3LYIA

Pwwp domain of human bromodomain-containing protein 1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
b'EPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 1
publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lyiA01
2DIQA 2DIGA 4B9XA 2MWPA 3MEWA 5M9OA 2M16A 4BE0A 3DB4A 3NTIA 2XDPA 2X4YA 3O8VA 5FROA 5KCHA 3QJ6A 3Q1JA 4II1A 2LCCA 2NLUA 3S6WA 3OYDA 2GF7A 3OYIA 3UWNA 2L8DA 2MWOA 4OVAA 3L2QA 3C4SA 2DAQA 1WJSA 2F5KA 3OYMA 4ZTJA 5KE3A 3M9QA 3UT1A 3S3NA 2QQRA 2EQUA 2PQWA 2RHIA 3PMIA 4C5IA 3S3OA 4UC4A 2K3YA 3QIIA 3L42A 4PLLA 2RHUA 2BKDN 2R5MA 2XK0A 2YRVA 4A4EA 4IUQA 2LVMA 3OYHA 2JTFA 4E7IA 2P0KA 4NS5A 3LLRA 5KCOA 3LYIA 4PLIA 5J39A 3PFSA 4IUVA 4E7JA 2EQKA 2BIVA 3P8DA 3OY9A 3OYAA 3LGFA 2RJDA 3OYJA 5FRNA 1OI1A 3E9FA 3QBYA 4IUPA 4CRIA 4Q5WA 3MEAA 3LH0A 4E7HA 3FDRA 4L59A 4C5HA 3OMGA 3OYLA 4LD6A 2LTOA 2R57A 4BDZA 4E7KA 2WACA 1WGSA 4N4GA 4QQDA 1G5VA 5KH6A 4A4GA 2D9TA 2RI2A 4QVZA 5D6WA 3MP8A 2EQJA 2HQXA 3OQ5A 4C5GA 2X35A 2IG0A 3H6ZA 2RI5A 3L2UA 3ZEHA 3OYCA 4QQ6A 3P8HA 4BD3A 3MP1A 4BACA 2K3XA 2B8AA 3DLMA 3LX7A 4C5EA 3OYNA 3QKJA 2RI3A 2EKOA 4GY5A 4IUUA 3SD4A 2LRQA 3GOXA 3F70A 1OYXA 5D6YA 3DB3A 2BUDA 3BDLA 3MEVA 4HCZA 5KE2A 2VYTA 3KUFA 3S3MA 4B9WA 3PMTA 5J26A 4A4HA 4A4FA 3FC3A 2R58A 3PNWC 5C6SA 4QW2A 5IAYA 2GFAA 3OA6A 4FU6A 3OMCA 3EAEA 4E7LA 2L3RA 2RHZA 1WJRA 3NTHA 3FLGA 1OZ2A 4X34A 2M1HA 4RG2A 4EDUA 2L89A 1WJQA 4IKFA 2FHDA 4IUTA 2RO0A 3OB9A 1H3ZA 3L2VA 2EQMA 3OYEA 1KHCA 1XNIA 3MO8A 2GFUA 5CIUA 3LGLA 1RI0A 3FEOA 3MEUA 3L2WA 4BDYA 1MHNA 4IURA 2O4XA 3ME9A 5D6XA 4FL6A 5C0MA 3OS1A 3OS0A 4PL6A 3OS2A 3MP6A 4ZTFA 2RHYA 4BE1A 3H8ZA 2EFIA 4BE2A 2R5AA 3OYFA 3E9GA 2LDMA 2RJFA 5FRMA 4QQGA 3ASKA 2M0OA 5IN1A 2X4WA 4Z02A 2O4XB 3OYBA 2RHXA 3CEYA 1N27A 2E5QA 2RJEA 2RJCA 2X4XA 3NTKA 3OYGA 3L2RA 3META 2E6NA 2G3RA 1OZ3A 1SSFA 2JZ2A 3OYKA 2CKKA 2QQSA 4N4IA 2HQEA 4N4HA
chains in the Genus database with same CATH superfamily
1M30A 4AG1C 4OMQA 1AWOA 5IXBA 1YP5A 3QUIA 2XMFA 1OQKA 2HEQA 2CP3A 1QCFA 2NUTB 2A36A 3UA6A 1YJ9Q 2K5IA 3X28B 2DJQA 5FLXE 2FL7A 5CO7A 1K9MC 3FB9A 3S3OA 2OAUA 3RKWA 4C0FA 5GJVB 2YUOA 3L42A 2HBPA 1GFCA 1JB0E 2JTFA 3G71Q 1GBRA 2DL8A 2B86A 2AHJB 2RD1A 2JUFA 1EIFA 3HFNA 1LNXA 2QAZA 4HT9A 3FDRA 4PJOF 1UUEA 1S72A 3EG2A 4QKUA 1T3SA 2D9TA 2IG0A 2YLCA 2KNBB 3G7ZA 4LDXA 5GMKe 2SEMA 1X01A 4IIMA 1ZBXA 4M77C 4C92G 5LL6S 2VKNA 1ZUUA 2QA4A 4PJMA 2CSQA 2DJZA 2DTOA 5GAMh 3X20B 2CH4W 3PNWC 3JB9D 1WA7A 4D8DA 4FU6A 3RKXA 1QQJA 2OJ2A 3JV3A 4M77D 1BIAA 2DPPB 3CC7Q 4RTYA 1M5Q1 4PJOE 2HSPA 1H3ZA 1KHCA 3ER0A 4R0KA 1WQWA 2Y90A 5I22A 4M78A 1FMVA 5GMKj 3SWNC 2VGNA 2ZGWA 1NEGA 1I8FA 3MP6A 4F7UG 4V2SA 1ZLMA 3JSCA 3UATA 4D8KA 2A7YA 5FRMA 2KK4A 3ASKA 1NZ9A 2M0OA 1MV3A 3CBOA 3CPFA 1KC8R 2X4WA 3G4SA 1RAFB 1VQ7A 4M78B 2X4XA 2KE9A 2G3RA 4FYYB 2JZ2A 2D8HA 5J3BA 4RUGA 1E6HA 4BE0A 3QDFA 3CMET 3QJ6A 3A5ZB 3D7SB 3GNGA 3CCUA 1AOJA 3EFSA 1EFNA 4M7AA 2DBKA 2K3YA 5KYWB 4PLLA 1NG2A 1ZUYA 1PC0A 3A8OB 2FO0A 2V8KA 3R6OA 3CC4T 3JCMb 1Q82C 3DKMA 2DILA 2A0FB 3LYIA 4C8QC 3UA7A 3OY9A 4F16A 1UGQB 1CKBA 3EFOA 4LD6A 1UJYA 2V26A 2QYZA 1QVFP 1AWJA 2DM1A 3VS0A 4QVZA 4LN2A 1Y96A 3EFOB 5GAMe 1MMAA 4C92B 2EPDA 4LDYA 1TS9A 4C5EA 2RI3A 1Y96B 2E70A 8AT1B 2VYTA 1VQNQ 2X51A 4EMKC 2DE0X 1OEBA 3KBGA 2KEAA 1WJRA 3CMAA 2RO0A 5GAMj 3VYGA 4AFSC 3VKIA 4A4KA 4PJJA 1YHQQ 4BDYA 4C8QF 4F7UB 3CD6A 2O9VA 4XTVA 1YI2A 3JCMd 1R0CB 2LDMA 1QP2A 4QQGA 1BI0A 3G6ET 4JZ4A 1RAGB 2YT6A 4OB1B 2QQSA 2DNUA 1G3WA 1M90R 2E5KA 2PVGB 2E3HA 1SEMA 1M8VA 1EX4A 1K4US 5AYFA 1OV3A 3V8KA 3I56A 2AK5A 5I21A 4M75C 2GF7A 3CC4Q 4HCCA 1H8KA 3KFVA 2KI7A 1C6VX 3CCUT 2RHIA 2OTLQ 5GAN7 2YHTA 2CUDA 2KDSA 2LMJA 4C8QE 5GAN4 1BB9A 5LJ5f 2P0KA 2VGMA 1VQ9A 2GBQA 4DBHA 4ATOA 1Y07A 4IUPA 3JCMQ 2OTJA 2RQUA 3EG9B 1QW1A 1G5VA 2CZ1B 1VQ5A 5D6WA 4DEXA 3JB9J 4XU0A 3H6ZA 2KGTA 1QVGS 1W2BA 4MMLA 3I5RA 4BD3A 1WXTA 1X75C 3CCRQ 5GAN5 4AMCA 3VUBA 1BCOA 1UGRB 1K9AA 4M75F 2CP6A 1VQ6Q 1JQQA 1SSHA 1RABB 1U1SA 3QPHA 2AT1B 3QZ5B 2JVVA 4J83A 5GAMg 2DFUA 1BK2A 3E2UA 1D1BA 2CH4A 3G6EQ 1NPPA 2JW4A 2LX7A 1KC8C 2V1QA 3REBB 2JM8A 3PIOA 2LNVA 3C95A 2XDDA 2RB6A 1HYOA 3PT9A 1M4ZA 1PWTA 1ZA1B 3CEYA 4OGCA 4ZGJB 1YI2T 2LNHB 1M27C 2ZPIB 4LUEA 4N4HA 1VQMT 1D09B 4M75E 2DD4A 3CCEA 5KCHA 2PVOB 3QSUA 1FMKA 4RG8A 2L8DA 1XQHA 2GGRA 2HQHA 2IIMA 1R77A 1U8RA 3I56T 2QQRA 3NHNA 4L5GA 4C5IA 1M9SA 1YWOA 2H8HA 2H3JA 1G83A 4A4EA 3UDCA 1O9SA 1NLPC 1W2BP 1PHTA 2J06A 4M78D 1JXOA 1IXDA 1K0XA 1MUZA 2KROA 2KAFA 3CC2T 4E7HA 1VQ9T 5GAOp 4N4GA 4QQDA 1YJ9A 5I2MA 2C06A 2DO3A 2EGCA 2X35A 3PE0A 4C0DC 3EGUA 5GAMd 3P8HA 2X4JA 1LOJA 3SDZA 2RPNA 1W4SA 4J9GA 3G71A 4GY5A 5HK3A 5IH2A 1YFNA 2LRQA 1N9SA 4RTZA 3MPUB 1OYXA 2BUDA 3BDLA 1HSQA 2EJFA 3T9NA 5CKDA 1K9MU 4C92C 4A4HA 5IXFA 2ZCFB 2JMCA 2QDLA 4DQ2A 2L3PA 1OZ2A 1E7OA 1G3TA 3OB9A 5CKEA 1PD1A 1PRMC 3L2VA 4FYWB 1G3YA 1VYUA 3FRNA 4J8OA 2MK5A 4FT4A 1I5OB 5C0MA 2O01E 3P8BB 2DTHA 1UG1A 1VQMQ 3V7CA 3VS6A 4JRQA 2D1XA 4JLGA 3OSSC 2DL5A 1S1NA 1M90C 2ZZDA 3CCJT 1LVKA 2FB7A 2QEXT 2CZ6B 1K8AR 3VRZA 1NEBA 2E1HA 1JU5C 2E12A 1QMCA 4X1VA 4IIOA 5IHNA 2M16A 3M0TA 4LDVA 1ARKA 3CC7A 2PUOB 2DL4A 2KVQG 3O8VA 3S6WA 4HA8A 2DAQA 3CCET 2CSIA 3TCJA 1K8AU 3GLXA 4C92F 4O5VA 3PMIA 1N5ZA 1ZQ1A 3CC2Q 2CP0A 1VIEA 4CC4B 4E7IA 3RNJA 2C0OA 4PLIA 1VQPT 1BBZA 3QXEB 1JJ2A 2IPOB 2YUPA 1RI9A 1KQ1A 3GNFB 4NL2A 2E6ZA 2ZPGB 1SRMA 5GANf 3H0HA 1VQOQ 2EQJA 1VOMA 2XKOC 2LQNA 1YCSB 1YJ9T 4F7UF 2YSQA 2DXUA 1N8RR 3QO3A 2JXBA 3V8LA 4J9BA 4DBQA 4OMMA 4AFQC 4IUUA 1LPLA 1V1CA 4C92E 1AD5A 1TWBA 1I0CA 2HDAA 2MCNA 2Y4YA 4J9EA 2PNIA 1NBEB 2QASA 2MAMA 1BI2A 1NYFA 4KGZB 3OW2P 2R58A 2EBPA 2GFAA 1ZSGA 5FU6B 2P0QA 2VWFA 2QK0A 4R55A 3INZA 3VUZA 5CVIA 2L2PA 3CCSQ 3OYYA 5D6XA 3CCJQ 2F2XA 3HPWA 4QT7A 1TU0B 1NYGA 2RHYA 6AT1B 2NUPA 3FJPA 2CGHA 4F7UE 4ZGDB 1ACMB 2MI6A 5IN1A 3GP8A 1VQNA 2KBTA 1RAIB 2HNIA 4F17A 5I2SA 1AWXA 3V8JA 1BCMA 1WHMA 2HQEA 1Y0MA 1IB8A 2O2OA 5CQXA 4QVDA 2MWPA 1QCOA 4ELYC 3NFCA 3VU3C 3OYDA 1M2VB 1YHQA 1Q81C 3CXCP 5GAOr 1GFDA 1IREB 1WPYA 3TQ7P 2C0IA 1VQPQ 4FW1A 2XU8A 2KRSA 2HZYA 3E19A 4E6RA 5CQYA 1YJNT 4M78G 2KMTA 1FX7A 4A63B 5FU7C 3UF4A 4CRIA 4HVVA 2NUZA 3OYLA 1KIKA 1KQSP 3CC4A 3HSBA 3MP8A 4C5GA 4WTOB 1YITT 2KRMA 4Z8AA 2VVKA 1Z9QA 1QWFA 3C94A 2OTLA 2G6FX 2KXCA 2L5QA 1RL2A 4J6WA 1HJDA 2CYZB 5LJ5h 1D0YA 3CBPA 3CCLQ 1Q86R 3GOXA 3DB3A 4M7AG 3JCMc 4JS4A 2JMAA 3N5BB 3FC3A 4DEYA 5C6SA 2A08A 2CT4A 3QYHB 1OX9A 2KYBA 4ESRA 2M1HA 4N0AA 1WJQA 2DA9A 3LH5A 2PTKA 4DOVA 2O4XA 4FL6A 4DOWA 4LUDA 3EHRA 3CCRA 3OS2A 3H8ZA 4Z88A 1OPKA 1X6GA 1K8AC 1QVFA 2M51A 1VQ6A 3M0PA 2O4XB 2FRWA 1AHJB 3E1SA 3EH1A 4HKEA 1WDXA 4F04B 4X9DA 1VQNT 1M1FA 1ZBJA 2ECZA 4BY6B 1BIBA 3L2QA 3G6EA 4JZ3A 2RNAA 2JT4A 4P5NA 3V7RA 4EMGA 1UFFA 1YJNQ 3SHWA 5KE3A 4XAXB 2EGAA 3FJ5A 1K0SA 1A0NB 1WX6A 2LCSA 3BY7A 1YHQT 4MZTA 2BE9B 3M0QA 1MNEA 2EJGA 1BI3A 4MDXA 2LVMA 3VS5A 3JB9F 2DBMA 2X3WD 1JRIA 4J6YA 1HD3A 5GJWB 1YITQ 3QBYA 4M77F 1M3BA 1KC8U 2FPEA 4E7ZA 3JCMP 3RIRA 4GBQA 1X2QA 2OX7A 2DEUA 3CCMQ 1N8RC 1NPRA 3JCMf 3CBMA 4PNOA 1MNDA 1X69A 4PFPA 4KH1B 2DXTA 3CPWA 4M7AB 1LJOA 1G8XA 2OTLT 2WSCE 3M0UA 2RF0A 3MEVA 1SKUB 5KE2A 3NGPA 2X3XD 1X27A 4PK4A 2MIOA 1RLPC 5LJ5j 4F14A 2EYWA 2KR3A 4CC3A 4OMOA 2K3BA 3M55A 4M77E 3HFOA 1AWWA 3ZL7C 1KFZA 1VUBA 2K2MA 1GCQC 4AG2C 1QWEA 3M58A 4RTWA 2SRCA 2DKGA 4BE1A 5FU6C 4RTXA 4C0ZA 3CCRT 1RAEB 3NTKA 1XJWB 4HVWA 2JS0A 2ENMA 1VQ6T 1UHCA 2DL7A 4KUIA 1ZSZA 5ECAA 4GLMA 2MWOA 1AZEA 3C4SA 2ROTA 2O88A 4MZPA 2JOYA 2EQUA 1TSFA 1VQMA 1ZSZB 3M4GA 3X26B 1TOVA 2PVDB 4KULA 5GAN6 3GBQA 1IO6A 4M7DA 4A54A 3QWXX 3CPWP 1T3LA 2EQKA 2RMOA 4HVUA 1JEGA 1OPLA 2QG9B 4BDZA 2P0PA 4M7DB 4LNPA 1UEBA 4ANJA 3VS7A 3EFRA 1M90U 3JAME 2JM9A 2AKKA 2V8JA 3TREA 3WVDB 3OYCA 1Q86C 4FW2A 4RMOA 3CC2A 2FYKA 1G2BA 1UJ0A 2M9UA 1QVGA 4JS5A 2XICA 1B07A 4AT1B 5CCAA 2ZPHB 3IQLA 4B9WA 1PD0A 5LJ5g 3HL8A 2EW3A 3M54A 2K9GA 2CUBA 3THKA 3NTHA 5GANh 4EIKA 2NWMA 4IUTA 4RTUA 5GMKm 1LCKA 3OYEA 1T0HA 5KYUA 3WXMB 3ME9A 3O5ZA 2XD0A 2YDLA 3M57A 1PNJA 2COWA 1WXUA 2MOXA 2P4TA 5KYUB 2CREA 2DK3A 1N27A 3OYGA 3RKYA 2EGEA 2XI9A 2BE7D 3QIIA 4HXJA 4ZNXA 3QDRB 1CKAA 3HRTA 2GQVA 2M02A 2X4YA 3PVQA 3PGGA 4J5YA 4JDSA 2YRDA 1PSEA 2KRNA 2K79A 3CCSA 3OYMA 2F5KA 3CCJA 1U5SA 1GCPA 4OMFB 2QEXA 4JUVA 2X9HA 4A53A 1Y57A 1T0JA 2C0TA 3L1AA 1WYXA 2YRVA 2V1RA 4IUQA 1U3OA 2CZ7B 1M3CA 4MZMA 3VS2A 1F1BB 2I0NA 3M0RA 2VV5A 4XU3A 4PJOA 1QVGP 4YTLA 2LT4A 2D8JA 3CCVT 2GQIA 4J6XA 1WLPB 2FZGB 1VQLT 4C5HA 3A1PA 4M78C 3PTAA 2KT1A 2R57A 3TEEA 2J05A 5LJ5d 3UPUA 2E4HA 2DXCA 1Z9ZA 1Q81R 1WHKA 5GAN8 1M2OA 1QLYA 1VQPA 2FEIA 2DD5A 1RAAB 1WNLA 3DLMA 3OSVA 4JJDA 3OYNA 3QKJA 5GANe 2YRCA 2QTXA 1YJWQ 3RESA 1TTHB 1YCYA 1Q81U 4OMPA 4A4FA 4QW2A 3MHXA 4NL3A 2LQKA 4E7LA 4M7AC 3NMZC 2DVJA 1PKSA 2ZPEB 2EJ9A 4JRIA 3JCMW 2VASA 3VS1A 1K1ZA 3MO8A 3FEOA 1I07A 1VQOT 2K5FA 2L3QA 4WF2A 3OS1A 4CC7A 5GANj 4FSSA 4M78F 2DX1A 4M7AD 1UGSB 5FW9A 3OYBA 4J7FA 1UE9A 2E6NA 1XTDA 4N4IA 2E65A 2VC8A 1UHFA 1X43A 3U23A 1WFWA 2HSEB 5FROA 4J7IA 5LJ3f 1JBMA 1WJSA 1WIEA 2A3LA 4BI3A 2PQWA 3OW2A 1WI7A 4E7SA 3CCST 3CCVQ 2RHUA 1VQLQ 4M7AF 4KGXB 5D7UA 5KYYA 4FM4B 5J39A 2F2WA 4M78E 2BIVA 7AT1B 1KD1R 2COYA 4X9CA 3OMGA 4DBFA 3M5AA 2HKNA 2WACA 2K57A 3SEMA 2J6OA 1YJNA 1UGPB 2EQIA 5GAN3 3V7SA 3RDVA 1FXXA 1SG5A 3HRUA 1U06A 2JNGA 2EYQA 5IT9E 1SRLA 1R0BG 1TH7A 4TVRA 2CDTA 1YITA 4M7AE 2EVRA 4WCIA 3CXCA 1ABQA 4XK8E 3TVTA 1KK7A 4AFZC 3QJYA 2FZKB 3EAEA 4RCCA 4PKCC 5AT1B 3CCMA 4RG2A 4C8QA 4EDUA 4M7DD 3JCMh 3EHQA 1ZHIA 3L2ZA 3RMSA 2BZ8A 4MMKA 1XNIA 5CIUA 3MEUA 3QHSA 2COZA 1WHGA 5GANg 3OS0A 4PL6A 1GRIA 2EFIA 2R5AA 1MMGA 1H3HA 2JTMA 2XDBA 1KQSA 1WHHA 1ZX6A 4NOYA 4OMNA 5HK0A 1N8RU 4JRKA 1PRLC 3EGDA 3CCLT 3VYHB 4XQ3A 2RJCA 3JB9I 3ULRB 3L2RA 1QKXA 1JJ2S 2FG0A 4BI8B 1VQ4Q 1X6BA 3SFMA 2HMAA 3QWYA 2DYIA 2F2VA 3EGDB 3I55Q 4PJLA 1XOVA 4PFZA 5KYXA 1B3QA 3UWNA 4EMKA 4HT8A 4KUDK 4OP0A 1RLQC 1E6GA 2YLBA 3EGXA 3M9QA 1HK9A 3X25B 4BB7A 1I5LA 3MKDA 3TU4K 3AHUA 1HXDA 4Y92A 4CI0C 2EYXA 2RN8A 3BDUA 4RTVA 1X2KA 2NUPB 1SHFA 3EGXB 4L6V5 4VUBA 3PFSA 4XTXA 2K2VA 3RERA 1MMNA 4JJNK 4Q5WA 2RQVA 1YIJQ 3LH0A 2MPXC 1VA7A 1H92A 3J7AF 2DVEA 4LXCA 1I1JA 1K73R 1QKWA 1PG5B 1NM7A 1PKTA 3ZBDA 1D3BA 4AFUC 5GAOm 2VUBA 2LQ8A 4OB3B 2GTOA 4J9CA 4M75A 1QP3A 1YWPA 1B34A 2ED0A 1K73U 5GANd 4J9HA 4XU2A 1D3BB 2CP5A 1GL5A 4PFOA 3WVEB 2NUTA 3OMCA 2L3RA 2RHZA 2YXYA 4JPBW 4JRPA 1SF9A 2FHDA 3CQTA 4PJOD 1IZ6A 1W6XA 4PJNA 3L2WA 3URGA 3VS3A 2V8IA 1MHNA 3CCMT 5GAN2 1TG0A 3OBYA 3JCMX 3OYFA 5FWBA 2O9SA 3LW5E 3NPFA 3CCQT 1SPKA 4FYXB 1Q86U 2CKKA 2OI3A 2L0AA 5HY6A 3VRYA 2FPFA 2DIGA 1UDLA 4KBMB 1H641 2LT1A 5CR2A 3LWHA 4II1A 2NLUA 1YNZA 1IHWA 1BU1A 3A8MB 2LJ3A 4FT2A 5DY9A 3S3NA 2JS2A 5EC7A 1NE8A 3JCMV 2ESWA 4OB0B 4QVCA 2A37A 1NLOC 1KD1C 3LLRA 4IUVA 4M4ZA 3SB2A 2EKHA 3VV0A 3M59A 3MEAA 1I81A 1VQKQ 4E7KA 3AT1B 5HKCA 4LD9K 4J9FA 4A4GA 1J3TA 2VXEA 4FSXA 4ZGEB 3OQ5A 2HD0A 1U1TA 1Q7YC 1ZUKA 2A28A 2YUNA 5GAOn 3I5SA 3I9QA 4JJCA 2K3XA 3LX7A 9ATCB 3LWIA 2DZCA 1JXMA 2DLPA 2J6KA 2AIRB 2D6FA 2JJ9A 1QVFS 4ORZA 5IHIA 3R6NA 2QXFA 3I35A 5LJ5e 5DLOA 5J26A 2EYYA 3JB9H 1R8OB 3OA6A 3BFMA 4M7DG 1AEYA 1M1KC 2MYSA 2EQMA 1VQ8T 4KT0E 4C0GA 5KYWA 4HCKA 2GCXA 3CCQQ 3M53A 3JCMg 5GMKl 3GIBA 1BKBA 2BTTA 1YJWA 1KQ2A 4Z02A 4OF1A 4EPCA 2RJEA 1EZZB 2QDYB 5L23A 1AVZC 4RTTA 5M9OA 4BI4A 1X6OA 4C0DB 2XDPA 2KT8A 2LCCA 2LZ6B 4C92A 4OVAA 2CS7A 4ZN3A 2RK2A 3A8LB 1KJWA 2LP5A 3H9NA 1S72T 1C0MA 1MV0B 2QQBA 3EG3A 2BKDN 2R5MA 4C8QD 4FIBA 5CKFA 3CPWS 1YBYA 2HKQB 4NS5A 4E7JA 2LX9A 4XTZA 3A8HB 3LGFA 5FRNA 3MJXA 1K73C 4L59A 2RQRA 5LJ3h 2QA4T 4F7UA 1UB4A 3OS5A 1C1AA 1B7TA 3L2UA 2DEQA 1NJIC 3EG1A 3CCVA 1VQLA 2ROLA 2P4RA 3SD4A 3X24B 2WSFE 3KUFA 3RBBB 4KGVB 4D6WA 1VQ8Q 4OB2B 3CMEQ 3GF5A 2RK1A 1TUDA 2GTJA 2BZXA 4X34A 4PJOG 2PUKB 2L89A 3G4ST 1VQ7T 1V29B 1PM3A 5A0GA 8ATCB 3KXTA 1FMWA 3HP9A 4ZTFA 1CSKA 2E10A 3EG9A 2RHXA 2E5QA 1GBQA 2YUQA 1YJWT 3META 2KSSA 1VQOA 4BE2A 2J6FA 2DIQA 2ZAEA 4M75D 3MEWA 3DB4A 3NTIA 1S72Q 3FIFA 2NYSA 3Q1JA 2CT3A 2EIFA 1W70A 3OYIA 4E2FB 5GAOq 4ZTJA 1FWZA 4ELZC 4B6MA 1RACB 2QQAA 5FWCA 2QQ9A 4MDWA 2O31A 1OU8A 1ABOA 1IHVA 2P84A 3RUXA 5LJ3e 3J80E 3TSZA 5I11A 2QA4Q 4JLIA 4N0AC 3P8DA 1O75A 4Z89A 2RJDA 4RCBA 3EG0A 1OI1A 3J81E 1K76A 3E9FA 5GAMf 5HCKA 1VQ4A 2K4YA 1TXQA 3JB9G 2LTOA 1BYMA 1WGSA 3I55A 5KH6A 4J9IA 1G3SA 4M77G 1W2BS 3C0CA 3RR6A 3A8GB 2RA2A 1N9RA 3ZEHA 2KY9A 2CZ0B 4BY6C 4QQ6A 1M3AA 1P92A 2VXFA 2MF2A 5LJ3j 3CMAT 4LDWA 1QVPA 5D6YA 1QCNA 3G4SQ 3S3MA 3CD6T 1VQ7Q 1IGUA 1KSWA 1YIJA 2ZPBB 4PJOB 2RQWA 2OAWA 2K6DA 5EG2A 2XHCA 2F5TX 5CK9A 4IKFA 2HCKA 1OU9A 2DYBA 4DBRA 2GFUA 4KH0B 3CCUQ 3M56A 5A2QE 2I2LA 2HL5C 4OGEA 4FCYA 1TUCA 4XTWA 2QGGA 2W0ZA 2DF6A 3HHTB 5FU7B 3E9GA 2Z0WA 1VIFA 3EH2A 4KRTA 2XIDA 5L8RE 5A0LA 5IHKA 2ED1A 3QG1A 3QZ9B 5CKBA 1SSFA 2E3IA 2IVWA 3C12A 1UECA 5KYNA 4OMLA 3RMQA 3HRSA 3CCLA 1WZOA 1FYNA 3UT1A 1UTIA 2RM4A 2OTJT 4XU1A 2DRMA 4C8QG 4DA4A 4UC4A 2CP7A 3BW1A 3M0SA 1K9MR 2F1LA 2EAYA 1VQ5T 3OYHA 2AZVA 5GMKi 4M77A 3MCAB 3OYAA 3OYJA 2LC4A 3OBWA 1Q95G 2AKLA 2GNCA 2ZPFB 1M1GA 2J7IA 2ABLA 4M77B 2Y4XA 1I4K1 2FPDA 2DRKA 1VQ4T 4XTYA 3CMAQ 1N6AA 2KYMA 3A98A 2RI5A 3PVLA 3I55T 2PZ1A 2K7AA 2DL3A 3VS4A 5LJ3g 3M4YA 2E64A 3CD6Q 3MP1A 4XTUA 3SWNA 1MMDA 2EKOA 2PU9B 3DLLA 1YI2Q 4C92D 3H41A 1KG1A 1ZSZC 4Y91A 5GAOl 4HCZA 1RAHB 3BE3A 5DLQE 1WHJA 2VB6A 1WHLA 5KYYB 1VQKA 5IAYA 3SWNB 2YWWA 1RUWA 2LQWA 2AZSA 2HBWA 3FLGA 1YIJT 1JO8A 3QYGB 2M0YA 1WXBA 5CAIA 1KD1U 3I56Q 1RI0A 2FRYA 3ZFJA 4M7DC 1Q7YR 2HL3A 4Y28E 1D0XA 4J9DA 3OW2S 1PSFA 1OULA 2XG8D 1PCXA 2QI2A 1Y71A 1YN8A 2D0QB 2E41A 2LJ0A 1Q7YU 1VQ9Q 1OZ3A 4M75G 3OYKA 4R56A 4B9XA 3HKSA 2DXBA 2OTJQ 1MGQA 2CP2A 1AT1B 1M1KR 3JRZA 1UGVA 1OOTA 1VQ5Q 3CCQA 4C8QB 1IRXA 3H0IA 2DZ9A 3JCMJ 1D1AA 3VJPA 5DM7R 2W10A 2EWNA 2XK0A 4K11A 1M1KU 2EYZA 2WSEE 5A0DA 5LJ3d 1GCQA 2JTEA 5KCOA 3H0FA 4GLKA 2FZCB 1AZGB 1Q82R 3GPLA 3CXCS 4M7DF 2K5LA 2JN0A 1IGQA 3HTRA 3G71T 2D0NA 5CKHA 4O6JA 1M8MA 4LDUA 2HAXA 4E47A 2RI2A 4CC2A 1TUGB 1WQ7A 4BUGA 3G1JA 2HQXA 1VYVA 2MMPA 1Q82U 1D0ZA 5KYXB 1OX8A 4EMKB 1VYTA 1D1CA 1W1FA 2QTVA 2DERA 4BACA 1RADB 2KQWA 2B8AA 2DETA 3REAB 1V76A 4FYVB 4LE9A 2RH2A 1KQSS 3F70A 3TSWA 2QEXQ 2RQTA 4RKUE 1SHGA 3PMTA 2LJ1A 2QGFB 2ATCB 5GMKh 1M2VA 2BZYA 2DMOA 3CCEQ 2F69A 4M7DE 4ZN1A 1BI1A 1VQKT 1JJ2P 3LGLA 2FVUA 1KHIA 4IURA 1NJIR 2L3SA 4PJOC 3JCMe 1DJ7B 1ZA2B 1Y7XA 2KXDA 3CC7T 2LCLA 4HCBA 2RJFA 4M75B 4EMHA 2H3EB 1GXIE 4ME7A 1B34B 2DTIA 1VQ8A 1NJIU 3PIPA 3CMEA 4JJBA
chains in the Genus database with same CATH topology
2E12A 3QDRB 5M9OA 2M16A 4LDVA 3QUIA 4BI4A 1X6OA 3HRTA 2GQVA 4C0DB 2XDPA 2PUOB 2X4YA 2KVQG 3O8VA 3CC7A 2LCCA 3S6WA 3PGGA 4J5YA 4JDSA 1PSEA 4OVAA 2K5IA 2CS7A 4HA8A 3X28B 2DAQA 4C92A 2F5KA 5FLXE 4ZN3A 3OYMA 3CCSA 3CCET 3TCJA 3CCJA 2FL7A 4OMFB 1K8AU 3GLXA 2RK2A 3A8LB 5CO7A 2QEXA 1K9MC 4JUVA 3FB9A 4C92F 4O5VA 3PMIA 1S72T 3S3OA 2OAUA 3RKWA 4A53A 4C0FA 2QQBA 3L42A 3L1AA 1ZQ1A 2BKDN 2HBPA 2R5MA 2YRVA 4FIBA 5CKFA 4C8QD 4IUQA 3CPWS 2CZ7B 1JB0E 2JTFA 4MZMA 1VIEA 1YBYA 4NS5A 4E7IA 2VV5A 2LX9A 4PLIA 4XU3A 4E7JA 4XTZA 2AHJB 2RD1A 3A8HB 1VQPT 3QXEB 4PJOA 2JUFA 4YTLA 3LGFA 1JJ2A 5FRNA 2LT4A 3CCVT 1EIFA 3HFNA 1LNXA 4J6XA 4HT9A 1VQLT 3FDRA 1KQ1A 3GNFB 4L59A 4M78C 4PJOF 4C5HA 3PTAA 4NL2A 2R57A 1S72A 2E6ZA 3TEEA 2ZPGB 5LJ3h 5LJ5d 3UPUA 5GANf 2QA4T 4F7UA 1UB4A 2D9TA 2DXCA 3OS5A 2EQJA 5GAN8 2IG0A 2XKOC 1VQPA 3L2UA 2DEQA 2YLCA 2DD5A 1YJ9T 4F7UF 1NJIC 2DXUA 3CCVA 3G7ZA 3QO3A 4LDXA 1WNLA 3V8LA 5GMKe 1VQLA 1X01A 1ZBXA 3DLMA 4M77C 3OSVA 4C92G 3OYNA 3QKJA 5GANe 4IUUA 2QTXA 5LL6S 3SD4A 4C92E 3RESA 1YCYA 2QA4A 3X24B 2WSFE 1Q81U 2Y4YA 2DJZA 2DTOA 3KUFA 5GAMh 4D6WA 2MAMA 1BI2A 3X20B 4A4FA 2R58A 3PNWC 3JB9D 4OB2B 3MHXA 4QW2A 2GFAA 4NL3A 3GF5A 2RK1A 4FU6A 2LQKA 3RKXA 4E7LA 4M7AC 4X34A 5FU6B 2P0QA 4PJOG 2PUKB 2ZPEB 2EJ9A 4M77D 2L89A 1BIAA 2DPPB 4JRIA 3G4ST 4R55A 3JCMW 1VQ7T 1M5Q1 3INZA 1V29B 3VUZA 4PJOE 1H3ZA 1KHCA 3MO8A 3ER0A 5CVIA 5A0GA 3FEOA 3KXTA 1VQOT 1WQWA 2K5FA 2Y90A 3HP9A 3OYYA 4M78A 5GMKj 5D6XA 4WF2A 3SWNC 2VGNA 3HPWA 3OS1A 2ZGWA 1I8FA 3MP6A 4ZTFA 4F7UG 2RHYA 4V2SA 5GANj 3JSCA 3FJPA 2CGHA 2A7YA 4M78F 4F7UE 4ZGDB 5FRMA 4M7AD 2KK4A 1UGSB 3ASKA 1NZ9A 2M0OA 2MI6A 3CBOA 3CPFA 5IN1A 2X4WA 3GP8A 1VQNA 2E10A 3G4SA 2HNIA 1VQ7A 4M78B 3OYBA 2RHXA 5I2SA 2E5QA 2X4XA 4M7DD 4J7FA 1YJWT 3META 2E6NA 2KSSA 2G3RA 3V8JA 1XTDA 1VQOA 2JZ2A 4N4IA 2HQEA 4BE2A 2E65A 2VC8A 2DIQA 5J3BA 4M75D 5CQXA 4QVDA 2MWPA 3MEWA 4BE0A 3DB4A 3NTIA 5FROA 3FIFA 4J7IA 3QJ6A 4ELYC 3Q1JA 3CMET 3A5ZB 5LJ3f 3NFCA 1JBMA 2EIFA 3GNGA 3VU3C 3OYDA 3OYIA 3CCUA 5GAOq 1YHQA 1Q81C 3EFSA 1WJSA 4ZTJA 5GAOr 2A3LA 1FWZA 4ELZC 1IREB 1WPYA 2QQAA 1K73C 4BI3A 4M7AA 2QQ9A 2XU8A 4MDWA 2PQWA 3OW2A 2K3YA 3CCST 4PLLA 2RHUA 3E19A 3A8OB 3CC4T 2V8KA 3RUXA 3R6OA 5LJ3e 3JCMb 1Q82C 4M7AF 5CQYA 3DKMA 1YJNT 3J80E 4FM4B 4M78G 2KMTA 1FX7A 3LYIA 5J39A 4C8QC 4JLIA 4N0AC 4M78E 2BIVA 1O75A 3P8DA 3OY9A 5FU7C 2RJDA 4RCBA 1UGQB 1OI1A 3J81E 5GAMf 3E9FA 4CRIA 1VQ4A 2K4YA 3OYLA 3JB9G 4X9CA 3OMGA 3M5AA 2LTOA 4LD6A 1BYMA 2WACA 1WGSA 2K57A 3I55A 5KH6A 3CC4A 3HSBA 4QVZA 1YJNA 1G3SA 3MP8A 1Y96A 4M77G 4C5GA 1YITT 1W2BS 1UGPB 3A8GB 2RA2A 5GAMe 1N9RA 5GAN3 3ZEHA 2KY9A 3C94A 2OTLA 2CZ0B 4BY6C 4C92B 4QQ6A 3V7SA 1FXXA 1RL2A 2L5QA 1P92A 4J6WA 2CYZB 2VXFA 3HRUA 2MF2A 5LJ5h 2JNGA 5LJ3j 4LDYA 2EYQA 4C5EA 2RI3A 3CBPA 5IT9E 1Y96B 2E70A 3CMAT 1TH7A 4TVRA 3GOXA 4LDWA 1QVPA 5D6YA 3DB3A 4M7AG 3JCMc 4JS4A 1YITA 2VYTA 4M7AE 3S3MA 3CD6T 3CXCA 4XK8E 3N5BB 1YIJA 4EMKC 3FC3A 5C6SA 2ZPBB 3QYHB 4PJOB 3QJYA 3KBGA 3EAEA 4RCCA 4PKCC 1WJRA 3CCMA 2M1HA 2XHCA 2F5TX 4RG2A 5EG2A 4N0AA 1WJQA 3JCMh 4C8QA 4EDUA 5CK9A 1ZHIA 3CMAA 2RO0A 4IKFA 3L2ZA 3RMSA 5GAMj 3VYGA 4MMKA 1XNIA 2GFUA 5CIUA 3M56A 3MEUA 3QHSA 3VKIA 4A4KA 5A2QE 4BDYA 4C8QF 2I2LA 4DOVA 4F7UB 2O4XA 3CD6A 4FL6A 4OGEA 5GANg 4DOWA 3OS0A 4PL6A 3CCRA 3OS2A 4XTWA 3H8ZA 2EFIA 4XTVA 1YI2A 3HHTB 2R5AA 3JCMd 5FU7B 3E9GA 2LDMA 1QP2A 2JTMA 2XDBA 1VIFA 4QQGA 1KQSA 1K8AC 1BI0A 4NOYA 5HK0A 1N8RU 1QVFA 3G6ET 1VQ6A 4JRKA 2XIDA 2O4XB 3CCLT 3VYHB 4XQ3A 1AHJB 2RJCA 5L8RE 3E1SA 3JB9I 5A0LA 3L2RA 4HKEA 3QG1A 3QZ9B 5CKBA 1SSFA 1JJ2S 4OB1B 2QQSA 4X9DA 1G3WA 2IVWA 2PVGB 1VQNT 4BI8B 3C12A 1M1FA 1M8VA 3SFMA 5AYFA 3V8KA 4BY6B 3I56A 1BIBA 5I21A 1XOVA 4M75C 2GF7A 3RMQA 3UWNA 4EMKA 4HT8A 3L2QA 3HRSA 3G6EA 4HCCA 4KUDK 4P5NA 3V7RA 4OP0A 4EMGA 3CCLA 2YLBA 5KE3A 4XAXB 3M9QA 2RM4A 3UT1A 2OTJT 1HK9A 3X25B 4BB7A 4XU1A 4C8QG 2RHIA 3BY7A 3CCUT 4MZTA 4UC4A 5GAN7 4DA4A 1YHQT 1I5LA 3TU4K 2YHTA 3BW1A 2KDSA 2EJGA 3AHUA 4C8QE 1BI3A 1HXDA 4CI0C 5LJ5f 5GAN4 3BDUA 2EAYA 1VQ5T 2LVMA 3OYHA 4MDXA 3JB9F 5GMKi 2P0KA 4M77A 4L6V5 4VUBA 2VGMA 3MCAB 1VQ9A 3PFSA 4XTXA 2K2VA 1JRIA 3RERA 3OYAA 4J6YA 3OYJA 2LC4A 4ATOA 1Y07A 4JJNK 3QBYA 4IUPA 4M77F 3OBWA 4Q5WA 3JCMQ 1KC8U 2OTJA 3LH0A 1QW1A 3J7AF 2ZPFB 1M1GA 3JCMP 2DVEA 4M77B 3RIRA 1G5VA 2Y4XA 1I4K1 2CZ1B 1VQ5A 5D6WA 1VQ4T 1N8RC 1NPRA 3JCMf 4XTYA 3JB9J 3CBMA 4PNOA 1N6AA 4XU0A 3H6ZA 2RI5A 3I55T 3ZBDA 1D3BA 1QVGS 5GAOm 5LJ3g 2VUBA 2E64A 2LQ8A 3M4YA 1W2BA 4MMLA 4OB3B 4BD3A 3MP1A 1X75C 4XTUA 2DXTA 4M75A 3SWNA 3CPWA 1QP3A 4M7AB 5GAN5 1LJOA 2EKOA 2PU9B 1B34A 3DLLA 2OTLT 2WSCE 4C92D 3VUBA 1K73U 1KG1A 5GANd 1UGRB 4XU2A 3MEVA 1D3BB 4Y91A 4M75F 5GAOl 4HCZA 5KE2A 5DLQE 1U1SA 3QPHA 1VQKA 5IAYA 3SWNB 5LJ5j 3WVEB 3OMCA 3QZ5B 2L3RA 2RHZA 3M55A 4JRPA 2JVVA 3FLGA 4J83A 1YIJT 3QYGB 4M77E 5GAMg 5CAIA 1KD1U 2FHDA 4PJOD 1IZ6A 3HFOA 1RI0A 3L2WA 3URGA 3ZFJA 4M7DC 1NPPA 1MHNA 1VUBA 2V8IA 5GAN2 3CCMT 3M58A 4Y28E 3OBYA 1KC8C 3OW2S 2DKGA 1PSFA 3JCMX 4BE1A 5FU6C 3PIOA 2LNVA 3OYFA 3C95A 2XDDA 2RB6A 2XG8D 3PT9A 4C0ZA 1M4ZA 3LW5E 3CCRT 2QI2A 1Y71A 3CCQT 3CEYA 2D0QB 4OGCA 4ZGJB 2E41A 1YI2T 3NTKA 1Q7YU 1OZ3A 4M75G 3OYKA 2CKKA 1Q86U 2ZPIB 5HY6A 4R56A 4N4HA 1VQMT 1VQ6T 4M75E 2DIGA 4B9XA 3HKSA 2DD4A 2DXBA 4KBMB 4KUIA 3CCEA 1H641 2LT1A 1MGQA 5CR2A 5KCHA 3LWHA 2PVOB 4II1A 2NLUA 3QSUA 3JRZA 4RG8A 2L8DA 2MWOA 1XQHA 3C4SA 3CCQA 4MZPA 4C8QB 3A8MB 2JOYA 4FT2A 5DY9A 2DZ9A 1U8RA 3I56T 3JCMJ 3S3NA 2QQRA 2EQUA 4L5GA 3VJPA 5DM7R 1NE8A 4C5IA 2EWNA 1VQMA 3JCMV 3M4GA 1M9SA 4OB0B 3X26B 2XK0A 2H3JA 2PVDB 4A4EA 4KULA 3UDCA 5GAN6 4QVCA 1O9SA 1M1KU 1KD1C 2WSEE 5A0DA 4M7DA 3LLRA 5LJ3d 4A54A 5KCOA 4IUVA 4GLKA 3SB2A 2EQKA 4M78D 3VV0A 3GPLA 3CXCS 3M59A 4M7DF 2KAFA 2K5LA 3MEAA 3CC2T 4E7HA 1I81A 2JN0A 1VQ9T 5GAOp 3G71T 4BDZA 4E7KA 2P0PA 4N4GA 4QQDA 5CKHA 5HKCA 1YJ9A 4O6JA 4M7DB 5I2MA 4LDUA 2C06A 4LD9K 4A4GA 2HAXA 4E47A 1UEBA 2RI2A 2VXEA 3EFRA 4FSXA 4ZGEB 2DO3A 1WQ7A 4BUGA 1M90U 2HQXA 3OQ5A 3JAME 2X35A 2HD0A 2MMPA 1U1TA 1Q82U 4C0DC 2V8JA 1Q7YC 3TREA 3WVDB 4EMKB 3OYCA 1Q86C 5GAMd 3P8HA 5GAOn 2X4JA 4RMOA 1LOJA 3SDZA 3CC2A 4BACA 2FYKA 2KQWA 2K3XA 2B8AA 2M9UA 3LX7A 1W4SA 3LWIA 3G71A 1QVGA 4GY5A 5HK3A 4JS5A 2DZCA 2XICA 2LRQA 2D6FA 2RH2A 1N9SA 1KQSS 3F70A 1OYXA 1QVFS 5CCAA 2BUDA 3BDLA 2ZPHB 2EJFA 2QXFA 4RKUE 3T9NA 5CKDA 4B9WA 5DLOA 3PMTA 5LJ5g 4C92C 5LJ5e 3HL8A 5J26A 3M54A 4A4HA 1K9MU 2ZCFB 3JB9H 1R8OB 3OA6A 5GMKh 3BFMA 4M7DG 4DQ2A 3NTHA 1OZ2A 5GANh 2F69A 4M7DE 4ZN1A 1BI1A 1M1KC 4IUTA 5GMKm 1G3TA 3OB9A 5CKEA 1VQKT 3L2VA 2EQMA 3OYEA 1G3YA 1VQ8T 3LGLA 4KT0E 4C0GA 3FRNA 2FVUA 1KHIA 4J8OA 3WXMB 4IURA 3ME9A 4FT4A 2GCXA 5C0MA 3M53A 4PJOC 2O01E 3P8BB 2XD0A 3JCMe 2DTHA 3JCMg 5GMKl 3M57A 3GIBA 1DJ7B 1BKBA 1Y7XA 3CC7T 1YJWA 2LCLA 4HCBA 2RJFA 3V7CA 4JRQA 1KQ2A 4JLGA 3OSSC 4Z02A 4OF1A 2P4TA 2DK3A 4M75B 4EPCA 4EMHA 1M90C 2ZZDA 3CCJT 1GXIE 4ME7A 1N27A 2RJEA 1B34B 2FB7A 2DTIA 3RKYA 3OYGA 1NJIU 1VQ8A 2XI9A 3PIPA 2CZ6B 2QEXT 2QDYB 3CMEA 3QIIA 2E1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIQ A;  2DIG A;  4B9X A;  2MWP A;  3MEW A;  5M9O A;  2M16 A;  4BE0 A;  3DB4 A;  3NTI A;  2XDP A;  2X4Y A;  3O8V A;  5FRO A;  5KCH A;  3QJ6 A;  3Q1J A;  4II1 A;  2LCC A;  2NLU A;  3S6W A;  3OYD A;  2GF7 A;  3OYI A;  3UWN A;  2L8D A;  2MWO A;  4OVA A;  3L2Q A;  3C4S A;  2DAQ A;  1WJS A;  2F5K A;  3OYM A;  4ZTJ A;  5KE3 A;  3M9Q A;  3UT1 A;  3S3N A;  2QQR A;  2EQU A;  2PQW A;  2RHI A;  3PMI A;  4C5I A;  3S3O A;  4UC4 A;  2K3Y A;  3QII A;  3L42 A;  4PLL A;  2RHU A;  2BKD N;  2R5M A;  2XK0 A;  2YRV A;  4A4E A;  4IUQ A;  2LVM A;  3OYH A;  2JTF A;  4E7I A;  2P0K A;  4NS5 A;  3LLR A;  5KCO A;  3LYI A;  4PLI A;  5J39 A;  3PFS A;  4IUV A;  4E7J A;  2EQK A;  2BIV A;  3P8D A;  3OY9 A;  3OYA A;  3LGF A;  2RJD A;  3OYJ A;  5FRN A;  1OI1 A;  3E9F A;  3QBY A;  4IUP A;  4CRI A;  4Q5W A;  3MEA A;  3LH0 A;  4E7H A;  3FDR A;  4L59 A;  4C5H A;  3OMG A;  3OYL A;  4LD6 A;  2LTO A;  2R57 A;  4BDZ A;  4E7K A;  2WAC A;  1WGS A;  4N4G A;  4QQD A;  1G5V A;  5KH6 A;  4A4G A;  2D9T A;  2RI2 A;  4QVZ A;  5D6W A;  3MP8 A;  2EQJ A;  2HQX A;  3OQ5 A;  4C5G A;  2X35 A;  2IG0 A;  3H6Z A;  2RI5 A;  3L2U A;  3ZEH A;  3OYC A;  4QQ6 A;  3P8H A;  4BD3 A;  3MP1 A;  4BAC A;  2K3X A;  2B8A A;  3DLM A;  3LX7 A;  4C5E A;  3OYN A;  3QKJ A;  2RI3 A;  2EKO A;  4GY5 A;  4IUU A;  3SD4 A;  2LRQ A;  3GOX A;  3F70 A;  1OYX A;  5D6Y A;  3DB3 A;  2BUD A;  3BDL A;  3MEV A;  4HCZ A;  5KE2 A;  2VYT A;  3KUF A;  3S3M A;  4B9W A;  3PMT A;  5J26 A;  4A4H A;  4A4F A;  3FC3 A;  2R58 A;  3PNW C;  5C6S A;  4QW2 A;  5IAY A;  2GFA A;  3OA6 A;  4FU6 A;  3OMC A;  3EAE A;  4E7L A;  2L3R A;  2RHZ A;  1WJR A;  3NTH A;  3FLG A;  1OZ2 A;  4X34 A;  2M1H A;  4RG2 A;  4EDU A;  2L89 A;  1WJQ A;  4IKF A;  2FHD A;  4IUT A;  2RO0 A;  3OB9 A;  1H3Z A;  3L2V A;  2EQM A;  3OYE A;  1KHC A;  1XNI A;  3MO8 A;  2GFU A;  5CIU A;  3LGL A;  1RI0 A;  3FEO A;  3MEU A;  3L2W A;  4BDY A;  1MHN A;  4IUR A;  2O4X A;  3ME9 A;  5D6X A;  4FL6 A;  5C0M A;  3OS1 A;  3OS0 A;  4PL6 A;  3OS2 A;  3MP6 A;  4ZTF A;  2RHY A;  4BE1 A;  3H8Z A;  2EFI A;  4BE2 A;  2R5A A;  3OYF A;  3E9G A;  2LDM A;  2RJF A;  5FRM A;  4QQG A;  3ASK A;  2M0O A;  5IN1 A;  2X4W A;  4Z02 A;  2O4X B;  3OYB A;  2RHX A;  3CEY A;  1N27 A;  2E5Q A;  2RJE A;  2RJC A;  2X4X A;  3NTK A;  3OYG A;  3L2R A;  3MET A;  2E6N A;  2G3R A;  1OZ3 A;  1SSF A;  2JZ2 A;  3OYK A;  2CKK A;  2QQS A;  4N4I A;  2HQE A;  4N4H A; 
#chains in the Genus database with same CATH topology
 1M30 A;  4AG1 C;  4OMQ A;  1AWO A;  5IXB A;  1YP5 A;  3QUI A;  2XMF A;  1OQK A;  2HEQ A;  2CP3 A;  1QCF A;  2NUT B;  2A36 A;  3UA6 A;  1YJ9 Q;  2K5I A;  3X28 B;  2DJQ A;  5FLX E;  2FL7 A;  5CO7 A;  1K9M C;  3FB9 A;  3S3O A;  2OAU A;  3RKW A;  4C0F A;  5GJV B;  2YUO A;  3L42 A;  2HBP A;  1GFC A;  1JB0 E;  2JTF A;  3G71 Q;  1GBR A;  2DL8 A;  2B86 A;  2AHJ B;  2RD1 A;  2JUF A;  1EIF A;  3HFN A;  1LNX A;  2QAZ A;  4HT9 A;  3FDR A;  4PJO F;  1UUE A;  1S72 A;  3EG2 A;  4QKU A;  1T3S A;  2D9T A;  2IG0 A;  2YLC A;  2KNB B;  3G7Z A;  4LDX A;  5GMK e;  2SEM A;  1X01 A;  4IIM A;  1ZBX A;  4M77 C;  4C92 G;  5LL6 S;  2VKN A;  1ZUU A;  2QA4 A;  4PJM A;  2CSQ A;  2DJZ A;  2DTO A;  5GAM h;  3X20 B;  2CH4 W;  3PNW C;  3JB9 D;  1WA7 A;  4D8D A;  4FU6 A;  3RKX A;  1QQJ A;  2OJ2 A;  3JV3 A;  4M77 D;  1BIA A;  2DPP B;  3CC7 Q;  4RTY A;  1M5Q 1;  4PJO E;  2HSP A;  1H3Z A;  1KHC A;  3ER0 A;  4R0K A;  1WQW A;  2Y90 A;  5I22 A;  4M78 A;  1FMV A;  5GMK j;  3SWN C;  2VGN A;  2ZGW A;  1NEG A;  1I8F A;  3MP6 A;  4F7U G;  4V2S A;  1ZLM A;  3JSC A;  3UAT A;  4D8K A;  2A7Y A;  5FRM A;  2KK4 A;  3ASK A;  1NZ9 A;  2M0O A;  1MV3 A;  3CBO A;  3CPF A;  1KC8 R;  2X4W A;  3G4S A;  1RAF B;  1VQ7 A;  4M78 B;  2X4X A;  2KE9 A;  2G3R A;  4FYY B;  2JZ2 A;  2D8H A;  5J3B A;  4RUG A;  1E6H A;  4BE0 A;  3QDF A;  3CME T;  3QJ6 A;  3A5Z B;  3D7S B;  3GNG A;  3CCU A;  1AOJ A;  3EFS A;  1EFN A;  4M7A A;  2DBK A;  2K3Y A;  5KYW B;  4PLL A;  1NG2 A;  1ZUY A;  1PC0 A;  3A8O B;  2FO0 A;  2V8K A;  3R6O A;  3CC4 T;  3JCM b;  1Q82 C;  3DKM A;  2DIL A;  2A0F B;  3LYI A;  4C8Q C;  3UA7 A;  3OY9 A;  4F16 A;  1UGQ B;  1CKB A;  3EFO A;  4LD6 A;  1UJY A;  2V26 A;  2QYZ A;  1QVF P;  1AWJ A;  2DM1 A;  3VS0 A;  4QVZ A;  4LN2 A;  1Y96 A;  3EFO B;  5GAM e;  1MMA A;  4C92 B;  2EPD A;  4LDY A;  1TS9 A;  4C5E A;  2RI3 A;  1Y96 B;  2E70 A;  8AT1 B;  2VYT A;  1VQN Q;  2X51 A;  4EMK C;  2DE0 X;  1OEB A;  3KBG A;  2KEA A;  1WJR A;  3CMA A;  2RO0 A;  5GAM j;  3VYG A;  4AFS C;  3VKI A;  4A4K A;  4PJJ A;  1YHQ Q;  4BDY A;  4C8Q F;  4F7U B;  3CD6 A;  2O9V A;  4XTV A;  1YI2 A;  3JCM d;  1R0C B;  2LDM A;  1QP2 A;  4QQG A;  1BI0 A;  3G6E T;  4JZ4 A;  1RAG B;  2YT6 A;  4OB1 B;  2QQS A;  2DNU A;  1G3W A;  1M90 R;  2E5K A;  2PVG B;  2E3H A;  1SEM A;  1M8V A;  1EX4 A;  1K4U S;  5AYF A;  1OV3 A;  3V8K A;  3I56 A;  2AK5 A;  5I21 A;  4M75 C;  2GF7 A;  3CC4 Q;  4HCC A;  1H8K A;  3KFV A;  2KI7 A;  1C6V X;  3CCU T;  2RHI A;  2OTL Q;  5GAN 7;  2YHT A;  2CUD A;  2KDS A;  2LMJ A;  4C8Q E;  5GAN 4;  1BB9 A;  5LJ5 f;  2P0K A;  2VGM A;  1VQ9 A;  2GBQ A;  4DBH A;  4ATO A;  1Y07 A;  4IUP A;  3JCM Q;  2OTJ A;  2RQU A;  3EG9 B;  1QW1 A;  1G5V A;  2CZ1 B;  1VQ5 A;  5D6W A;  4DEX A;  3JB9 J;  4XU0 A;  3H6Z A;  2KGT A;  1QVG S;  1W2B A;  4MML A;  3I5R A;  4BD3 A;  1WXT A;  1X75 C;  3CCR Q;  5GAN 5;  4AMC A;  3VUB A;  1BCO A;  1UGR B;  1K9A A;  4M75 F;  2CP6 A;  1VQ6 Q;  1JQQ A;  1SSH A;  1RAB B;  1U1S A;  3QPH A;  2AT1 B;  3QZ5 B;  2JVV A;  4J83 A;  5GAM g;  2DFU A;  1BK2 A;  3E2U A;  1D1B A;  2CH4 A;  3G6E Q;  1NPP A;  2JW4 A;  2LX7 A;  1KC8 C;  2V1Q A;  3REB B;  2JM8 A;  3PIO A;  2LNV A;  3C95 A;  2XDD A;  2RB6 A;  1HYO A;  3PT9 A;  1M4Z A;  1PWT A;  1ZA1 B;  3CEY A;  4OGC A;  4ZGJ B;  1YI2 T;  2LNH B;  1M27 C;  2ZPI B;  4LUE A;  4N4H A;  1VQM T;  1D09 B;  4M75 E;  2DD4 A;  3CCE A;  5KCH A;  2PVO B;  3QSU A;  1FMK A;  4RG8 A;  2L8D A;  1XQH A;  2GGR A;  2HQH A;  2IIM A;  1R77 A;  1U8R A;  3I56 T;  2QQR A;  3NHN A;  4L5G A;  4C5I A;  1M9S A;  1YWO A;  2H8H A;  2H3J A;  1G83 A;  4A4E A;  3UDC A;  1O9S A;  1NLP C;  1W2B P;  1PHT A;  2J06 A;  4M78 D;  1JXO A;  1IXD A;  1K0X A;  1MUZ A;  2KRO A;  2KAF A;  3CC2 T;  4E7H A;  1VQ9 T;  5GAO p;  4N4G A;  4QQD A;  1YJ9 A;  5I2M A;  2C06 A;  2DO3 A;  2EGC A;  2X35 A;  3PE0 A;  4C0D C;  3EGU A;  5GAM d;  3P8H A;  2X4J A;  1LOJ A;  3SDZ A;  2RPN A;  1W4S A;  4J9G A;  3G71 A;  4GY5 A;  5HK3 A;  5IH2 A;  1YFN A;  2LRQ A;  1N9S A;  4RTZ A;  3MPU B;  1OYX A;  2BUD A;  3BDL A;  1HSQ A;  2EJF A;  3T9N A;  5CKD A;  1K9M U;  4C92 C;  4A4H A;  5IXF A;  2ZCF B;  2JMC A;  2QDL A;  4DQ2 A;  2L3P A;  1OZ2 A;  1E7O A;  1G3T A;  3OB9 A;  5CKE A;  1PD1 A;  1PRM C;  3L2V A;  4FYW B;  1G3Y A;  1VYU A;  3FRN A;  4J8O A;  2MK5 A;  4FT4 A;  1I5O B;  5C0M A;  2O01 E;  3P8B B;  2DTH A;  1UG1 A;  1VQM Q;  3V7C A;  3VS6 A;  4JRQ A;  2D1X A;  4JLG A;  3OSS C;  2DL5 A;  1S1N A;  1M90 C;  2ZZD A;  3CCJ T;  1LVK A;  2FB7 A;  2QEX T;  2CZ6 B;  1K8A R;  3VRZ A;  1NEB A;  2E1H A;  1JU5 C;  2E12 A;  1QMC A;  4X1V A;  4IIO A;  5IHN A;  2M16 A;  3M0T A;  4LDV A;  1ARK A;  3CC7 A;  2PUO B;  2DL4 A;  2KVQ G;  3O8V A;  3S6W A;  4HA8 A;  2DAQ A;  3CCE T;  2CSI A;  3TCJ A;  1K8A U;  3GLX A;  4C92 F;  4O5V A;  3PMI A;  1N5Z A;  1ZQ1 A;  3CC2 Q;  2CP0 A;  1VIE A;  4CC4 B;  4E7I A;  3RNJ A;  2C0O A;  4PLI A;  1VQP T;  1BBZ A;  3QXE B;  1JJ2 A;  2IPO B;  2YUP A;  1RI9 A;  1KQ1 A;  3GNF B;  4NL2 A;  2E6Z A;  2ZPG B;  1SRM A;  5GAN f;  3H0H A;  1VQO Q;  2EQJ A;  1VOM A;  2XKO C;  2LQN A;  1YCS B;  1YJ9 T;  4F7U F;  2YSQ A;  2DXU A;  1N8R R;  3QO3 A;  2JXB A;  3V8L A;  4J9B A;  4DBQ A;  4OMM A;  4AFQ C;  4IUU A;  1LPL A;  1V1C A;  4C92 E;  1AD5 A;  1TWB A;  1I0C A;  2HDA A;  2MCN A;  2Y4Y A;  4J9E A;  2PNI A;  1NBE B;  2QAS A;  2MAM A;  1BI2 A;  1NYF A;  4KGZ B;  3OW2 P;  2R58 A;  2EBP A;  2GFA A;  1ZSG A;  5FU6 B;  2P0Q A;  2VWF A;  2QK0 A;  4R55 A;  3INZ A;  3VUZ A;  5CVI A;  2L2P A;  3CCS Q;  3OYY A;  5D6X A;  3CCJ Q;  2F2X A;  3HPW A;  4QT7 A;  1TU0 B;  1NYG A;  2RHY A;  6AT1 B;  2NUP A;  3FJP A;  2CGH A;  4F7U E;  4ZGD B;  1ACM B;  2MI6 A;  5IN1 A;  3GP8 A;  1VQN A;  2KBT A;  1RAI B;  2HNI A;  4F17 A;  5I2S A;  1AWX A;  3V8J A;  1BCM A;  1WHM A;  2HQE A;  1Y0M A;  1IB8 A;  2O2O A;  5CQX A;  4QVD A;  2MWP A;  1QCO A;  4ELY C;  3NFC A;  3VU3 C;  3OYD A;  1M2V B;  1YHQ A;  1Q81 C;  3CXC P;  5GAO r;  1GFD A;  1IRE B;  1WPY A;  3TQ7 P;  2C0I A;  1VQP Q;  4FW1 A;  2XU8 A;  2KRS A;  2HZY A;  3E19 A;  4E6R A;  5CQY A;  1YJN T;  4M78 G;  2KMT A;  1FX7 A;  4A63 B;  5FU7 C;  3UF4 A;  4CRI A;  4HVV A;  2NUZ A;  3OYL A;  1KIK A;  1KQS P;  3CC4 A;  3HSB A;  3MP8 A;  4C5G A;  4WTO B;  1YIT T;  2KRM A;  4Z8A A;  2VVK A;  1Z9Q A;  1QWF A;  3C94 A;  2OTL A;  2G6F X;  2KXC A;  2L5Q A;  1RL2 A;  4J6W A;  1HJD A;  2CYZ B;  5LJ5 h;  1D0Y A;  3CBP A;  3CCL Q;  1Q86 R;  3GOX A;  3DB3 A;  4M7A G;  3JCM c;  4JS4 A;  2JMA A;  3N5B B;  3FC3 A;  4DEY A;  5C6S A;  2A08 A;  2CT4 A;  3QYH B;  1OX9 A;  2KYB A;  4ESR A;  2M1H A;  4N0A A;  1WJQ A;  2DA9 A;  3LH5 A;  2PTK A;  4DOV A;  2O4X A;  4FL6 A;  4DOW A;  4LUD A;  3EHR A;  3CCR A;  3OS2 A;  3H8Z A;  4Z88 A;  1OPK A;  1X6G A;  1K8A C;  1QVF A;  2M51 A;  1VQ6 A;  3M0P A;  2O4X B;  2FRW A;  1AHJ B;  3E1S A;  3EH1 A;  4HKE A;  1WDX A;  4F04 B;  4X9D A;  1VQN T;  1M1F A;  1ZBJ A;  2ECZ A;  4BY6 B;  1BIB A;  3L2Q A;  3G6E A;  4JZ3 A;  2RNA A;  2JT4 A;  4P5N A;  3V7R A;  4EMG A;  1UFF A;  1YJN Q;  3SHW A;  5KE3 A;  4XAX B;  2EGA A;  3FJ5 A;  1K0S A;  1A0N B;  1WX6 A;  2LCS A;  3BY7 A;  1YHQ T;  4MZT A;  2BE9 B;  3M0Q A;  1MNE A;  2EJG A;  1BI3 A;  4MDX A;  2LVM A;  3VS5 A;  3JB9 F;  2DBM A;  2X3W D;  1JRI A;  4J6Y A;  1HD3 A;  5GJW B;  1YIT Q;  3QBY A;  4M77 F;  1M3B A;  1KC8 U;  2FPE A;  4E7Z A;  3JCM P;  3RIR A;  4GBQ A;  1X2Q A;  2OX7 A;  2DEU A;  3CCM Q;  1N8R C;  1NPR A;  3JCM f;  3CBM A;  4PNO A;  1MND A;  1X69 A;  4PFP A;  4KH1 B;  2DXT A;  3CPW A;  4M7A B;  1LJO A;  1G8X A;  2OTL T;  2WSC E;  3M0U A;  2RF0 A;  3MEV A;  1SKU B;  5KE2 A;  3NGP A;  2X3X D;  1X27 A;  4PK4 A;  2MIO A;  1RLP C;  5LJ5 j;  4F14 A;  2EYW A;  2KR3 A;  4CC3 A;  4OMO A;  2K3B A;  3M55 A;  4M77 E;  3HFO A;  1AWW A;  3ZL7 C;  1KFZ A;  1VUB A;  2K2M A;  1GCQ C;  4AG2 C;  1QWE A;  3M58 A;  4RTW A;  2SRC A;  2DKG A;  4BE1 A;  5FU6 C;  4RTX A;  4C0Z A;  3CCR T;  1RAE B;  3NTK A;  1XJW B;  4HVW A;  2JS0 A;  2ENM A;  1VQ6 T;  1UHC A;  2DL7 A;  4KUI A;  1ZSZ A;  5ECA A;  4GLM A;  2MWO A;  1AZE A;  3C4S A;  2ROT A;  2O88 A;  4MZP A;  2JOY A;  2EQU A;  1TSF A;  1VQM A;  1ZSZ B;  3M4G A;  3X26 B;  1TOV A;  2PVD B;  4KUL A;  5GAN 6;  3GBQ A;  1IO6 A;  4M7D A;  4A54 A;  3QWX X;  3CPW P;  1T3L A;  2EQK A;  2RMO A;  4HVU A;  1JEG A;  1OPL A;  2QG9 B;  4BDZ A;  2P0P A;  4M7D B;  4LNP A;  1UEB A;  4ANJ A;  3VS7 A;  3EFR A;  1M90 U;  3JAM E;  2JM9 A;  2AKK A;  2V8J A;  3TRE A;  3WVD B;  3OYC A;  1Q86 C;  4FW2 A;  4RMO A;  3CC2 A;  2FYK A;  1G2B A;  1UJ0 A;  2M9U A;  1QVG A;  4JS5 A;  2XIC A;  1B07 A;  4AT1 B;  5CCA A;  2ZPH B;  3IQL A;  4B9W A;  1PD0 A;  5LJ5 g;  3HL8 A;  2EW3 A;  3M54 A;  2K9G A;  2CUB A;  3THK A;  3NTH A;  5GAN h;  4EIK A;  2NWM A;  4IUT A;  4RTU A;  5GMK m;  1LCK A;  3OYE A;  1T0H A;  5KYU A;  3WXM B;  3ME9 A;  3O5Z A;  2XD0 A;  2YDL A;  3M57 A;  1PNJ A;  2COW A;  1WXU A;  2MOX A;  2P4T A;  5KYU B;  2CRE A;  2DK3 A;  1N27 A;  3OYG A;  3RKY A;  2EGE A;  2XI9 A;  2BE7 D;  3QII A;  4HXJ A;  4ZNX A;  3QDR B;  1CKA A;  3HRT A;  2GQV A;  2M02 A;  2X4Y A;  3PVQ A;  3PGG A;  4J5Y A;  4JDS A;  2YRD A;  1PSE A;  2KRN A;  2K79 A;  3CCS A;  3OYM A;  2F5K A;  3CCJ A;  1U5S A;  1GCP A;  4OMF B;  2QEX A;  4JUV A;  2X9H A;  4A53 A;  1Y57 A;  1T0J A;  2C0T A;  3L1A A;  1WYX A;  2YRV A;  2V1R A;  4IUQ A;  1U3O A;  2CZ7 B;  1M3C A;  4MZM A;  3VS2 A;  1F1B B;  2I0N A;  3M0R A;  2VV5 A;  4XU3 A;  4PJO A;  1QVG P;  4YTL A;  2LT4 A;  2D8J A;  3CCV T;  2GQI A;  4J6X A;  1WLP B;  2FZG B;  1VQL T;  4C5H A;  3A1P A;  4M78 C;  3PTA A;  2KT1 A;  2R57 A;  3TEE A;  2J05 A;  5LJ5 d;  3UPU A;  2E4H A;  2DXC A;  1Z9Z A;  1Q81 R;  1WHK A;  5GAN 8;  1M2O A;  1QLY A;  1VQP A;  2FEI A;  2DD5 A;  1RAA B;  1WNL A;  3DLM A;  3OSV A;  4JJD A;  3OYN A;  3QKJ A;  5GAN e;  2YRC A;  2QTX A;  1YJW Q;  3RES A;  1TTH B;  1YCY A;  1Q81 U;  4OMP A;  4A4F A;  4QW2 A;  3MHX A;  4NL3 A;  2LQK A;  4E7L A;  4M7A C;  3NMZ C;  2DVJ A;  1PKS A;  2ZPE B;  2EJ9 A;  4JRI A;  3JCM W;  2VAS A;  3VS1 A;  1K1Z A;  3MO8 A;  3FEO A;  1I07 A;  1VQO T;  2K5F A;  2L3Q A;  4WF2 A;  3OS1 A;  4CC7 A;  5GAN j;  4FSS A;  4M78 F;  2DX1 A;  4M7A D;  1UGS B;  5FW9 A;  3OYB A;  4J7F A;  1UE9 A;  2E6N A;  1XTD A;  4N4I A;  2E65 A;  2VC8 A;  1UHF A;  1X43 A;  3U23 A;  1WFW A;  2HSE B;  5FRO A;  4J7I A;  5LJ3 f;  1JBM A;  1WJS A;  1WIE A;  2A3L A;  4BI3 A;  2PQW A;  3OW2 A;  1WI7 A;  4E7S A;  3CCS T;  3CCV Q;  2RHU A;  1VQL Q;  4M7A F;  4KGX B;  5D7U A;  5KYY A;  4FM4 B;  5J39 A;  2F2W A;  4M78 E;  2BIV A;  7AT1 B;  1KD1 R;  2COY A;  4X9C A;  3OMG A;  4DBF A;  3M5A A;  2HKN A;  2WAC A;  2K57 A;  3SEM A;  2J6O A;  1YJN A;  1UGP B;  2EQI A;  5GAN 3;  3V7S A;  3RDV A;  1FXX A;  1SG5 A;  3HRU A;  1U06 A;  2JNG A;  2EYQ A;  5IT9 E;  1SRL A;  1R0B G;  1TH7 A;  4TVR A;  2CDT A;  1YIT A;  4M7A E;  2EVR A;  4WCI A;  3CXC A;  1ABQ A;  4XK8 E;  3TVT A;  1KK7 A;  4AFZ C;  3QJY A;  2FZK B;  3EAE A;  4RCC A;  4PKC C;  5AT1 B;  3CCM A;  4RG2 A;  4C8Q A;  4EDU A;  4M7D D;  3JCM h;  3EHQ A;  1ZHI A;  3L2Z A;  3RMS A;  2BZ8 A;  4MMK A;  1XNI A;  5CIU A;  3MEU A;  3QHS A;  2COZ A;  1WHG A;  5GAN g;  3OS0 A;  4PL6 A;  1GRI A;  2EFI A;  2R5A A;  1MMG A;  1H3H A;  2JTM A;  2XDB A;  1KQS A;  1WHH A;  1ZX6 A;  4NOY A;  4OMN A;  5HK0 A;  1N8R U;  4JRK A;  1PRL C;  3EGD A;  3CCL T;  3VYH B;  4XQ3 A;  2RJC A;  3JB9 I;  3ULR B;  3L2R A;  1QKX A;  1JJ2 S;  2FG0 A;  4BI8 B;  1VQ4 Q;  1X6B A;  3SFM A;  2HMA A;  3QWY A;  2DYI A;  2F2V A;  3EGD B;  3I55 Q;  4PJL A;  1XOV A;  4PFZ A;  5KYX A;  1B3Q A;  3UWN A;  4EMK A;  4HT8 A;  4KUD K;  4OP0 A;  1RLQ C;  1E6G A;  2YLB A;  3EGX A;  3M9Q A;  1HK9 A;  3X25 B;  4BB7 A;  1I5L A;  3MKD A;  3TU4 K;  3AHU A;  1HXD A;  4Y92 A;  4CI0 C;  2EYX A;  2RN8 A;  3BDU A;  4RTV A;  1X2K A;  2NUP B;  1SHF A;  3EGX B;  4L6V 5;  4VUB A;  3PFS A;  4XTX A;  2K2V A;  3RER A;  1MMN A;  4JJN K;  4Q5W A;  2RQV A;  1YIJ Q;  3LH0 A;  2MPX C;  1VA7 A;  1H92 A;  3J7A F;  2DVE A;  4LXC A;  1I1J A;  1K73 R;  1QKW A;  1PG5 B;  1NM7 A;  1PKT A;  3ZBD A;  1D3B A;  4AFU C;  5GAO m;  2VUB A;  2LQ8 A;  4OB3 B;  2GTO A;  4J9C A;  4M75 A;  1QP3 A;  1YWP A;  1B34 A;  2ED0 A;  1K73 U;  5GAN d;  4J9H A;  4XU2 A;  1D3B B;  2CP5 A;  1GL5 A;  4PFO A;  3WVE B;  2NUT A;  3OMC A;  2L3R A;  2RHZ A;  2YXY A;  4JPB W;  4JRP A;  1SF9 A;  2FHD A;  3CQT A;  4PJO D;  1IZ6 A;  1W6X A;  4PJN A;  3L2W A;  3URG A;  3VS3 A;  2V8I A;  1MHN A;  3CCM T;  5GAN 2;  1TG0 A;  3OBY A;  3JCM X;  3OYF A;  5FWB A;  2O9S A;  3LW5 E;  3NPF A;  3CCQ T;  1SPK A;  4FYX B;  1Q86 U;  2CKK A;  2OI3 A;  2L0A A;  5HY6 A;  3VRY A;  2FPF A;  2DIG A;  1UDL A;  4KBM B;  1H64 1;  2LT1 A;  5CR2 A;  3LWH A;  4II1 A;  2NLU A;  1YNZ A;  1IHW A;  1BU1 A;  3A8M B;  2LJ3 A;  4FT2 A;  5DY9 A;  3S3N A;  2JS2 A;  5EC7 A;  1NE8 A;  3JCM V;  2ESW A;  4OB0 B;  4QVC A;  2A37 A;  1NLO C;  1KD1 C;  3LLR A;  4IUV A;  4M4Z A;  3SB2 A;  2EKH A;  3VV0 A;  3M59 A;  3MEA A;  1I81 A;  1VQK Q;  4E7K A;  3AT1 B;  5HKC A;  4LD9 K;  4J9F A;  4A4G A;  1J3T A;  2VXE A;  4FSX A;  4ZGE B;  3OQ5 A;  2HD0 A;  1U1T A;  1Q7Y C;  1ZUK A;  2A28 A;  2YUN A;  5GAO n;  3I5S A;  3I9Q A;  4JJC A;  2K3X A;  3LX7 A;  9ATC B;  3LWI A;  2DZC A;  1JXM A;  2DLP A;  2J6K A;  2AIR B;  2D6F A;  2JJ9 A;  1QVF S;  4ORZ A;  5IHI A;  3R6N A;  2QXF A;  3I35 A;  5LJ5 e;  5DLO A;  5J26 A;  2EYY A;  3JB9 H;  1R8O B;  3OA6 A;  3BFM A;  4M7D G;  1AEY A;  1M1K C;  2MYS A;  2EQM A;  1VQ8 T;  4KT0 E;  4C0G A;  5KYW A;  4HCK A;  2GCX A;  3CCQ Q;  3M53 A;  3JCM g;  5GMK l;  3GIB A;  1BKB A;  2BTT A;  1YJW A;  1KQ2 A;  4Z02 A;  4OF1 A;  4EPC A;  2RJE A;  1EZZ B;  2QDY B;  5L23 A;  1AVZ C;  4RTT A;  5M9O A;  4BI4 A;  1X6O A;  4C0D B;  2XDP A;  2KT8 A;  2LCC A;  2LZ6 B;  4C92 A;  4OVA A;  2CS7 A;  4ZN3 A;  2RK2 A;  3A8L B;  1KJW A;  2LP5 A;  3H9N A;  1S72 T;  1C0M A;  1MV0 B;  2QQB A;  3EG3 A;  2BKD N;  2R5M A;  4C8Q D;  4FIB A;  5CKF A;  3CPW S;  1YBY A;  2HKQ B;  4NS5 A;  4E7J A;  2LX9 A;  4XTZ A;  3A8H B;  3LGF A;  5FRN A;  3MJX A;  1K73 C;  4L59 A;  2RQR A;  5LJ3 h;  2QA4 T;  4F7U A;  1UB4 A;  3OS5 A;  1C1A A;  1B7T A;  3L2U A;  2DEQ A;  1NJI C;  3EG1 A;  3CCV A;  1VQL A;  2ROL A;  2P4R A;  3SD4 A;  3X24 B;  2WSF E;  3KUF A;  3RBB B;  4KGV B;  4D6W A;  1VQ8 Q;  4OB2 B;  3CME Q;  3GF5 A;  2RK1 A;  1TUD A;  2GTJ A;  2BZX A;  4X34 A;  4PJO G;  2PUK B;  2L89 A;  3G4S T;  1VQ7 T;  1V29 B;  1PM3 A;  5A0G A;  8ATC B;  3KXT A;  1FMW A;  3HP9 A;  4ZTF A;  1CSK A;  2E10 A;  3EG9 A;  2RHX A;  2E5Q A;  1GBQ A;  2YUQ A;  1YJW T;  3MET A;  2KSS A;  1VQO A;  4BE2 A;  2J6F A;  2DIQ A;  2ZAE A;  4M75 D;  3MEW A;  3DB4 A;  3NTI A;  1S72 Q;  3FIF A;  2NYS A;  3Q1J A;  2CT3 A;  2EIF A;  1W70 A;  3OYI A;  4E2F B;  5GAO q;  4ZTJ A;  1FWZ A;  4ELZ C;  4B6M A;  1RAC B;  2QQA A;  5FWC A;  2QQ9 A;  4MDW A;  2O31 A;  1OU8 A;  1ABO A;  1IHV A;  2P84 A;  3RUX A;  5LJ3 e;  3J80 E;  3TSZ A;  5I11 A;  2QA4 Q;  4JLI A;  4N0A C;  3P8D A;  1O75 A;  4Z89 A;  2RJD A;  4RCB A;  3EG0 A;  1OI1 A;  3J81 E;  1K76 A;  3E9F A;  5GAM f;  5HCK A;  1VQ4 A;  2K4Y A;  1TXQ A;  3JB9 G;  2LTO A;  1BYM A;  1WGS A;  3I55 A;  5KH6 A;  4J9I A;  1G3S A;  4M77 G;  1W2B S;  3C0C A;  3RR6 A;  3A8G B;  2RA2 A;  1N9R A;  3ZEH A;  2KY9 A;  2CZ0 B;  4BY6 C;  4QQ6 A;  1M3A A;  1P92 A;  2VXF A;  2MF2 A;  5LJ3 j;  3CMA T;  4LDW A;  1QVP A;  5D6Y A;  1QCN A;  3G4S Q;  3S3M A;  3CD6 T;  1VQ7 Q;  1IGU A;  1KSW A;  1YIJ A;  2ZPB B;  4PJO B;  2RQW A;  2OAW A;  2K6D A;  5EG2 A;  2XHC A;  2F5T X;  5CK9 A;  4IKF A;  2HCK A;  1OU9 A;  2DYB A;  4DBR A;  2GFU A;  4KH0 B;  3CCU Q;  3M56 A;  5A2Q E;  2I2L A;  2HL5 C;  4OGE A;  4FCY A;  1TUC A;  4XTW A;  2QGG A;  2W0Z A;  2DF6 A;  3HHT B;  5FU7 B;  3E9G A;  2Z0W A;  1VIF A;  3EH2 A;  4KRT A;  2XID A;  5L8R E;  5A0L A;  5IHK A;  2ED1 A;  3QG1 A;  3QZ9 B;  5CKB A;  1SSF A;  2E3I A;  2IVW A;  3C12 A;  1UEC A;  5KYN A;  4OML A;  3RMQ A;  3HRS A;  3CCL A;  1WZO A;  1FYN A;  3UT1 A;  1UTI A;  2RM4 A;  2OTJ T;  4XU1 A;  2DRM A;  4C8Q G;  4DA4 A;  4UC4 A;  2CP7 A;  3BW1 A;  3M0S A;  1K9M R;  2F1L A;  2EAY A;  1VQ5 T;  3OYH A;  2AZV A;  5GMK i;  4M77 A;  3MCA B;  3OYA A;  3OYJ A;  2LC4 A;  3OBW A;  1Q95 G;  2AKL A;  2GNC A;  2ZPF B;  1M1G A;  2J7I A;  2ABL A;  4M77 B;  2Y4X A;  1I4K 1;  2FPD A;  2DRK A;  1VQ4 T;  4XTY A;  3CMA Q;  1N6A A;  2KYM A;  3A98 A;  2RI5 A;  3PVL A;  3I55 T;  2PZ1 A;  2K7A A;  2DL3 A;  3VS4 A;  5LJ3 g;  3M4Y A;  2E64 A;  3CD6 Q;  3MP1 A;  4XTU A;  3SWN A;  1MMD A;  2EKO A;  2PU9 B;  3DLL A;  1YI2 Q;  4C92 D;  3H41 A;  1KG1 A;  1ZSZ C;  4Y91 A;  5GAO l;  4HCZ A;  1RAH B;  3BE3 A;  5DLQ E;  1WHJ A;  2VB6 A;  1WHL A;  5KYY B;  1VQK A;  5IAY A;  3SWN B;  2YWW A;  1RUW A;  2LQW A;  2AZS A;  2HBW A;  3FLG A;  1YIJ T;  1JO8 A;  3QYG B;  2M0Y A;  1WXB A;  5CAI A;  1KD1 U;  3I56 Q;  1RI0 A;  2FRY A;  3ZFJ A;  4M7D C;  1Q7Y R;  2HL3 A;  4Y28 E;  1D0X A;  4J9D A;  3OW2 S;  1PSF A;  1OUL A;  2XG8 D;  1PCX A;  2QI2 A;  1Y71 A;  1YN8 A;  2D0Q B;  2E41 A;  2LJ0 A;  1Q7Y U;  1VQ9 Q;  1OZ3 A;  4M75 G;  3OYK A;  4R56 A;  4B9X A;  3HKS A;  2DXB A;  2OTJ Q;  1MGQ A;  2CP2 A;  1AT1 B;  1M1K R;  3JRZ A;  1UGV A;  1OOT A;  1VQ5 Q;  3CCQ A;  4C8Q B;  1IRX A;  3H0I A;  2DZ9 A;  3JCM J;  1D1A A;  3VJP A;  5DM7 R;  2W10 A;  2EWN A;  2XK0 A;  4K11 A;  1M1K U;  2EYZ A;  2WSE E;  5A0D A;  5LJ3 d;  1GCQ A;  2JTE A;  5KCO A;  3H0F A;  4GLK A;  2FZC B;  1AZG B;  1Q82 R;  3GPL A;  3CXC S;  4M7D F;  2K5L A;  2JN0 A;  1IGQ A;  3HTR A;  3G71 T;  2D0N A;  5CKH A;  4O6J A;  1M8M A;  4LDU A;  2HAX A;  4E47 A;  2RI2 A;  4CC2 A;  1TUG B;  1WQ7 A;  4BUG A;  3G1J A;  2HQX A;  1VYV A;  2MMP A;  1Q82 U;  1D0Z A;  5KYX B;  1OX8 A;  4EMK B;  1VYT A;  1D1C A;  1W1F A;  2QTV A;  2DER A;  4BAC A;  1RAD B;  2KQW A;  2B8A A;  2DET A;  3REA B;  1V76 A;  4FYV B;  4LE9 A;  2RH2 A;  1KQS S;  3F70 A;  3TSW A;  2QEX Q;  2RQT A;  4RKU E;  1SHG A;  3PMT A;  2LJ1 A;  2QGF B;  2ATC B;  5GMK h;  1M2V A;  2BZY A;  2DMO A;  3CCE Q;  2F69 A;  4M7D E;  4ZN1 A;  1BI1 A;  1VQK T;  1JJ2 P;  3LGL A;  2FVU A;  1KHI A;  4IUR A;  1NJI R;  2L3S A;  4PJO C;  3JCM e;  1DJ7 B;  1ZA2 B;  1Y7X A;  2KXD A;  3CC7 T;  2LCL A;  4HCB A;  2RJF A;  4M75 B;  4EMH A;  2H3E B;  1GXI E;  4ME7 A;  1B34 B;  2DTI A;  1VQ8 A;  1NJI U;  3PIP A;  3CME A;  4JJB A; 
#chains in the Genus database with same CATH homology
 2E12 A;  3QDR B;  5M9O A;  2M16 A;  4LDV A;  3QUI A;  4BI4 A;  1X6O A;  3HRT A;  2GQV A;  4C0D B;  2XDP A;  2PUO B;  2X4Y A;  2KVQ G;  3O8V A;  3CC7 A;  2LCC A;  3S6W A;  3PGG A;  4J5Y A;  4JDS A;  1PSE A;  4OVA A;  2K5I A;  2CS7 A;  4HA8 A;  3X28 B;  2DAQ A;  4C92 A;  2F5K A;  5FLX E;  4ZN3 A;  3OYM A;  3CCS A;  3CCE T;  3TCJ A;  3CCJ A;  2FL7 A;  4OMF B;  1K8A U;  3GLX A;  2RK2 A;  3A8L B;  5CO7 A;  2QEX A;  1K9M C;  4JUV A;  3FB9 A;  4C92 F;  4O5V A;  3PMI A;  1S72 T;  3S3O A;  2OAU A;  3RKW A;  4A53 A;  4C0F A;  2QQB A;  3L42 A;  3L1A A;  1ZQ1 A;  2BKD N;  2HBP A;  2R5M A;  2YRV A;  4FIB A;  5CKF A;  4C8Q D;  4IUQ A;  3CPW S;  2CZ7 B;  1JB0 E;  2JTF A;  4MZM A;  1VIE A;  1YBY A;  4NS5 A;  4E7I A;  2VV5 A;  2LX9 A;  4PLI A;  4XU3 A;  4E7J A;  4XTZ A;  2AHJ B;  2RD1 A;  3A8H B;  1VQP T;  3QXE B;  4PJO A;  2JUF A;  4YTL A;  3LGF A;  1JJ2 A;  5FRN A;  2LT4 A;  3CCV T;  1EIF A;  3HFN A;  1LNX A;  4J6X A;  4HT9 A;  1VQL T;  3FDR A;  1KQ1 A;  3GNF B;  4L59 A;  4M78 C;  4PJO F;  4C5H A;  3PTA A;  4NL2 A;  2R57 A;  1S72 A;  2E6Z A;  3TEE A;  2ZPG B;  5LJ3 h;  5LJ5 d;  3UPU A;  5GAN f;  2QA4 T;  4F7U A;  1UB4 A;  2D9T A;  2DXC A;  3OS5 A;  2EQJ A;  5GAN 8;  2IG0 A;  2XKO C;  1VQP A;  3L2U A;  2DEQ A;  2YLC A;  2DD5 A;  1YJ9 T;  4F7U F;  1NJI C;  2DXU A;  3CCV A;  3G7Z A;  3QO3 A;  4LDX A;  1WNL A;  3V8L A;  5GMK e;  1VQL A;  1X01 A;  1ZBX A;  3DLM A;  4M77 C;  3OSV A;  4C92 G;  3OYN A;  3QKJ A;  5GAN e;  4IUU A;  2QTX A;  5LL6 S;  3SD4 A;  4C92 E;  3RES A;  1YCY A;  2QA4 A;  3X24 B;  2WSF E;  1Q81 U;  2Y4Y A;  2DJZ A;  2DTO A;  3KUF A;  5GAM h;  4D6W A;  2MAM A;  1BI2 A;  3X20 B;  4A4F A;  2R58 A;  3PNW C;  3JB9 D;  4OB2 B;  3MHX A;  4QW2 A;  2GFA A;  4NL3 A;  3GF5 A;  2RK1 A;  4FU6 A;  2LQK A;  3RKX A;  4E7L A;  4M7A C;  4X34 A;  5FU6 B;  2P0Q A;  4PJO G;  2PUK B;  2ZPE B;  2EJ9 A;  4M77 D;  2L89 A;  1BIA A;  2DPP B;  4JRI A;  3G4S T;  4R55 A;  3JCM W;  1VQ7 T;  1M5Q 1;  3INZ A;  1V29 B;  3VUZ A;  4PJO E;  1H3Z A;  1KHC A;  3MO8 A;  3ER0 A;  5CVI A;  5A0G A;  3FEO A;  3KXT A;  1VQO T;  1WQW A;  2K5F A;  2Y90 A;  3HP9 A;  3OYY A;  4M78 A;  5GMK j;  5D6X A;  4WF2 A;  3SWN C;  2VGN A;  3HPW A;  3OS1 A;  2ZGW A;  1I8F A;  3MP6 A;  4ZTF A;  4F7U G;  2RHY A;  4V2S A;  5GAN j;  3JSC A;  3FJP A;  2CGH A;  2A7Y A;  4M78 F;  4F7U E;  4ZGD B;  5FRM A;  4M7A D;  2KK4 A;  1UGS B;  3ASK A;  1NZ9 A;  2M0O A;  2MI6 A;  3CBO A;  3CPF A;  5IN1 A;  2X4W A;  3GP8 A;  1VQN A;  2E10 A;  3G4S A;  2HNI A;  1VQ7 A;  4M78 B;  3OYB A;  2RHX A;  5I2S A;  2E5Q A;  2X4X A;  4M7D D;  4J7F A;  1YJW T;  3MET A;  2E6N A;  2KSS A;  2G3R A;  3V8J A;  1XTD A;  1VQO A;  2JZ2 A;  4N4I A;  2HQE A;  4BE2 A;  2E65 A;  2VC8 A;  2DIQ A;  5J3B A;  4M75 D;  5CQX A;  4QVD A;  2MWP A;  3MEW A;  4BE0 A;  3DB4 A;  3NTI A;  5FRO A;  3FIF A;  4J7I A;  3QJ6 A;  4ELY C;  3Q1J A;  3CME T;  3A5Z B;  5LJ3 f;  3NFC A;  1JBM A;  2EIF A;  3GNG A;  3VU3 C;  3OYD A;  3OYI A;  3CCU A;  5GAO q;  1YHQ A;  1Q81 C;  3EFS A;  1WJS A;  4ZTJ A;  5GAO r;  2A3L A;  1FWZ A;  4ELZ C;  1IRE B;  1WPY A;  2QQA A;  1K73 C;  4BI3 A;  4M7A A;  2QQ9 A;  2XU8 A;  4MDW A;  2PQW A;  3OW2 A;  2K3Y A;  3CCS T;  4PLL A;  2RHU A;  3E19 A;  3A8O B;  3CC4 T;  2V8K A;  3RUX A;  3R6O A;  5LJ3 e;  3JCM b;  1Q82 C;  4M7A F;  5CQY A;  3DKM A;  1YJN T;  3J80 E;  4FM4 B;  4M78 G;  2KMT A;  1FX7 A;  3LYI A;  5J39 A;  4C8Q C;  4JLI A;  4N0A C;  4M78 E;  2BIV A;  1O75 A;  3P8D A;  3OY9 A;  5FU7 C;  2RJD A;  4RCB A;  1UGQ B;  1OI1 A;  3J81 E;  5GAM f;  3E9F A;  4CRI A;  1VQ4 A;  2K4Y A;  3OYL A;  3JB9 G;  4X9C A;  3OMG A;  3M5A A;  2LTO A;  4LD6 A;  1BYM A;  2WAC A;  1WGS A;  2K57 A;  3I55 A;  5KH6 A;  3CC4 A;  3HSB A;  4QVZ A;  1YJN A;  1G3S A;  3MP8 A;  1Y96 A;  4M77 G;  4C5G A;  1YIT T;  1W2B S;  1UGP B;  3A8G B;  2RA2 A;  5GAM e;  1N9R A;  5GAN 3;  3ZEH A;  2KY9 A;  3C94 A;  2OTL A;  2CZ0 B;  4BY6 C;  4C92 B;  4QQ6 A;  3V7S A;  1FXX A;  1RL2 A;  2L5Q A;  1P92 A;  4J6W A;  2CYZ B;  2VXF A;  3HRU A;  2MF2 A;  5LJ5 h;  2JNG A;  5LJ3 j;  4LDY A;  2EYQ A;  4C5E A;  2RI3 A;  3CBP A;  5IT9 E;  1Y96 B;  2E70 A;  3CMA T;  1TH7 A;  4TVR A;  3GOX A;  4LDW A;  1QVP A;  5D6Y A;  3DB3 A;  4M7A G;  3JCM c;  4JS4 A;  1YIT A;  2VYT A;  4M7A E;  3S3M A;  3CD6 T;  3CXC A;  4XK8 E;  3N5B B;  1YIJ A;  4EMK C;  3FC3 A;  5C6S A;  2ZPB B;  3QYH B;  4PJO B;  3QJY A;  3KBG A;  3EAE A;  4RCC A;  4PKC C;  1WJR A;  3CCM A;  2M1H A;  2XHC A;  2F5T X;  4RG2 A;  5EG2 A;  4N0A A;  1WJQ A;  3JCM h;  4C8Q A;  4EDU A;  5CK9 A;  1ZHI A;  3CMA A;  2RO0 A;  4IKF A;  3L2Z A;  3RMS A;  5GAM j;  3VYG A;  4MMK A;  1XNI A;  2GFU A;  5CIU A;  3M56 A;  3MEU A;  3QHS A;  3VKI A;  4A4K A;  5A2Q E;  4BDY A;  4C8Q F;  2I2L A;  4DOV A;  4F7U B;  2O4X A;  3CD6 A;  4FL6 A;  4OGE A;  5GAN g;  4DOW A;  3OS0 A;  4PL6 A;  3CCR A;  3OS2 A;  4XTW A;  3H8Z A;  2EFI A;  4XTV A;  1YI2 A;  3HHT B;  2R5A A;  3JCM d;  5FU7 B;  3E9G A;  2LDM A;  1QP2 A;  2JTM A;  2XDB A;  1VIF A;  4QQG A;  1KQS A;  1K8A C;  1BI0 A;  4NOY A;  5HK0 A;  1N8R U;  1QVF A;  3G6E T;  1VQ6 A;  4JRK A;  2XID A;  2O4X B;  3CCL T;  3VYH B;  4XQ3 A;  1AHJ B;  2RJC A;  5L8R E;  3E1S A;  3JB9 I;  5A0L A;  3L2R A;  4HKE A;  3QG1 A;  3QZ9 B;  5CKB A;  1SSF A;  1JJ2 S;  4OB1 B;  2QQS A;  4X9D A;  1G3W A;  2IVW A;  2PVG B;  1VQN T;  4BI8 B;  3C12 A;  1M1F A;  1M8V A;  3SFM A;  5AYF A;  3V8K A;  4BY6 B;  3I56 A;  1BIB A;  5I21 A;  1XOV A;  4M75 C;  2GF7 A;  3RMQ A;  3UWN A;  4EMK A;  4HT8 A;  3L2Q A;  3HRS A;  3G6E A;  4HCC A;  4KUD K;  4P5N A;  3V7R A;  4OP0 A;  4EMG A;  3CCL A;  2YLB A;  5KE3 A;  4XAX B;  3M9Q A;  2RM4 A;  3UT1 A;  2OTJ T;  1HK9 A;  3X25 B;  4BB7 A;  4XU1 A;  4C8Q G;  2RHI A;  3BY7 A;  3CCU T;  4MZT A;  4UC4 A;  5GAN 7;  4DA4 A;  1YHQ T;  1I5L A;  3TU4 K;  2YHT A;  3BW1 A;  2KDS A;  2EJG A;  3AHU A;  4C8Q E;  1BI3 A;  1HXD A;  4CI0 C;  5LJ5 f;  5GAN 4;  3BDU A;  2EAY A;  1VQ5 T;  2LVM A;  3OYH A;  4MDX A;  3JB9 F;  5GMK i;  2P0K A;  4M77 A;  4L6V 5;  4VUB A;  2VGM A;  3MCA B;  1VQ9 A;  3PFS A;  4XTX A;  2K2V A;  1JRI A;  3RER A;  3OYA A;  4J6Y A;  3OYJ A;  2LC4 A;  4ATO A;  1Y07 A;  4JJN K;  3QBY A;  4IUP A;  4M77 F;  3OBW A;  4Q5W A;  3JCM Q;  1KC8 U;  2OTJ A;  3LH0 A;  1QW1 A;  3J7A F;  2ZPF B;  1M1G A;  3JCM P;  2DVE A;  4M77 B;  3RIR A;  1G5V A;  2Y4X A;  1I4K 1;  2CZ1 B;  1VQ5 A;  5D6W A;  1VQ4 T;  1N8R C;  1NPR A;  3JCM f;  4XTY A;  3JB9 J;  3CBM A;  4PNO A;  1N6A A;  4XU0 A;  3H6Z A;  2RI5 A;  3I55 T;  3ZBD A;  1D3B A;  1QVG S;  5GAO m;  5LJ3 g;  2VUB A;  2E64 A;  2LQ8 A;  3M4Y A;  1W2B A;  4MML A;  4OB3 B;  4BD3 A;  3MP1 A;  1X75 C;  4XTU A;  2DXT A;  4M75 A;  3SWN A;  3CPW A;  1QP3 A;  4M7A B;  5GAN 5;  1LJO A;  2EKO A;  2PU9 B;  1B34 A;  3DLL A;  2OTL T;  2WSC E;  4C92 D;  3VUB A;  1K73 U;  1KG1 A;  5GAN d;  1UGR B;  4XU2 A;  3MEV A;  1D3B B;  4Y91 A;  4M75 F;  5GAO l;  4HCZ A;  5KE2 A;  5DLQ E;  1U1S A;  3QPH A;  1VQK A;  5IAY A;  3SWN B;  5LJ5 j;  3WVE B;  3OMC A;  3QZ5 B;  2L3R A;  2RHZ A;  3M55 A;  4JRP A;  2JVV A;  3FLG A;  4J83 A;  1YIJ T;  3QYG B;  4M77 E;  5GAM g;  5CAI A;  1KD1 U;  2FHD A;  4PJO D;  1IZ6 A;  3HFO A;  1RI0 A;  3L2W A;  3URG A;  3ZFJ A;  4M7D C;  1NPP A;  1MHN A;  1VUB A;  2V8I A;  5GAN 2;  3CCM T;  3M58 A;  4Y28 E;  3OBY A;  1KC8 C;  3OW2 S;  2DKG A;  1PSF A;  3JCM X;  4BE1 A;  5FU6 C;  3PIO A;  2LNV A;  3OYF A;  3C95 A;  2XDD A;  2RB6 A;  2XG8 D;  3PT9 A;  4C0Z A;  1M4Z A;  3LW5 E;  3CCR T;  2QI2 A;  1Y71 A;  3CCQ T;  3CEY A;  2D0Q B;  4OGC A;  4ZGJ B;  2E41 A;  1YI2 T;  3NTK A;  1Q7Y U;  1OZ3 A;  4M75 G;  3OYK A;  2CKK A;  1Q86 U;  2ZPI B;  5HY6 A;  4R56 A;  4N4H A;  1VQM T;  1VQ6 T;  4M75 E;  2DIG A;  4B9X A;  3HKS A;  2DD4 A;  2DXB A;  4KBM B;  4KUI A;  3CCE A;  1H64 1;  2LT1 A;  1MGQ A;  5CR2 A;  5KCH A;  3LWH A;  2PVO B;  4II1 A;  2NLU A;  3QSU A;  3JRZ A;  4RG8 A;  2L8D A;  2MWO A;  1XQH A;  3C4S A;  3CCQ A;  4MZP A;  4C8Q B;  3A8M B;  2JOY A;  4FT2 A;  5DY9 A;  2DZ9 A;  1U8R A;  3I56 T;  3JCM J;  3S3N A;  2QQR A;  2EQU A;  4L5G A;  3VJP A;  5DM7 R;  1NE8 A;  4C5I A;  2EWN A;  1VQM A;  3JCM V;  3M4G A;  1M9S A;  4OB0 B;  3X26 B;  2XK0 A;  2H3J A;  2PVD B;  4A4E A;  4KUL A;  3UDC A;  5GAN 6;  4QVC A;  1O9S A;  1M1K U;  1KD1 C;  2WSE E;  5A0D A;  4M7D A;  3LLR A;  5LJ3 d;  4A54 A;  5KCO A;  4IUV A;  4GLK A;  3SB2 A;  2EQK A;  4M78 D;  3VV0 A;  3GPL A;  3CXC S;  3M59 A;  4M7D F;  2KAF A;  2K5L A;  3MEA A;  3CC2 T;  4E7H A;  1I81 A;  2JN0 A;  1VQ9 T;  5GAO p;  3G71 T;  4BDZ A;  4E7K A;  2P0P A;  4N4G A;  4QQD A;  5CKH A;  5HKC A;  1YJ9 A;  4O6J A;  4M7D B;  5I2M A;  4LDU A;  2C06 A;  4LD9 K;  4A4G A;  2HAX A;  4E47 A;  1UEB A;  2RI2 A;  2VXE A;  3EFR A;  4FSX A;  4ZGE B;  2DO3 A;  1WQ7 A;  4BUG A;  1M90 U;  2HQX A;  3OQ5 A;  3JAM E;  2X35 A;  2HD0 A;  2MMP A;  1U1T A;  1Q82 U;  4C0D C;  2V8J A;  1Q7Y C;  3TRE A;  3WVD B;  4EMK B;  3OYC A;  1Q86 C;  5GAM d;  3P8H A;  5GAO n;  2X4J A;  4RMO A;  1LOJ A;  3SDZ A;  3CC2 A;  4BAC A;  2FYK A;  2KQW A;  2K3X A;  2B8A A;  2M9U A;  3LX7 A;  1W4S A;  3LWI A;  3G71 A;  1QVG A;  4GY5 A;  5HK3 A;  4JS5 A;  2DZC A;  2XIC A;  2LRQ A;  2D6F A;  2RH2 A;  1N9S A;  1KQS S;  3F70 A;  1OYX A;  1QVF S;  5CCA A;  2BUD A;  3BDL A;  2ZPH B;  2EJF A;  2QXF A;  4RKU E;  3T9N A;  5CKD A;  4B9W A;  5DLO A;  3PMT A;  5LJ5 g;  4C92 C;  5LJ5 e;  3HL8 A;  5J26 A;  3M54 A;  4A4H A;  1K9M U;  2ZCF B;  3JB9 H;  1R8O B;  3OA6 A;  5GMK h;  3BFM A;  4M7D G;  4DQ2 A;  3NTH A;  1OZ2 A;  5GAN h;  2F69 A;  4M7D E;  4ZN1 A;  1BI1 A;  1M1K C;  4IUT A;  5GMK m;  1G3T A;  3OB9 A;  5CKE A;  1VQK T;  3L2V A;  2EQM A;  3OYE A;  1G3Y A;  1VQ8 T;  3LGL A;  4KT0 E;  4C0G A;  3FRN A;  2FVU A;  1KHI A;  4J8O A;  3WXM B;  4IUR A;  3ME9 A;  4FT4 A;  2GCX A;  5C0M A;  3M53 A;  4PJO C;  2O01 E;  3P8B B;  2XD0 A;  3JCM e;  2DTH A;  3JCM g;  5GMK l;  3M57 A;  3GIB A;  1DJ7 B;  1BKB A;  1Y7X A;  3CC7 T;  1YJW A;  2LCL A;  4HCB A;  2RJF A;  3V7C A;  4JRQ A;  1KQ2 A;  4JLG A;  3OSS C;  4Z02 A;  4OF1 A;  2P4T A;  2DK3 A;  4M75 B;  4EPC A;  4EMH A;  1M90 C;  2ZZD A;  3CCJ T;  1GXI E;  4ME7 A;  1N27 A;  2RJE A;  1B34 B;  2FB7 A;  2DTI A;  3RKY A;  3OYG A;  1NJI U;  1VQ8 A;  2XI9 A;  3PIP A;  2CZ6 B;  2QEX T;  2QDY B;  3CME A;  3QII A;  2E1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...