3LYLA

Structure of 3-oxoacyl-acylcarrier protein reductase, fabg from francisella tularensis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
247
structure length
247
Chain Sequence
MSLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 3-oxoacyl-acylcarrier protein reductase, FabG from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
total genus 84
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3lylA00
3FRJA 4ZU3A 3SEFA 3ZV4A 4CMJA 3ZWNA 4AJJA 1N92A 2BRUA 1WVGA 5DNAA 3ZWMA 3QSGA 4JCOA 3VDQA 4BGUA 4INAA 2PKQO 1Q0QA 3E9NA 1CF2O 3JTMA 1ML3A 1U8XX 3COSA 2Q3EA 1DSSG 1YE3A 2H5LA 3H2SA 2PZKA 1GDHA 2YV1A 2X23A 2EW2A 5TX7A 1PJQA 4OSOA 4YA6A 3IKVA 4FDAA 5KJFA 5ICSA 5EQDA 4P4NA 1IZ9A 1B8VA 4FJ2A 2IZ1A 4YEDA 1VJ0A 3RKRA 3S2FA 1Q7GA 2JCYA 3DHNA 2Q2QA 4PLZA 3O8QB 3B70A 1JWBB 2XPCA 1QYXA 4BS9A 1EVIA 3C7AA 3TRIA 3BHMA 4YQZA 3B20A 3AUTA 2YW9A 1E3JA 2GGSA 2WJPA 4KTVE 3OQ1A 1LC3A 3W6ZA 4MVJM 2EG9A 4RO0A 2DC1A 3KYBA 4UEOA 2HQ1A 3ST7A 1TLTA 4PLPA 1PGOA 1A71A 1K0UA 4CM4B 4YYZA 1E6WA 3MOGA 3SJ7A 4JROA 1PU2A 3AK4A 1BVRA 1ZO8A 2OBNA 4KMSA 4PLCA 1ENYA 5CEJA 1NQTA 1WDLA 4FD3A 4J4TA 1CJCA 2BFMA 2O2YA 2BHLA 1MG0A 1ULUA 4JP2A 1B16A 2YV2A 3RJ5A 5A3JA 5JPIA 1K3TA 4W7HA 4AJKA 3DEYX 2X86A 2VWQA 4FN4A 4J91A 4E0BA 4YR9A 1FDUA 1F06A 1NASA 2I3AA 4YRAA 3WJ7A 1Q7BA 1CRWG 4XIJA 1SZJG 2GERA 2D5CA 5THKA 4ND4A 3JQ8B 3C85A 4TKMA 1O9BA 2F00A 2GASA 2ZQYA 2W90A 3ICCA 4LGVA 4PLYA 3SC6A 1FDWA 1S7CA 4IJWA 2Z5LA 1QMGA 4KZPA 4Q39A 3WQRA 2HU2A 5IDWA 1PJSA 1KERA 4CL3A 5L4NA 1L7DA 4CLRB 1Y8RA 2B4TO 1NYTA 4AG3A 4KUGA 2QZZA 4TROA 5G0VA 1LEHA 3GNQA 2O3UA 2WTBA 3JQ6A 3FSRA 4XCVA 4BGIA 2CZCA 1M6WA 3JQFC 5JAMA 1WAMA 2Y68A 5C7OO 2G76A 4GX0A 2FPGA 4I5FA 1LSOA 5CG2A 3GOHA 5A9SA 1YDWA 5IAAA 3H7AA 1YBAA 1R4NA 1ENPA 1HLDA 1W4ZA 1I5RA 2D8AA 2A92A 1ORRA 3AUUA 1DRUA 1MUUA 3PQFA 1I2ZA 3GZ4A 1M76A 1JA9A 3NT4A 3GH3A 3I9OA 3EVTA 4JXKA 4L75A 1PS0A 1GD1O 2DPGA 1LLDA 3IP1A 2IE0A 3HFGA 2DTXA 4M55A 1LA2A 1HETA 4B3IA 1OC4A 4E2XA 2B69A 4M1QA 2EXXA 1GEGA 2OFPA 2ZB7A 2OGUA 2DQ4A 5HA5A 2VRBA 1GZ4A 4S1VA 3INRA 2GN4A 2O50A 5DBFA 4PLWA 1KVUA 2GZ1A 2R00A 2NVWA 4ALLA 3B6ZA 3L0DA 4R1SA 1YGYA 5GZ3A 4Z9XA 2Z1NA 4WCFB 3MJ4A 3QW2A 1LDMA 3QWHA 4RQTA 4Q3BA 1ID1A 3GNSA 1NQAO 5TT1A 2IDZA 2PKRA 2X5KO 2NVUB 5T8KA 2ZYGA 5C5IA 1EK6A 4IS2A 4FGWA 5DOZA 1DIHA 1XEAA 1R4MB 2UYYA 4B8WA 3VPGA 4UUPA 1VC2A 2BFPA 1UR5A 4B3HA 2JAHA 2JFGA 4Z9YA 4BV8A 1I2CA 3AY3A 4YAIA 3N58A 3H9QA 1N5DA 3OF2A 4MIYA 4E12A 1E77A 3F5SA 3I9NA 3CINA 2JKVA 3LLVA 3G0OA 4CUKA 2Y0CA 4LW8A 3RWBA 2VWGA 3GN1A 5A3VA 1Y9AA 2QIOA 1NR7A 1M66A 1PZGA 1U9JA 3PEFA 3ADOA 3HB5X 4LK3A 3EYWA 4CQMA 4GWKA 2WYVA 2EGGA 2J5QA 3DHEA 4GPD1 4R4JA 3GEDA 4E2YA 1UXKA 5KVQA 4YAKA 2GRAA 3JD4A 4TVOA 2OBYA 1I33A 1H6DA 1V35A 2BI8A 3CMCO 5BSHA 5JY6A 3JQAA 1EUCA 4L73A 3ZHBA 3L77A 3D5QA 4J1TA 4QFCA 2QRLA 4DIFA 3ZV6A 1ZEMA 4RLSA 5T6BA 5F3RA 4OXKA 1PWXA 1U28A 1VLLA 3ROMA 4UUMA 3I6IA 3VPFA 1MG5A 1E3SA 3BTVA 5U4QA 1PL8A 2D4AA 4GLOA 5HBRA 2B4RO 4EUEA 5KJ6A 4MP3A 2NU9A 3NX4A 3QVXA 1KY5A 4PRLA 3SXPA 3JD2A 4P22A 2FPIA 3IJPA 1MX3A 3TL3A 4ALKA 3VTZA 4AJ2A 1O95A 4MJLA 5JYDA 4UVEA 1IY8A 1I3NA 2ZJ1A 3I4FA 4NBRA 3KLPX 4K6CA 1Q0HA 3P5SA 4L76A 2PH3A 5G4LA 3LC1O 1MFPA 2E49A 5IZ4A 5COQA 3EY4A 1TEHA 2E82A 1HYHA 2W2KA 2NV6A 3WYBA 2UUOA 4BNVA 5B1YA 4YVFA 1QRRA 4J43A 5ILGA 4GGOA 1OMOA 1QORA 3RVDA 4DPKA 3GPIA 1O5IA 4O6VA 1QV6A 4E5YA 2RBEA 4BIIA 3UKOA 1H6CA 2VYVD 4R1NA 5DDIP 2EKQA 4CLDA 3PVZA 1K89A 4W4TA 5TRTA 4XGNA 2AQKA 3GEGA 4CR8A 2Y0DA 4EI2A 4BNJA 3E03A 5IN4A 4XYBA 5B4UA 2YFQA 1E6EA 3ZNPA 3D5TA 3GG9A 1Z82A 1ZKMA 4UVDA 5JYEA 3TF5A 3AFMA 4IGEA 3VC7A 1ZK3A 1PQUA 4AJPA 4PG6A 2BI7A 2W2LD 3DBRA 3PHIA 1TT5B 1P0FA 4RPKA 1PZEA 2P5UA 3A4VA 3JQGA 4JNKA 1DRVA 5I7FA 1A72A 3DOJA 4NBUA 5JDIC 2JAPA 4GGPA 4XRRA 1LDNA 2FPPA 4KOAA 5TS3A 4Y8VA 2FZWA 1HDYA 4R3NA 1KY4A 4NMHA 4ZICA 5JBIA 6ADHA 2DLDA 3GVPA 2XAAA 2W4QA 3L07A 4N7RA 2X22A 4WLUA 4RL6A 5JW6A 3KETA 1E3WB 3WMXA 2GNAA 4Z0PA 1OFGA 3C7CB 1TXGA 2G17A 5T5QA 3VTFA 4NJMA 1WZEA 5FEUA 1EUZA 4J2OA 3FWNA 3WTBA 4BO7A 4UVGA 5AVOA 3DDNA 3DZKA 1QG6A 2PLAA 3IMFA 1C0PA 3DOOA 2YZ7A 3O03A 4Y67A 1P9LA 2C82A 3I52A 2PD6A 4AL4A 5L4LA 1PZFA 2YUTA 1YKFA 1Q0LA 2ZJ0A 1DXYA 1HDRA 2VRCA 5ES3A 3OEYA 5COAA 3UICA 3ZV5A 2EJVA 3KXDA 4U5QA 1NWHA 3ZHXA 4PZDA 5KJEA 2C5EA 4TSKA 5T67A 5CEEA 1BVUA 3PXXA 4RPHA 4BNLA 4II2A 2JL1A 3TOXA 5ILOA 3VZPA 3D4PA 2RHCA 2UV8A 2R00C 3GT0A 3MJTA 4OOEA 5I8ZA 1Q7CA 3W4IA 2JD2A 2HMUA 3DWFA 3E9QA 1Y6JA 2CF6A 4M89A 4M86A 5KIAA 2GZ2A 1ISJA 1QLHA 4YT5A 1YL5A 5JDCA 4II3A 2QQ5A 4FC7A 4XGIA 2HUNA 3R1IA 4ZHSA 2JCXA 3AI2A 1A4UA 1H5QA 4K28A 2W2KB 3IS3A 2BMAA 1P44A 2AE2A 1V6AA 3Q11A 4ZQEA 4DLBA 1E1MA 1B8UA 1NM5A 1ZW1A 1B14A 3PYMA 3GUCA 3CE6A 4AVYA 1ZXLA 4IDEA 4HXYA 4CM9A 2NSDA 2OHXA 4FQ8A 4RCVA 3WQQA 4AJ4A 2XF8A 3WB9A 3GFGA 1PJBA 1WNTA 3TN7A 1WLYA 4H3VA 4R5MA 5IZCA 2VN8A 1NPYA 4DQUA 1DC6A 1U3WA 1GR0A 2PV7A 1P1RA 1PTJA 2E4AA 3EGOA 4GMGA 3ONEA 5FF9A 3VVBA 2HRBA 5ER9A 5JFOA 5FFFA 5EJ2A 2PKQP 1DOHA 3OBBA 1XLTA 3GVCA 2EERA 4W9NC 1Z73A 1YVEI 3FNEA 1CDOA 2DBVO 4PG5A 4LRTB 3PQDA 1EDOA 4IM7A 3ROKA 3RBZA 5KKCA 3BMQB 4UEKA 3PTZA 3UHAA 1I30A 3WICA 4D7AA 3D3WA 3MJVA 4EEXA 3LF1A 1T24A 3C8MA 3FTPA 1SC6A 4B4VA 1D3AA 4MVJE 1HDZA 5DBIA 4WJZA 1ZMOA 1WDMA 4NDNE 3MWDB 1I24A 1GY8A 1T26A 5CDUA 2AQIA 2FR0A 3FHLA 4XQEA 4GWGA 1YB5A 4MINA 3LZ6A 2FMUA 2YQ5A 4B8ZA 1A27A 2AQHA 1E7SA 2V65A 2DVMA 1B15A 1GAEO 1NR1A 1P1KA 1XSEA 2Y05A 3DAGA 5CG1A 2J8ZA 2CVOA 3VKUA 3A14A 4J3FA 4ND5A 5AYVA 4XKJA 3U49A 1LLUA 2DUUA 1M67A 4HFNA 4XYMA 3KOUA 2WD7A 4WECA 4XYGA 5L7YA 3AM5A 2BH9A 1N7GA 1E1KA 1HSZA 4JK3A 1WMBA 3PFFA 3ZWVA 1UXJA 2HRZA 1EQUA 1AGNA 1DB3A 1HE3A 3QA9A 1PZHA 1DFIA 2Y66A 3WTCA 4YCAA 1VSUA 3RROA 4R9RA 4LCJA 1NPDA 1VRWA 3NDRA 2H9IA 3DBLA 3QE3A 1T2AA 5T57A 4WUVA 3KZVA 3OFSA 3E1KA 3BMOB 4J6FA 1P1FA 4OH1A 1ISHA 1RYDA 3ZDFA 4IQGA 2Y1EA 1Z74A 4JIGA 3UF0A 1A5ZA 3H3FA 3OA2A 4R68A 4RF3A 2WWRA 1N8KA 4CLOA 4P8RA 1D8AA 4CV3A 2VYNA 1SCUA 2A94A 4BNGA 3U3XA 2HCTA 3SBOA 2B83A 7MDHA 3G1UA 4WOKA 5I7SA 2EF1A 4E2WA 1T1SA 2QYSA 2BGLA 2AMFA 1RYEA 4XQGA 2JFHA 3NDIA 5JY1A 3FNFA 1HLPA 1P3DA 2DFDA 2O23A 2UVDA 3DONA 2CY0A 3ULKA 5AOVA 1E7MA 5FYDA 1DIGA 4RORA 1XIVA 4F6CA 3WFIA 3RC1A 2VUTA 3G17A 1BW9A 4CM8B 3DBVO 4IMRA 2WYWA 4J4BA 3DAPA 1XWFA 4IIVA 2PA3A 4XYEA 3U4CA 5DF1A 2SCUA 3ICPA 2NADA 3G3EA 4FFRA 1I3KA 3OH8A 4FFOA 3H5AA 1KYQA 5HM8A 4DLLA 4OQZA 4YT4A 1LJ8A 2CDBA 3RSHA 2DAPA 4AJ1A 4PN3A 3BMOA 4N54A 1XDWA 4BGVA 3CH6A 2ZKLA 1KVRA 4J0FA 4NPCA 2X6TA 1HZZA 2DU8A 4O59O 3PFWO 4OKNA 1YBMA 4MDHA 3AY7A 5JO9A 4XYLA 4DREA 2B37A 1UZLA 4D3FA 4DA9A 4MP6A 1ZUD1 3MJSA 1O8CA 5CDSA 4WLEA 1SAYA 4YAEA 3ZH2A 1PJ4A 2VT3A 4N5LA 4A2CA 2HSDA 3BMCA 3DQPA 5HS6A 3PHHA 1YL6A 3GG2A 3DMTA 1R0LA 4Y9DA 4CM6A 1E92A 2PZMA 3PP8A 2BELA 4IXWA 3JYNA 1NPTO 1H6AA 3HN7A 1IHXA 3EMKA 3MJCA 4B4WA 3WSVA 3LT1A 1BGVA 1ZK0A 4XX0A 3U4DA 3GA0A 3VPXA 4EJ6A 4J4HA 3DBHB 3DTYA 1JWAB 5F1PA 1GU7A 3H65A 2V7PA 1NVMB 3PWKA 3L4BC 2G82A 3KSDO 1GQ2A 2C2YA 3WMWA 3UOGA 3DHYA 1NP3A 3EDMA 1ARZA 4YT8A 2Q4BA 4PGFA 2ZIZA 1VKNA 4HFJA 1D7OA 4LISA 4E4YA 3ANNA 5DP1A 3ZWXA 5BSGA 4IZIA 1G1AA 4M49A 5H82A 4IS3A 1PJTA 1VKOA 1JKFA 5A5EA 3OEWA 1NFRA 5EQFA 5GMOA 4B4OA 1D1SA 3UCEA 2CDAA 4DRYA 2VHYA 3QLJA 3HWRA 4ZRMA 5ICMA 1MP0A 4BOYA 4J0EA 3AOEA 4OOFA 4RDHA 3SC4A 3VPHA 5A9SB 3L6EA 5KCZA 4RVHA 1B2LA 4BUCA 3X2EA 2RIRA 4RQUA 1AHHA 1B3BA 1HWYA 3RFXA 4N18A 4CMEC 4WK6A 1Y8QA 1K6XA 4D43A 1K5HA 1RJWA 3IC5A 3PWSA 3R0IA 4TRJA 2AQ8A 3C24A 2Q49A 4KDEA 1IL0A 2OOSA 4IBOA 1N2SA 1KETA 3VZQA 3EVNA 4HUJA 4DC1A 1G6KA 3H5NA 4E6PA 4YRBA 3JD1A 3GMDA 2O48X 2X0RA 1LTHR 1CEQA 1EVYA 1IE3A 4KDFA 3RFVA 4YJDA 3LSYA 3EZYA 2NTVA 4IDBA 1DC4A 1YO6A 5TSDA 1LQTA 1MA0A 3NT5A 3D64A 3QWIA 4MIOA 4N5NA 2B0JA 3WNQA 1ONPA 2DM6A 2O3SA 4ZGWA 1N1EA 3HN2A 1QYCA 2D0IA 4E5MA 4Z0TA 4XD2A 3KHUA 2AA3A 3FD8A 3MJEA 4NJMB 3AY6A 4FOOA 3PZBA 4QT0A 5EL0A 3WGZA 2EEZA 3U5TA 4TWRA 5AXBA 3KYDA 1A4IA 1B26A 3U4IA 3QIVA 3QVWA 2BFOA 3K2EA 3BXXA 4TRMA 3QWFA 2IZZA 3K8ZA 4CM3A 4ZA2A 5T8KC 1IUKA 4L4XA 4EDFA 3FPLA 2I3GA 4OL9A 1HYGA 1DC3A 3VKVA 4UEJA 1ISMA 4DYDA 5IDXA 4Z9FA 3GY0A 5EINA 1GV0A 1M2WA 1ZMTA 2EJWA 3F1LA 1Y8QB 3R3SA 1DLIA 3UCFA 2PGLA 2EWMA 1HF3A 1J6UA 3F3SA 3FF4A 3FBGA 3PIIA 4FW8A 2RH4A 2O4UX 4PG8A 3MEQA 3O8QA 3GNTA 3GC6A 4CMEA 3I3OA 3OJEA 1DEHA 5TT0A 4W82A 2I99A 1MV8A 3NYWA 3KV3O 3K73O 5F21A 3KO8A 3QWBA 2H1SA 4ZQFA 1SNYA 3GN2A 1WDKA 3PDJA 3RCBA 5JCJD 2RHRA 3OIFA 4D45A 1GPJA 4BKUA 1C14A 2ET6A 3PQEA 2PTGA 1ADCA 5B4VA 4B7XA 3CEAA 1OBFO 1Y8RB 4QSMA 4IY1A 5DCYA 4Y6SA 3DR3A 4ILKA 1PIWA 2B5VA 4GAEA 1ISFA 3ROPA 1LNQA 3TL2A 4K26A 4HWKA 3IAHA 1E7RA 1WPQA 3ZGYA 4RPLA 5IF3A 4R01A 3GLQA 3JCZA 4CMCA 5K9ZA 2NTJA 2Y1FA 4YBZA 2OP0A 1P77A 2CVQA 5IDYA 1E5QA 2ZCUA 1UXGA 4KQXA 4WEQA 4S3MA 3NGXA 1IHYA 3KEQA 1P33A 3C7DB 1NQ5A 4QX6A 4YDRA 5LDGA 4GX1A 1O0SA 4BHTA 3ZWPA 4H15A 4G5HA 3ZNQA 1U1IA 3DZIA 4XIYA 4G65A 4GSLA 4LN1A 3IKTA 2Q99A 1NHGA 1PL7A 1PJCA 1GV1A 2I5PO 2JD1A 5G0SA 1GYRA 5KTKA 5JS6A 1ZJZA 2QRJA 3EHEA 4XJSA 3GMSA 1IOLA 2V6BA 4Q3NA 1XELA 3E6AA 2PR2A 2B4QA 1E7YA 4GI2A 1PX0A 1T25A 4BO1A 1YOVA 5ER6A 4CUZA 5DOVA 4K6FA 5THQA 4OJNA 1GUFA 1U3UA 1LDYA 1X7DA 4DPLA 4MP8A 4G81A 4OQYA 4BO6A 2CVZA 4JBIA 4NR0A 4OO3A 3ETDA 3RAJA 4PG4A 4PLHA 4EGFA 3WYEA 4FCCA 1GYQA 3QVTA 3V2HA 3CZMA 3JQEA 4JGBA 1O6ZA 4CMKA 1GCUA 1QSGA 3A06A 2DUWA 1OI7A 1T2CA 1V8BA 4P38A 2GD1O 1R16A 2RCYA 2D59A 1GL3A 1HXHA 1P1HA 3R6DA 1Y9EA 4CMIB 1LI4A 2PWZA 2P91A 4JBGA 1X14A 1HE5A 1DRWA 1PR9A 1O94A 2AE1A 4PZCA 3WQSB 2PZJA 3Q0EA 2HLPA 4CQLA 1KEUA 1UAYA 5JDIA 3E5MA 1AUPA 1GZ6A 5JCJA 4L0QA 4EITA 5TIIA 2GCGA 2HK8A 4EJMA 1TB4A 2WDZA 4LCEA 4P4LA 1GQYA 1UXIA 3OMLA 1WP4A 3T4XA 5F5LA 1WXDA 4R54A 2DTDA 4CR6A 4RF5A 5TLSA 1U5CA 1ZH8A 2NVUA 2PNFA 1ZSNA 5EPOA 3Q9UA 1X0VA 3ETEA 3L6OO 1R0KA 3LU1A 3ZN2A 1HDXA 4O5OA 2X58A 2QG4A 5JCXA 2VTEA 4BNWA 4DQVA 1MGOA 1QXSA 4XDYA 3KEOA 4GX5A 3GZNB 5BNTA 1ADBA 5L53A 3T7CA 1P74A 1R15A 1VL8A 2RAFA 4OIMA 4MKXA 2VNAA 3GAFA 4YB8A 4CMHA 1WWKA 1I01A 5TGDA 1QV7A 3VOSA 1EFKA 3P7MA 3RUHA 4FR5A 3ZWOA 5L7WA 1PQPA 1KBZA 2Q46A 3EZLA 1JTVA 1P0CA 4OSPA 5LDHA 1DIAA 1RM5A 1YS4A 2NWQA 2QX7A 2X0JA 3PDUA 4IDCA 4O1MA 3S2EA 4QEDA 4RVFA 3F5QA 4E3ZA 4U7WA 4BNXA 1M75A 4H7PA 2YHUA 1NXQA 2Q2VA 2HMWA 1ZK4A 4NG5A 1GTMA 2PGDA 2HMSA 3TZQA 3UH1A 1A7KA 3QP9A 5CPFA 3T4EA 1ONOA 4FBGA 3HZZA 4CL8A 1ZZEA 2E37A 4K1LA 1I10A 3C1TA 1SB8A 3O26A 1MC5A 5A04A 2QRKA 4E31A 4QQRA 3ETGA 1XR3A 3VH2A 3ABIA 3ZNOA 4A10A 5H83A 1HDGO 2GN8A 1ZXBA 3ZWWA 3WJAA 3UXYA 2Q1SA 3DZFA 1E0DA 1PQWA 2FZEA 3GDOA 3HUDA 4PVDA 3H9EO 1DIBA 1PWZA 3RFTA 2Y1CA 2C07A 2J3JA 3JD0A 4JBHA 5BT9A 1DLJA 3ITKA 5I8WA 3QV1A 3Q2KA 1Z45A 4J7CA 3AU8A 1GEEA 2P68A 1LSUA 4ND2A 2RH8A 2WMDA 4CM9D 4NIMA 1QKIA 2HKIA 1G0NA 3OICA 4ZQHA 1JQBA 1YRLA 2Y1DA 4DLAA 2O7QA 1LU9A 1NFFA 3WGTA 3SVTA 4HADA 1D4FA 3NTQA 4FFLA 5TNXA 5BQFA 3DBRB 4BO4A 1RM0A 3HQ4O 3LF2A 4BKOA 2X9GA 1B3RA 1UH5A 5JLAA 3RUCA 3GPDG 2FY8A 4DTIA 3V8BA 2J3IA 4D46A 1DHRA 3HHPA 2OXIA 4FFNA 5EN4A 4BNIA 1OC2A 1OAAA 1R4MA 2R2GA 4A0SA 5I9MA 2B35A 4NFSA 1NFQA 4GBJA 4YJHA 3PGXA 1I2BA 4RVDA 5JAZA 5ITVA 4CV0A 5JAIA 2E6UX 3V1UA 3SLKA 4D79A 5G0UA 3U4HA 1FMCA 3HSKA 2ZCVA 1LC0A 1JLLA 1W8DA 1ZK1A 4OGWA 4W6ZA 3EW7A 1LLQA 3ZWBA 1H9AA 1LRKA 1OZAA 4AFNA 1LLCA 4H16A 4MVJI 1HE2A 4MKZA 1DPGA 3H8VA 9LDBA 1E7WA 4DGSA 1J4AA 1IPFA 1HEUA 4TZTA 2D5AA 4YJFB 3ZU5A 2BKAA 1BHSA 4GMFA 1FDTA 3JQ7B 4W99A 1E3LA 4AJLA 2BF7A 5K0ZA 1GUYA 4JX8A 3HB4X 3PJGA 1VJTA 4BO5A 3GGOA 2V6FA 1H9BA 4OXYA 4DMMA 2FHSA 1BTOA 3G79A 1NNUA 4I5EA 1N9GA 3INGA 3E5RA 4CODB 5JNLA 4URFA 3LT4A 4EBFA 5HS4A 4PLVA 1SB9A 3WYCA 1JN0A 5G2OA 1H2BA 5LCXA 3WNVA 4GVXA 5GZ1A 2Y1OA 3ANMA 3V2GA 3BTOA 4KWIA 2FN7A 3K92A 4U6SA 3NAQA 2O3QA 2BGKA 3WGIA 5ENDA 2A35A 3WBFA 1JW9B 3V5NA 3A1NA 1VL0A 4X54A 3F1KA 4TRNA 2C7GA 1FF9A 3H2ZA 3O38A 1UP6A 3RU7A 4QTZA 4HY3A 5KJCA 3UGKA 1HTBA 4CR7A 4CQMB 5CDYA 1UP7A 3ASUA 4Z3DA 2LDBA 4RVUA 4RDIA 3TPCA 4GQAA 4Q9NA 5IDQA 2HK7A 1NWCA 1JU9A 4GVLA 5B12A 1T2EA 2B36A 1DFHA 1R4NB 1VE9A 4OXNA 4E2ZA 4U0JA 1YL7A 2JCVA 3E48A 5HWSA 3OIGA 3W8DA 3DTTA 2OP1A 4LVCA 5FWNA 2P9EA 4XZ3A 4BMSA 4CLOB 3TOZA 3F46A 4DYVA 4R69A 4DPMA 4NBWA 1KC3A 3JQDA 1ONNA 3PJDA 4CLXA 4RZIA 3VH1A 3KM0A 2IEDA 1F8GA 2D3TA 4AJNA 3WGQA 4L9RA 1ULSA 4J1QA 2H63A 2C20A 2YDYA 2OL4A 1AN9A 4KUHA 2CDCA 1N9GB 1V3TA 3TSCA 5HRUA 1X1TA 2O3TA 4MVJF 4CM4A 4J49A 5K6AC 2HDHA 2Y0EA 5TJHA 4BNMA 4G2NA 3OJLA 4DWVA 3FR8A 1WZIA 4L8VA 4OYRA 5B4TA 1UAGA 1NHWA 2BD0A 3TQHA 4CJXA 4O63O 5AQ1A 2BGMA 4L74A 3WLEA 3ADPA 4CQLB 3PJFA 3WGGA 3DZBA 5IXYA 2NQ8A 4E33A 3L6DA 4PCVA 1LSJA 2I66A 5L3ZA 5TF4A 3UVEA 4XA8A 4C7KA 2P4QA 2ZB8A 3ZCXA 1U7HA 5BNIA 3DFUA 2NNLD 1L1FA 3IUSA 4E30A 1PS9A 2ZTUA 2ZB4A 3ITDA 2DKNA 8LDHA 3Q3CA 5ADHA 4R5HA 4NK5A 1QYWA 4R16A 1AXEA 3V2UA 1T1RA 4U6QA 2YHIA 4WOJA 2VHVA 3DXFA 5EIOA 3UFXA 1TT5A 2DBRA 3F4LA 4MOWA 4D0RA 1W6UA 3ZU4A 3VVCA 2EP5A 4J9UE 4JJIA 4KTTE 4OAQA 3JQ9A 5A02A 1AHIA 3N74A 4MVJA 2IZ0A 5T64A 4QUKA 5ENVA 2I9PA 5DULA 2OUIA 3TDKA 3WBBA 2VQ3A 3VAZA 1UZNA 4F3YA 1D1TA 5JXWA 1C1XB 5ITWA 1KEVA 3BMQA 1XQ6A 4WLFA 2Y67A 2WD8A 2VTDA 4AJHA 4PLGA 1ENOA 1E7QA 3BA1A 3HNPA 3KLMX 4IDDA 4J9VA 4YJHB 2EP7A 3K5PA 2X9VA 3SJUA 4WLNA 5A9TA 3CMMA 4CPDA 1YXMA 3V1TC 4CLHA 2X7HA 4I9HA 4PG7A 4Y6RA 3WWYA 1HT0A 1PSDA 1LDBA 4F46A 4F6LA 2HJSA 2JJYA 3HJAA 3AM4A 5L9AA 4LRSB 1FK8A 2E48A 4FFPA 3KRTA 1U7TA 5F1KA 3ZU3A 4ITUA 3WR5A 4XGKA 1E5LA 1KOLA 3FR7A 2WSBA 4O0LA 4F45A 1KVQA 4R51A 3TNLA 5KOIA 3GAZA 2ZYAA 1UDBA 3FPCA 3PGJA 1DJQA 1KS9A 1PJ3A 1LDEA 4ZD6A 3DZGA 1CIVA 1BXGA 4BKRA 3X2FA 1TI7A 2TMGA 4K9DA 4IJKA 4Y98A 1SO8A 2NACA 1QYDA 1Z75A 3GVXA 3DBHA 4BVAA 5IZCC 1ZK2A 1J0XO 1XU7A 1GYPA 2I6TA 3C1OA 2UDPA 3VPSA 3RC7A 1C1XA 4YPOA 1PEDA 4AICA 4BV9A 2AHRA 3U09A 3I5MA 2VRCD 3EAGA 1MFZA 4DIOA 2ZTVA 4AJIA 5A03A 9LDTA 5DN9A 3BMCB 3W6UA 4CM5A 2AEFA 2W8ZA 2Y99A 4RVGA 1UXHA 3GRPA 4JLWA 4WNCA 3T7EA 2EV9A 1XA0A 3LYLA 3NTRA 3JQ8A 3V1YA 1ISGA 1HDCA 1CETA 2Q50A 1WMAA 5C37A 1EE2A 3ANLA 3DZHA 5DCWA 1JVSA 3AUAA 3H9GA 4DC0A 1A9ZA 3DMTC 4TRRA 3CSDA 3B1KA 3M2PA 2WEKA 1KEPA 1U4SA 3HE3A 5L51A 1S6YA 2CUKA 4IJUA 3CIFA 2IODA 4J1SA 4DQXA 4L4RA 3WDSA 4QO7A 4HNGA 3DBLB 4WE3A 4E32A 4BNTA 1M6HA 4NQZA 4PLTA 5TC4A 1KEWA 2FWMX 3PYLA 4ALJA 1V9LA 4AJEA 4EW6A 1XU9A 3OHSX 1YJ8A 3KYCB 1LRLA 3BHIA 3PIDA 3ASVA 4CMBA 1PGPA 4FJ1A 5B37A 1U4OA 4JQCA 4KQWA 4D41A 4HV4A 4N5MA 3VZSA 1PR3A 1BMDA 1H0KA 3KVOA 1EMDA 5CFZA 3RASA 1BDBA 1JKJA 1ZBQA 1EVJA 3K31A 4NNJA 3UAGA 1LUAA 1X1EA 1VPDA 3ON5A 4XJTA 1QR6A 5A9RA 4NI5A 2LDXA 4OKIA 3JSAA 1SOVA 5IJZA 3RQSA 3NJ8A 4IGFA 5EMHA 3LDHA 1OOEA 2VUUA 1E1LA 2IYOA 3OM9A 3RUEA 4LSWA 1NAHA 3JV7A 4LMRA 3NGLA 1I3MA 4Q3CA 4NHEA 3OQ6A 4XB2A 3JYLA 1NQOA 3Q6IA 4XEHA 3BTSA 4UVIA 4IQ0A 1MB4A 4BO8A 2GLXA 3BYZA 5GY7A 4E5PA 4I9NA 3CZRA 3IJRA 1JKIA 1AE1A 1QLJA 4TMFA 4IPTA 3RJ9A 4ALIA 5C3MA 2X1HA 1R6DA 2Q1UA 4YRDA 1EFLA 2BFAA 3RKUA 1T2DA 2C29D 3P2OA 1IPEA 3IIEA 3W4KA 2VHWA 2WYUA 3I4CA 3D3EA 1VSVA 3ROQA 4YXFA 1LSSA 3I1JA 4GX2A 1E3EA 1CQJA 5KVCA 1ZNQO 2OO5A 3FN4A 4GKBA 2WE8A 1V3UA 3G49A 4MVJP 4M54A 3OIDA 1PS8A 4FOSA 2AG5A 1BG6A 2C0CA 2FOIA 3L4BA 2NUAA 1Z7EA 3WOHA 1Y5RA 1HL3A 4FS3A 4CV1A 1BRMA 1TT7A 2VCYA 3FNGA 2HJRA 2NU8A 5CPBA 1IB6A 1XCBA 3DB2A 4XQ9A 2PD4A 5CP8A 2HMTA 1JVBA 2D1YA 3W1VA 3OP4A 1DAPA 1E1NA 3HFSA 1RM4A 1F14A 4Q3EA 3MOIA 4FC6A 4FJ0A 3ZI0A 4XWYA 3K9QO 5MDHA 3JQBA 2EKPA 2W98A 3D4NA 3E82A 1X0XA 3FCOA 3NTOA 3WLFA 1CERA 5JO0A 1I8TA 4U8GA 4EUHA 1JDJA 3ZZNA 4XDZA 4ID9A 2QW8A 4OM8A 5CDGA 1KVTA 5HTOA 4FIZA 2YDXA 4L4SA 4YQYA 4D3DA 3S2IA 4IDAA 3VDRA 4PZEA 2NLOA 3VHRA 3NEPX 2OMEA 4CM1A 4M8SA 3AW9A 1ZVMA 3KSUA 3INTA 1GUZA 5GZ6A 2EW8A 2VOEA 1HDOA 4JJGA 3BZUA 4CM7A 3TZKA 4DBZA 1V0JA 4BNZA 1YH3A 2H6EA 1ZEJA 3ONFA 2YJZA 4IJVA 3BAZA 2J5RA 1EEHA 3O4RA 3N7UA 3Q9NA 1LBEA 4WGGA 5DT9A 3P19A 1Y81A 1H2HA 3IUPA 2Y93A 4YJGB 1XG5A 3STHA 1I32A 1YQXA 3RI3A 1T4BA 3D1LA 2I67A 2GN6A 2GF2A 4LVUA 5TJ9A 3E18A 4Q3DA 1P45A 1PJLA 4KP7A 3CKYA 4NK4A 3FNHA 4WCDA 4WLOA 4B7UA 4QXMA 3KYDB 4PLFA 3RUDA 3UUWA 3RUAA 1HKUA 1ZCJA 1X7GA 1DO8A 5I7VA 1SOWA 3AI1A 1EE9A 4E13A 3M1LA 5AXAA 4TVBA 4KUEA 3ZU2A 2C59A 4ONEA 4QFDA 3F9IA 4RLHA 1ENZA 2J3KA 4RJTA 1RWBA 4IXTA 1O89A 3I6QA 2I76A 1Q2XA 3DMYA 1SEVA 1SBYA 3I9MA 3GGGA 1UP4A 4MVJD 1A7AA 2O2SA 1DFGA 4BO2A 1A9YA 3ZWCA 1XHLA 4BO0A 1EBFA 1C0IA 2JFFA 5IFLA 5JSFA 3TJRA 4J16A 3F6YA 1I3LA 3C1AA 3NT2A 3AFNA 3LVFO 3ZV3A 3PJEA 3PLNA 4IUYA 3TZHA 3HDYA 1UJMA 2EKLA 4UVHA 4WEOA 5A1TA 3SLGA 3TZ6A 5FI5A 1TA4A 3NRCA 2VZ0A 3GDGA 1T2FA 4CLRA 3KB6A 4DMLA 1N1GA 3MCVA 4A03A 4HBGA 1K6JA 2G5CA 6LDHA 3QVOA 5G0WA 1FDSA 2POQX 4ROSA 3KSZO 3G1TA 2FRDA 1NBOA 1FDVA 1K6IA 4DUPA 1UDAA 3PK0A 4TKLA 2PD3A 3QVSA 3PHLA 4ZQBA 5LC1A 3BTUA 5F5NA 2VWHA 1HRDA 1MXHA 4QECA 1R66A 2P4HX 4UUOA 4FSHA 4PVCA 5U9CA 1YOVB 1LRJA 3Q2IA 3PI7A 2A9FA 3PWZA 3ZHYA 1PGJA 1EQ2A 2F1KA 4XB1A 3H9JA 5U1PA 1YQGA 2PK3A 3OSUA 1BDMA 1ZFNA 3H5RA 3I83A 5CHEA 3H6KA 5BR7A 4YJGA 2ZATA 2VZ9A 1F0YA 2AG8A 2GZ3A 1B7GO 2DBQA 4RV9A 3D3WB 3NV9A 4GSKA 1JAYA 5DP2A 1KC1A 2Q4EA 2AW5A 3JQ9C 3MTGA 2V6GA 5EERA 3ZWYA 3GHHA 4ZJUA 4A7PA 5TQVA 2O3RA 3F47A 2YV3A 1RKXA 1L7EA 3OJFA 1ISIA 4MKRA 5KKAA 1ZIDA 3GFBA 1YWGO 1YDEA 4I5GA 3JQ7A 3D7LA 4IIUA 1RM3A 4MPDA 3GRKA 2J5KA 4YJFA 2HO5A 1YQDA 1X7HA 2EIHA 1P31A 3I23A 4KWHA 3VH4A 1J5PA 3IDSA 2PH5A 4J1NA 3TWOA 2ZTMA 3IL2A 3I9JA 5A06A 1BXZA 2GUGA 5BSFA 3RBVA 4WKGA 5MGBA 3IOYA 2EGHA 4RVSA 3B1JA 1XQ1A 3S55A 4A5OA 4Y6PA 2C54A 4NH4A 3LQFA 1WW8A 4UUNA 2CNBA 4ZVVA 5KWEA 3S8MA 1DJNA 2OORA 1AXGA 5L7TA 4JJFA 4Z6KA 3AU9A 1X15A 3KTDA 1G0OA 3AJRA 4RF4A 3RC9A 5I9NA 1GADO 4B3JA 3I9LA 5K6AA 2VWPA 2YY7A 1J49A 1U3VA 3ENKA 2OZPA 3CUKA 1YJQA 4B7CA 4EUFA 3OECA 3I9KA 2NU6A 4D0SA 3CTMA 3ZW8A 4R1TA 3PYXA 1Q1NA 1K2WA 2CF5A 3DO5A 4P4GA 3E8XA 3C3XA 2PFGA 3LK7A 3WXBA 3MWEB 4BKQA 4EJ0A 2FR1A 2ZQZA 1ZSVA 3TZCA 4CLEA 3O9ZA 4HKTA 3P2YA 1IYZA 2DPHA 2G0TA 3QQPA 4IQ8A 4CMGA 4A73A 1NX6A 3W8EA 4E5NA 4A27A 1DHTA 2VNSA 4XR4A 3PHGA 3WGOA 4D42A 3VZRA 1JAXA 1F12A 2QHXA 1F17A 2B5WA 3NJ4A 3OETA 3RU9A 4NZ9A 3Q1LA 4WPGA 3KUXA 3NDJA 2X4GA 3EUWA 3TFQA 5JMWA 5BSEA 5G4KB 4ND3A 1C1DA 2HMVA 1EVZA 5KJ1A 4YWJA 1LQUA 3JQAB 1EUDA 3JD3A 4E5KA 4RPJA 3QRWA 3OJ0A 3E9MA 1NTOA 2CMDA 7ADHA 1NVTA 1B0AA 2ZTLA 1P1IA 3BHJA 4DIBA 4ALNA 2J6IA 4WCFA 2GYYA 1Y5MA 2P5YA 3CXRA 4HFRA 5JC8A 3FI9A 3JYPA 4OMUA 4Q3AA 4XRGA 3FWZA 4IMPA 1IULA 2YFHA 4EYEA 5A4DA 2GPTA 3DL2A 3PRJA 1HSOA 3GDFA 2PY6A 2WE7A 4B79A 3H4VA 3K6JA 1ZSYA 5L45A 3UCXA 4XR9A 3JQGB 4BMVA 1H6BA 3KYCA 5DCUA 1GPDG 2IXAA 3RC2A 2GDZA 2DBZA 5L4SA 3GZNA 1HYEA 2O7SA 5DBGA 4EZBA 4QO8A 4PIVA 1E6UA 4TZKA 4R3WA 1U2GA 3GEMA 1XGKA 4AJOA 1DIRA 2Q2WA 1GQQA 1KVSA 4LMPA 4NFHA 5FI3A 4NFYA 1BWSA 1R0SA 3IQDB 3IP3A 3WIDA 1Y1PA 4BB6A 5JC1A 2JD0A 1QYVA 2NQTA 3D4OA 3K2BA 4R9SA 2ZK7A 4J2HA 3AOGA 1FJHA 3S1LA 3WGYA 4DXHA 1B8PA 3BIOA 1EDZA 2NM0A 1Y7TA 2VUSA 3JQAD 1NVGA 1W73A 3TFOA 3M2TA 4IINA 2IXBA 3M6IA 1VI2A 4MIEA 5DZSA 4FGSA 1YB4A 3LT0A 2VZ8A 5A05A 2O4CA 3HADA 5G4KA 4J7XA 1P1JA 4BNHA 1UDCA 1DC5A 2XXJA 1BXGB 2NVBA 3AWDA 1F8FA 2WD7B 2X5JO 3DOCA 3QJ5A 4LSMA 1I36A 3D0OA 3JQFA 3RUFA 5IXSA 3BMNB 4ZQGA 3GHYA 1MLDA 3DC2A 5KVSA 1PL6A 5IG2A 4J90A 1U5AA 1LXCA 1LX6A 2O3JA 2X5OA 1CYDA 3DAFA 5KNLA 5L40A 2Y1GA 4HFMA 1DBVO 3QHAA 4I5DA 4A26A 2C7VA 4NU6A 4GL4A 4XQCA 8ADHA 1C3VA 1DDOA 1X13A 3AM3A 3FTNA 4B4UA 3AI3A 3RBXA 3WS7A 1UUFA 3PPIA 4FPXA 4BO3A 4BL5A 1FXSA 4CUJA 3HDJA 1C1DB 1ADGA 3HDQA 3W8FA 4D3SA 3DFZA 4I8XA 5G0TA 1DAOA 1CWUA 4RGBA 4GLLA 4WASA 4NBVA 2IYPA 4FB5A 2ILTA 1PGNA 3R3JA 1EBUA 4GH5A 5H81A 2JHFA 4UULA 1BXKA 2QYTA 3M1AA 2Q1TA 1I0ZA 5C7IO 3WG9A 3F4BA 1GFSA 3LC2O 4YTEA 4BNUA 1CQIA 5JMPA 4I1IA 4W7IA 2I65A 2Z1MA 3U62A 2AEJA 2EHDA 2P9GA 1U3TA 2PGJA 5CAEA 3LT2A 3GR6A 1RPNA 2IRWA 3GUYA 4NU5A 5BNFA 4IZHA 2BLLA 2R6JA 3SX2A 3KBOA 4HX5A 3WGHA 5A5FA 3CPSA 5C7LO 3JQCA 4PRKA 4ALMA 1W0CA 4RZHA 3A28A 1BW9B 4CM8A 1GZ3A 4ND1A 3L9XA 4ESOA 3LC7O 1BSVA 5AXDA 2FR8A 3U0BA 5COBA 1U2DA 4BMNA 3GK3A 1T4DA 1VM6A 5EESA 2X0NA 4BQRA 1VJ1A 2PZLA 2VT2A 3PLRA 1YB1A 2C5AA 3VH3A 1YONA 4MVJG 2FP4A 3GGPA 3JQBC 4R41A 1C0KA 5KVVA 2W2LA 4IDFA 2X0IA 1EK5A 3HDHA 3ZHZA 1HZJA 1MC4A 1SEPA 1E3IA 1GCOA 4BNNA 5JAQA 4RF2A 1PJ2A 3AOEC 2AXQA 1R12A 1VL6A 2P2SA 4BGEA 4CV2A 4W9NA 4EEZA 4IDGA 4JN6B 3OJOA 2GN9A 5CDTA 4UREA 2YHIB 4BB5A 3WWZA 1Z6ZA 1HE4A 3BMNA 3DZJA 1PGQA 3EC7A 3L9WA 4JP3A 3WSWA 4BNYA 2FSVA 1NAIA 3H3JA 4RPGA 3GVIA 2TMDA 2X9NA 2V6MA 4I9UA 2VHZA 1H93A 2AEMA 3W4JA 3GVHA 4WNIA 2YQ4A 2G1UA 4I08A 4DVJA 1MXFA 1ZJYA 5I7EA 4GKVA 2GSDA 3S2GA 3B1FA 2Q1WA 2D2IA 1EZ4A 2GO1A 2UAGA 3QY9A 3WFJA 1N7HA 4HNHA 4YT2A 5CEFA 1XKQA 4MO2A 3U9LA 4ZRNA 4DL9A 2QZ9A 4CMIA 3H9UA 4YACA 5JDCC 1SMKA 4Z3KA 1KIFA 3L4SO 2C2XA 3PZRA 3QWAA 3MZ0A 1V3VA 3ORFA 4DBVO 4C7JA 4NJOA 4BKPA 4ZN6A 4PFJA 4OHUA 2JHGA 2ZYDA 4Z0HO 2J3HA 2VYVA 1XYGA 2NU7A 1SPXA 2XXBA 4UAGA 1Z7BA 3K96A 1YBVA 3RIHA 3WIEA 3UN1A 3ZNNA 3ZWAA 3LLSA 2VHXA 2X8LA 3RUIA 1IZ0A 4CQMD 4E21A 2VYND 3EK2A 4NBTA 3FBTA 2FSSA 5I9LA 4WCFC 4WLVA 2GR9A 2YYYA 3GF4A 4U0KA 5IN5A 3GQVA 4C4OA 4D44A 1ADFA 2ZB3A 4HP8A 2Z95A 4FFMA 4M87A 4YAJA 2P9CA 3K30A 2Q45A 3JYQA 2DT5A 2HK9A 3A9WA 2VOJA 5JE8A 3RD5A 1E3WA 1TVEA 2NTNA 1LDGA 3OA0A 3AUSA 4BQPA 3NKLA 2A4KA 5AXCA 1H94A 2CSUA 5F1OA 3WX0A 4BNFA 4TQGA 1C0LA 3ENNA 2DFVA 4CMAA 2UUPA 2IEBA 2CFCA 3JYOA 3PHJA 5L95A 1QP8A 2CD9A 2DTEA 4MVJH 3OQBA 3ONDA 4J7UA 2WM3A 4BNKA 2XOXA 3UW3A 3ZW9A 1R37A 3NUGA 5J23A 4YAGA 1UZMA 3MTJA 4R1UA 4BO9A 2HAEA 3HG7A 1U8FO
chains in the Genus database with same CATH superfamily
5K2OA 1W44A 3FRJA 2FWPA 1K06A 2X1MA 3PVCA 4OBWA 3SEFA 3ZV4A 1KBOA 3I04A 4AJJA 1NLMA 4MYDA 1TF5A 1Y4DE 4Z1MA 2DH5A 4JCOA 4UJ5A 4RA6A 3URKA 2C4TA 4INAA 2NP7A 3OX1A 2WWFA 1ISPA 4Q18A 3L49A 5K0FA 2JJ1A 4IGKA 2R5WA 2J6BA 3K70B 2FWJA 4EPWA 1U8XX 4FI3F 2HF7A 4I99A 2XYPA 4FGUA 1YE3A 2H5LA 4IIXA 1XTZA 2G67A 1MN6A 2C0PA 2YV1A 1U6IA 2NZ8A 3B51X 2CVHA 5KJFA 4LXXA 5ICSA 1Z4OA 3WIVA 1OZFA 2JCGA 4RD6A 4UHDA 1TK9A 4ZIRB 5ABPA 4KYVA 5IH7A 1G8PA 3PPVA 2CBZA 1C29B 3C0KA 5JEEA 3KQQA 1ECBA 1J33A 2PWBA 1EVIA 4OJKA 3C7AA 3LW8A 1M2VB 3FDXA 4B3SB 4L6IA 3B20A 3AUTA 2W11A 5H02A 1JEOA 1E3JA 2WJPA 3VOAA 2GARA 2HHAA 1X77A 3LWZA 3NHYA 1D1QA 3W6ZA 4MVJM 1SOMA 1YULA 4DDTA 2CN1A 1L6RA 3IQEA 3D8UA 2WPDA 4Z99A 4DKJA 1UOOA 3KYBA 1S4MA 2HQ1A 3PPWA 3TLGA 1TC1A 3ST7A 1YVUA 3EUEA 4D5EA 1TMGE 5SZKB 4CM4B 3OM1A 1FRNA 3G0DA 2W7TA 4YYZA 3EODA 4RM2A 4CG3A 3AFGA 1Q12A 4O2BF 2HYIC 3O3CA 4N65A 4HO1X 3EA0A 2K2WA 1AHNA 1K68A 1W5EA 1WF3A 3A3YA 3BILA 3D0RA 4KMSA 1D6SA 4PLCA 5DI3B 1WDLA 4ZWNA 4J4TA 1A9OA 4AG6A 1ZA1A 3WYDA 1Y48E 4JP2A 5F1YA 4XOUA 1OIVA 4WZBA 1OZGA 1W25A 2IYAA 2R1TB 2PPLA 3EIFA 1P6QA 4MQBA 3VSDA 4MR9A 4F2WA 4F96A 5CB4A 3DEYX 1Z13A 2GMWA 2VWQA 4FN4A 4CFSA 3D81A 4C2TA 1TAQA 1N2XA 2I2WA 2VEDA 2I3AA 4YRAA 2EEPA 1Q83A 3GD7A 1KFJB 1CRWG 3E27A 4XIJA 4F5EA 3VKGA 2HDOA 3RFFA 4DY6A 2D5CA 1FRQA 3RH0A 1M2HA 1GPNA 2QPLA 3JQ8B 2WT9A 3PFKA 3WZLA 1STOA 3DNFA 3SBXA 4EYOA 2O2ZA 1UBJS 1F3LA 4LV5B 3DA8A 4X6XA 1K4KA 1NVUQ 1DAFA 1S7CA 4IJWA 4NYIR 5JZSA 1H4SA 2BOVA 3PL5A 4FE4A 4Q1CA 4F5ZA 3WQRA 2AG1A 2PUFA 2QOEA 1KJJA 1EB8A 2WYHA 1RJ9A 3B52X 3MT8A 1Y8RA 4TWZA 3SNKA 4E94A 1PTJC 1T8WA 5B1YA 4AG3A 3WP0A 1Y6FA 2QZZA 2BZ0A 1KDVA 5A3QA 5K3FA 2WRZA 1LEHA 2OK8A 3QNWA 4HN4B 3ZHUA 2X2FA 1KSFX 2XECA 3E22A 4XCVA 5JAMA 1DBPA 2WT4A 1WAMA 2Y68A 1KH3A 5C7OO 2G76A 1E69A 4EHHA 2BPOA 5CG2A 4OV6B 2BGRA 1OILA 1WZUA 4PC6A 1SJ9A 3D59A 5A9SA 2VJOA 4BP9A 2Q5EA 1ENPA 2EJBA 2WJYA 3K3PA 1JHZA 1KQPA 2D8AA 2PBFA 3A9SA 3GAAA 4W5HA 5DLEA 4AZ3A 3UV3A 4PQYA 3PQFA 3X43A 3L8YA 1JA9A 4KR0A 1UBCA 4Y2QA 2WF8A 3ZDYB 3MMZA 4E1BA 2DPGA 1LLDA 4PSKA 3F90A 3VUEA 2DTXA 3ANSA 3MD0A 1O95C 4B3IA 1JFSA 4PPQA 3JVDA 3TX6A 1P4AA 4M1OA 4CIBA 4Y0NA 4X6YA 5E6UB 5CBPA 3EPLA 2P27A 1OX4B 2OGUA 1GZDA 1HA3A 4OHFA 3OG9A 3SS9X 2HWWA 2O0HA 1RI2A 2OSVA 1GZ4A 1K1EA 3INRA 1LW6E 1SG6A 1UPAA 2O50A 5EXPA 3DR5A 3M6XA 5AVQA 2GZ1A 2OMKA 2R00A 3K7EA 4K6OA 2GM4A 1T5LA 1X7ZA 1WUYA 3B6ZA 3C5WP 4QARA 5GZ3A 4Z9XA 5REQB 1NNEA 3PPXA 1FSGA 2FR8C 3MJ4A 1VL5A 1LDMA 4RQTA 2FUKA 1DTWB 4ZVRA 4KLAA 3GNSA 5TT1A 4URXR 1A5AB 1XNQB 1DGQA 2II6A 4KVGA 5BW4A 2DUNA 1JDTA 2Q41A 5GVSA 2OZLA 3MGGA 5C5IA 1KWKA 4IS2A 3V1NA 1FP2A 3AB3A 2E0IA 1YZGA 4XUEA 3FXAA 3INNA 3BD9A 4YBRA 5DNUA 2WZDA 4TLLB 1DIHA 1XEAA 3NHRA 1E1QD 2OHVA 3QLTA 3P26A 4KQIA 4P32A 4V0MA 1JQEA 4UUPA 3HXQA 2BFPA 3KB8A 1IEXA 1UR5A 4WK0B 4B09A 1N32B 1GA6A 1IWOA 1SA0B 3QEJA 4BLRA 3H9QA 1OWLA 2W0SA 3BGVA 5IABA 2EKZA 5ARDA 4E12A 1FTGA 1KHTA 2XMDA 1E77A 3F5SA 4OVKA 3EFOA 2JKVA 3GW8A 3W5VA 3ORRA 3V4FA 5BN4B 4UQLA 2D7DA 1U8TA 3N5CA 3RTDA 4LW8A 3GCZA 4LCBA 2ABWA 2XYQA 3EVEA 3PEFA 4FCWA 2I62A 4DIEA 3D7SA 4MRMB 4TQAA 3WISA 4GOLD 3THOA 3IP9A 3RYCA 4C14A 1W47A 1G8SA 1HPLA 2I7VA 2BKUA 1I4TD 3RYFA 4YAKA 5K0TA 1OGYA 2FEXA 5JLJA 2I71A 4D4HA 5BSHA 1DWOA 4GYYA 3QXCA 4IV0A 2X40A 2JFVA 3JQAA 4JUFA 5DGDA 3SIWA 1X8LA 2PYDA 2X0FA 3F8WA 2VP4A 5REQA 1YZFA 4EARA 3U1TA 1P7PA 3ICVA 2QG6A 4M1ZA 1XNRB 3A37A 1NF3A 2GZHA 2I6SA 2R85A 3RIYA 3NWEA 2QY9A 2VVTA 1ZEMA 3HS3A 3VR0A 3ZV6A 5T6BA 1PR2A 4HS9A 4IIBA 1VLHA 1RXUA 1U28A 1VLLA 3MGAA 4OXKA 1E5DA 1QVVA 3BTVA 3I6IA 1R74A 4KN8A 4OFWA 4UUMA 5U4QA 4C7KA 3HHEA 5KJ6A 2VSYA 3H8JA 3A36A 2PH7A 3SXPA 1TK2A 3JD2A 3P0IA 1P18A 1N1DA 2HAEA 3TL3A 1JFLA 2BZ1A 3L0BA 5T4BA 4BQNA 3OD5A 3LQQA 2NU9B 5IF9A 3FPEA 1UL1X 1I3NA 1XROA 3ECAA 4I5IA 2QTNA 2JIRA 1R6XA 2QTCA 4R1QA 5K0NA 1YDMA 2ZJ7A 2COKA 4QYIA 4F4FA 4L76A 4Q9AA 5G4LA 3ZK8A 5JNRA 3LC1O 1Q84A 5BQPA 2E49A 3EY4A 3IPLA 3HJBA 2E82A 2W2KA 3ACDA 2NV6A 3WYBA 2UUOA 3WXMA 4BNVA 3RWMB 1JJAA 1TQ6A 4PNHA 1VGVA 3L8GA 4MQ5A 3RQIA 1Y6RA 4DQ0A 3D6FA 3UBTA 1YBFA 3OLCX 1ZY2A 2ON6A 4C0LA 4GM0A 1QV6A 2CHFA 4JSYA 5G1OA 4C30A 1EIWA 4G0XA 4M6WB 5B1HA 5CITA 1VXOA 1UJ4A 2ZIUB 4R1NA 4NOLA 1D2CA 2H9YA 3PVZA 4H4DA 4J0HA 4ABYA 2Q0SA 4XGNA 5TRTA 4CR8A 4M7PA 2Y0DA 2ZRBA 3K2IA 5EE5B 4BLWA 2FUCA 5KQMA 5DM70 1J90A 2VH1A 4I1RA 2CJYA 4QPNA 4CCYB 1KJ8A 2EBHX 2P9ZA 4QU5A 5CM9C 3TI7A 2XDQB 4YJ2A 1RZRA 1XBTA 1E6EA 1T29A 2YFQA 3FMFA 4U7TB 4Y9UA 4L2IB 1Z82A 3B6IA 4UVDA 5LQJA 2H0AA 1YDGA 5JYEA 3AFMA 2H52A 3KSAC 1ZK3A 1PQUA 2HA2A 4AJPA 1XYYA 3QVLA 2SICE 2GTHA 2J9YB 4W1QA 4WY8A 1I1HA 2W2LD 3A7EA 4LEIA 4ZC8A 3QKRA 1PZEA 4HAUA 2QVZX 3JQGA 4HC4A 4JBWA 3LZCA 2VSNA 1DJPA 5I7FA 1A72A 4NEQA 4BP3A 1T5TA 1LDNA 1CZHA 2FPPA 3FMVA 1G8FA 3IB3A 1AB5A 1KH2A 3I2YX 2YN2A 5I9TA 4U9HS 4R3NA 1KY4A 1H1TA 1W8IA 2JNWA 4EP1A 4YRMA 4F92B 5CM2Z 3L1KA 1FEZA 5FTJA 3IUEA 5CVVA 3ESBA 3KJZA 4NOJA 4QWWA 1U2DC 2X22A 4RL6A 4TV8A 3DWIA 1KDOA 3PNYA 2D0DA 4EJSC 4FDLA 4J0IA 3KETA 2GNAA 2VF8A 4Y2GA 1NU6A 4BVHA 5T5QA 1COWD 3GJXC 2RGYA 2OCPA 4QGHA 5FEUA 1XTSA 3FWNA 1YIAA 3H1PA 2DJIA 1VRCA 3MQ2A 5HKKA 2XXAA 1TAHA 2RHBA 3IMFA 2PLAA 4WBNA 1W94A 3O03A 4MS1B 4TOIA 3M0EA 1AKMA 2B34A 1P2BA 2H2FA 1PZFA 2IGTA 1ZUNB 1YC5A 2ZVJA 3UK1A 3ZV5A 2I7DA 2VRCA 3OEYA 2V3WA 4HDQB 1JEQA 1HI9A 1CSEE 5A3SA 3S28A 2EJVA 3KXDA 3LLMA 1UT8A 3NHBA 2BAGA 4RSHA 4RJJA 3MT0A 4PTLA 5KJEA 3HP1A 3O21A 4R2HA 4TSKA 4RGYA 4YJKA 5T67A 3K1AB 3CF2A 3V8RA 1J09A 2CEAA 2D0OB 3FCCA 4GC5A 2J32A 1VXRA 4RPHA 1GOTA 1USWA 3EG9B 3BCSA 4BNLA 1KZ1A 3TB6A 1QFXA 5BNWA 3D4PA 1RBYA 2RHCA 2P5SA 2R00C 2X2EA 3GT0A 3HEBA 3MJTA 4MR8A 5T4HA 3V55A 4CG2A 5BYKA 1ZM3A 4KLNA 3O4IA 1CB0A 4U6NA 2PGOA 2CF6A 2DECA 4LVOA 5KMGA 3KQTA 5KIAA 1BXRA 1Z4LA 2DR0A 1OX6A 2EBWA 2GZ2A 4DA4A 2NUPA 2VO1A 2HMAA 2P3SA 1QLHA 1RWKA 1CVLA 1YL5A 2XOEA 3EGWA 3K9CA 4IJ5A 2GQ0A 2RGEA 2VH5R 4KQJA 4PXAA 4Q7EA 4YMIA 3FFXA 1XU4A 2ZVPX 2HRRA 3RARA 2XB8A 2Q1YA 3Q7RA 4HH3C 1Z6AA 2HUNA 3R1IA 2J3LA 4XGIA 4ZHSA 5CK4A 4KI0A 3PNKA 3QTTA 4DLRA 1KI6A 1G1MA 4JKIA 1BAPA 3NKVA 5GV7A 4MUEA 1P44A 1KA9H 3T94A 1KK1A 2A0FA 1B0PA 1CZRA 2HIAA 1L4KA 4JDPA 1NN1A 1YHNA 4TUYA 5DCLA 5A4AA 3DOFA 3QOXA 2JFNA 3LT5A 1ZXLA 1XFDA 2MTBA 3CX7A 2JJ2A 4ZCQA 2OHXA 2P0YA 4TS9A 1UFVA 3GFGA 3WB9A 1FL9A 1PJBA 2HEIA 4DDVA 1QPBA 2VN8A 1ZRMA 5IHPA 4DBLE 1A4RA 1TUIA 1DC6A 1LX7A 2AJLI 3N8HA 3CG4A 4FQ5A 1VG0B 1P1RA 1PTJA 4JAVC 4JODA 4Q5IA 4BB9A 2V98A 4ZYUA 5FF9A 1S2NA 4HVLA 3LAWA 1DKQA 1SBCA 2C4UA 1RI4A 2HRBA 3KXIA 3OO1A 2J6HA 2PMBA 2PKQP 4AIRA 4TYYA 1DOHA 1FYFA 3OBBA 3UMVA 1Z73A 3FUVA 3GLUA 3I39X 3FNEA 3WDMA 3LA6A 1J0DA 1CDOA 2CHVA 4I8DA 4JYBA 4PG5A 3FHCB 3PQDA 5SYMA 3D8RA 2BL4A 1O8BA 5KKCA 3MAAC 2AFHA 4GKAA 5I5EA 1NC1A 2V9PA 3BMQB 3MNFA 3OPYA 3TTVA 3WICA 5J5VA 2JVIA 1LKZA 4UDOA 4EEXA 2YNMC 3EWIA 1LPSA 1P4HA 1FQOA 4ZCPA 2VF7A 3C8MA 1L7AA 1S5PA 4O33A 1SC6A 3QYAA 3MK31 1W2HA 4N5IX 1HDZA 3ABQB 5DBIA 5FOQA 1ZMOA 2EX1A 4TL8A 1WDMA 3Q1KA 4ZI7B 1JPVA 2AQIA 2V5AA 4WACA 4EX7A 1GTVA 3FHLA 3G8YA 4YJ2F 4N9WA 4KV9A 4ZYYA 4GWGA 1I1NA 5ESXA 2QD2A 4F06A 1UDRA 2FMUA 3LZ6A 2YQ5A 4B8ZA 4PONA 4RK6A 1E7SA 1JR3E 3FTDA 1OWOA 1P1KA 4P3PA 5FPPA 1M8PA 3T1TA 5K20A 1NYRA 3DAGA 2J8ZA 5EXXA 1LK0A 2JBWA 4TKVB 4LX0A 4XSHA 4URZR 3H99A 4KJXA 1VJ5A 2OD2A 1IBCA 3QLEA 5LMUB 1S96A 5IT9A 3ZQ6A 5DXFA 3FH0A 5GOZA 1V4VA 3LPLA 1Z5WA 3GUUA 2BFDB 3PD7A 3SU8A 3U48A 4C7VA 3E15A 4YNBA 4CT0A 4RHXA 4QC2A 4QM6A 4Q4AA 3BN3A 4BFWA 5IRCD 4JK3A 2B7BA 4JX9A 2P62A 2GKGA 3ZWVA 1HNWB 1VPTA 3LXMA 5B1IA 5LP6F 2WAMA 2WC1A 4Y2JA 5C8ZA 4AF8A 2CLKB 3CRW1 2PSJA 5ALTA 4DCOA 1OBHA 4TT3D 1RC8A 1XFAA 5FBRB 1Z8FA 1EFRD 1MQSA 3E7WA 3I45A 1V7QA 3MUNA 4L5CA 1ACMA 1YQTA 3NRJA 4JT4A 3RK1A 4R2WA 2IH5A 3EZ7A 1OU0A 4YXWA 4ASUD 2Z6AA 2ONZA 3OU7A 1UMDB 1PJ8A 3N6XA 4D9JA 4XCXA 3L0IB 1RR6A 3DBLA 1R8YA 1DTSA 1TZCA 2AJDA 2WB4A 4N3BA 5T57A 4EHFA 5KB3A 3DKKA 1NUSA 4YROA 3OFSA 4II7A 3F2IA 4J6FA 3KKMA 4OH1A 3DYIA 5H7XA 5KOJA 2HM7A 3E22B 1A5ZA 1QGED 3KD3A 1TF7A 1J1IA 2JH8A 2C00A 3OA2A 1Y37A 3G9UA 3PDIA 2WWRA 3LFHA 2BMDA 4O4HF 2F3SA 5J40A 1CQXA 4W7SA 5CA0F 1KGSA 1GKYA 1JFFA 3KTAA 4CV3A 4D8YA 1YNOA 4WJKB 1E5VA 3HRIA 4JJKA 1OFUA 2OV2A 3AT1A 3SBOA 2NUTB 2W6IA 3FUXA 4IMJB 3KHSA 2KLHA 5I7SA 1V7ZA 4HNSA 4X7RA 4P3NA 1GFWA 1DKUA 2BGLA 2BEUB 1E1QA 3PF8A 1KMHB 4P1ZA 1W36D 3BWDD 5JY1A 4DXAA 5I6DA 1L5QA 4Q82A 1TMKA 2VP6A 5KX5F 3QFTA 2AG6A 3NNDA 3S4YA 3DONA 4CTJA 2GYUA 2MDTA 5CDFA 1Z0SA 4HDKB 4GUAA 2ZTHA 5CD1A 3DL0A 3LL4A 4C7XA 2DHDA 4F6CA 3AHHA 1NXXA 3OUZA 4OXQA 1JSZA 4YHHB 4JSRA 1BW9A 5AVKA 2H4WA 4CM8B 2WYWA 3KE8A 2PA3A 4OEHA 3U4CA 3VNAA 3ZDDA 2IUSA 2FQ1A 2ZAGA 5AH0A 5FL7D 4QBIA 2NADA 1IHOA 1U1CA 4FFRA 3S44A 3L5KA 2VF4X 5B58C 1FYEA 2Z8YM 1HR0B 3H9BA 2QLFA 3I37X 5HM8A 4KR6A 1V6CA 5TVKA 1DBSA 3GRFA 3DE6X 4AJ1A 2E4WA 4RZXA 4NMLA 1DBIA 5LP6B 3AX6A 3P9KA 1XDWA 4HTFA 1GKUB 3BAFA 4J0FA 4RHFA 5ESRA 5C8XA 4NPCA 1HZZA 2DU8A 4F1KA 1TM2A 2JRLA 1QH0A 4L95C 5EKSA 4DREA 5C8VA 5IT5A 4RKYA 1IBLB 1AQLA 4MP6A 1W59A 4BVKA 2R7NA 4RS4A 1S9DA 5JDCA 4G0UA 1VCMA 5KX5B 3C3KA 1AH2A 2VT3A 2HCBA 4TS3A 3BMCA 3E2MA 5HS6A 3R75A 3OZ7A 3WWDA 2NAFA 3GG2A 3PNPA 3T15A 3DMTA 1BX3A 1GG2A 1N5OX 1R0LA 3PV0A 1QHIA 2M6SA 4I46A 1E92A 1K6EA 3IAFA 3IT3A 3PP8A 4UHHA 2GZSA 4CM6A 1QG4A 1NPTO 3OTOB 4TZ0A 2ZUDA 3RYFB 1A4XA 1W2GA 1ZN9A 5KC8A 1X7XA 3U4DA 2XNCA 3CLTC 2C8VA 2OK7A 1VLJA 4J4HA 1KEZA 2DX7A 1QE5A 1OCEA 3UG6A 3MOSA 2DQKA 2O2JA 2V7PA 2G4VA 3VX3A 4ZDKA 3QUTA 4P3YA 3ZCPA 5KAPA 2C2YA 5D3MB 2YY5A 4IP0A 1ZG3A 4DNFA 2CNWA 2OQ2A 4NESA 4WUTA 3REOA 3DHYA 4F8JA 3LGAA 1N2CA 4QHSA 1F2UA 2UYGA 3MVEA 1GZVA 1O4WA 1CZNA 3G5UA 4EG8A 3SF8B 4C3VA 1V7PC 2Q4BA 4XVCA 1FIUA 1ZVQA 1VKNA 3BL5A 1D7OA 4ISCA 4QG3A 5AW6A 2Z57A 4MRPA 4WKCA 4ZAGA 3ZWXA 5BSGA 1SIUA 1MB2A 4IS3A 1PJTA 5FD8A 1AXRA 3O90A 3T6KA 4OTZA 4G2TA 2OFFA 1ZN8A 4WKPA 2H2AA 4M4SA 3SIRA 4ER6A 5A5EA 4DDHA 2F48A 2FMKA 5ALZA 3E9EA 1D1SA 5LQAA 2CDAA 3AEQB 1QK4A 2V8OA 2VHYA 1QIIA 4IDQA 1NUUA 5AVVA 5L3SB 4NU0A 4ZRMA 2X3YA 2WAYA 3AOEA 1IDN1 2QDXA 2W6JD 3QYFA 4X94A 5TMBA 3PC7A 5EIEA 1JQAA 3F78A 1ODTC 3IV6A 5ES4B 1CE8B 4NE9A 4JFAA 4UBLA 4HGQA 1UIMA 1BX0A 3RFXA 1MVOA 2I54A 3G5AA 3H4IA 4WK6A 4BRWA 2B0CA 2H2DA 1Y8QA 2D00A 1I1QB 4LJ5A 1U3FA 4FW9A 1DEKA 1PD1A 1T3LA 2XGMA 2XYGA 3FLAA 4MUIA 3IC5A 1BJRE 3ADKA 3P32A 4TRJA 5H0IA 5JALA 2AQ8A 4XVUA 1C30A 1N2SA 1UK9A 4I50F 5E7MA 4Y2TA 4HUJA 1H8EA 3SE7A 1D6MA 4ZYVA 1GRRA 1VJDA 2ZGVA 2Z4TA 3NJRA 1UJ5A 1CIPA 1LNSA 1YTUA 2O48X 2X0RA 3ETCA 2D62A 1BJKA 1RCFA 1YK1A 4RMHA 4KDFA 3U9SA 1Y7IA 3LSYA 1K9SA 2IHNA 2JAXA 2NTVA 1OF1A 1EZZA 2V7QA 2GKSA 2V7WA 4FCTA 5JRJA 2UZ4A 3OF3A 1VMIA 4JUBA 4QQKA 2FZVA 4FEAA 3SHWA 1PP4A 4UTPA 2BSXA 3TXXA 1ONPA 1Y4UA 2BBSA 5DNDA 1TRHA 3ZBQA 1N1EA 4WV3A 1UPUA 1RQGA 3HVRA 4BRUA 3MJEA 2ORYA 4FOOA 1SUSA 3EF1A 3N2ZB 1PCXA 4QT0A 5EL0A 4LVNA 4AUNA 3PX7A 3MRTA 1U0NA 2CK3A 3BWCA 4FDTA 1B26A 4V39A 4YONB 4DA8A 2P0AA 1ZI9A 3BXXA 3GJ3A 1FBTA 2IZZA 3BXPA 4B35A 3R44A 1MO3A 1P8AA 5EJEA 4OLBA 1X74A 5T8KC 3V8EA 3T5CA 1HDEA 1RAHA 2WBLC 2WLSA 3IPYA 3FPLA 4AKSA 1HYGA 3ZE2B 4RKEA 4MWDA 1RTTA 2JBAA 4JJ7A 2SKCA 2QTMA 5EE3A 3RNOA 3IKJA 3P9PA 3P9RA 4LDJA 1XXHB 4V3BA 5FI1B 3TPFA 4RTMA 3HO8A 1K8RA 3LPCA 5ELLA 1TC2A 1ZMTA 2Z4SA 4PPGA 5FA6A 1P2VA 1L4FA 1IG3A 1Z0UA 1M0WA 1DLIA 1MC8A 2AUNA 1RI3A 1HF3A 1U94A 4BC1A 1IWPB 3UKDA 5HKKD 3TGLA 2I6FA 1C4WA 4BDSA 1R9GA 4CMEA 1G98A 1G59A 3Q40A 4GDMA 1C3OA 3C3YA 4JDUA 3NYWA 3K73O 3P94A 2YXBA 3BGSA 3QPAA 4FEGA 2JIOA 3A58B 2CKDA 4YJ3B 4KFTA 4DDUA 2IS4A 1WDKA 3CH4B 4M9XA 4CRWB 4AS2A 3DP9A 3OIFA 2GBPA 4O08A 4D45A 4BKUA 2CXTA 2BGUA 1RMYA 3NKFA 3SR4A 3C3JA 3U4GA 5AUNB 2RDMA 5DCYA 3ESAA 4EA6A 3DR3A 3QE0A 2BM8A 3DLIA 2B5VA 4ZU1X 1P91A 2Q0HA 4PYMA 4QUHA 4HYEA 3TL2A 4G5XA 2GAAA 1BIFA 5TQ0B 1G3QA 3FDZB 4RPLA 2PXAA 2FXIA 1ZI6A 3DDUA 3R7BA 3ZC3A 1MEOA 1BO6A 3KQUA 5I4CA 5IDYA 1A9PA 3FYSA 3HY4A 4LDZA 2GFQA 2GHQA 3QU4A 1MORA 2O0LA 3Q5EA 2DE0X 2F90A 3EIQA 2OVFA 1ZD9A 2WV9A 2YVQA 5BW5A 3A6PC 4QX6A 4ENWA 1J21A 1R9JA 4XX0B 1QH8B 5BOSB 2VF2A 1V6SA 1L2TA 3SYRA 3LX8A 2W5UA 1XF9A 2CCJA 3A0UA 1U1IA 1ZHFA 4GPIB 4EW3A 2HX1A 5KREA 4RDCA 2HGZA 1W4LA 2WNHA 3KZOA 3ZGNA 4X66B 1QIDA 4NCHA 4YFVA 1U0EA 4F2HA 3T7IA 3TSYA 5I7AA 4RTSA 1SC9A 2DQZA 5B6JA 1PL7A 2IP4A 2O07A 3NVKI 1AN0A 1D09A 4KQHA 2ODQA 3GLGA 4WK2B 5FBKA 4UE3S 4CTKA 3WMEA 1ZUHA 2QRJA 1I2DA 2XAUA 2J6CA 4EO4A 3GMSA 3ICQB 3FPJA 1JSXA 1R8SA 2V6BA 1G4UR 1UOEA 2B8NA 4FWTA 3I5AA 1CNFA 3MTQA 4DQDA 4L15A 3E61A 1PX0A 1T25A 2JDIA 4HDAA 5J1TB 1MH9A 2QAJA 4HATA 5LKAA 2J3EA 1EUYA 1SKMA 1D9XA 5DNVA 1QIHA 3IIMA 3ZTTA 5LMNB 1U3UA 4DPLA 3OD1A 4B73A 1JI0A 1KSHA 2E6KA 1YA8A 2R7MA 2YZNA 5KYUA 4OQYA 5C7YA 1JR6A 3CBGA 4OO3A 3ETDA 2Z6VA 4DIUA 3RAJA 1LTKA 4FCCA 3QVTA 4M9UA 2Z98A 1CQIB 5IYZF 4HSEA 2HQSA 3HJRA 3GQBB 3ZW7A 3FOCA 4Y3UA 5HTKA 3T9BA 4F4CA 2DUWA 2YWEA 3R6LA 2B20A 2CXXA 4PAOA 2VPTA 2Q3HA 1V8BA 4X61A 5EKDA 2GD1O 2C4VA 4JC8A 3TTSA 2WZBA 2D59A 1TKAA 2YCLA 1ZP6A 1HXHA 1P1HA 1XCLA 5F2NA 1Y9EA 3BUSA 3F5FA 2PCJA 2VRNA 5ADVA 1MDFA 1NVVR 4D4JA 2E89A 4AY5A 4WTOA 5KYNA 1H2AS 1T2NA 2AE1A 3KKZA 2PX5A 3O8DA 1WSWA 1EEXB 1CW2B 1EXNA 3WQSB 4NENB 2LIPA 1P5FA 2GCNA 4BAZA 1UAYA 3Q7EA 2C4NA 4QDOA 5JDIA 3BSWA 1QV9A 1AUPA 2H5JA 3HV0A 2G4CA 3KOMA 3KZMA 3WLRA 2A57A 4RBNA 1VLZA 4G8CA 3L3BA 4S05A 1V16A 1XZKA 1FTWA 2QLBA 5CCEA 1IVYA 3FOZA 1EM8A 5JRDS 3EGXB 2V6IA 1H4TA 3SS7X 2CLSA 3G8AA 2V55B 4G5SA 2IS1A 1V5WA 3I05A 4WQMA 4R54A 3QE4A 4CR6A 1ADYA 4RF5A 5TLSA 2FPRA 2AVDA 2Z8ZA 2DPYA 3BWVA 1Q0RA 3DC7A 2VJMA 4KAXA 3RT1A 1DTEA 3VAYA 5C46F 1ZSNA 4CTMA 4UM9B 1DUIA 2YZKA 1MT3A 3GA7A 3L7MA 4MGYR 5EP3A 2O05A 4A4DA 5KSOA 2RHJA 3QW4B 5EWMB 1NBWB 5H5JA 1VKZA 1OXSC 3U61B 3STUA 4BNWA 1XJQA 4OF4A 4EI7A 3GP5A 2BEJA 3LDGA 1P74A 3IAAA 4IVPA 2KHZA 5LZ2A 3GLIE 1QH1B 3GAFA 4EY3A 3TNYA 1DJOA 1YCFA 1V95A 1PJAA 1QV7A 2ANCA 4XCQA 3ZWOA 2E5FA 5ALEA 1P9NA 3HWWA 5HQ3A 2PJRA 4YRPA 4IMIB 2ENWA 4P98A 5ECGC 5CK5A 5I01A 4F38A 1P0CA 4F3NA 3MD9A 3QPVA 1DIAA 3FWHA 2X0JA 3BXGA 3OJWA 1YZNA 2Q62A 3PDUA 4ZARA 3S2EA 4HF7A 1JH9A 3WHKA 2I2BA 4OKSA 3EXAA 3MG9A 3AVVA 2N9UA 3U3ZA 4J0CA 4BNXA 1M75A 2YHUA 1U4NA 1K0FA 3TSZA 4L7VA 4KGVA 4NG5A 3A2KA 3LP6A 3TAHA 3KOOA 4REQA 3K6KA 3BZWA 1A7KA 3W5IA 5AIBA 3SI7A 2ZXUA 4P0TA 1TW2A 3SJCA 1XXHE 4FBGA 1S2DA 4TTSA 3C1TA 3H84A 1NRXA 4F4DA 3AYXB 2QI9F 4DWOA 4QQRA 3ETGA 1XR3A 1FFCA 3OLQA 3EEFA 2NSHA 2FEKA 4HB3A 3ABSB 5H83A 1J5XA 2GFHA 2GPSA 1EE1A 5ESWA 3O92A 1ZXBA 3CKLA 1JYFA 5HKOA 3WJAA 3UXYA 1JILA 2JZCA 4BEVA 5BY2A 4MV6A 4PVDA 4GOKA 2BW0A 3ZGXA 3VNBA 3TLXA 1XP8A 2RHHA 2YIVX 4C07A 2L0XA 3EIOA 3V48A 1CJBA 2GNOA 3KUUA 3M49A 4M0CA 1VKHA 2J9ZB 1OI4A 2XUJA 1TQ8A 4MK4A 4MVCA 3W3AD 2Y71A 4M0MA 4EHBA 1FFXA 2OQIA 3VR6H 2BFBB 5I8WA 1Z45A 2ZDGA 1JEJA 1CP2A 1ORIA 2P68A 3AV0B 1DV2A 3M3HA 4XJXA 2OCBA 1XCMA 3E84A 4EB6B 4NIMA 4JT2A 3OZVA 3OICA 4MV9A 4ZQHA 4BX0A 4RTPA 3U44B 3M1YA 5ELMA 2JI8A 2EQAA 3CWCA 5JFTA 3DKVA 1J22A 4DLAA 2O7QA 3IURA 3V3KA 4V1CB 5K4GA 3WGTA 4JEIA 1V9SA 2RI0A 3KJHA 2CXHA 3NTQA 3JAKB 4HADA 2IGBA 5ALQA 5TNXA 3ZTYA 4LZLA 2WUFA 3DBRB 3LY5A 4A8HA 4F3RA 4BO4A 1AQ6A 1H8HD 1LF5A 4FKBA 4WA8A 5MFZA 2XYHA 3HQ4O 5KNCH 4MV0A 5KTNA 3I04M 4NYJR 4MZXA 4DTIA 1QG2A 3KWFA 2OD9A 3CZAA 3OFNA 1MHPA 1NJ6A 3HLYA 4KR3A 1OAAA 1SXJE 4NZOA 1U8AA 4NFSA 3E81A 3QEKA 1XZPA 2QAGA 3GB9A 3QZUA 4A8JB 2HF2A 5ITVA 1XDZA 3AIOA 3MRSA 5JAZA 4BC0A 1N5JA 1XALA 5KOYA 1OY1A 3WL8A 2H1FA 2HJHA 4X6UA 3K5IA 3SLKA 3KJGA 2Q7DA 3U4HA 2Q6IA 4WXPA 1FMCA 1R5NA 1GLVA 3H2GA 4LJAA 5FQOA 5TB5A 2PYIA 5CBKA 1JLLA 1O08A 4W6ZA 3M5CA 1JLKA 3TJZA 1LRKA 3NETA 3DMDA 4NCAA 1OZAA 4AFNA 1VA4A 6ABPA 2VK2A 2VDRB 2RHMA 1T9GS 3QX9A 2FDXA 4MVJI 3A1CA 4MKZA 4KITB 3CVXA 1SBTA 4LOKA 3OFJA 2NT4A 1XAIA 1IN5A 3B38A 4KXNA 1J4AA 2R7LA 5K8IA 1QMPA 3BRSA 1IPFA 2ZBQA 2D5AA 1OROA 4U7GA 1Z4NA 1L7RA 3KT3A 1FDTA 4EL0A 4UD2A 4DHEA 2AI2A 4OFBA 4AJLA 5IK2A 4V1CA 1IY9A 4LIPD 2QNRA 2IX3A 3C41J 4N41A 3W5HA 3GUVA 1G9SA 4BO5A 3UC9A 2V6FA 1ZYUA 4HGPA 2ORIA 2FU5C 4A2PA 1BTOA 5HF9A 4MNTA 3KTOA 4C5CA 2CXNA 4I5EA 1N9GA 4PNZA 4D9CA 1JI3A 2V3VA 1XZJA 3COZA 1CF9A 1B6SA 4O25A 4ZT3A 2PJDA 5BV7A 4PLVA 1CX9B 2HY7A 4FMCF 1JN0A 5G2OA 3Q98A 2ZSHA 4DR1B 5CTJA 2A2ZA 4DM7A 3H0EA 4BX2A 3I6BA 1YZYA 2IELA 4KRXA 1EUCB 5FFNA 2EZ9A 4KWIA 4RA9B 2GM5A 3VOTA 2LNDA 3MCTA 1Q91A 2W2OA 1JW9B 3WBFA 1NUTA 3V5NA 3A1NA 3KJQA 3NVDA 4X54A 3EZXA 3F1KA 3VSAA 1WRBA 3H2ZA 1SXPA 3O38A 3RU7A 3G7NA 1TU3A 4NCIA 4EMTA 2JFZA 1VE1A 4HY3A 1WKBA 4Q02A 4TVSA 2VHCA 3T8YA 1K5GA 4Q93A 4CQMB 3HP4A 2GBLA 3JRXA 4UM7A 2OESA 1IWBB 2Z0MA 2WIDA 3QKWA 3SR0A 5JJ5A 1XJ5A 2RK3A 2HK7A 3O82A 4P36A 4RTLA 2IHVA 1JU9A 1GA4A 1A69A 4GYJA 4JWTA 4WH0A 1MAHA 4EUHA 3K32A 2NUTA 5AKEA 4LF4B 1SA0A 2SNIE 4E2ZA 4OXNA 3VU8A 5U4XA 1ID8A 3RS0A 3MELA 4R3UC 4N3AA 1DG9A 2CHQA 3Q15C 4IOLA 4B45A 2AXNA 2JGIA 4U0JA 1ZESA 2PDAA 2X5XA 3VNUA 3TOZA 4DLVA 4PZ0A 5EVJA 4N7JA 4BX9A 5CLHA 1JA0A 3TSOA 3N2IA 4NBWA 3BM5A 4WKOA 5B53A 2QNIA 1Q1AA 1ONNA 4ZO4A 2BHRA 3W3AH 4CLXA 4RZIA 1O58A 4JYPA 4LFCB 1AQIA 3VH1A 4DCJA 4DLYA 4ZEMA 3T3GA 2AN1A 2D3TA 4DOMA 4JC0A 4L9RA 1N8NA 3X1XA 2I33A 4DMUB 2L82A 2OL4A 2RB5A 4UTNA 4RHCA 1XI2A 1XHFA 1I0LA 5BN3A 2ZIWB 5TARA 2JKYA 3CX8A 4J49A 4ENSA 1N6KA 4WXRA 4ZAVA 1G2IA 5FJIA 4LYFA 4A8PA 1JDBB 1SG0A 4P92A 5HF6A 2FWAA 4EA9A 4JI2B 1QJCA 4H1TA 1YI0A 2Y0EA 4H6XA 2OQVA 1OA1A 1T2VA 4D74A 4L8VA 2CFOA 4OYRA 1KY2A 3OQHA 2IYFA 1QZTA 4QTYA 4H7KA 1XVVA 4O63O 4IH1A 2V9CA 3L6CA 4L02A 3WGGA 3D8NA 3DZBA 5HGJA 3AF0A 1RFLA 2NQ8A 3BSSA 3LXRA 4PCVA 1LSJA 1OUMA 3P2IA 5E0OA 3HXMA 2A3NA 5BNIA 3SP1A 2NNLD 5F3DA 2OA0A 3M4XA 3IUSA 4MAFA 3SXUB 3C6KA 4MLPA 3UHOA 1JFTA 2RGCA 4MA5A 3ITDA 3KJFA 4RJKA 3IQZA 8LDHA 3EXEA 3Q3CA 2PMWB 4ZTZB 4K9MA 3QHQA 3AUJB 1G3IA 4R5HA 5IULC 2QTBA 4KQEA 5BOVA 3JY6A 1U8UA 5L3QA 3H11A 4UEWA 3STVA 2J09A 1T1RA 1H5UA 4U6QA 4ZVTA 3NOVA 4B6EA 4BMOB 4C3ZA 4ZDIA 2GB4A 2VHVA 3CEHA 4I7EA 1RWOA 5C1DA 5JH7A 1W36B 1JDNA 2QVBA 1TT5A 3LGXA 4D0RA 2IPLA 2CV2A 3O8LA 3NS7A 4D4LA 4J9UE 1DBWA 2QU8A 2W6OA 4OAQA 1AC5A 3NHMA 1JR4A 5K1ZA 1XMQB 4TYNA 2UU9B 4Y9RA 2FQQA 1S89A 2HI0A 3BSFA 3QTLA 1GL6A 2NYAA 2V4MA 2I9PA 4HDSB 5E7JA 5ENVA 1JHVA 2OUIA 2JGAA 1FTNA 5JBNA 3EWNA 2VQ3A 1QCDA 1S2OA 4TSFA 1ZU4A 1IC6A 1D1TA 4KWTA 4QUJA 1GPYA 4IDOA 4DMFA 4F4JA 5FWYA 2IYXA 1D5CA 1Y3BE 5I48A 4CEJA 3GLSA 1DNPA 4PS0A 1U6JA 2Y67A 4OHWA 3TLAA 1WDWB 4JI5B 1VG9B 1CUCA 3OC0A 1E1YA 2QF7A 4PLGA 5AW4A 5KZMB 1CG6A 1V5EA 3BA1A 4IDDA 5GM1A 2R87A 3CVJA 1P8JA 1Q1QA 4N0DA 1D2GA 2C31A 2EP7A 3DG9A 2E2WA 3K5PA 3SJUA 4WLNA 3W5CA 3DVAB 5AFSA 2O8DB 3IHWA 2AR9A 1Q14A 2WWIA 1O97C 1GNTA 2WU3A 2IE8A 4CE6A 3TOVA 3LVQE 2X7HA 2J9FB 1AQJA 1JJBA 4QAQA 1PSDA 4H7IA 4Z9BA 4QOEA 5JANA 4F6LA 3RYCB 3KEMA 2E48A 1GAJA 1U7TA 2JFWA 1NI5A 3LW7A 5JVDB 1VRVA 4ITUA 2FGKA 4M2LA 1W4BA 4MQUA 3FR7A 3R77A 5AHOA 4HNAB 3E0XA 3EEIA 4Q01A 4RW0A 1GSHA 4AS3A 2V54A 3KKQA 1W29A 2XUOA 2OXFA 4MVXA 3W2FA 3WNZA 4EEKA 3H05A 4Z7OB 1IOZA 2YOHA 4EFMA 5AVSA 4BO7A 3QF4B 3A4YA 2V8BA 3FPCA 1DJQA 3LQKA 4WCVA 5JZ9A 2I29A 5BUQA 5LMZA 4BP1A 1BXGA 3OZEA 3SOZA 4UE6A 1BXRB 3K8YA 4BKRA 3X2FA 1W1IA 2B1GA 1OSNA 3AYZB 1W49A 5KDOA 1A8IA 1QRUA 1QS0B 1T2UA 2NACA 3QKUA 1QYDA 2D2EA 4CEIB 4OU4A 4DXDA 5MN4A 4ZQIA 1F1JA 2ZETA 2GCPA 3BWBA 4NMWA 1ZJ5A 3AESB 4WT7A 3ZS8A 2FEWB 1XOIA 4C6RA 2UDPA 5LMCA 1K63A 4J76A 4UAUA 3RC7A 1CRLA 1BU8A 2Q28A 3OQNA 1EG2A 2IXGA 2P1ZA 4ZEWA 4DAEA 3U09A 3CZCA 1XRSB 2VSFA 4N40A 3BMCB 5DN9A 1Y8AA 3K5HA 4P4SA 5IVDA 1E2IA