3LYLA

Structure of 3-oxoacyl-acylcarrier protein reductase, fabg from francisella tularensis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
247
structure length
247
Chain Sequence
MSLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
publication title Structure of 3-oxoacyl-acylcarrier protein reductase, FabG from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase
total genus 84
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3lylA00
5F1KA 4AJNA 1I01A 4L8VA 5H83A 2I3GA 3SJUA 3O03A 1MC5A 1BMDA 4D43A 1ZJYA 3D3EA 1ENYA 1KVRA 5CP8A 4FFMA 2HMVA 5IZCA 5JXWA 1KS9A 4OIMA 4NI5A 4Z6KA 1LTHR 5ES3A 1DC3A 4MIOA 4RVUA 1SB8A 1ZEJA 3PGXA 3D1LA 1E1KA 3KB6A 5TX7A 3F4LA 4AL4A 4MKXA 3DZKA 2VZ0A 2VYVD 1P44A 4J1QA 1V9LA 4EUEA 2VZ8A 2GASA 2JKVA 2GN6A 3D5TA 1T2EA 4GVXA 4D41A 3VDRA 4DPMA 1CYDA 4J1TA 3WYEA 3GGGA 3FPLA 3V1TC 2A92A 4DA9A 3WFJA 1P0CA 2HMSA 4L4SA 1BXGB 3DFUA 4GBJA 1QKIA 1JU9A 2IZ1A 5IDYA 1AHIA 3VVCA 3DONA 1NWHA 3PJFA 4D0SA 2O3TA 4HXYA 4ZRMA 2EW2A 2O48X 4GX2A 4FJ1A 3IP3A 2AEJA 4B7XA 1WMBA 4BNWA 4BNVA 3MZ0A 1ZO8A 5G0VA 4J3FA 1WP4A 3H6KA 4XB2A 1ONNA 4Z3KA 4YACA 2FHSA 5CEFA 1OC2A 3KEQA 4CLOA 1PTJA 1YL5A 3ZU4A 2BFOA 3RKRA 3GG9A 1EVJA 3AFMA 3OJOA 5A5EA 2QRLA 1I36A 3E48A 2X23A 2ZTMA 4JXKA 2P4QA 4IINA 2Q1SA 4XDYA 2C7VA 1O5IA 3NDJA 3A9WA 5T57A 2HO5A 4FGWA 3ROPA 4ALNA 3JD1A 4BO2A 3JQ6A 3PZBA 1Z75A 5EERA 3W4KA 4DMMA 1ISJA 1ULSA 3OJLA 1I33A 3JQFA 2CD9A 2QQ5A 3OM9A 1LRJA 3IIEA 3H2ZA 4L76A 3CXRA 5A02A 3GAZA 3VPHA 1K6XA 1UDAA 2FSSA 1PSDA 1OFGA 5AXAA 1RPNA 5I8ZA 1ZNQO 3ZU2A 3ZWCA 4YT2A 5A1TA 5KOIA 2VYND 2D8AA 4CM8B 2JD2A 1LRLA 3OICA 4J2OA 1CQJA 4JQCA 4TRMA 4DIBA 4BGVA 4BQRA 4M1QA 1YDWA 2Q1TA 4QUKA 4GKVA 4BNXA 3I9KA 4CM9D 4YYZA 3DZHA 4E2ZA 3RUDA 4E31A 2FN7A 3PEFA 5COBA 4ID9A 4A5OA 1X7GA 3KV3O 3DBHB 4DREA 4W6ZA 4BO6A 3FF4A 1JAYA 4B3JA 1BXKA 2ZB7A 1I2BA 2X9NA 3O38A 5DBGA 3WS7A 2ZQYA 3EW7A 4JBGA 1SNYA 4R41A 5GY7A 2CDCA 2HUNA 4CQMA 2P2SA 3ASVA 2JD1A 3VC7A 3BAZA 1R37A 2Q99A 3KO8A 2DBQA 3QA9A 4YAGA 4MVJA 1ZJZA 4P4GA 3GVHA 2Q4EA 1N1GA 1K0UA 5JC1A 4XR9A 3ZWVA 1B15A 4KZPA 4OH1A 1FDSA 1LLUA 1C0IA 5H81A 3E03A 4UUOA 3DBLA 1M6WA 2GN9A 2JCVA 3GUCA 1U7HA 4N54A 5ER9A 3WBFA 1C1XA 1XCBA 3EY4A 2QHXA 1PZHA 5G4LA 3VTFA 3UN1A 4QXMA 1HEUA 1E7QA 1K6JA 2WD7A 2FP4A 3FI9A 3KSZO 4E2XA 1T2CA 2X5JO 4R1TA 3Q9UA 3OBBA 2R2GA 4IDGA 5TJ9A 4E6PA 5HBRA 2FSVA 2B5VA 2AQKA 4OM8A 2DUWA 3K96A 4IY1A 4EGFA 4WLEA 3QY9A 9LDTA 3EHEA 1UUFA 1GADO 2AE2A 3CIFA 1LXCA 2EP7A 5DBIA 3FD8A 4YAKA 3DZBA 1ISGA 1LX6A 3DC2A 4BO5A 3ZNNA 4YRDA 3G79A 3BZUA 1PQPA 3D4PA 1DJQA 3K6JA 1CJCA 4H3VA 1GL3A 5A06A 1XG5A 3FNHA 2B37A 3PDJA 1PJ4A 1T2FA 1GZ4A 5EPOA 4JJFA 1ENOA 1VI2A 1DOHA 1F8FA 2VQ3A 4DBZA 4DVJA 1DLIA 1YBVA 1QMGA 3RUCA 3DBVO 4PLGA 3ZWBA 4PZEA 1X7DA 3ON5A 5C7IO 2HJRA 1QRRA 2XOXA 3EAGA 3FNGA 4PG5A 4Q3NA 3TNLA 3JQAD 1ARZA 1LBEA 1N8KA 2EGGA 4RLSA 3E5RA 3GVXA 1N9GA 2Q45A 1X0XA 3U4HA 5JSFA 2NSDA 1JWBB 4FJ2A 1N5DA 3C1OA 3VZRA 4GGOA 1MG0A 1OI7A 4GMFA 3QVSA 4H16A 3L9WA 2DLDA 4OXNA 1A9YA 3OHSX 2FPPA 1X14A 5F3RA 4AICA 3ENNA 1C1DB 2EGHA 3GEDA 1GQQA 3RUFA 1U8XX 3TF5A 3C1TA 4OXKA 3ZWNA 3ENKA 3WMXA 2VWHA 2D4AA 2G0TA 3AK4A 4CV3A 2I6TA 3FR8A 1LLDA 2C5AA 2HKIA 4M86A 3TZQA 2GNAA 2OL4A 1E3WB 3QVOA 2PKRA 4FCCA 3WMWA 4R01A 2PH5A 4RPKA 3DHEA 3ZW8A 1N92A 1GDHA 5HRUA 1DIAA 1Z73A 4CM4A 5IJZA 2HMWA 4M55A 4YT5A 3KOUA 1HE5A 1I3KA 4B8WA 1HE4A 2VOEA 5B4VA 4W4TA 3R1IA 4EBFA 4LVUA 5DP1A 1E92A 2NTVA 3D7LA 5HS6A 4IXWA 1JA9A 4AJHA 4PRLA 1QORA 3VKUA 3WOHA 3JQGA 3PWZA 3IKVA 5C3MA 4TQGA 2OO5A 5T6BA 1LEHA 1L7DA 2EHDA 1ENPA 4Y9DA 4R68A 3ZHZA 1JN0A 4YRBA 2HCTA 2PKQP 1YL6A 1EDZA 2GN4A 4EYEA 3JQBA 4ZQHA 3ZGYA 2IRWA 3KZVA 4IUYA 2PZMA 1TB4A 2NACA 2DBZA 3RASA 3EC7A 5A3VA 1T25A 3NJ8A 2AEMA 3I6QA 1ISIA 2Q46A 3ETGA 4KQXA 3WB9A 4B7CA 5CDUA 5JAQA 5CDGA 3PYMA 1NWCA 1P1HA 1UP6A 4LK3A 1GEEA 2Q2VA 4KUEA 4II2A 2XF8A 5K6AA 5KVSA 1R0SA 3I5MA 3NTRA 1WAMA 3PGJA 5AQ1A 2VCYA 3NGXA 1F0YA 4IIUA 4BGEA 1NPTO 1UH5A 2RH8A 1RJWA 1R12A 2IE0A 5ICMA 5JDIA 4E0BA 3G0OA 3PYLA 1G1AA 1JQBA 1PJQA 3ZWOA 8ADHA 2CVQA 3DL2A 3AUSA 4LISA 1U9JA 3CUKA 3H9EO 4FFPA 4MVJM 1VM6A 2YV3A 4OOEA 5BSFA 2HK7A 3ONEA 3PVZA 5A04A 1ZSYA 4NBRA 3LT4A 2FOIA 2P9EA 1H94A 1LRKA 3OH8A 5L53A 1LLCA 4J90A 4ND5A 3FR7A 2A9FA 1YB1A 4DBVO 3RBVA 1Y7TA 1AHHA 2OP0A 4IZIA 2V6GA 1HE2A 3DMTC 1QLJA 1XU7A 3FNFA 4IDAA 3ZCXA 4MIEA 1YWGO 3QQPA 4JJIA 2GLXA 4JJGA 1JAXA 1W73A 5JAMA 2P5YA 3AM4A 5EESA 4WK6A 2RCYA 4W7HA 5DT9A 2NU7A 1PJLA 1QYWA 1RYDA 1WLYA 4J4HA 5GZ1A 2GCGA 3B70A 5TNXA 2H5LA 3DAFA 1YJ8A 4R51A 2VHYA 3UF0A 1MA0A 4CM8A 3L4BC 3AJRA 3BHMA 3DAGA 2NM0A 3VKVA 1E7YA 1KEPA 3ULKA 3OQBA 1SEPA 1C0LA 1XQ1A 4O6VA 5LDHA 2FRDA 1VC2A 4Y6RA 5JS6A 3H7AA 4BNTA 5BSGA 3HDJA 3TZCA 4A03A 3T7EA 4DMLA 3LT0A 1Z6ZA 1JKFA 4G5HA 5I7SA 3L0DA 3LF1A 2I67A 4UUPA 4YWJA 4ITUA 5ADHA 5FYDA 1LC0A 1IUKA 2UYYA 5IZ4A 5KJ6A 1EUZA 1F06A 2Y1CA 3UFXA 2ZTLA 3H9QA 3KLPX 4J0FA 4CLOB 2CY0A 4M89A 5TLSA 4KDEA 4DPLA 4UVHA 3TPCA 1TT7A 2DC1A 3BXXA 3VTZA 2DPGA 4U8GA 3H65A 3VOSA 2P91A 1RKXA 3ADOA 1ML3A 2G5CA 2I3AA 4WLNA 2YHIA 4TRRA 3RAJA 3IMFA 5A4DA 4EUFA 4TKLA 4LN1A 4UVIA 4WEQA 5JLAA 4WLOA 3HQ4O 3BHIA 1ZH8A 2X5KO 2JD0A 4FPXA 4PG7A 3RKUA 4HP8A 1PS9A 1VJTA 1NQTA 1QYVA 3GR6A 1FF9A 3H2SA 2ZYGA 5HA5A 2C0CA 3A06A 4DUPA 1LDMA 1CIVA 1MFZA 5GZ6A 3AOGA 3QV1A 4E21A 1MXFA 4B4WA 4DWVA 4B3HA 1M75A 3VPXA 2GDZA 2B35A 4BNUA 3OMLA 5C7LO 1E6WA 3PP8A 1ADCA 2HK8A 4R3WA 5T8KC 3VPFA 4GQAA 1ISFA 4FFNA 1TI7A 1EE2A 2HDHA 4II3A 4KUGA 2G1UA 3FPCA 2W90A 1GZ3A 1E7RA 2YDYA 2JFGA 2J5RA 2BD0A 4JGBA 1X1TA 4B4VA 5IN4A 4RPHA 2NQTA 3KYCA 5J23A 4CV1A 5HM8A 3ZV3A 1YRLA 1H9AA 2Q49A 4YJDA 3NV9A 1I30A 4XCVA 3RBXA 1X7HA 4A27A 3SEFA 2VWPA 4CQMB 3N58A 3TRIA 2WJPA 1KERA 2D0IA 3K8ZA 4IGFA 3VHRA 3ZWPA 3RU7A 1B2LA 1WVGA 5KJEA 1U4OA 3SX2A 3WICA 1KVTA 3HDQA 3O9ZA 2RHCA 3PJDA 4WPGA 2E48A 3RC1A 4B79A 3BTUA 4J2HA 1GPJA 4YQZA 2Y1OA 2C20A 3QSGA 2VUTA 5G0UA 3GDGA 4W82A 2YZ7A 3DBLB 1WNTA 1P74A 2SCUA 5DOZA 4PLWA 2WYVA 4BNGA 1BTOA 2EKLA 3U4DA 4IXTA 1C1XB 1EVYA 4PFJA 5L4LA 1VE9A 4KWHA 1OZAA 1DLJA 1IHXA 4D46A 3ZN2A 1ZZEA 2PV7A 2DM6A 2V6BA 2Z95A 2WD7B 2VRCA 1EMDA 3LVFO 4FSHA 1R4MA 4IZHA 3GVCA 1DFHA 1SMKA 3BMQA 1RM4A 4J43A 4OKNA 4Q3DA 4YA6A 3V1YA 4RQUA 2WDZA 4IIVA 5JCJA 5B1YA 3LC2O 3FWNA 2FPIA 3Q6IA 1PL7A 1CQIA 4YVFA 1O9BA 3UW3A 3GDOA 4BHTA 4NMHA 3ZNOA 1EQUA 4WASA 3TQHA 1P45A 5BNIA 1PL8A 4ZVVA 4ZHSA 4NHEA 2Q2QA 1BVUA 3DZIA 4KTVE 4EEXA 2ZB8A 4URFA 4GI2A 3UCFA 4BMVA 4MVJP 3F9IA 3I4CA 3DHYA 2CFCA 1I10A 1UXJA 2C7GA 1TLTA 1DO8A 5LC1A 4Z0PA 3DEYX 4BIIA 3INTA 3H5NA 4NBTA 4RF3A 4RPGA 1EDOA 5AXCA 3NT4A 2IDZA 2GUGA 1UAGA 1B26A 3ZWAA 3LC7O 3ONFA 4NG5A 2NVBA 5DP2A 1Q0QA 1N9GB 2AXQA 4BNIA 1GY8A 2UUPA 1ZBQA 1U5CA 3HN7A 2QZZA 4EJ6A 4FOOA 2BFPA 3GRPA 2A4KA 1A7AA 1NHWA 2CVOA 1H6AA 1U7TA 4YCAA 3N7UA 2ZIZA 2X58A 2PFGA 1T4BA 3KYDA 3SXPA 3A28A 4WUVA 3HFSA 2NU6A 4FGSA 1P33A 4WNIA 3WBBA 1R0KA 2NQ8A 4AJJA 1LNQA 4NK4A 1A7KA 2PNFA 2WSBA 3F5QA 2CSUA 1LDEA 2OZPA 1PQUA 1ZXLA 5BQFA 4FQ8A 3OF2A 3RUAA 4WEOA 3LYLA 3GGOA 3E6AA 4YXFA 1FXSA 3A14A 3HG7A 1DIRA 3RUHA 4JP2A 4XJSA 3KXDA 3HHPA 2PTGA 1NFFA 1SZJG 1XHLA 4CLDA 3K2BA 4I9NA 3AM3A 3OETA 4Q3CA 4E2YA 3Q11A 1V3UA 2DFDA 3FWZA 3D3WA 4CMKA 1M76A 2YJZA 5BNFA 1VSVA 4Z3DA 1PEDA 4YAJA 2D5AA 1P1KA 3X2FA 4X54A 3AM5A 3WTCA 1ONOA 3OIGA 1XEAA 4O1MA 4CPDA 1KIFA 1XSEA 1ADGA 4PG8A 2GYYA 2O2YA 4RF2A 3WQQA 4ZQBA 1H6DA 3PIDA 2AQHA 1D8AA 1IB6A 1U5AA 4K26A 3JQGB 3GHYA 1FDVA 4ZD6A 3F3SA 1VSUA 1H93A 3HFGA 4F6CA 4NK5A 4HFRA 5B4UA 3VZQA 1YL7A 4R1UA 4XWYA 4O5OA 3EUWA 5GZ3A 3IKTA 3E9MA 4Z0TA 4FD3A 2GR9A 5FI5A 4GX0A 1V3VA 3BMNB 4J16A 3DDNA 5TF4A 2ZCUA 1GUZA 1U1IA 3ZH2A 3IC5A 4AJOA 2E6UX 4MJLA 1GZ6A 1ZSNA 3R3JA 1A4UA 4XR4A 3JCZA 2W4QA 2J5QA 4E5MA 3WTBA 2RIRA 5DBFA 1E77A 3GRKA 1HDZA 1KVUA 2UVDA 2J3HA 5JE8A 4QO7A 7MDHA 3AUTA 4PLCA 3ETEA 3WGTA 3E1KA 1HDXA 1T4DA 3K73O 3IJPA 3QHAA 4XJTA 1LSSA 4JIGA 3ZZNA 3I23A 2UDPA 1YJQA 1HE3A 3KM0A 4TSKA 4INAA 3AOEC 1MB4A 5L4NA 2EERA 2HRZA 4G81A 5IDWA 3IUPA 2X0NA 4NR0A 3VDQA 1U3TA 3M1LA 4R16A 4CMJA 3PJEA 3KSDO 5JMWA 3ORFA 3SLGA 4ALIA 3KEOA 1E3EA 1E7WA 5KVQA 1LSJA 1E3IA 3EK2A 2B4RO 2WE8A 2Y68A 2R00C 4MP8A 3BIOA 3KLMX 2VT3A 4XQGA 1SC6A 5KIAA 4AJ4A 3S8MA 4QX6A 4YBZA 3DZGA 1HSZA 3WQRA 4YR9A 1UZMA 2Y0EA 3M2TA 2JCYA 4BB6A 1ZK0A 2AMFA 4CMCA 3UVEA 5CHEA 3U9LA 4MP3A 1QR6A 4UEKA 3S55A 4MOWA 3U3XA 3GZNA 1V0JA 4LRTB 3QVWA 1YGYA 2CF5A 4DC1A 1QYCA 1BHSA 4IMRA 5TQVA 2HK9A 1VJ1A 3NUGA 1PZGA 4Y67A 2HQ1A 4C7KA 4KTTE 3GZ4A 5JO9A 2GRAA 1HDYA 2ZB3A 2G76A 1J6UA 4ROSA 4E30A 4PGFA 1BXZA 4RPJA 3OQ1A 4U5QA 3ZWMA 1YQDA 2DKNA 3WGYA 3QWAA 3OSUA 4BV9A 2NTNA 3DZJA 1Q2XA 3RU9A 2BFAA 2POQX 2GZ2A 2AW5A 3HJAA 3RBZA 4W99A 2C54A 1NVGA 3KYBA 3RJ5A 1K2WA 1KEUA 1TT5B 2ZTVA 2YHIB 2Z5LA 3C24A 1WDKA 3C8MA 3JD4A 2OBNA 1SB9A 1E1LA 2FR8A 2O7SA 4QFCA 1S7CA 3I9JA 4NNJA 2FY8A 3MWDB 3H9UA 4J6FA 4RVDA 1PZFA 4ALKA 4BL5A 1HDGO 2CNBA 2I9PA 3JV7A 4HUJA 4MO2A 2PKQO 3H9GA 4NBWA 1PS8A 1NASA 3ZNQA 3DTYA 4ALLA 4ZQGA 5CG1A 4R5HA 4IDFA 3E9NA 3C3XA 4IQ0A 3W4IA 4ALMA 3AY3A 2VRBA 4BO4A 1AXGA 4E5KA 4NBUA 1M6HA 1A72A 1B7GO 2WM3A 1YQGA 2VHVA 3KTDA 4DIOA 3H5AA 1PZEA 3I4FA 4AJPA 2B4TO 4QSMA 4ILKA 3B20A 5C7OO 4JX8A 3GNQA 4CUJA 1BRMA 4K1LA 2BKAA 4D3DA 3WWZA 2AE1A 3U62A 1Z74A 1YS4A 4KOAA 1GV1A 1JDJA 3WSVA 1UXGA 3WNVA 1CRWG 3P7MA 1UDCA 4FB5A 4U0KA 1J4AA 3KYCB 1Q7GA 2IZZA 3OJ0A 4BKQA 1JKJA 2BI8A 3GN1A 3OFSA 3C1AA 3MJ4A 3GMSA 3VPSA 6ADHA 1SBYA 1QV7A 3INRA 5ILGA 2JCXA 2ZYDA 5CEJA 3V5NA 3MTGA 3E8XA 4JNKA 4K9DA 3IDSA 3IAHA 5EQDA 3BMOA 4L75A 1MGOA 3W8DA 4FBGA 3CZRA 4AVYA 2J3JA 4YAEA 4CQMD 2C07A 3T4EA 5CG2A 1WZIA 4L9RA 4MVJD 5JDCC 3GLQA 1IE3A 3I9OA 3Q9NA 1U3WA 2HJSA 1J49A 4I5EA 1E6EA 2DU8A 3UGKA 4Q3AA 3ZU5A 1O89A 3DTTA 5ITVA 3D5QA 1R4MB 2OP1A 1IZ0A 3BMQB 4N7RA 5JY1A 3RROA 3JYLA 5I9LA 5EL0A 2QZ9A 1PU2A 3ZI0A 1ADFA 4TRNA 3O8QA 4MVJF 2Q2WA 3P2OA 3ZDFA 3P5SA 3Q0EA 1LDYA 1DIGA 1ZMTA 2HMTA 3VZSA 3WYCA 3LT2A 4FS3A 2W2LA 4WLFA 3QIVA 4BNMA 1E7MA 3PLRA 3MJEA 4R3NA 1GU7A 4RF5A 1Z7BA 3GA0A 4IJVA 1HKUA 2ZKLA 2YHUA 3T7CA 3Q2IA 3K5PA 4EEZA 4A2CA 2QRKA 3NAQA 3FRJA 3D4OA 4YPOA 3ZU3A 1MX3A 2ZYAA 4Y6SA 3FN4A 3WLFA 1NFQA 3I9MA 2VHWA 1C14A 1NQ5A 2E49A 1DHTA 2O2SA 4D79A 3HDYA 1ISHA 3ZHXA 1AXEA 3AW9A 4DPKA 5JMPA 2D59A 1HZZA 5CPBA 1E1MA 1RM5A 2E4AA 3CKYA 4XRGA 4GGPA 4NFSA 3OJEA 5EN4A 3M6IA 2PWZA 2YV2A 1HXHA 1R66A 3B1JA 1YB4A 4Z9YA 1NBOA 1EUDA 1PJ2A 1TXGA 4LCEA 3VVBA 5KTKA 4UUMA 5JPIA 3QJ5A 4RVFA 3KYDB 4MPDA 4B8ZA 4BNKA 3MJCA 4BOYA 5L40A 3DBRB 3PPIA 1FDUA 1G6KA 2W98A 5U4QA 3GG2A 3SC4A 3K9QO 1GCUA 3VPGA 1B16A 1BW9A 3BMNA 1OBFO 3HSKA 1D7OA 4YT4A 4XGIA 4LW8A 5G4KA 1F8GA 5KJ1A 1ZKMA 1I3NA 4WOJA 3LQFA 3GK3A 3OP4A 3NX4A 4IDEA 1NR7A 3SJ7A 1NTOA 3LDHA 3PRJA 5H82A 4EI2A 3DQPA 3D3WB 3D0OA 3F46A 4HNHA 5AXBA 2XXJA 1DFIA 3GEMA 3GQVA 1SO8A 2ZCVA 5I9MA 4YTEA 5JFOA 2OUIA 5JDCA 5A05A 3ABIA 3GN2A 3PWSA 4CMAA 4JLWA 3EVTA 4J1NA 5EMHA 5T67A 1DAOA 1FDWA 3RFVA 1Y5RA 5IF3A 1EQ2A 4WLUA 4DIFA 3AY7A 1ISMA 2EEZA 4DLBA 4MVJG 4IDBA 3AI3A 3BMCB 3MEQA 3JYOA 2IODA 1X13A 3ZWYA 2OMEA 2V6FA 1O8CA 4XX0A 2EJWA 2DUUA 3RFTA 1H5QA 3ZV6A 3W6ZA 1OAAA 3NYWA 1V35A 5TT0A 5TSDA 2JJYA 3GPIA 3NTOA 4GSKA 2EJVA 3CSDA 1MC4A 1T2DA 4FDAA 5DDIP 1ZW1A 2FPGA 4YJHB 3SBOA 2RH4A 4BNHA 3H3JA 4XQ9A 3QWHA 4AJIA 3HADA 4W9NC 5LCXA 1HDCA 4CMIB 4CMEC 5DZSA 4FOSA 4RL6A 3V2UA 4QO8A 4I5GA 3ZV5A 2QG4A 4F6LA 1VKNA 5JBIA 4U6SA 3ZWWA 1MFPA 4IS2A 4CL8A 3RI3A 4ZU3A 3ITDA 5FEUA 2C2YA 4HX5A 2X8LA 4F46A 3WDSA 3EDMA 9LDBA 1PGPA 5CDYA 5LDGA 4BNFA 4A10A 3F4BA 2YQ4A 4GL4A 1YQXA 1MG5A 1YOVA 3HWRA 4KQWA 1Q1NA 4CODB 1Y81A 2Y0CA 4IJUA 1T26A 2BRUA 4FFRA 4BS9A 2VTEA 3QLJA 3NT2A 1WPQA 4BMNA 2J6IA 5K9ZA 2FR1A 1HLPA 1VLLA 1EK6A 3BTSA 4TKMA 4NH4A 1NM5A 3TN7A 2I76A 3ITKA 4GSLA 2EKPA 3JQ9C 4IJWA 2IXBA 4KMSA 5KJFA 4XDZA 3C7DB 5I7FA 4TVOA 5FWNA 1TT5A 2X0JA 1OC4A 3INGA 4RV9A 1XR3A 5L7TA 1EUCA 3VH1A 4JK3A 4NFHA 4P22A 4DYDA 2PLAA 4LMRA 1QV6A 4IQ8A 4GPD1 4J91A 4BV8A 3PHJA 5ILOA 3GVPA 3K2EA 4WLVA 1AN9A 1I0ZA 2EXXA 5JAIA 4JROA 1BVRA 1GTMA 1KVSA 3OIFA 3CZMA 4GVLA 5KVVA 3CINA 1HYGA 3UCXA 4UAGA 5IXSA 4YB8A 2DTXA 4PLZA 1T1RA 2J8ZA 4KUHA 4AFNA 4GX5A 3JTMA 4WKGA 4FFOA 1HZJA 4ONEA 3GZNB 1WXDA 2O50A 3DWFA 4BNNA 1VJ0A 1D1SA 2PGDA 3LF2A 4K6FA 4PLPA 4N5NA 3JQEA 5FF9A 4XZ3A 5KKAA 1LQTA 1PJ3A 1U2GA 1QYXA 1GCOA 5FI3A 4YJFB 2HLPA 4OKIA 3PFFA 2O4UX 1V6AA 3OA0A 4PN3A 3EVNA 4RJTA 3ASUA 3HNPA 1H6BA 1KOLA 2I99A 1HLDA 2JAPA 1RYEA 3DMTA 2B0JA 3SLKA 4B4OA 4BUCA 2C59A 3B1KA 4QECA 1DC4A 2QYTA 4GWGA 1DJNA 2VOJA 4ZA2A 1GPDG 4FJ0A 3PHLA 3W6UA 4BGUA 4BKUA 1J5PA 1XYGA 1YE3A 4R5MA 4CMEA 1C3VA 5MDHA 4CLXA 1ORRA 1E0DA 3KBOA 1NX6A 4PLVA 5DCWA 2PA3A 1R16A 5G2OA 3ZHYA 5A5FA 3LLSA 3EMKA 4J4TA 2EIHA 3WX0A 4OYRA 5IN5A 4HWKA 2IYOA 4F3YA 3L4BA 4EJMA 4QT0A 1H0KA 1HYEA 3KHUA 1NNUA 5DOVA 1E7SA 5HS4A 1Z82A 3ONDA 5F5LA 4OMUA 3AU9A 4CM1A 5JYEA 3TWOA 3WXBA 4CMGA 3RC9A 5KKCA 1O0SA 3KUXA 1ZMOA 1D1TA 2F1KA 1W0CA 5I9NA 4CMBA 3T4XA 4WCFC 2O3SA 3LK7A 4XB1A 2H63A 1ENZA 4DRYA 4XIJA 3DOCA 1W6UA 4IS3A 5A9TA 3WFIA 1TEHA 1I2ZA 2Y1EA 4Y8VA 3WG9A 3WGGA 1HL3A 3WGOA 3DFZA 1DBVO 2GO1A 3N74A 1SOWA 4NU6A 3TSCA 4A0SA 2VHXA 6LDHA 2V6MA 3UCEA 3B1FA 4BNLA 2Q50A 1VL6A 3R0IA 1PR9A 4CV2A 3GC6A 1XKQA 4UEJA 3WIEA 3ZW9A 4JP3A 3TFQA 1H9BA 3MJSA 4RLHA 2B83A 4RCVA 2HSDA 1X15A 5IZCC 3RVDA 2BF7A 1H2BA 3ZNPA 1O94A 2VTDA 1GR0A 3S2EA 3AUUA 1UXIA 4A73A 3BMOB 1XELA 3G17A 3LSYA 4LMPA 3MCVA 4XA8A 1LDBA 4BNJA 1BDMA 1CEQA 4YAIA 3JYPA 4R1NA 4QTZA 3NGLA 3OIDA 2E82A 4AJEA 2NVWA 1PQWA 3AI2A 1PGJA 5T8KA 1XDWA 4PCVA 1E5QA 2YW9A 3AI1A 3GAFA 4HKTA 4GWKA 4CLHA 3K31A 4XYMA 2Y93A 4B4UA 1ZK2A 4O59O 4WE3A 4D0RA 4R4JA 5EQFA 5IAAA 1B8PA 3C7CB 1PJBA 1KYQA 4EITA 4Q3EA 1PWZA 2DQ4A 3MTJA 1IHYA 5BR7A 3O8QB 5COAA 3DBRA 2ZTUA 1PIWA 1LUAA 4J1SA 1CWUA 3PLNA 1BSVA 2V65A 4I9UA 2VRCD 2VYVA 2RHRA 3P19A 1PGOA 1JTVA 1EEHA 3WGIA 2W2KB 4E5YA 3VH4A 3PYXA 5JCJD 1YKFA 2YUTA 4HY3A 3PIIA 5L7WA 4CL3A 2GZ3A 4E32A 3TL2A 1ZCJA 3E5MA 2ZATA 1SEVA 4NU5A 4RVSA 1UXHA 4CQLB 3IP1A 3GPDG 4N5MA 4PIVA 4DGSA 2VZ9A 3TDKA 2WMDA 2H1SA 1GUFA 3PHGA 3PTZA 2CMDA 3AWDA 3AY6A 4YDRA 2Y05A 2BGMA 2O4CA 1N1EA 3PHHA 1GFSA 4HNGA 3QWBA 1ULUA 2F00A 1MXHA 4BO8A 5BNTA 3E9QA 5TT1A 4OL9A 1I3LA 4M8SA 4ALJA 4WGGA 2XPCA 2WD8A 3OEYA 2H6EA 4JBIA 2QX7A 4LCJA 1P3DA 3BMCA 4JN6B 4WCFA 4YJGB 4KWIA 2R6JA 1DFGA 4WJZA 2PGJA 2PK3A 4S3MA 4XYGA 5L95A 3OQ6A 4YEDA 2B4QA 3VH3A 3W8FA 4AJLA 3BA1A 4ZRNA 2WWRA 4U6QA 1KVQA 2ZJ0A 3JQ7B 4YJHA 1F17A 4GH5A 1BW9B 3LZ6A 4XYLA 3UXYA 1UZLA 4CMIA 3FNEA 1LJ8A 2HAEA 1I24A 1LQUA 3TZHA 4DC0A 1CF2O 3I6IA 5G4KB 3IUSA 3RIHA 4OHUA 4CM3A 1Y8QB 2RAFA 1VPDA 4NFYA 4YT8A 2O3JA 1HRDA 1E3LA 2VYNA 3MOGA 2ZB4A 4FIZA 4BB5A 1XA0A 3I9LA 2LDBA 2CUKA 4CM9A 4UULA 1VL0A 1ONPA 1GEGA 2VUSA 1EZ4A 1I3MA 4ZN6A 1KY4A 2WE7A 4UVGA 4NZ9A 3OEWA 3DMYA 4XQEA 2WEKA 2FMUA 1LA2A 3RCBA 1MLDA 3UKOA 5G0SA 1UZNA 2CVZA 1D4FA 3ZV4A 4AJ1A 3VAZA 1WWKA 1GAEO 1PL6A 4ND1A 2C5EA 5DCYA 1QP8A 4CLRB 4GMGA 1CERA 3CTMA 3ROMA 1E6UA 3NDRA 3NEPX 3WJ7A 1TA4A 2NLOA 3A1NA 1N7HA 2PY6A 4BO9A 2Z1NA 3GNTA 4I8XA 4IBOA 1F12A 3QVTA 5BSEA 4BNYA 1S6YA 4TZKA 3ANLA 1K5HA 1UJMA 5A03A 3F1LA 2EWMA 2I66A 2A94A 4BO0A 3M2PA 1P31A 3GY0A 3FBGA 5A3JA 2VUUA 1UP4A 1HSOA 2NTJA 4EUHA 4EW6A 2EKQA 3WQSB 4C4OA 1B8VA 4Q39A 4YRAA 1E3SA 1DEHA 2ZK7A 3JQ8B 5EJ2A 3JQCA 1DRUA 2BLLA 1X1EA 4PVCA 4D3SA 4JBHA 2YV1A 3WYBA 1DDOA 1P9LA 4XYEA 3ETDA 3EZLA 4L0QA 1M2WA 3ANNA 3DXFA 2DBRA 2IZ0A 5HTOA 3BTOA 1E5LA 1YOVB 3GH3A 2UV8A 1Y6JA 3NTQA 4FC7A 3OJFA 3DR3A 4R9RA 1NAHA 1N2SA 3ADPA 1A9ZA 1PX0A 3RQSA 4YJFA 5JW6A 2BHLA 1PS0A 1DXYA 4NQZA 5THQA 4ND4A 1VKOA 3X2EA 3FTPA 4BO1A 2JFHA 1YO6A 2QRJA 3S2GA 3NDIA 4D3FA 4UREA 3I83A 4JCOA 4L74A 2NV6A 1I5RA 3EZYA 2E37A 2BGKA 1XGKA 4G2NA 4BNZA 3PQFA 4RVHA 4J7CA 1T1SA 1NAIA 2H9IA 2OHXA 3LLVA 3ZWXA 1BWSA 4RZHA 5CDTA 1DPGA 3GF4A 1R4NB 4Y6PA 5BT9A 1J0XO 4A7PA 1Y1PA 1YBMA 5F5NA 1NXQA 3UUWA 1Y5MA 3GGPA 2NVUB 3JQAA 4PLTA 1Y8RA 1TVEA 2GPTA 3I3OA 3PQEA 1I32A 2AG8A 2DTEA 3C85A 2BFMA 3W4JA 1BGVA 5ER6A 4FC6A 3RUIA 2BMAA 4E33A 5JAZA 3QVXA 3HE3A 4XGKA 1DC6A 1DSSG 3JYQA 2J5KA 4J7XA 1A5ZA 4EJ0A 1ZXBA 4OQYA 2JHGA 2PH3A 5A9SA 1B3BA 4M49A 4XD2A 3TL3A 3D64A 3W1VA 3VZPA 4CJXA 5KCZA 4PG4A 3AOEA 1FJHA 4E4YA 3HN2A 3HB5X 2P68A 5CDSA 1JKIA 5JC8A 4NIMA 3F1KA 4AG3A 4QFDA 4ZICA 1UR5A 2B36A 1WDMA 2D3TA 4XIYA 3L6DA 2HMUA 4I5FA 4J4BA 4HV4A 2O3RA 1C0PA 1ZK4A 2QW8A 2X9VA 2J3IA 3G3EA 1WW8A 2R00A 3GEGA 4Z9XA 1GD1O 3S2IA 1PJSA 1KETA 5IG2A 4D7AA 1ADBA 1V8BA 2Y99A 2YFHA 3S1LA 2X22A 1K3TA 1UXKA 3DOOA 2I5PO 1YVEI 3JQBC 4XQCA 1RWBA 4GLOA 3PI7A 2VNAA 3MOIA 1U3UA 3LT1A 1I8TA 3Q2KA 5DN9A 1W8DA 4RORA 3CH6A 3QE3A 1IL0A 2XAAA 4NJOA 1T24A 4NJMA 1A27A 4GKBA 4Q3BA 3OECA 1Q0LA 2IEDA 1MUUA 3JD3A 4P8RA 1QXSA 5K6AC 1QYDA 4UVDA 1P0FA 2LDXA 4PLHA 1XU9A 1MV8A 3UICA 4LSMA 2OBYA 1PJTA 2RBEA 3PQDA 4TWRA 1U2DA 3PZRA 5KWEA 4BMSA 2P4HX 1M66A 4J7UA 1ZFNA 1N7GA 4ZQEA 1P1RA 1HETA 3NT5A 2X86A 2JHFA 5JDIC 1QLHA 5F21A 2VT2A 1JW9B 4DL9A 1EBFA 2C2XA 4BKPA 4TVBA 4CM6A 3CE6A 1DIBA 1PR3A 3WLEA 2FWMX 5CAEA 5IDQA 5JNLA 2P5UA 3CMCO 4IDDA 2EG9A 2FZWA 3UOGA 1OOEA 1G0OA 2W2KA 1HYHA 2JL1A 3MWEB 5F1OA 3ROKA 1GUYA 2W8ZA 4CMHA 4DLAA 5B37A 1KBZA 1FMCA 4S1VA 4GX1A 5EINA 2B5WA 2AA3A 4IQGA 4TMFA 4CQLA 4L4XA 5GMOA 2AHRA 3R3SA 4XRRA 2X7HA 1P1FA 4RZIA 4ZQFA 2EV9A 4WECA 1D3AA 2BI7A 2QIOA 5THKA 2GF2A 1EE9A 4DQVA 2GSDA 3GVIA 4R54A 1NVTA 4ZGWA 4MVJI 4P38A 3F5SA 3WNQA 4IMPA 1O6ZA 1A4IA 2OFPA 4MIYA 3FHLA 2Q1UA 3NRCA 1WZEA 1Z45A 3L6OO 5L7YA 3CMMA 4E5NA 2DPHA 2NWQA 4YJGA 1EK5A 3ANMA 4MP6A 3HUDA 1IPEA 3DB2A 4D45A 2PD4A 3I9NA 4I1IA 4N18A 4QQRA 1K89A 1KEWA 5AYVA 4OAQA 3JQDA 5DF1A 3EGOA 5TJHA 3JQ7A 1HT0A 1Q7BA 3G1UA 1IPFA 4YQYA 1Q0HA 3GNSA 1YDEA 1P1IA 4CUKA 2CDAA 5CEEA 3FTNA 1V3TA 3SVTA 3QWIA 1FK8A 4RPLA 4DQUA 3SC6A 5B12A 1KC1A 2NADA 1NR1A 5G0TA 4RO0A 4ESOA 1U3VA 1Y8QA 4TROA 1PGNA 3COSA 2WYUA 4E2WA 3H4VA 5IDXA 2Y1FA 4DYVA 1GYPA 4D42A 3RWBA 3GT0A 4DTIA 2W2LD 3QRWA 1GYQA 5ENVA 4HFMA 4CM7A 5KJCA 5TIIA 4WNCA 1NFRA 4LGVA 4P4NA 1PGQA 3WGHA 2HU2A 1ZVMA 4XYBA 2YYYA 4FW8A 5L9AA 4RQTA 1HF3A 2NUAA 4W7IA 4XGNA 3F47A 2X5OA 3KSUA 2A35A 5JY6A 3WJAA 3CEAA 2CZCA 3KRTA 4R69A 1ZIDA 1SAYA 3U0BA 1BXGA 1XWFA 3Q3CA 3RC7A 2NU9A 4WCFB 2EP5A 1EVZA 2DTDA 4O0LA 4OJNA 1M67A 4CLRA 4B3IA 4ND2A 1U28A 1B8UA 4ZJUA 1QG6A 4OQZA 3L4SO 2DBVO 4PG6A 4BQPA 4PZCA 5I7VA 2ZQZA 1BDBA 4AJKA 2C29D 2GZ1A 4R1SA 5CPFA 1HDRA 4J9VA 4DQXA 2CDBA 4NBVA 2O3UA 3RFXA 2OORA 1LC3A 3NJ4A 1LDNA 4I9HA 2DFVA 2PD6A 2TMDA 1ZK3A 5T64A 2YDXA 2Y66A 3QP9A 4LVCA 4BVAA 4Z9FA 1C0KA 2D1YA 8LDHA 1O95A 2AEFA 3G49A 4K28A 3CPSA 3JQ8A 4NPCA 1ZEMA 3B6ZA 2C82A 5KVCA 3AU8A 3IJRA 5G0WA 1R6DA 4E3ZA 3GMDA 3PK0A 1NPYA 2AG5A 3BHJA 5U9CA 1VL8A 3OA2A 4XKJA 3KVOA 5U1PA 3BTVA 1G0NA 2EW8A 2Y1GA 4PVDA 1A71A 2X1HA 3RD5A 1ID1A 3TJRA 1K6IA 2GD1O 4E12A 1YH3A 1P77A 3D4NA 1YB5A 4G65A 3PDUA 4N5LA 3PJGA 2D2IA 2PZLA 3ROQA 1T2AA 3PXXA 3IL2A 2GN8A 4HFJA 2DVMA 4R9SA 5L4SA 4MKZA 2UAGA 4WOKA 1B0AA 2BELA 4MDHA 3IS3A 5TC4A 4RF4A 3L07A 1NVMB 4H7PA 3RUEA 5AVOA 3TOZA 1L1FA 4CUZA 1AGNA 1IULA 2I65A 5C37A 1GYRA 3GFGA 3DBHA 2BH9A 2ZJ1A 1R4NA 2O3QA 1EFKA 4M87A 2YQ5A 4OOFA 3AUAA 2CF6A 1H6CA 3H5RA 1KC3A 3FBTA 1IY8A 1AE1A 1DRVA 2YY7A 3DAPA 5DNAA 5K0ZA 1E1NA 5DCUA 2NVUA 3FSRA 4FFLA 2G17A 4BGIA 5MGBA 3WIDA 5T5QA 4ND3A 1LSUA 3HZZA 1LU9A 4CM5A 1CETA 1H2HA 4DLLA 2IXAA 4MINA 3DO5A 2Y0DA 1FDTA 1Y9EA 2XXBA 3FCOA 3RSHA 2HRBA 4BO7A 1EVIA 5HWSA 3H9JA 1JLLA 5AOVA 5L3ZA 2PZKA 1EBUA 3MJVA 4RVGA 3QWFA 5C5IA 4FR5A 1SCUA 1VRWA 4Z0HO 2OXIA 4XEHA 4E5PA 3PWKA 3GOHA 4PLYA 4K6CA 4UEOA 3PFWO 3U4CA 4Q9NA 5TRTA 2DAPA 3GDFA 4MVJE 1I2CA 3LC1O 1UDBA 3RJ9A 3G1TA 3O4RA 4IJKA 4PZDA 5TS3A 2VN8A 1IZ9A 1NHGA 1BG6A 2FR0A 3Q1LA 4IDCA 2O23A 3UH1A 3TOXA 4BKRA 5A9RA 3A4VA 1WMAA 4J0EA 3TZ6A 4OSPA 4RDIA 3F6YA 4J49A 1DHRA 4W9NA 4HBGA 3WGZA 3ZHBA 3M1AA 1LLQA 2X0IA 4KDFA 4BO3A 3HB4X 1XLTA 3MJTA 3W8EA 2VNSA 3BYZA 1GQ2A 3GUYA 1WDLA 2AQ8A 2AQIA 3E82A 1ZUD1 3JQAB 4BKOA 1Y8RB 3I52A 2NNLD 4CLEA 2Q3EA 2G82A 1HTBA 3JD2A 2Z1MA 1HWYA 3QW2A 1IOLA 3STHA 4C7JA 2EF1A 1LI4A 1SPXA 2FZEA 4OGWA 2NU8A 3WR5A 1IYZA 3H3FA 5IXYA 3DZFA 5A9SB 3V2GA 3V8BA 3U49A 3LU1A 2OGUA 1MP0A 7ADHA 5IFLA 3L9XA 1GQYA 4FN4A 2P9CA 3AFNA 4LSWA 3K92A 4M54A 1XIVA 1HDOA 3VH2A 1DC5A 1W4ZA 1X0VA 4U7WA 3JQ9A 1U8FO 3ICPA 3E18A 4Y98A 1LDGA 3HDHA 1E3JA 3NKLA 1XQ6A 4L73A 4AJ2A 1F14A 4IM7A 1KY5A 4A26A 3I1JA 1KEVA 1Y9AA 1P1JA 4MVJH 1ZSVA 2WYWA 1UP7A 4MKRA 1NPDA 2X9GA 1LSOA 2P9GA 2PD3A 4UVEA 1C1DA 2VWGA 1JVSA 1R15A 4D44A 2GERA 2Q4BA 3WGQA 5F1PA 2GGSA 4EZBA 4P4LA 2J3KA 4HFNA 3UAGA 4GLLA 3DHNA 5COQA 2OOSA 2VWQA 4E13A 1QSGA 1SOVA 2D5CA 5ITWA 1GV0A 3GHHA 5CFZA 1NQOA 2Y1DA 1NQAO 5ICSA 1AUPA 4H15A 1JVBA 1E3WA 5EIOA 5I8WA 4RGBA 4I08A 2DT5A 2JFFA 4NJMB 5JO0A 2PZJA 2UUOA 4OO3A 4QEDA 1YXMA 2X4GA 5FFFA 1NP3A 3JYNA 4IPTA 2ILTA 2B69A 2X6TA 3S2FA 2O7QA 4U0JA 4GAEA 3DOJA 4OXYA 3ICCA 4J9UE 2PR2A 1U4SA 3V2HA 1YONA 1DRWA 4LRSB 1ZK1A 3U4IA 2PGLA 1B14A 4DXHA 1B3RA 5B4TA 3JD0A 5KNLA 2BGLA 1PJCA 1OMOA 4OSOA 3L77A 4CR8A 1CDOA 4PLFA 2VHZA 5ENDA 4CR7A 2YFQA 1R0LA 4EDFA 5DULA 3RC2A 5I7EA 2Q1WA 4B7UA 3WSWA 3U5TA 1RM3A 4IGEA 5BSHA 1RM0A 1NYTA 5JYDA 4HADA 5L51A 1DB3A 3IQDB 4F45A 2ET6A 1JWAB 3TFOA 3U09A 3PHIA 3K30A 2X0RA 4KP7A 3WWYA 1Q7CA 3L6EA 1L7EA 4PRKA 1UAYA 3IOYA 3R6DA 3JQFC 5L45A 4UUNA 2Y67A 3H8VA 4CV0A 3GFBA 2QYSA 2TMGA 4I5DA 3ST7A 2IYPA 3TZKA 4TZTA 5JCXA 3EYWA 3V1UA 3C7AA 3P2YA 1YBAA 4CM4B 4O63O 2V7PA 1EFLA 2WTBA 4WCDA 1DAPA 5TGDA 4L4RA 4RDHA 3O26A 3UHAA 2JAHA 4CR6A 1Z7EA 4NDNE 3KETA 2IEBA 4TRJA 1PWXA 1DIHA 3JSAA 5AXDA
chains in the Genus database with same CATH superfamily
2V3VA 3C8UA 1CUFA 1I01A 5B7QA 1GRVA 2I3GA 4XLLA 2HHCA 3H2JA 5I8PA 4KR0A 4BRSA 1BMDA 3ZVLA 1ENYA 3AR9A 1ULTA 1WTCA 3DBIA 1QO0D 3AERB 4DCMA 5K05A 1ECCA 2ISCA 2WIJA 4FFMA 1M9NA 2HMVA 2ZE6A 2BTOA 1RWQA 2X41A 2XMRA 1KS9A 4FCWA 2GBLC 4MQUA 1L5NA 4EPXA 2PGNA 3AVWA 4N03A 4NI5A 4Z6KA 3UMMA 1LTHR 4LWQA 1PFVA 5B6JA 1ODIA 1N6LA 3P32A 2LTAA 3UBTA 5CXSA 4RESA 1Z9BA 1MJ5A 1E6LA 1Z37A 3H4TA 2YUIA 4LQ4A 3KG2A 1YB2A 2W6JD 5TX7A 1YJ5A 2VZ0A 3DWGA 1VMIA 2AD1A 2H7XA 2IVFA 2ORVA 1V9LA 3G8AA 1J25A 2GN6A 3D5TA 4IHKA 1T2EA 1KZ1A 1M33A 1Q44A 1WL8A 1B76A 1XYVA 2YVQA 3GL9A 4GVXA 4JWKA 3OESA 2EWWA 1T4GA 3HXPA 2XB9A 2H4JA 3FPLA 3V1TC 1E4EB 2LVBA 2GD6A 4DA9A 2C78A 1P0CA 4GI1A 4IW3B 3P4UA 1RI4A 3MGKA 4LOKA 1QKIA 4OQLA 4EGAA 3VVCA 3DONA 1EP3B 2EJTA 3PJFA 2HA2A 4GX2A 3OWOA 5KX5A 2AEJA 5FIUA 1N6OA 4BNVA 2QE6A 1SKYE 3I58A 4RJKA 3T9CA 5G0VA 5K0JA 1CFJA 3M9XA 4KH1A 3DLTA 3T9EA 1WP4A 2CUNA 3H6KA 4QDJA 4LF7B 4FFBB 3ILXA 3Q5EA 3ECCA 1G1MA 1R00A 1PTJA 3ZU4A 5CH3A 1VGRA 3A4IA 3C3WA 2V55B 1PAUA 1VKHA 1G17A 3GG9A 4D6PA 5ABPA 3AFMA 4FFWA 1ABBA 4TLEA 3OEHD 4ZK6A 5A5EA 5K4GA 3E48A 5C3UA 2UVQA 1UINA 2EGUA 4G5GA 3VM6A 1CTQA 1YK1A 1Q3TA 4JXKA 5JFGA 4XVUA 2O19A 4BPRA 4PYMA 3C16C 1GTVA 1Z0UA 2QW0X 2C7VA 1O5IA 2BGJA 2CK3A 4HGZA 1XRNA 4HJXA 5G1PA 2WY2D 4FGWA 3W5BA 1T3HA 1AA6A 4BO2A 2W2NA 3PZBA 2FW9A 5AWFC 4HRVA 5EERA 3H8WA 1VDMA 4MGYR 2VP3A 3JQFA 1G9XA 1UC9A 2CD9A 5F35A 1EWQA 1G2QA 3IIEA 2C7PA 3H2ZA 3CXRA 1L5HA 2BCEA 4HDMB 1UDAA 1JTFA 2H9AA 5FO0A 1JEQB 2XSZA 5AXAA 4LYFA 5I8ZA 1U1EA 1VL1A 1SQ6A 1WB5A 9ATCA 7GPBA 2VYND 3EIHA 2JD2A 3HU3A 2Z08A 5IAKA 1Z0AA 4J2OA 4TRMA 2ZYHA 4Q1DA 4EI8A 5C53B 1YBFA 2R7NA 5ALVA 1YDWA 2Q1TA 4NOMA 4YIKA 1DWUA 3TMKA 4PC7A 1U3DA 3PDWA 4N40A 5CH5A 2Q9BA 4YYZA 3IALA 1Y6FA 4JB8A 1Z6TA 2HPAA 2PM8A 4F1KA 3PEFA 4RD4A 4A5OA 3V8MA 3PQ4A 1U0JA 1OX4B 4B3JA 1X42A 4B82A 2X9NA 1PBNA 4M46A 3OFJA 1I14A 5AKLA 1KYTA 4Q15A 2CDCA 5C8YA 3MS4A 3IEVA 3NLLA 3DCNA 2Z30A 3BAZA 4FLMA 3VC7A 2I29A 2AC4A 2DBQA 3QA9A 4QASA 4BAZA 4EI7A 3QFRA 5AFSA 2GM9A 4YAGA 2JNWA 3C4VA 5AM3A 4P4GA 5ADVA 2D06A 4KN6A 1K0UA 3TIGA 1NUTA 3AL0C 2EZTA 5TQ2A 2DPMA 2BGTA 2JIOA 4HNRA 1XTZA 3IQEA 1IQRA 1CRQA 1X7YB 1OFTA 5JZ9A 2IYEA 2YVKA 4CIWA 1EB8A 1LLUA 4LXTA 4MGEA 3LFUA 3N8DA 5LM3A 4Q4JB 5J5VA 4UUOA 3NM4A 1M6WA 3D81A 3X1WA 2OQRA 1TUBB 3VFDA 3GUCA 3R6LA 1U7HA 2E4UA 4N54A 5AOVA 4ZEMA 3HH8A 4CIXA 5CITA 5K6TA 3WBFA 2F8TA 4CI9A 4FYJA 1SVKA 1SXPA 2ID9A 2QHXA 3EZXA 3AR5A 1WMSA 5G4LA 4PYJA 2R47A 2KMLA 2JGDB 2BGUA 4V1CI 1E7QA 3OLYA 2FP4A 4TXLA 1YHZA 3KSZO 3T5GA 2IGTA 4R1TA 1NT4A 4H18A 2WTMA 3VR6D 2XYGA 4EKNB 5GV8A 3WZMA 3IMCA 4PYRA 4AIIA 4JBLA 2FSVA 3FI0A 1IWOA 3GGCA 2B5VA 3TAUA 4DG9A 5CDFA 4DUGA 2OY0A 3S8EA 4G09A 4B5LA 1S2OA 2WM8A 3JXEA 3N8HA 5ADWA 2L18A 3JZAA 1GADO 3OMWA 3A2MA 1F5SA 5EP1A 3LRXA 4LWOA 4QHSA 5TQJA 2ZULA 2YIMA 5GV7A 5ICCA 3ZGZA 2YMMA 2AN1A 3CVYA 5C81A 1E2IA 2DSTA 3M1IA 1U0TA 3MJFA 5LLDA 4HPJB 4IXDA 4BFSA 3PDJA 2B37A 1WBBA 1W9MA 2XT6A 1GZ4A 2VDWB 4G4SP 2R7MA 1RI3A 1MQSA 3PDCA 4C4RA 2CWWA 1JLHA 5HF6A 4ERXA 4JLPA 3PSAA 1G9SA 5EZQA 4MCAA 3R7BA 3ON5A 1Z5GA 3VO1A 3DXZA 1XMJA 3QU2A 4DMHA 2QPOA 2OBXA 4CEHB 1ZGBA 3MLEA 1QRRA 3TNLA 2ISSD 1P3Y1 2Y2UA 4Q3NA 1T0IA 3KZ1E 1UBHS 2G4CA 1U0BB 1BYUA 5JS1A 5DYWA 3E5RA 5HW0A 3EPLA 5JSFA 2B3DA 2O5RA 3OKPA 2JGKA 3U4HA 3X44A 2NSDA 1JWBB 3M5WA 4LNHA 4GGOA 3ILSA 1Y34E 2F1RA 1C7EA 1U7UA 3IULA 4UBKA 1N5LA 4QOSA 4WA7A 3OHSX 2FPPA 2YBDA 5EJ7A 2PSSA 2VSNA 3JVVA 1XO1A 1SQSA 4JYCA 4AICA 2V6JA 5K0GA 4OLHA 3FE2A 5I48A 1MRNA 1PR0A 3AV3A 3GEDA 1E4YA 1GQQA 3R76A 1XN1A 4OXKA 1OFVA 4MW5A 1NOKA 5IVPA 3PC8A 2GVNA 4DABA 1K5DA 5AOBA 2YR0A 2GZSA 2VNJA 3IYLW 3IBGA 1RABA 1P2UA 4RS3A 3AK4A 2H9YA 4MHSA 3CC8A 2AD5A 1XTIA 4WTOA 4MAAA 4MUIA 1YF3A 1C41A 3WLJA 1VLJA 5CGZA 1U9IA 4M86A 4QU9A 4UJ3A 3TZQA 1A5SB 4DCVA 1SXJD 3QGMA 3F2VA 3UHJA 5HX7A 1ZAYA 2OO3A 4H7IA 1OX6A 3P4YA 2IV3A 4CHGA 3BPSA 3SR3A 3DE2X 3EJ6A 3ZW8A 4QGSA 2OR3A 1DIAA 5IJZA 1JE0A 3BD6A 4M99A 5JANA 3TLJA 1R8XA 3KKZA 3Q5DA 3NWPA 1K86A 4PEVA 4ZT5A 1I3KA 1V4NA 2CZGA 2NUPB 5DVZA 1HE4A 2VOEA 3NHJA 1JGTA 3OZEA 4PHCA 4TV8F 2WNIA 1TYEB 4KX5A 3D1JA 4N3AA 4EBFA 5JSZB 3EZ6A 3NYIA 3NC4A 5ERGB 3AEQA 4EK9A 1ZOLA 5CA0F 5IUJC 4N76A 2VL7A 5EWMB 4L15A 4Y2YA 3GO4A 3Q7PA 5B5SA 1Y4ZA 5EJ6A 1QORA 4BLVA 2XKJE 4IMIB 4AWAA 4DLXA 3D6NB 3V4FA 1IRIA 4S1PA 1T8PA 3OKAA 2EFDB 1Z28A 4RKYA 3W5AA 1QH0A 2WU0A 4FYYA 4MYHA 1USIA 1V8PA 4HGQA 5KOHB 1LEHA 4PTYA 2ORWA 3CGWA 4DNFA 2O8NA 4DLPA 1AUXA 1CB0A 5CFPA 2EHDA 1ENPA 2HIGA 2WSLA 3S28A 1IVYA 4A6DA 2HCTA 5IZCA 1EDZA 3O7MA 2I3ZA 4NG4A 1EFAA 3EVCA 5BORA 4ZQHA 2WAOA 2ORIA 1A9PA 5B3KA 2BY4A 4U7HA 2WJ4A 2C2OA 2W6MA 1V8DA 2D1SA 3BT7A 5DNUA 2BONA 2QK4A 2FN3A 1KOJA 2NACA 2R44A 3K0EA 3NOVA 1ZGGA 3DNFA 4MUXA 3I6QA 3ZW7A 3EPPA 4NEQA 4A8JC 3WB9A 3U44A 1XF1A 1CLEA 1UMBB 2FQYA 3MWKA 3DLCA 1UP6A 1E4EA 2QTVB 4RC9A 4TMZA 4Z4HA 2Q2VA 5K6AA 1N2BA 1H1LB 3QJGA 5KVSA 4YY3B 4C7BA 3K9CA 1WAMA 1JQKA 2BISA 3WGUA 4DR6B 1GCIA 3LTNC 1OLUB 1ODTC 5L3SA 4IIUA 3B2EA 4MWEA 4CL2A 1NPTO 2XB6A 3OCWA 1VJ5A 1DO2A 1RJWA 2GXSA 1R12A 2XCLA 5ICMA 2J0VA 1ZHOA 1W5TA 4MUJA 3PYLA 1U9ZA 2EYQA 3SR4A 1SKQA 1JQBA 3A1VA 4LJKA 2F67A 2OPHA 3TDMA 2SECE 3V4VB 3FROA 1VG9B 2CVQA 2VP4A 3T1NA 1LPPA 3U7QA 1OH8A 2G1PA 2JGFA 1U2GC 2BGIA 4OOEA 2ZGVA 1PKXA 2XUQA 3PVZA 4PBRA 5BSFA 1XPRA 2P9EA 4FDVA 1H0HA 1YB7A 2IEIA 3VU0A 5L53A 4KR6A 4J90A 4ND5A 3PTAA 1WABA 1J0EA 1QCCA 3ZLTA 4MS3A 3L7KA 2R4TA 3KE9A 1EJBA 4B9AA 3IAM6 4PICA 1RHKA 5DX0A 5IASA 4IZIA 2V6GA 3T1VA 4PAOA 1D9XA 3FNFA 1HNZB 3IV9A 3QQPA 5JQGB 2GLXA 1ZMBA 5DM2A 3LBYA 3L7DA 3QZUA 3KJHA 1WVIA 5HGXA 5H4HA 2NP6A 3G2LA 2IPAB 2P5YA 2RGXA 5JAMA 3PEYA 2CJWB 4UTVA 1Z5VA 5DT9A 2PL5A 1RYNA 1RYDA 1I13A 4Z4EA 4WINA 3BK1A 4RZUA 1D2NA 2C95A 1JEQA 4UCWA 4DCJA 3WLOA 4R2KA 5G53C 1G7RA 3DAFA 3R0QA 3LKZA 5UKDA 2FMTA 1FRZA 4Z0NA 1K7SN 2FF7A 4QM6A 1YASA 2GBIA 3VKVA 3C6YA 1KEPA 3ULKA 1TAGA 1JS1X 4A0FA 4XWKA 1UOQA 1SEPA 1YKGA 2HGSA 4O6VA 4BN5A 4A8JA 1B4DA 5LDHA 1QHXA 4IVNA 4TKVA 3BFVA 4WXRA 1YR7A 4DLZA 1TEZA 3H7AA 1X9HA 1XMVA 3HDJA 1F0KA 3ELYA 3C6XA 4TMYA 3T7EA 5ALRA 4HAYA 1GIAA 3LUFA 1N6RA 3EY9A 1OPRA 4G5HA 5JJ5A 3WWOA 2WLTA 4XUGB 2H16A 3ISTA 5ADHA 3ID6C 4WKNA 1MO4A 2IEGA 3EVBA 1G20E 2ODEA 3UY4A 3H9QA 4M89A 2Z4RA 3R7LA 2CV2A 1JALA 1E9EA 4JYZA 2QTGA 1TT7A 2A0UA 1WBDA 4U8GA 5LD2C 3E9CA 3H65A 3C6MA 2HUPA 4EGSA 1U90A 2P91A 2Z3VA 1GGVA 4LDZA 3T3EA 1DRKA 2QLBA 3DGEC 3ONWA 2ZSHA 3MT8A 4G1VA 1W59A 4TKLA 3VHXA 4L3OA 2A88A 3R5XA 4OSEA 2O52A 4ZRDA 1X7YA 4W5WA 3HQ4O 4FPXA 1ZH8A 3MSCA 4QG3A 3ACBA 2Q3FA 2ZJ2A 1RHMA 3F5MA 1VJTA 3FHJA 3KSAC 4Q4JA 4L1KA 4TWZA 4WBXC 4XUDA 3DLHA 5JSYA 1CCWA 3NXSA 4MDYA 1UPBA 2MYTA 4JY7A 4X8OA 3S0JA 2F59A 2QVXX 1E2LA 2AIRA 3NC0C 4GOND 1CIVA 5GZ6A 3ZQKA 3AOGA 3R09A 4DJTA 4E4RA 4Q47A 5AH0A 1N3BA 1DEAA 2C03A 1WA5A 2EEPA 2HA0A 3RIGA 2MMCA 2GDZA 2F6RA 3WYFA 3G7UA 4BNUA 4EATA 3CZ9A 4B6JA 5GJBA 1B1CA 1OI2A 3KSRA 4N47A 1N0WA 3PP8A 3M3DA 3DT6A 3VPFA 4H59A 1QOQB 2H1CA 2VCEA 2YN4A 4BQNA 2Z2XA 2HF8A 2XMQA 3H0KA 1TVKA 1B74A 1JDNA 2G1UA 2W90A 3AB7A 4Y9TA 5ESDA 2FCAA 1PWYE 5CW2A 4ZTUB 2HW8A 6NULA 2Z2IA 3C5EA 2ZI7A 4RMGA 4O2BB 1WQ3A 4BXOB 3TRHA 3BD7A 5IN4A 5KOJB 5JEDA 2ALJA 2NQTA 3II6X 4V0MA 4G5QA 3T7JA 5BO5A 2C5SA 2WHXA 3SWWA 4YJDA 4XCVA 1XA3A 4AY2A 2V7TA 5IAEA 2R84A 2BMEA 2VP6A 4CQMB 4B3XA 1U2PA 4OHXA 3WL8A 1QFMA 4HDNB 3HU1A 1XE3A 3ZWPA 3D3KA 3GZJA 3OJXA 2OGWA 1OT5A 4O4LF 1U4OA 3WICA 1KVTA 1WSBA 2ZIWB 3A1FA 3EQ2A 3NALA 4JVNA 4NU0A 2RHCA 4TXNA 5I9IA 3S1AA 3RC1A 1RAIA 1RMYA 4BUZA 2HQSA 3GUZA 1IN8A 1CBUA 4RA9A 3TG8A 3U3MA 2CXXA 2BZ1A 2RFLA 2WSSA 4JL6A 4CEHA 3G8CA 3ZVNA 3GDGA 4KRYA 2C9ZA 4W82A 4BY9E 1P62B 1C7ZA 2JLCA 5DOZA 4PW0A 4PLWA 3WHIA 3WV5A 2EKLA 4R1OA 1C1XB 1U0OC 4PFJA 5LB2A 5L4LA 4QPCA 1QRUA 1DLJA 3AKEA 2O6HA 2E4XA 2V6BA 1WS6A 2Z95A 5JFTA 3AEZA 1WR8A 3PXGA 1EMDA 3FNIA 1V5WA 3LVFO 4IX9A 4YAFA 3SR0A 5HZMA 3BMQA 1SMKA 1A8HA 3F3KA 3RRYA 3HSSA 1U98A 1GZVA 1HBJA 2WDZA 3SIPA 3WDKA 2WJIA 1IN7A 1IM5A 3GRYA 3IP6A 3EIWA 4IIYA 4EELA 4FOTA 4JENA 3QLUA 1BA2A 3MWGA 2HIAA 3Q7IA 2KLHA 3FIJA 3Q6IA 1PL7A 5CB6A 1IQ0A 2EF0A 1OIXA 1O9BA 2F17A 2JJ2D 3EUAA 4MTCA 2ZT8A 4GGMX 3EMBA 5DHPA 4NMHA 5DKFA 3SGLA 4BLSA 2V7BA 3ZD9A 1UQUA 1JKJB 3KCQA 5K45A 1NW7A 2AB0A 2PO5A 3FLBA 4NHEA 4KODA 4DLUA 4PHGA 4AKIA 1BVUA 3TECE 1VHJA 1WUYA 3DZIA 5DFAA 1GG8A 3EN0A 4EEXA 2E4YA 3UCFA 3TXAA 4OD0A 3MELA 2R6GA 4MVJP 2BSXA 3I4CA 1RIFA 2NAFA 3VR2D 3DDCA 3PE6A 2WRZA 4RHXA 3DHYA 4C2TA 2QDXA 1U2EA 2M6SA 1UXJA 2C7GA 2LW7A 2NUPA 3HB9A 3PRHA 4F5DA 2REBA 5JYCA 3P27A 5KYYA 1KJIA 1BHQ1 3KTFA 4NBTA 4RPGA 4U2FA 3C5WP 3ONFA 5DP2A 5EWMA 3TIIA 2R1VB 3ZWAA 1Q0QA 1N9GB 1UFQA 3HLTA 4IEFB 3T9BA 1GY8A 5A4FS 1YZUA 4RA6B 5H02A 4HLUA 1LLFA 4DSTA 2UUPA 3LRTA 4RZXA 4YNBA 2QX8A 2JKYA 3EAQA 2I03A 4X1IB 2P41A 4M0LA 2I1WA 4X7MA 1KJ9A 3TW8A 2OHIA 1UDXA 2B99A 1CG6A 2VAXA 2A4KA 1A7AA 3PNBA 4R31A 4U1RA 1U7DA 1E5TA 1H6AA 1CZKA 2AVDA 3CBGA 5LR6A 1KTVA 4A3SA 3P0IA 1OXKB 4HCJA 4N9QA 4C0QC 1H4QA 1P5FA 4FGSA 2GXAA 2OCAA 3WBBA 4QGHA 2IVZA 2ZBUA 4YV1A 3R8FA 1LNQA 3GIWA 2IP2A 4NK4A 1A7KA 3SM3A 3VR3D 4EKGA 1RLTA 2CSUA 4GZ3A 4Y1RA 5AHWA 4YRGA 3LX6A 2IEAA 3D0KA 4A16A 1PQUA 2BFWA 1MNQA 1X19A 5BQFA 2H7CA 4B3GA 2QGZA 3RUAA 3RODA 2GS9A 2C8KA 3DH0A 4N82A 3I2FA 2X1VA 4JVSB 2X15A 1NKSA 1RXEA 3NAGA 5B58T 2OWDA 3USZA 3RFFA 3B6EA 2PXAA 2YWEA 3W79A 1UOPA 3GFVA 1AY0A 3KXDA 3ONNA 4PANA 1NFFA 5JS7A 4CLDA 5AMXA 2AI2A 3EXHA 3AM3A 4GUDA 3IAUA 3ECSA 4I9NA 4S1WA 1V3UA 3FWZA 3DB1A 4CMKA 4MQLA 1XNJA 2JAOA 2A0YA 2C4KA 4Z3DA 3SQXA 1PEDA 1XJ0A 1JEOA 2CXQA 1NJSA 2DX7A 2COEA 2ZTHA 4JFAA 4O1MA 3AJDA 1M6VB 1JQJC 2X13A 3L0CA 2QRNA 3AHDA 4H1HA 3CPJB 3EEBA 3GLIB 3KKMA 4IDQA 2H8KA 4RF2A 2P30A 3FPAA 1YHYA 2IY8A 2BEVA 1J42A 3M34A 3THWA 1H6DA 2YVAA 1KKMA 3QOYA 4OQPA 4D74A 3PD7A 1IB6A 1PUJA 1XT6A 4X20B 1OT3A 4KGZA 1M1YE 4KFUA 4BC0A 2GVDC 4ZD6A 4NBKA 1THGA 3HFGA 1FW6A 3D8RA 3R6TA 4HFRA 2QYHA 3JR7A 5J4HA 4EY5A 2F3TA 2BFDA 1M5RA 4UM7A 1A76A 4Z0TA 1NBEA 4HB0A 4YLYA 4RL4A 4KK4A 5C4MA 1RHUA 1EGAA 3FFWA 3HNRA 3MRSA 2IDKA 3BMNB 3BGOS 4J16A 4PPYA 1K5GA 1BS1A 1QH8B 2OCLA 4B84A 1ODFA 5K3FA 4AMYA 3U7HB 5IX8A 1XK6A 3ZH2A 5F4BA 3VTKA 1E2DA 4QQ8A 3F6SA 2JFQA 3A1TA 4H6XA 2XDWA 4MJLA 5LKAA 1EK2A 1A9SA 1J0DA 3BWXA 4JQYA 1IXSB 2HPVA 3G9XA 1PLKA 3CUEF 1NLMA 1L1RA 4XR4A 3U37A 2W4QA 2J5QA 2VZLA 3OQVA 4LG1A 3RTEA 2PKWA 4L0DA 1N0UA 1TYDE 2D2FA 4L07A 4IWNA 2RIRA 4UXIA 5AK3A 1NF8A 4KBGA 5H3HA 2HLDA 1Z0KA 1YC5A 1V4BA 4EOGA 2BMWA 3AUTA 4NAUA 4MWZA 3E1KA 2WHQA 3IJPA 1FYXA 4GVPA 1KO4A 3S44A 4P98A 2NXCA 3HABA 4QBHA 1J06A 1RADA 2IW1A 1HE3A 4RH1A 3FPFA 4TSKA 4DDWA 3LPMA 4FWTA 1C3EA 4MEBA 4F21A 1EB9A 1JT2A 3FNQA 4OI4A 1H2RS 2VJLA 5FEMA 1N5OX 3K15A 5MFPA 3IESA 3U1BA 2ZRKA 2H2DA 1VB5A 1KAQA 3OTHA 5DGHA 3ZI7A 3GJZA 4XX0B 4OAPA 3ER9A 2J3QA 2BFCB 1N4AA 4NCNA 2FQ1A 2XQKA 5BMVB 1E3IA 3EK2A 4H6VA 1CHDA 4B6QA 1K5PA 5ELLA 4D4IA 1UK7A 4MP8A 1BH2A 3O8DA 2XBMA 4DBLE 1OIWA 2VT3A 2J0EA 3H11B 1LPOA 3L2OB 3ZE0B 1TM5E 1XLVA 1XU4A 4C6TA 3PNMA 5KIAA 1RQXA 3SNHA 4YMTA 3BSWA 1D7AA 1K63A 1HSZA 3HCWA 3K9FC 3UWKA 3WQRA 1UZMA 3FZEA 5FNVF 3NHLA 2JCYA 4HWSA 4NCIA 2ASVA 5E6UB 4MXDA 2M98A 1N6IA 2VDUE 1I6MA 3IPLA 4HB2A 4W63A 5FHQA 4GKJB 3CN7A 4EG5A 4YCLA 5KSYA 1CF9A 5FBVB 3U9LA 1QR6A 1M2HA 1K7CA 4UEKA 3SHFA 4BE4A 1BWQA 4A92A 3VKWA 1P7VA 5EY5B 4BWGA 2CF5A 2DE0X 1BHSA 3STVA 2R751 2JFBA 2WWXA 4BXOA 4C7KA 2A9VA 2YXBA 4ETIA 5DHFA 2GRAA 5JXIA 3D6JA 3UWOA 1HDYA 4QVKA 3PUHA 4OATA 4Z7JA 1VKJA 4ROSA 5FOXA 5G41A 1BXZA 1BCRB 3OIUA 4U5QA 4E30A 2G63A 4M3NA 3WGYA 4XVRA 2HBZA 3UFXB 4QAJA 5BUQA 4ZV4A 1DAFA 1S02A 4ETWA 5BWBA 4URHA 2BFAA 3FWHA 1XNRB 1QRDA 3RBZA 1ISPA 2CMKA 5BSTA 5K0FA 4ILEA 2XA1A 4IRMA 4HH4A 4YYEA 2R8BA 1NVGA 3KYBA 1TT5B 4K81B 4ZANA 3A31A 1CDDA 3VR1A 4C4AA 2Q7DA 1WDKA 1BJTA 1QVVA 2PQMA 5K99A 5BV8A 1RVDA 1KI3A 2WJ6A 3EPKA 3D02A 1YMVA 2QL6A 2O20A 2H4YA 2QTBA 1BFUA 5E1OA 1MX5A 1S7CA 3FCUB 4LOAA 2VRWA 4BL5A 4RVDA 4MLZA 4P92A 4RIFA 5ALNA 3UAOA 3JV7A 2I9PA 4TLLB 1EKXA 2CLKB 4HUJA 3H9GA 2FLKA 4CKEA 4DN6A 2C7RA 1NASA 3ZNQA 5G3ZA 1OGIA 4I46A 4R5HA 4RK0A 3AVPA 3MW8A 3ZIAA 4AKHA 2JGLA 3AY3A 4BQIA 1JX6A 4UFPA 4BO4A 1G5IA 1LW6E 4QGFA 1E4OA 1TCCA 3TM5A 5IS2A 2FX5A 2H7VA 2CK3D 3EDQA 1B7GO 3KTDA 2QTAA 2YZGA 1UKCA 5D01A 4UFNA 4X84A 4L5CA 3KSBC 1N8SA 5C7OO 3B20A 4JX8A 3OUZA 2IJGX 4DMCA 2G9RA 1PR6A 3TTXA 1Z3CA 2IIQA 1LY1A 3BWVA 3FFTA 3I34X 4GI3A 1YS4A 1G21E 2ZYVX 2ZUDA 3A70A 2CL5A 3JAWB 4KOAA 4PPNA 2XSZD 3WNVA 1SVLA 2FX3A 5CHYA 3U3DA 4RYLA 1DQZA 3CZQA 1IWBB 3VI4B 4D99A 4FB5A 4U0KA 3T5AA 1Q7GA 2IZZA 4HTAA 1A9QA 2R97A 4MRMB 5PNTA 4RTRA 4FT2A 1JKJA 2BI8A 2J6BA 3Q3VA 2WTAA 1GL9B 1MJGM 3U56A 1LI7A 3OFSA 2QV0A 2QGFA 3EG9A 3HJRA 3MJ4A 5IANA 4JI4B 4TTTS 3BFJA 1YVPA 3INRA 1BC5A 3LM8A 1RCFA 4RIIA 5ILGA 4XSGA 1JH8A 4B3FX 1EFRA 2VKTA 1OI4A 1D09A 3E8XA 3Q7SA 4H6PA 3ZJ5A 1TRKA 1FRVA 1I2AA 1GA6A 1HR0B 3DT9A 2I7XA 2LIVA 3PVCA 1J2YA 3BMOA 5EQDA 4RY2A 2YJNA 4G1EB 5KWSA 1G3UA 4N0QA 5JSHA 1E2GA 4GPAA 3FZQA 1HKHA 2J3JA 2O06A 2R11A 3DLPX 4YAEA 2QMOA 1M0TA 3T4EA 4OHCA 2FSHA 4YX9A 4BQQA 4FINA 2SCUB 1JYSA 1XTKA 2Q7XA 4GI7A 1FYEA 1R5OA 4PTZA 3FVWA 3G8DA 2CWDA 5JNRA 3G2OA 1TUEA 1CVRA 1HFWA 2GZDA 2A9KA 2HJSA 3Q9NA 4XJXA 3RVPA 2DU8A 2BTQB 1ZYUA 2I22A 4FD2A 4Q3AA 3ROFA 3UAWA 3DTTA 3DEIA 3UGKA 5I5EA 1UCFA 2E5WA 1N5KA 5HIKA 1RZVA 1RAHA 1GTRA 2AEEA 3JYLA 1ZD2P 5C2JB 1L3CA 1PU2A 4R2LA 4BQOA 3KBBA 5DTIA 2VJOA 4IZ6A 1UKZA 2ZT6A 4GXTA 4TS4A 5TMDA 2WTEA 2GCIA 1U28C 3TUZC 4JLSA 1LDYA 1CQIB 5HFAA 4KMOA 1ZMTA 2W83A 3ZQ6A 3BFPA 3VZSA 3OCCA 3ZLBA 4HLQB 2K2WA 2W2OA 3LT2A 4B7AA 4WLFA 3QIVA 4HT3B 5DNYB 5J63A 3PLRA 3RVNA 1V39A 1KORA 2RB4A 2PV0A 2ADOA 1FTYA 2DHRA 1V37A 4WAUA 3Q2IA 3W9UA 3TGWA 1BQ4A 1F1JA 4DUGD 2QRKA 3ED1A 1YI0A 4Y2HA 3D4OA 4GO1A 1XXHA 2NYUA 2XMZA 3U1TA 3HRKA 4IIBA 4WOPA 3ZU3A 4CF6A 3HN6A 2ZYAA 1MX9A 1KP9A 1P17A 3O9MA 4JUFA 5FLKA 3WLFA 4C0WA 4TLAA 3T94A 3OOWA 1L1QA 4CWAA 1WNFA 3PX2A 1MO2A 1WY7A 2HXSA 1IJKA 2XQGA 3A4YA 2OHVA 4H17A 4LXYA 4DZTA 2O2SA 3NONA 4YP9A 3ZWDA 4D79A 3ZHXA 2DR3A 1N1MA 1PR2A 4PQRA 1KR2A 3GFFA 3KPUA 2D59A 4AMBA 1HZZA 2DWPA 3BVPA 2BTEA 4OUDB 2WWVD 3M6FA 4P53A 2D1FA 4Q82A 4GNRA 1PLJA 4Y9RA 3CA8A 1RM5A 4I66A 3ZGXA 3OPYI 2Z2KA 1EDBA 3MCTA 2I4TA 3OJEA 5D5PA 2XA2A 1HT3A 2JI8A 1FNNA 2X8WA 3CG4A 5CTJA 4ZFNA 2ZRHA 3BXZA 1ZCBA 2OHJA 1USUA 2GYUA 2QGNA 4HEJA 4NHOA 4M9RA 5AVUA 4C08A 3R3HA 2J30A 1NBOA 2BEJA 3TI7A 3T3DA 1UWKA 1Y6RA 3G5TA 1SIOA 2DHEA 4GM4A 2CHFA 3LVQE 1UBGA 4LCEA 4LZZA 1HGXA 1IMOA 4OHFA 5JPIA 4RVFA 3VVBA 1QQ6A 3VUEA 3CH5A 4EO9A 4DLNA 5AUNB 3K70B 4BNKA 2R48A 3MJCA 5L40A 3PUJA 2RGDA 3AIMA 4K7JA 2W98A 3ETCA 3VOTA 4I8DA 1XTSA 2W2TA 3MRVA 1B16A 1FS5A 3BMNA 3L0ZA 3VPGA 1ZRNA 5ALQA 4JUDX 1CUJA 1E9AA 1BEEA 1T3ZA 3A1DA 1D7OA 4QUHA 4QUGA 2JG3A 3R0XA 4AZTA 4HNUA 3SKVA 1WEHA 2PS0A 4L7QA 1PV4A 2I54A 4EHNA 1LCIA 1I3NA 1YNSA 3ZY3A 1H66A 1CULC 1ZI6A 3GK3A 4MWSA 3NX4A 1SXGA 5AIBA 4RHFA 2IS2A 3NHWA 4U6NA 3K0AA 3WLNA 1NTOA 4UAJA 5T3UA 1O2DA 1MZVA 2P6NA 3D0OA 3D3WB 3ER6A 3F46A 3K0FA 1DFIA 4WZBE 3GEMA 4QC2A 3GQVA 4FYIA 4IIJB 2GCPA 3WXMA 3CF4A 5C8DA 3ZWKA 2BP7B 5JDCA 3BH7A 4DCCA 1RXUA 3B6IA 1A97A 5FTJA 4A6PA 3HKEA 3FUCA 4CMAA 4J1NA 5SY4A 2I7CA 1PFKA 1NU8A 2OPBA 2BEWB 4DARA 3RFVA 1Y5RA 4K9SA 2P6MA 1YA8A 4O29A 4Z9AA 4LYHA 5HMLA 2QX6A 3AIIA 1K3FA 2EEZA 3FFXA 4MVJG 5AI0A 4ARCA 3T99A 2HTEA 2YL2A 3AI3A 3BMCB 1GNLA 4BMCA 2IODA 3A9RA 1R0BA 1QKJA 2C3PA 3NBFA 4QDKA 2XOEA 1PL0A 2IUUA 3UJ3X 2OMEA 5JBQA 3CJTA 1GN9A 4QJ5A 4EHDA 4XX0A 2DUUA 3LBNA 4G6ZA 4LIPD 5FOUA 3ZV6A 2FRXA 4OQDA 2IOQA 3W90A 5D1HA 5BMVA 1OAAA 1V1RB 1M2NA 4KIWA 3T1OA 5TT0A 2A1TR 4F4DA 1NXOA 2C2BA 4GSKA 4JT2A 4DNPA 3SBOA 4FDAA 2ZPTX 3N5KA 3H3JA 3I9V1 3VJLA 5KYTA 3AQIA 4EPYA 4KLCA 2WFLB 2YXLA 5IKEA 1X1SA 2CXSA 4I1UA 2IYVA 3EF0A 5ED4A 2VA9A 4RL6A 1FX0B 4XX1A 3V2UA 1ISRA 4PXSA 4I5GA 4YI3A 1N6PA 3UK7A 1A8IA 5D00A 1W76A 1JSXA 3IPXA 3MK31 1DUIA 1Q14A 1Z2EA 1ZM2A 3DOFA 2D74A 4KXUA 3VRHA 3DMNA 1YTLA 4A8HA 3F67A 3AFHA 4GE0A 1FSPA 2GFIA 1Z7GA 2X8LA 2VKQA 5AK0A 1TO6A 3IT3A 2WU1A 1T8YA 5LDGA 1SM4A 1AB6A 3BH0A 4BNFA 3GPCA 1SBTA 2C9DA 4JELA 2FJ0A 1UBMS 1RI1A 4LNAA 2IUSA 4PF1A 3BZWA 3HWRA 3LC0A 3O3NB 3QUBA 1JSLA 3N2LA 3UWDA 5T4FA 1Y81A 2UZAA 1T26A 2BRUA 1U04A 1YR2A 3HBLA 3L5OA 4L08A 2QQFA 4S04A 4G8JA 3CV3A 1WXGA 3OZUA 5HCUA 2M6LA 2ZBVA 3NT2A 1RRMA 1WPQA 4BMNA 2RGGA 2J6IA 3FB1A 4DJJA 1BCRA 1R64A 4F97A 5JASA 5K9ZA 4IJ5A 4RE6A 2A78A 3FCEA 4HAVA 2I76A 3ITKA 2XJ4A 1O7JA 1I7LA 4GSLA 2EKPA 3JQ9C 2ZRDA 3R0ZA 2X7JA 1KU0A 1UK8A 2G40A 5I7FA 3HJGA 4TVOA 5BN1A 5FWNA 1N2CB 1TT5A 1OWNA 4ZVNA 3LX4A 2A4MA 1XR3A 2PT5A 2O2DA 4P5PA 3RRJA 2BOVA 4DG5A 4JK3A 2J6HA 3OD1A 3D7MA 4B09A 4JP8A 1T8RA 2VLIA 1QV6A 4IQ8A 4GPD1 4J91A 2D4HA 4KN8A 4BV8A 4P34A 3K2EA 1Z5PA 5DM1A 1AN9A 4KU4A 4Q4LA 3W5JA 1WY5A 2UYCA 2Q3HA 3RRBA 3U1VA 1RQGA 2QMYA 3EWNA 3OIFA 5CCBA 1TJYA 4QE3A 4DF3A 3CINA 2CEKA 3IEKA 2I8AA 4UAGA 5DX1A 3PUVA 1JFSA 4PLZA 1V8OA 1EIZA 2FMIA 3NEAA 4QGAA 5DX8A 3TBHA 2GXUA 4ES6A 1VSTA 2C4VA 2OCPA 1QTNA 3N87A 4C4SA 2PN1A 4LPSA 1DAIA 2WF9A 2WNHA 4FFOA 1OTHA 3DV2A 5DE3A 1VE3A 2EG5A 2VHCA 2V9ZA 3CY6A 3HU2A 2IELA 1MIOB 1D1SA 1R6BX 4N5NA 2HC9A 5FF9A 3DW3X 3EASA 1PSWA 3U19A 1QGZA 4WDQA 2XZOA 4G07A 4PCAA 3U7GA 2PL9A 4OEHA 4QG7A 4URXR 4ZCPA 3M6AA 4BX8A 1JG4A 4XDHA 1QGYA 2G25A 3I01M 1Z25A 2J0UB 3MQ2A 5D7NA 1OZGA 1V6AA 4NX2A 2JI4A 4KXYA 4EYQA 4P7FA 1CJVC 3WQBA 4LJAA 2FN4A 1CUIA 1KOLA 2ZU0C 4BVLA 1H4SA 1XMXA 4ZO4A 2GLUA 3DMTA 2E3JA 4LNUA 5K8LA 4N8EA 1RJEA 2IOFA 2JEYA 4G01B 4EHLA 4B4OA 3LUPA 2C59A 5AR1A 1NV8A 2DY0A 5H3CA 2ZJ7A 5F5XA 5JI3E 1ICEA 1CT9A 1DJNA 2ZKIA 4FJ0A 4BKUA 3PHLA 2XIJA 6REQB 5A4MS 3GLTA 1YRYE 2X0KA 1C3VA 4CLXA 3FMFA 3KBOA 2BF4A 1KE1A 1NX6A 4PLVA 1N2HA 1WW3A 3BIWA 1R16A 5ALJA 5G2OA 5HBGA 3ZHYA 1IONA 5A5FA 4EEZA 4N8DA 3S70A 4BRUA 3QYPA 2GEJA 2DFLA 4NOJA 1ZVQA 2Z8XA 3F9RA 1GNTA 1Q0TA 5JI2E 4KNYA 3LOPA 4EJMA 4YREA 1GRNA 1W34A 1EM6A 1Y48E 3KHUA 4QT0A 4GMDA 1NNUA 3ODPA 2NIPA 2O0MA 3A3NA 1YIAA 4G5XA 1MVLA 2XKKA 4DV6B 3SFTA 2GPAA 3UGQA 2C4MA 1NQUA 5BW6B 2GSWA 5JYEA 1NZFA 2YJ3A 4G36A 4LYYA 3V3KA 4DWWA 5KS2A 4DIDA 1K66A 1FVXA 5JRJA 4DDVA 1D1TA 3DNMA 5EIAA 2PH1A 2F1KA 4EY6A 1R5BA 2Z8ZA 4IGKA 3MMSA 4CMBA 4WCFC 2ADMA 2O3SA 5I9NA 4UBMA 3LK7A 5FB3A 2WMOB 4JQOA 2J9GA 2GBFA 1UWLA 4AUNA 5B2FA 5LQCA 1IBMB 3B85A 2JBAB 4IS3A 5A9TA 4NZMA 5DM4A 2JJMA 1TEHA 1ZESA 1W85B 3WFIA 4D81A 4ARZB 1NZDA 4Y8VA 3WG9A 3MTAA 1HL3A 1ZVVA 3EF3A 3DFZA 3WGOA 1ACJA 3QJYA 3PPVA 3QPVA 5K2OA 1YIDA 4NU6A 4P0TA 3BERA 2R8XA 4A0SA 4C0AC 3O4JA 3FA2A 1TLFA 1IB0A 2BEKA 3DDOA 3GP5A 4TLBA 3B1FA 4BNLA 4MGIR 6LDHA 4FZJA 1Y1QA 1AKNA 5HQ3A 1J24A 2XGMA 3O0DA 3CW2A 1H9BA 3MJSA 3EC2A 1VIAA 2HSDA 1X15A 2DMRA 3CZCA 3T9AA 1TDJA 4H0FA 4ZYLA 2PMWB 5BYKA 2FUG6 2QPTA 2VTDA 3VMMA 2WPDA 3ZDBA 4A73A 5JCOC 1RKQA 1X7XB 4MB6A 3G17A 4BEBA 5JZOA 1A7JA 1Q17A 4LMPA 3MCVA 4MLCA 1F7VA 3LQ4A 1BDMA 1DCMA 4D92A 1I4OA 3O83A 2FDRA 4E5VA 5B57C 5C1OA 4E09A 1R0ZA 1S8OA 5B3JC 1DG3A 1VE7A 4OUDA 2RGRA 4AJEA 1ZWKA 3GLGB 2GAIA 3UNXA 2RB5A 3E3LA 4PCVA 4YLGA 3R8CA 1E5QA 3BILA 4FX5A 5ECWA 4HKTA 4MUFA 4PO8A 2HNAA 1ES9A 3ZUGA 4G9GA 3KPYA 5JZSA 1XD2B 1UEXC 1C7RA 1ZK2A 3DLIA 5FBQB 1KEEA 1EQAA 1ZM4A 3N2KB 1UBRS 2WSSD 1B8PA 2RH5A 4DQDA 5JH7A 1KYQA 1N2EA 1XX6A 5D85A 2J41A 4O8CA 1ZH2A 2NUTB 2ZRBA 2QJOA 3U2QA 3GJXC 1TQ6A 4H0NA 1YZGA 4XWGA 3QE4A 3KQMA 1XQWA 2ZTUA 3PV0A 4FNGA 4NYJQ 4EF5A 2O8DA 1LUAA 2ODTX 1NKVA 2ZQ5A 4KQMA 4QELA 3TUJC 3OCXA 4EA6A 4LBVA 1GZ5A 2AGVA