4BY6 C;  1X75 C;  3PE0 A;  3H0I A;  1KD1 C;  2QG9 B;  5GAN g;  4OP0 A;  4CRI A;  2PNI A;  3RUX A;  1G3S A;  1WHH A;  1JXM A;  2CZ0 B;  1MUZ A;  4FSX A;  3VS3 A;  4F7U A;  4KGV B;  4RTY A;  3PIO A;  1Q81 U;  2OTL T;  2LQW A;  3I55 A;  4JJC A;  3MPU B;  1M2O A;  1FWZ A;  1OZ3 A;  2DTO A;  4MZP A;  2E6Z A;  2O4X A;  3CCV T;  3EFS A;  1PWT A;  2PVO B;  4FYY B;  4RCB A;  4LDY A;  2IPO B;  4FT4 A;  2VVK A;  2X51 A;  3VUZ A;  1JJ2 S;  5LJ3 h;  4AFZ C;  1X43 A;  2CS7 A;  3PNW C;  3JB9 F;  3J81 E;  4M78 G;  4DOW A;  4V2S A;  4M78 B;  2NYS A;  4GLK A;  1KHI A;  2EYQ A;  3MP8 A;  3PVL A;  2RPN A;  4ORZ A;  4LDV A;  1VQN Q;  4PKC C;  3F70 A;  3S3O A;  3OW2 S;  1VOM A;  3CCM Q;  1UHC A;  1UGP B;  2A0F B;  5A2Q E;  2FO0 A;  1WX6 A;  1FMW A;  1Q86 C;  1M90 R;  3REA B;  2KBT A;  3GPL A;  1Q81 R;  2MOX A;  1KD1 R;  5LJ3 g;  2COY A;  3EH2 A;  4OGE A;  2WSC E;  2LC4 A;  3JCM e;  1PG5 B;  2KE9 A;  2C06 A;  1WGS A;  1B34 B;  1M1K R;  2O9S A;  4C8Q A;  2RQV A;  2QA4 A;  4FT2 A;  1WFW A;  5HY6 A;  2X3W D;  2XDB A;  2P4T A;  2GTJ A;  1LVK A;  2FVU A;  3OS1 A;  2OAU A;  5AT1 B;  1N9S A;  1TSF A;  4JUV A;  5D6Y A;  3CCL T;  1Q82 C;  1VQK T;  5GMK h;  2QK0 A;  2FL7 A;  2JMC A;  2YUN A;  3OYY A;  3Q1J A;  2RN8 A;  5C0M A;  1PSE A;  1NYF A;  1KIK A;  2ZZD A;  1GCP A;  4BUG A;  4AFQ C;  2QGG A;  2E1H A;  2EGC A;  1G3T A;  2FPD A;  3L2W A;  2AT1 B;  1UE9 A;  4M4Z A;  5IN1 A;  4OMM A;  4F16 A;  5GAN 3;  5D6X A;  3X25 B;  1UJY A;  1AD5 A;  2LMJ A;  5J26 A;  1W70 A;  2DIL A;  2J6F A;  1D1C A;  1S72 T;  2EAY A;  3LGF A;  3X20 B;  1YJ9 A;  1KQS P;  3CCU A;  5CKF A;  2CKK A;  2RI2 A;  2RMO A;  2VC8 A;  3G71 A;  2L8D A;  1ZUY A;  4M77 G;  4GBQ A;  3QDF A;  2MMP A;  3BDU A;  1YJN Q;  5KYU B;  3TU4 K;  3I5R A;  5IAY A;  3VS7 A;  4E7L A;  2KXC A;  2LTO A;  2CUD A;  3VS0 A;  4MZT A;  4NOY A;  3MCA B;  2HDA A;  4ESR A;  2RQT A;  1QQJ A;  1M4Z A;  2HBW A;  4PJO F;  2LQ8 A;  3VU3 C;  3GNF B;  2K5I A;  1RAE B;  3QWX X;  2X3X D;  3CCJ T;  1M8M A;  4TVR A;  5FRN A;  1WI7 A;  1RAG B;  3CPF A;  4RUG A;  1OX9 A;  6AT1 B;  3HP9 A;  2RK2 A;  3A8M B;  3CXC A;  4HVV A;  4J5Y A;  5CVI A;  1KG1 A;  3MO8 A;  4C92 D;  1GCQ C;  1Y07 A;  4J9C A;  1A0N B;  1M3B A;  5CO7 A;  4AT1 B;  4J9B A;  2AHJ B;  2F1L A;  1U06 A;  3A8G B;  2HSE B;  4PFZ A;  1VYT A;  4IKF A;  2RQW A;  4QQD A;  3G6E T;  1WJS A;  4CC7 A;  1QVG P;  4EIK A;  1VQ7 T;  4F7U G;  1G5V A;  2Y90 A;  2CP3 A;  1MV3 A;  4DBR A;  2R58 A;  5GAN d;  5LL6 S;  2KYM A;  4FW1 A;  5GAN 2;  1M9S A;  1MV0 B;  1ACM B;  3O8V A;  2DMO A;  5GAO l;  3BDL A;  1UGQ B;  1IGU A;  5D6W A;  4J9D A;  1WHJ A;  1H3H A;  4M77 C;  3DLL A;  3CPW A;  3KFV A;  4XU3 A;  3HRT A;  1VYU A;  4J8O A;  3PFS A;  2JVV A;  5D7U A;  3G6E A;  4R56 A;  5LJ3 e;  1OQK A;  1D1A A;  2MPX C;  2XKO C;  1N8R U;  1T0J A;  2E6N A;  1NJI C;  1YI2 Q;  1NE8 A;  4HVW A;  3EG3 A;  1PKS A;  5KYW B;  1QWF A;  3NTH A;  3G71 Q;  2LT1 A;  4CC4 B;  1WHG A;  1NLO C;  2CUB A;  1YJ9 Q;  5DY9 A;  4PJO G;  2IIM A;  2C0O A;  1MGQ A;  2DYB A;  3E19 A;  3VJP A;  4X1V A;  2QAZ A;  3JCM Q;  4BE2 A;  5KYX B;  3QDR B;  1TUG B;  1PD0 A;  4AG2 C;  4DEX A;  1NJI R;  3TVT A;  3CMA Q;  5IXF A;  1LOJ A;  2M0O A;  2O31 A;  3JCM h;  1UB4 A;  3NFC A;  4NS5 A;  2L3Q A;  1GBQ A;  5HKC A;  3CC2 A;  3CC7 A;  1OOT A;  3NPF A;  5GJW B;  1YJW T;  4PJM A;  1VQ5 T;  1YIT T;  1KC8 R;  4EDU A;  2EYW A;  1JQQ A;  1OYX A;  4RTZ A;  2P0K A;  5GMK i;  1HJD A;  3MET A;  3I9Q A;  2XDD A;  2QA4 Q;  1XJW B;  4C0Z A;  3CD6 Q;  1Y96 A;  3UA7 A;  1WZO A;  4C5H A;  4M7D G;  1M1G A;  4EMK B;  3PT9 A;  2QXF A;  3EG9 A;  4F17 A;  5LJ3 d;  2ZPF B;  2NUP B;  3PIP A;  2NUT A;  1YN8 A;  5GMK e;  4F7U B;  1I4K 1;  2M02 A;  1I0C A;  1E6H A;  1Y57 A;  1YP5 A;  2KAF A;  5I11 A;  3TSZ A;  2V1Q A;  3D7S B;  4D8K A;  3RDV A;  2QI2 A;  1RAF B;  2DK3 A;  4M75 E;  1Q7Y R;  2M9U A;  1GFC A;  3LWI A;  2CP7 A;  1RAD B;  2XMF A;  1VQL Q;  3OBY A;  2JS2 A;  1J3T A;  2RK1 A;  1H92 A;  3RMS A;  2FZG B;  2RHI A;  1T3S A;  3MEW A;  1RLP C;  4MZM A;  5GAO r;  4PLI A;  2LCC A;  1Z9Z A;  2HQX A;  2FRW A;  4Q5W A;  5LJ5 f;  2J6O A;  1R0C B;  4XU2 A; 
#chains in the Genus database with same CATH homology
 4JS4 A;  2DZC A;  4HT8 A;  2EQK A;  3AHU A;  5M9O A;  4M75 C;  3J80 E;  4KUD K;  3ZFJ A;  4N0A A;  5KCO A;  5HK3 A;  1D3B B;  5CAI A;  1N8R C;  2VGM A;  3OMG A;  3OYG A;  4BDY A;  2MWP A;  1BIA A;  4M75 A;  2DVE A;  3A8L B;  2IVW A;  2O01 E;  5LJ5 h;  4RMO A;  3CME A;  5FU7 B;  4BD3 A;  5I21 A;  5GAM g;  3WVE B;  2V8K A;  2L89 A;  4M78 F;  1KQS S;  3KXT A;  2JOY A;  2VXE A;  4MMK A;  4HKE A;  1IZ6 A;  4UC4 A;  5FU6 B;  3JCM V;  1S72 A;  1Q81 C;  2LQK A;  4ME7 A;  1O75 A;  1I81 A;  2EKO A;  4M78 C;  5GAM j;  3ASK A;  4J6W A;  3M5A A;  1K73 C;  4XTX A;  3GP8 A;  2DIQ A;  2QQR A;  2A3L A;  5FRO A;  2LDM A;  1BYM A;  3G7Z A;  1HK9 A;  3JCM d;  3JAM E;  1M5Q 1;  4DOV A;  3N5B B;  3CCQ T;  1VQM T;  1P92 A;  4JRQ A;  4JRI A;  1XOV A;  4RCC A;  3QXE B;  4ZN1 A;  2VXF A;  4BY6 C;  3OYD A;  3I55 T;  2VYT A;  3QO3 A;  1X75 C;  3M53 A;  3UT1 A;  2EQU A;  4EMG A;  5GAO n;  1JRI A;  2ZPE B;  1KD1 C;  4A4E A;  2KMT A;  1WQ7 A;  3CCE A;  4BI8 B;  1X6O A;  2RI3 A;  4OP0 A;  4CRI A;  5GAN g;  4BDZ A;  1VQN T;  3BY7 A;  1VQ4 A;  3V7C A;  5A0L A;  5GAN 4;  3RUX A;  1G3S A;  3ZEH A;  2DXU A;  4L5G A;  2CZ0 B;  3HSB A;  1W4S A;  4M75 G;  4RG8 A;  2QQB A;  4PJO A;  3JCM c;  4BI3 A;  2OTL A;  4FSX A;  1U1T A;  4NL2 A;  4F7U A;  2XG8 D;  1Y7X A;  3PIO A;  3QJY A;  3P8H A;  2KK4 A;  3CCS T;  1Q81 U;  1LNX A;  2OTL T;  3OYC A;  5GMK l;  2RJD A;  4C5I A;  3I55 A;  2JTF A;  5FLX E;  2XDP A;  3VYG A;  2OTJ T;  1FWZ A;  1N9R A;  1OZ3 A;  3M56 A;  2DTO A;  4MZP A;  2E6Z A;  5DLO A;  1RL2 A;  3CCM T;  2O4X A;  3CCV T;  3EFS A;  1KQ1 A;  2PVO B;  4PL6 A;  4RCB A;  4LDY A;  4FT4 A;  1BKB A;  1JJ2 S;  3VUZ A;  4OVA A;  5LJ3 h;  1DJ7 B;  4FIB A;  2CS7 A;  3KUF A;  3PNW C;  3JB9 F;  1UGS B;  3J81 E;  4M78 G;  1UGR B;  2EIF A;  4PJO D;  4DOW A;  2EJG A;  2RA2 A;  4E47 A;  4M78 B;  2JN0 A;  2RHX A;  4GLK A;  4V2S A;  4XU0 A;  2XK0 A;  1VQO A;  1KHI A;  2EYQ A;  3MP8 A;  4KT0 E;  5J3B A;  3SWN A;  2PUO B;  1FX7 A;  2XU8 A;  4M7D B;  1M8V A;  2RI5 A;  4DA4 A;  4QW2 A;  3RIR A;  1VQ9 T;  4A4K A;  4FL6 A;  4LDV A;  3E9F A;  4M77 A;  3CD6 T;  1VQL A;  2RD1 A;  1ZQ1 A;  2XD0 A;  3QHS A;  4PKC C;  2HQE A;  4PJO B;  2E12 A;  2PU9 B;  3MP6 A;  4M7A G;  1N6A A;  3QII A;  1W2B A;  3F70 A;  3LX7 A;  4QVC A;  3V8K A;  2EJ9 A;  3FC3 A;  4M77 B;  3S3O A;  3OYI A;  3JCM P;  1YI2 T;  3OW2 S;  2VV5 A;  2QEX T;  1YIT A;  3MEA A;  1K8A C;  2XIC A;  3NTK A;  4OF1 A;  1UGP B;  5A2Q E;  1M90 C;  4M7D E;  4YTL A;  3GOX A;  3OYH A;  4M7A D;  3G71 T;  1IRE B;  3X28 B;  2DPP B;  1UEB A;  3HKS A;  4VUB A;  3UWN A;  3JB9 G;  2XID A;  2F69 A;  1Q86 C;  4JRK A;  1D3B A;  2RB6 A;  3OSV A;  3PMI A;  3GPL A;  4ZGJ B;  3PMT A;  2D6F A;  5LJ3 g;  3JB9 J;  4OGE A;  2Y4X A;  2WSC E;  2LC4 A;  3JCM e;  5DM7 R;  5GAM f;  4OB0 B;  1VQO T;  5CKE A;  5CCA A;  5LJ3 j;  4A4F A;  3OYL A;  3HFO A;  5CQX A;  2C06 A;  1WGS A;  3CBM A;  4J6X A;  3UDC A;  1B34 B;  1Y71 A;  4O6J A;  4C8Q A;  5LJ5 d;  1HXD A;  3CXC S;  3CD6 A;  3E9G A;  2JUF A;  1VQ9 A;  2BIV A;  4E7H A;  2QA4 A;  4A53 A;  4C0D B;  1QW1 A;  4FT2 A;  1NPR A;  3JRZ A;  3CC7 T;  4ZN3 A;  5HY6 A;  4MDX A;  1H64 1;  2XDB A;  2P4T A;  2CZ7 B;  1M90 U;  3V8L A;  2WAC A;  4C92 G;  2FVU A;  5EG2 A;  3SWN C;  3OS1 A;  2OAU A;  3FIF A;  4M7D C;  4Y91 A;  2GFA A;  4BAC A;  3LW5 E;  1N9S A;  3URG A;  3VV0 A;  3JCM b;  4JUV A;  3QPH A;  3LWH A;  5D6Y A;  3CCL T;  1Q7Y C;  4M77 D;  1Q82 C;  1VQK T;  1XQH A;  5GMK h;  3FEO A;  1WQW A;  2FHD A;  4M7A E;  1BI2 A;  2FL7 A;  3HRS A;  3L1A A;  3QBY A;  1BIB A;  2VGN A;  1B34 A;  3OYY A;  5A0D A;  3Q1J A;  5KE2 A;  5C0M A;  2LCL A;  5GAM d;  1VQP T;  4B9W A;  1PSE A;  5GAN 8;  1BI1 A;  3M9Q A;  3UPU A;  4ZTF A;  2ZZD A;  1QVG S;  2WSF E;  2DXT A;  1N27 A;  4BUG A;  2DD4 A;  5I2S A;  1M1K C;  1YIJ T;  2PVG B;  2E10 A;  5J39 A;  2E1H A;  3TEE A;  1G3T A;  3CMA A;  3OYB A;  4HT9 A;  2ZPB B;  2FB7 A;  2G3R A;  2QTX A;  3LLR A;  5GAO m;  5CR2 A;  4C8Q F;  3L2W A;  3FB9 A;  2M1H A;  4LDU A;  3OYA A;  2CGH A;  2QQS A;  4P5N A;  5IN1 A;  2DO3 A;  3L2V A;  5GAN 3;  5D6X A;  3X25 B;  3WVD B;  5J26 A;  3R6O A;  1QP3 A;  1K9M C;  5GAO p;  2E65 A;  2R5M A;  2HNI A;  4QVZ A;  2Y4Y A;  1S72 T;  2EAY A;  2PVD B;  3V8J A;  4ZGD B;  3LGF A;  4ELZ C;  3JSC A;  3X20 B;  3S3M A;  1YJ9 A;  1M1K U;  1Q7Y U;  2HBP A;  3CCU A;  2X35 A;  5CKF A;  3M4Y A;  2CKK A;  2RI2 A;  2XHC A;  4M78 E;  4BB7 A;  4C92 E;  2VC8 A;  3G71 A;  3RKX A;  2L8D A;  2JTM A;  2VUB A;  2ZCF B;  5KH6 A;  2K5L A;  4BI4 A;  3C95 A;  2LT4 A;  4M77 G;  4F7U F;  3M4G A;  5LJ5 e;  2HD0 A;  4N4G A;  4N0A C;  4QVD A;  4J83 A;  2MMP A;  3BDU A;  4HA8 A;  4RG2 A;  4X9C A;  1YI2 A;  5KCH A;  4PJO C;  2LVM A;  3TU4 K;  1VIE A;  5IAY A;  2DTI A;  1FXX A;  1I8F A;  2DAQ A;  2X4W A;  2RHU A;  5C6S A;  4E7L A;  1YHQ A;  4OB3 B;  1YCY A;  2LTO A;  1VQ5 A;  4C5G A;  1I5L A;  3M58 A;  1R8O B;  3RES A;  3M55 A;  3CMA T;  1VQ7 A;  1SSF A;  3MEU A;  5GAO q;  4E7J A;  2JNG A;  4MZT A;  4RKU E;  2R57 A;  3GLX A;  3EFR A;  4OB2 B;  4NOY A;  1VQ8 T;  3CC2 T;  2RHZ A;  2K57 A;  3MCA B;  4XTW A;  5FU7 C;  2DZ9 A;  3LGL A;  3RMQ A;  4BY6 B;  3RER A;  2PUK B;  3KBG A;  2DKG A;  3I56 T;  4IUQ A;  3G4S T;  2H3J A;  1M4Z A;  3QG1 A;  4PJO F;  3JB9 D;  2LQ8 A;  3VU3 C;  3GNF B;  3OS0 A;  1YIJ A;  3CCS A;  2K5I A;  4DQ2 A;  2KSS A;  3HRU A;  4J6Y A;  1WNL A;  3JCM f;  2RJC A;  3RKY A;  3CCJ T;  2DD5 A;  4TVR A;  2V8J A;  3CCR A;  1Q86 U;  3CCL A;  3EAE A;  3CPF A;  5FRN A;  4XQ3 A;  3A5Z B;  4ZTJ A;  3HP9 A;  4XAX B;  2RK2 A;  3A8M B;  3OS2 A;  3CBO A;  4IUP A;  3JCM X;  3CXC A;  1KC8 U;  2K3X A;  4J5Y A;  4LD6 A;  5CVI A;  4C8Q G;  1VQ4 T;  1VQ6 A;  1KG1 A;  4LD9 K;  3MO8 A;  4C92 D;  5GAM h;  3CCE T;  1Y07 A;  1VUB A;  1YBY A;  2BUD A;  5CO7 A;  4C92 B;  3NTI A;  4J7F A;  3OYM A;  2AHJ B;  3HFN A;  3A8G B;  4CI0 C;  2A7Y A;  4A54 A;  4JRP A;  1WPY A;  2LNV A;  4M75 B;  4C8Q C;  4IKF A;  4ATO A;  4M7D F;  3CCQ A;  3VKI A;  4QQD A;  3CC4 A;  4X9D A;  2PQW A;  3OYJ A;  3G6E T;  1WJS A;  4JLG A;  5GAN 7;  3CEY A;  1Q82 U;  4C0F A;  1YJ9 T;  3A8H B;  5GAN 5;  2KY9 A;  3DKM A;  4OB1 B;  4M77 F;  4F7U G;  1VQ7 T;  1NPP A;  5FRM A;  1G5V A;  2RO0 A;  3V7R A;  2RJE A;  2EQM A;  2Y90 A;  5CQY A;  3OB9 A;  2X4Y A;  3SD4 A;  3SFM A;  5GAM e;  3G4S A;  1QP2 A;  1XNI A;  2CZ6 B;  4WF2 A;  4M7A A;  2DTH A;  2R58 A;  5GAN d;  5LL6 S;  5GAN 2;  3FRN A;  3M54 A;  3MP1 A;  1M9S A;  4PNO A;  2QQA A;  3JCM W;  3CME T;  1VIF A;  3OY9 A;  3A8O B;  2K3Y A;  2NLU A;  2R5A A;  3OS5 A;  3QKJ A;  4A4G A;  2YRV A;  3OBW A;  3O8V A;  4C0G A;  4O5V A;  4MML A;  3L2U A;  2L5Q A;  2ZPH B;  4C92 F;  5GAO l;  4M75 D;  2MF2 A;  3BDL A;  1JB0 E;  4IUU A;  4II1 A;  1UGQ B;  3TRE A;  3X26 B;  4BE0 A;  5D6W A;  2K4Y A;  4IUR A;  4L59 A;  2RJF A;  2P0Q A;  2EFI A;  4XTU A;  5LJ3 f;  3MHX A;  2WSE E;  2FYK A;  3DB4 A;  2JZ2 A;  2QQ9 A;  4M77 C;  3CPW A;  3DLL A;  3S3N A;  1YJW A;  4LDW A;  4KUI A;  4XU3 A;  3SDZ A;  1U1S A;  4N4I A;  3HRT A;  2E64 A;  2QDY B;  3FJP A;  3T9N A;  3L42 A;  3L2R A;  1KQ2 A;  2K2V A;  3PFS A;  2JVV A;  4J8O A;  4OMF B;  4NL3 A;  3G6E A;  4R56 A;  3OMC A;  1V29 B;  3QZ9 B;  3QYH B;  3CCU T;  2GCX A;  2RH2 A;  3S6W A;  5LJ3 e;  3CCV A;  4HCC A;  2XKO C;  5A0G A;  3JCM J;  1N8R U;  4M78 A;  2E6N A;  3J7A F;  1NJI C;  5GAN f;  1YJN A;  4FU6 A;  2YHT A;  1NE8 A;  4ZGE B;  1JBM A;  2DXC A;  2I2L A;  4D6W A;  3C94 A;  2KQW A;  2MWO A;  1G3W A;  3NTH A;  4GY5 A;  3VYH B;  3TCJ A;  3GIB A;  4IUV A;  1GXI E;  2XI9 A;  4A4H A;  2LT1 A;  2O4X B;  2YLC A;  4M7D D;  2OTJ A;  4JDS A;  4XU1 A;  5DY9 A;  3QUI A;  3JB9 H;  4PJO G;  3P8B B;  4C8Q E;  4M7D A;  3ZBD A;  3LH0 A;  1MGQ A;  2DIG A;  2GF7 A;  3E19 A;  4IUT A;  3VJP A;  3ME9 A;  5CKH A;  2D9T A;  1YJN T;  2KDS A;  3MEV A;  3PGG A;  5GAN e;  3P8D A;  3JCM Q;  1OI1 A;  4XTV A;  4BE2 A;  3BW1 A;  3QDR B;  3ER0 A;  1VQM A;  3JB9 I;  3QZ5 B;  2E41 A;  1KD1 U;  4XTZ A;  4C8Q B;  1QVP A;  4M78 D;  4ELY C;  4EMK C;  3QYG B;  2RM4 A;  3L2Q A;  1H3Z A;  2EQJ A;  5CK9 A;  1LOJ A;  4BE1 A;  1X01 A;  2ZGW A;  1ZHI A;  1YHQ T;  3SWN B;  2M0O A;  4PJO E;  4Z02 A;  3JCM h;  1G3Y A;  4M75 F;  1O9S A;  1UB4 A;  3GF5 A;  4QQ6 A;  3OW2 A;  2B8A A;  3H6Z A;  2F5T X;  3NFC A;  4NS5 A;  5GAN h;  1NZ9 A;  5HKC A;  3CC2 A;  1RI0 A;  4HCB A;  3CC7 A;  2F5K A;  1QVF S;  4C0D C;  1BI3 A;  3SB2 A;  3BFM A;  1KC8 C;  5GAN 6;  3L2Z A;  2RHY A;  1YJW T;  2ZPI B;  3HPW A;  1VQ5 T;  5L8R E;  4Y28 E;  4R55 A;  3OYF A;  2QEX A;  1OZ2 A;  1YIT T;  1ZBX A;  3HHT B;  5CKD A;  3OA6 A;  4EDU A;  2GFU A;  2IG0 A;  1OYX A;  3WXM B;  3M57 A;  2P0K A;  3DB3 A;  5GAN j;  2GQV A;  5GMK i;  3M59 A;  3MET A;  1WJR A;  5FU6 C;  2DJZ A;  1M1F A;  2XDD A;  4JLI A;  1VQL T;  5DLQ E;  3HL8 A;  4C0Z A;  5CIU A;  3CPW S;  5CKB A;  2V8I A;  1Y96 A;  4N4H A;  4E7K A;  2LX9 A;  4C5H A;  2YLB A;  4M7D G;  3CC4 T;  1M1G A;  3V7S A;  4EMK B;  2E5Q A;  3PT9 A;  2EJF A;  4C92 C;  3JCM g;  2QXF A;  4PLL A;  4HCZ A;  5AYF A;  1K9M U;  3OSS C;  1VQ6 T;  4KBM B;  1U8R A;  4M7A F;  5LJ3 d;  2ZPF B;  4FM4 B;  4EMH A;  2DXB A;  4X34 A;  2X4X A;  3PIP A;  2QA4 T;  1VQK A;  1QVF A;  4KUL A;  1BI0 A;  5I2M A;  5GMK e;  4M7A C;  3QSU A;  5GMK m;  4F7U B;  2KVQ G;  4OGC A;  1I4K 1;  1WJQ A;  1VQP A;  3RKW A;  4JJN K;  2CYZ B;  1MHN A;  3FDR A;  3INZ A;  3QJ6 A;  1K73 U;  4MDW A;  4F7U E;  4QQG A;  2KAF A;  4XK8 E;  2X4J A;  4E7I A;  3DLM A;  4C92 A;  3OQ5 A;  3CCR T;  5HK0 A;  3OYE A;  1KHC A;  5GMK j;  3CCJ A;  4J7I A;  5LJ5 g;  3OYK A;  3FLG A;  1AHJ B;  1TH7 A;  2CZ1 B;  2D0Q B;  2K5F A;  2QI2 A;  4XTY A;  3CBP A;  2P0P A;  4EMK A;  3CCM A;  1K8A U;  3OYN A;  5KE3 A;  2DK3 A;  4M75 E;  3C12 A;  1JJ2 A;  2HAX A;  2M9U A;  1XTD A;  2EWN A;  2M16 A;  3C4S A;  3I56 A;  3LWI A;  2ZPG B;  4L6V 5;  2L3R A;  2LRQ A;  3E1S A;  4B9X A;  4EPC A;  2MI6 A;  2DEQ A;  1QVG A;  1VQN A;  4JS5 A;  1VQ8 A;  2E70 A;  3VUB A;  3OBY A;  1PSF A;  3GNG A;  4C5E A;  2RK1 A;  1KQS A;  1W2B S;  3RMS A;  3LYI A;  2RHI A;  1Y96 B;  3MEW A;  4MZM A;  4M7A B;  1EIF A;  5GAO r;  1NJI U;  3X24 B;  4PLI A;  2LCC A;  2HQX A;  5LJ5 j;  3PTA A;  4Q5W A;  5IT9 E;  5LJ5 f;  4LDX A;  2BKD N;  1LJO A;  2MAM A;  4XU2 A;  4C8Q D;  3H8Z A;  4M77 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...