3LYSA

Crystal structure of the n-terminal domain of the prophage pi2 protein 01 (integrase) from lactococcus lactis, northeast structural genomics consortium target kr124f
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
PIKQEISEYFKDWMELYKKNAIDEMTYKGYEQTLKYLKTYMPNVLISEITASSYQRALNKFAETHAKASTKGFHTRVRASIQCLIEEGRLQKDFTTRAVVKGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prophage pi2 protein 01, integrase
publication title Northeast Structural Genomics Consortium Target KR124F
rcsb
source organism Lactococcus lactis
molecule tags Recombination
total genus 33
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3lysA00
2KJ9A 1OUQA 2KEYA 1F44A 2A3VA 2CRXA 1A0PA 1PVPA 3CRXA 1MA7A 2HOIA 4ACOA 1XNSA 3C28A 2KIWA 2OXOA 3LYSA 2KD1A 1Z19A 1Z1BA 1CRXA 3MGVA 1XO0A 1NZBA 2KJ5A 1P7DA 2KOBA 1PVQA 3NRWA 1Q3UA 5CRXA 2HOFA 3C29A 2KKVA 1DRGA 1Q3VA 2KHVA 2KKPA 4CRXA 2KHQA 2KJ8A 4A8EA 1PVRA 1KBUA
chains in the Genus database with same CATH superfamily
1OXJA 3EWAA 5J29A 2C2RA 3JPTA 5AKGA 1BPBA 3IV6A 9ICFA 2FPMA 1SV0A 4MFCA 3G6XA 4FO6A 5ALGA 1BPZA 1XSLA 3PMLA 4NV0A 3TQ1A 3Q8RB 5ALLA 4Y2XA 2Y0SF 3ETLA 5KFSA 4M9NA 1P7DA 3NRZA 3WK4A 4QIWF 4DQSA 1SWWA 4F4KA 4CDGA 3EPGA 9ICKA 3C2KA 5DG8A 4QZAA 2FMQA 4Y2YA 2J6TA 1S76D 2KIVA 1ZQWA 1K1SA 1UHUA 5J0QA 5KTQA 5ALTA 3UMCA 3I28A 1Z1BA 1NJXA 3Q8SB 4MF2A 2YQEA 3PV8A 4P2HA 5DDMA 5AKJA 5KFIA 1N61A 3IN5A 5DBBA 4DFJA 1SKSA 4M0AA 5EE1A 4PZNA 1N60A 3H0MB 4DL2A 1SV0C 5L1LA 1S5LU 3V72A 4DLEA 1KN5A 1ZQZA 2JEFA 3C28A 2JEJA 2P6RA 4YMMA 1XWLA 4DQRA 1ZQRA 2KVSA 2MAXA 4PZOA 2NRWA 4BXOA 3AU6A 3NS1A 4UB2A 5HR7A 1WWUA 4YR3A 4MEXA 2J6SA 3WKAA 4ED2A 1UT8A 3ED5A 1IV8A 1BNPA 2FMPA 5J0RA 1XO0A 4DF4A 2JZBB 4KLJA 2CN1A 1A77A 3WK7A 5KFKA 1B0XA 4CCHA 2KJ8A 1TK5A 3C1YA 3EW9A 4DL5A 2MUTB 2R8JA 1KBUA 8ICMA 1ZQYA 3GIKA 5F9NA 3QU9A 4DSJA 2OH2A 4KLEA 4R66A 3RB6A 1Q8KA 5E79U 5ALQA 1KFSA 3AEVA 5KG6A 4RQ0A 2G08A 2D6FC 4ELUA 2E8NA 3BS5B 2O6KA 2KSOB 3UMGA 9ICIA 3SR6A 4I2BA 3ISBA 1IIPA 4ECVA 2BR0A 1N48A 7ICMA 2OM6A 2KV2A 3TKAA 5ALWA 4UB5A 2BGWA 2CRXA 1VDVA 3UQ2A 4Y2JA 3L4PA 1K1QA 2WF5A 5HMLA 1HUZA 3MDAA 7ICKA 3RH6A 3FAHA 2ALZA 1GO3F 4OCZA 5TZVA 1BNOA 4FZMA 3GV7B 4PPXA 4HYKA 1ZOLA 1ZQQA 3Q8MA 1KRPA 2EZYA 1KLNA 4F5QA 3MABA 2F8LA 2LPEA 3HPOA 4TUQA 3KHLA 1MQ3A 5HNKA 8ICYA 4BWMA 5KL8B 2NRVA 1KKXA 1J2MA 2HCFA 5G5HA 1RXVA 1ZQVA 1WCLA 2W7OA 9ICQA 5J2HA 2J6UA 2RP5A 4EZ6A 5KG2A 3C5GA 2E3TA 8ICJA 4GFJA 3GQCA 3TARA 5ALEA 3B0YA 4QZDA 2YMMA 1QCKA 4F72A 3HRDD 3QU4A 3OTQA 5ALRA 3UPQA 2BCUA 2HVHA 2FLNA 1NZBA 2W9AA 3M9NB 4RQNA 1L7NA 2K4EA 3NVZA 3WK8A 1NKCA 2YB4A 4KLSA 2W11A 3N7RC 5KFBA 2DUYA 7ICTA 4DS5A 1X6JA 3VCBA 1OUQA 1T8EA 1NNLA 1COOA 4BWJA 1L7OA 1PVPA 5KFHA 5KFMA 1MQ2A 2R18A 2GWSA 4ED0A 1N2XA 5IILA 2MSNA 2HHXA 4I29A 8ICTA 3BZKA 5AKZA 1UA0A 3K4GA 8ICIA 2MUTA 4F5NA 5G5GA 2JV3A 5AI8A 1S8OA 4RQ8A 5KAIU 2ZTEA 1VJ5A 3HP6A 1F44A 9ICLA 4IQVA 5H2FU 2R8IA 2BDPA 7ICSA 5AKLA 4KMUA 4F4ZA 2QB0B 1ZYQA 4ED7A 1JX4A 2XY5A 4IRKA 2ES6A 1Q3UA 2P6UA 4LZGA 2HDOA 1NKBA 2I9GA 4I2GA 4O9MA 3GILA 4C80A 4IQWA 4QWBA 5D46A 3JPQA 3TAPA 2F44A 2DF4B 2W03A 3LWMA 4J9OA 5D4BA 2KG5A 4NL9A 2A19A 4QW9A 4QWAA 2C2DA 3K1RB 2I6XA 5KFJA 3V7KA 4M47A 3JPOA 1MSWD 2VIXA 2E1EA 4DFPA 4USAA 2HHQA 5F3XB 3V7LA 2E8OA 8ICEA 3FDSA 5KG1A 4XUSA 3PSTA 4DQPA 1LKYB 2PFQA 4QZHA 5CHGA 3WKBA 1RYSA 2LYBA 4KLOA 5F9LA 3RJIA 3TANA 2H3VA 2BCRA 3D2NA 2RDJA 3PW5A 3GDXA 4UB3A 1SKRA 4ZH4A 4Z6FA 4AP9A 3V7JA 4RU9A 1UA1A 1FFUA 2PI5A 1PVRA 1ZJNA 3SV3A 1C20A 5AKEA 1BPYA 4C4TA 5KFCA 4UB8U 4PJ0U 4JB3A 3LDAA 3QU2A 2FI1A 3N7PD 2V4RA 2KE7A 5KNIA 3PW2A 4P0QB 3PW4A 1B22A 4DSIA 2ZIUB 1QLNA 4QWCA 4O5CA 2GOLA 2Y0SC 4NL9C 2KN7A 4YD2A 4M6WB 5KFZA 3AU2A 2HHTA 2LMRA 2IBKA 1L3TA 5AHXA 2Y1JA 1U49A 1XU4A 5KT3A 2B0CA 1SV4A 2YMLA 5B66U 3M8RA 4JV1A 4C0ZA 4CE6A 4ECQA 2HBKA 3D2QA 1ZQDA 4UAWA 5J2KA 3F53A 4QZ9A 3KTQA 3QXGA 3IP4B 1BGXT 4J9QA 5KG4A 1D9FA 1S77D 4CF3A 5J8YA 4Q8EA 2R8GA 4GIBA 2OXOA 1T4GA 3MGVA 4DSLA 2K8CB 4JWNA 4DLGA 3HKZF 3QE9Y 1TKDA 3PX6A 5KT6A 3Q8QB 2ISOA 4F4YA 4JMUA 5AM3A 4B9SA 5GTHU 4Z6CA 2NO5A 1S10A 1H38A 1JALA 2VA8A 2WB1C 8ICRA 1XNSA 3O0FA 2VA2A 1ZQLA 3E58A 4UB4A 2XIDA 2W55A 4OJPA 4BX9C 2Y9UA 5J2JA 3QZ8A 1T3NA 3E2EA 5AK4A 2E1FA 4KN4A 1LKYA 1ZD5A 4M9JA 2I1QA 1NZPA 2RQ5A 3RB4A 1YT3A 1SXEA 1KFDA 1S9FA 3PX4A 2ASJA 1RPLA 3UQ0A 2XY7A 2KOBA 5K4LA 4XRHA 2LYHA 2AQ4A 2BPGA 3HT3A 3GU3A 2W54A 5J8YC 2VA3A 2W3SA 1S0OA 4FS1A 1T94A 4Z6DA 4ACOA 3CP8A 4P0QA 1NK8A 1F0MA 2ZUDA 2ZIWB 5ALNA 3GZFA 4QZFA 2KHVA 4M6WA 4KN7A 3ORYA 5ALXA 4B9UA 2XICA 4Q43A 3CW2C 3RJEA 4EZ9A 7ICLA 3KFUF 4F71A 2AHOB 3VC8A 4F2RA 4MEYA 1TFRA 3WK6A 2DKZA 3R9KA 5ALIA 2F1IA 3MC1A 2ZJ5A 2HOFA 2HI0A 5CEHA 1RQNA 3NVYA 5J2DA 3IDWA 2W9MA 2ZJ8A 4YCXA 4BXOB 5ALVA 3LK9A 5EWEA 1ZD4A 4FZNA 2NYVA 2RHFA 3PR5B 1X9XA 1PK3A 4P4OA 3GV8B 4PL1A 4UAVA 1L3VA 3RF9A 1PVQA 1MN8A 2YB1A 4KLFA 3M7DA 4TUSA 4RT2A 2KKPA 1ZQKA 3M9MB 2R8KA 1D9DA 4DL3A 2G5HB 2KFNA 5HHHA 9ICOA 4DWIA 4KLDA 4RPZA 5BOMA 3RTVA 7ICJA 3KKAC 4EX7A 3M9OB 1SZHA 3UMBA 5J2AA 1KTQA 3LYSA 2C28A 1QTMA 4FBTA 2HVIA 4XQ8A 4DL4A 3KBBA 5DB8A 5KFEA 5L9XA 2EZXA 3F2DA 5DQIA 1CUKA 3UXOA 4J9NA 1COKA 4B9MA 4MFAA 4DFKA 1KDHA 1TAMA 9ICMA 2F1JA 2IMWP 4FE3A 3SZ2A 3T5JA 4NLNA 3ZDBA 2W8KA 4QWEA 5DG7A 4IQTA 5AM5A 3T5HA 1O08A 1QQ6A 2VJ5A 1DRGA 3MR2A 4UAUA 1U48A 5AIAA 4UBBA 5ALFA 4YQWA 1ZQIA 5ALSA 3ICXA 4YR0A 2H3IA 2QKQA 5J0UA 2JGAA 2ZIWA 3PSIA 3GIIA 2ESEA 1QSLA 5KFYA 5ALPA 3BQTA 4JK1A 4O3PA 4KLQA 1OW5A 1ZQEA 1XO1A 4A8EA 2HBLA 4UAZA 1SXDA 4Q8FA 5CWRA 2BDUA 5J0WA 3H8WA 3SENA 4F93B 1N56A 2JH7A 4IRCA 4IQUA 3GFKB 5AI5A 2WB1F 4JV2A 8ICXA 3SQIA 1K5OA 3BQ0A 5AM2A 1JXLA 1JMSA 4RPXA 1XSPA 4EX6A 4I2EA 4I2AA 3RR7A 2HOIA 2OEHA 1N62A 2JXJA 5C0YA 5IINA 3RB3A 2HOQA 2JMGA 1DK3A 4C8KA 4JUZA 4UB1A 3B9JA 4KITB 1SGGA 2EAPA 4GLXA 7ICEA 5AK6A 2BPCA 5L1MA 2G0AA 5DLFA 4OD0A 2AGQA 4OJLA 1KFTA 2ZJAA 4FFDA 4NM2A 2AU0A 4ECZA 1X6IA 3C29A 3SI8A 4O5KA 2I5HA 4LJXA 1ED1A 3Q8KA 2UVWA 4R65A 8ICFA 2PKEA 3IG8A 1CI4A 2A3VA 3AN1A 3QU5A 2K4HA 4DSFA 2ISPA 1NJZA 1V9PA 3KOOA 2NRXA 2B21A 1L3UA 4IR9A 2KZMA 3C1ZA 4KLHA 4J9LA 4UQGA 1HUOA 1SWVA 1ZQJA 3M1YA 1X40A 2ZIXA 5AI0A 2WFAA 9ICRA 3HKZC 9ICGA 2QARB 2DFLA 4EBCA 1JRPA 1HIWA 5HP4A 5ALHA 5J0XA 8ICGA 2EQYA 2MRLA 7ICRA 3SMVA 4B9NA 3T5LA 5EE9A 4YN4A 4NLKA 4US8A 2K4IA 2OHFA 3U26A 1CEZA 1JN3A 5AKKA 5J2GA 4CF4A 2KEYA 5KFUA 3H0RB 4KLIA 1X9SA 2A1JA 3QEAZ 1Z19A 2AH5A 4XA5A 4P4PA 2HSZA 2EANA 3OHAA 1AQ6A 2CPRA 2ODGA 1ZQAA 5B5EU 3SAFA 5ALKA 4J9KA 5ALJA 4U6PA 3KHGA 9ICTA 5DQHA 2OYYA 3ZDAA 1NKEA 4DSKA 3ZD9A 2ZG6A 2BCQA 4PGQA 2DBYA 4M04A 2MU2A 4J9MA 5J2BA 2LHTA 5C5JA 2E8PA 1L7MA 1Z1VA 4F3OA 2YX8A 5KFPA 4TQRA 1FFVA 3N28A 3F5EA 1TV9A 3RAQA 4I27A 5GTIU 2KNJA 3G6VA 5DG9A 1KW4A 3QUCA 2LM4A 2DGZA 1L8LA 3OJUA 1S0NA 4O3QA 1Y88A 4E0DA 2BQUA 1KEJA 4PH5A 4LVSA 4AYBF 3DDHA 2YY6A 4DOAA 2F8KA 1YZ6A 1JUDA 2ZXHA 3TI0A 3OHBA 1ZQOA 5KFRA 1KL9A 5HMMA 5IIJA 1Z4NA 2ATLA 3MR3A 4G9BA 2UVUA 2FLPA 3RJGA 2L5YA 5CP2A 4F50A 3TACB 1TAQA 4O3RA 2QARA 4IRDA 2OWOA 4P4MA 1S97A 7ICGA 5CA7A 4GXIA 5BOLA 3PX0A 4C7YA 4NM1A 5DGBA 3JPPA 2IOFA 1ZQUA 4Q44A 1ZJMA 1ZQFA 1D8YA 2WF6A 5DLGA 4RQ5A 3PY8A 4RQ2A 4DL7A 1RZTA 2EAOA 1NK7A 2E5SA 2H3FA 5FP0A 1N5XA 2JR5A 5ALDA 3HWTA 1NI3A 2WF9A 1NK0A 2VJ4A 5IIOA 1IG6A 4NXZA 1N63A 4WJ3B 5DB7A 1U45A 1J97A 4F92B 3GV5B 2DPJA 2XCPA 4YVZA 2WTFA 2EAMA 5J2IA 4PHEA 2HHVA 2QB1A 3IG5A 4C8OA 2BQRA 1ZQMA 1DK2A 5KL1B 3RB0A 4DFDA 1Z3EB 4Y2UA 3MFIA 1A6SA 2XC9A 1TK0A 5EE3A 5KT5A 5AM0A 3PR4A 3PVXA 2GH1A 2W7PA 2OCEA 3EUB2 3LVVA 1DGJA 3Q8PB 2DKXA 9ICAA 3CRXA 1IXRA 2F77X 1L8OA 4J9PA 4KLTA 2YMQA 1ZD3A 3UM9A 3D6JA 1ZQNA 4QZBA 4J9SA 3IHQB 1X9MA 4KTQA 1QSYA 3SD7A 4F4WA 3H0LB 8ICZA 1BPEA 1F5SA 1WUDA 2HHWA 5AK3A 5IIIA 4F5RA 2E8MA 2KJ9A 1WYGA 2KTQA 2W3RA 5J2CA 2A1AA 1ZQSA 3C5FA 3ETRA 1KQQA 3DEEA 5JTIA 1FIQA 3F2BA 3BQ2A 5AK5A 3RRHA 1L3SA 3RJHA 3V6HA 2XGPA 2D8CA 3OGUA 1T3QA 4O3SA 2F2AB 3PSFA 3V6KA 3BJYA 4IC9A 2BPFA 4EBDA 2LM1A 3IM1A 3BQ7A 4NY8A 2AGPA 1LVHA 1T7PA 2BKEA 1RYUA 1WG8A 2FDRA 4EBEA 3PSPA 5JU5A 5J2FA 5KG5A 4ECYA 5DB6A 2V4QA 2BCVA 7ICQA 1VLBA 3QZ7A 1QH9A 1BPDA 4PGYA 8ICPA 3KD3A 2W04A 2DWQA 2KP7A 5EOZA 4M2YA 5AM1A 4B9VA 4EEYA 3WKEA 1SL2A 3GIMA 5CB1A 3ISDA 8ICCA 1U9LA 2DQNB 1FO4A 4RNOA 4EEKA 1U4BA 4I2FA 4RQMA 1PUZA 2H3QA 2FPLA 2IHMA 4Y2RA 3GIJA 4CGZA 2JRZA 3RH5A 2K60A 3KHRA 4UATA 7ICHA 1Z4OA 4Z6EA 2FMSA 1ZQXA 2KJ5A 2WHEA 3QUQA 3EZ5A 4RQ1A 1QQ5A 4DEZA 3JPRA 4ELTA 5EWFA 4B9LA 5AI9A 4DCCA 4KLUA 5DBCA 4DQQA 2F1HA 4C7ZA 4C4SA 1DXSA 3B0XA 1UCVA 4R8UA 4ED8A 4DFMA 2BZFA 3L3FX 3RRGA 5CRXA 4DO9A 2P66A 4NJ8A 2G07A 3OPXA 1SKWA 2XY6A 4UARA 4UB6U 2NRZA 3BQ1A 2PI4A 4YG2A 2G06A 2AXTU 2QLTA 3CYMA 3QX7A 1YZ7A 2EH9A 4M9HA 4TQSA 5JUMA 4I2JA 4Y2VA 4Y2QA 4FBUA 1RG6A 1EXNA 3FC4A 4MFFA 3AQEA 2JEIA 2Z7JA 3E0FA 5TISU 5AKXA 5CR0A 1ZQ1C 5DB9A 1JROA 1SL1A 5KFWA 1L6NA 5ALUA 3TFSA 1ZXIA 4OJ5A 4PHPA 4O0IA 4F91B 4ECTA 3HILA 5A0LA 3BDPA 3QNMA 3RH4A 4JV0A 5IIMA 1V85A 1NJWA 4KLLA 2WAQC 1S0VA 5IIKA 3S6JA 2P35A 3F5AA 1UPHA 2ZIXB 3LWLA 3NVVA 2KD1A 2RDIA 2H5XA 2XCAA 1BVSA 3QU7A 2K89A 3MR5A 9ICVA 3WU2U 4AYBC 5KFVA 3DV9A 2XI9A 2F3NA 4BUGA 2DPIA 2YTUA 2PXIA 2IOHA 1XSNA 2K8AA 4RQ7A 3AQFA 3LVWA 2PFOA 1V38A 4RNNA 4YMOA 1ZQHA 1SB3C 5KG0A 9ICJA 2A1JB 4NLBA 4EYHB 4KLGA 2XVTA 4M9GA 2ZXIA 1Z00A 4DOBA 4QZCA 1N5WA 3T5KA 3PO4A 4PHAA 4ZOHC 3TFRA 4YP3A 4RPYA 5DDYA 1DGSA 2HBJA 4LZDA 3HW8A 4C8MA 3RBDA 3PMNA 4DS4A 1Q46A 1MC8A 2ZIVB 5KFAA 5HR6A 1XC9A 3ZI4A 2Y9TA 4Y2SA 4I28A 7ICPA 1NK6A 1ECWA 3JPNA 4QWDA 3N4MB 3QUTA 4EELA 5EWGA 2H3ZA 3AM9A 1D8LA 4C8NA 1X2IA 3RFAA 9ICSA 2VANA 5KFFA 1NJYA 2KVCA 2KZZA 4QZ8A 9ICNA 2PMZC 5DQGA 4RQ3A 1U47A 3H40A 4Y2PA 4QNLA 4UW9A 3ALRA 5KG7A 3A0HU 2FPKA 4C4RA 7ICUA 3MDCA 5DGAA 2AJQA 1HJPA 1ZRMA 3K75D 4YFKA 2M9NA 4Q45A 5AM4A 1QSSA 1JIHA 3AMZA 2Y1IA 4HAIA 2LKYA 3RJFA 4UASA 3PW0A 3K1ZA 1RM6C 2FLLA 5KFXA 4YXMA 1X66A 2EDUA 5J0YA 1TE2A 1RYRA 2IHNA 4O3MA 2LI6A 3H8SA 4RUCA 1NK4A 9ICHA 3PW7A 5JRTA 2W9CB 5KT4A 4ELVA 3Q8LA 4DF8A 3RR8A 5D49A 5J0TA 3ONNA 4Y2TA 4F5OA 1B43A 2YN4A 3NRWA 1UQVA 2W43A 4GXKA 8ICVA 2GO7A 2KHQA 1X42A 4GC6A 4IR1A 3IRUA 3HJEA 2C22A 5L1KA 4RQ6A 4KLMA 3L5KA 5KFNA 1C7YA 3M6ZA 5AICA 2VKQA 1L7PA 3H4BA 4F5PA 2RRDA 4O5EA 3EPIA 1O03A 4I2IA 3I1YA 4RUAA 3AUOA 2IA6A 1SIJA 2FE9A 5AKIA 4F8RA 4NLGA 3MGIA 2ZTCA 1QQ7A 4RNMA 4ECXA 8ICNA 3NTUA 8ICLA 7ICIA 4QJFB 3NUQA 2HMXA 4RQ4A 2ZUCA 4BDPA 7ICVA 4B9TA 4KX3A 4P0PB 1PK1B 2ZIVA 3N97B 2Q4TA 3D2SA 1S0MA 1PZNA 3RJJA 4CRXA 2LYAA 4FS2A 4OJOA 4M9LA 4QW8A 1X9WA 3BZCA 2F76X 1JXEA 4C8LA 2JZBA 2KICA 9ICXA 1CRXA 1FEZA 2WAQF 4DSEA 3TADA 1ZQGA 1XS9D 4IS7A 3C2LA 4K4HA 4ECSA 4FZLA 2ZUBA 2HW3A 4EENA 3T3FA 3BS5A 2KSOA 2IOFK 2HBMA 5AKYA 4F2SA 4I2HA 9ICEA 4J03A 4YD1A 2W9CA 2KFZA 3SV4A 4J9RA 4ICAA 5DKWA 1TVAA 5KFGA 3UXPA 2XGQA 2HHUA 4US9A 1A0PA 4QZEA 1ZRNA 4PGXA 3PNCA 5T14A 1ZD2P 5KAFU 2W9BB 3ZD8A 5L1IA 1UT5A 3M8SA 2AGOA 2KZ3A 2Q0ZX 3PO5A 3WK5A 3F2CA 8ICKA 3MBYA 2G09A 3KZIU 4OJ6A 3G6YA 4MF8A 4BJQA 4DL6A 8ICHA 2JH1A 3C21A 8ICSA 1ZQPA 2WF7A 3TADC 4ECUA 2CXYA 4TUPA 3C2MA 4K4IA 4RT3A 4EYIB 5ALMA 1RQLA 3H7IA 8ICOA 5J0SA 2UVVA 1LB2B 1RXWA 5AI6A 2LBOA 2PFPA 2BHNA 5KFLA 3MGHA 1WWVA 1SZPA 4B6JA 5KFOA 2ASLA 4P0PA 2PMZF 1PK1A 3BS7A 1ZQCA 8ICBA 5L1JA 2W8LA 5J0OA 2WF8A 5HHIA 3PZPA 4O3NA 1KSPA 3QYPA 1IM4A 2FJ6A 1DOQA 2NV3A 2XO7A 5DBAA 4UAYA 4R63A 3H8JA 3SEIA 4TURA 3ZDEA 4QIWC 3HX0A 2M0NA 2G5IB 3NVWA 1LV5A 4DQIA 1TAUA 5KG3A 5J0PA 7ICNA 1TK8A 2DL0A 5BPCA 8ICUA 4R8UB 3KZXA 5CJ7A 1A76A 2K4PA 4MHVA 2KMDA 3H8MA 3ISCA 3J81j 7ICOA 3RAXA 1M6YA 1NK9A 2BCSA 4RZRA 3MR6A 2QB0A 9ICWA 4JWMA 3OSNA 4K4GA 5KT7A 2AQ0A 4O3OA 4ED6A 1NOMA 3UXNA 7ICFA 3AL0B 3QUBA 1Q3VA 1V97A 9ICBA 2YMPA 2V9WA 2EZZA 4X5VA 1L5UA 4QZGA 3CNHA 2MA1A 4UBCA 2W9BA 5KFDA 2D3DA 2K8BB 4U7CA 4ECWA 5KT2A 3SYZA 4OO1J 2KKVA 8ICWA 2N1RA 2NO4A 2HHSA 1NK5A 1AROP 3OJSA 9ICUA 9ICCA 8ICAA 4R64A 1BPXA 3QEBZ 4YMNA 9ICPA 2NRTA 4CNQA 4GC7A 2UVRA 3SAHA 1URJA 3JPSA 1J2NA 4BGDA 2R8HA 1ZQTA 3OSPA 3C23A 5ALYA 5AIBA 1HEKA 3FM9A 2JEGA 4PHDA 4NWIA 2C2EA 3NASA 4GXJA 4ED3A 4KMOB 3SAGA 2ZIUA 5ALZA 1WCNA 4YR2A 3NGDA 3KKAA 2GLEA 4CF5A 5KFTA 5AKHA 1B4FA 2ASDA 1SL0A 3RJKA 4YXJA 3FYHA 4ED1A 4ECRA 1Z00B 3TAQA 1D8BA 1MA7A 4NLCA 3WKDA 5J2EA 4IL6U 3I76A 3V6JA 4NLZA 2KK0A 3H4DA 4KX5A 3ZDDA 3N7SC 3T79A 1ZQBA 1RDFA 2JHDA 3MFHA 5AI4A 3EYZA 2ZTDA 1JI7A 5EE0A 3KHHA 3RBEA 4DOCA 4I2CA 3THVA 4PL2A 3WK9A 5ALOA 2B6GA 3M6KA 2KIWA 4I2DA 2RLTA 3ZDCA 8ICQA 5KFQA 2PFNA 4G3IA 1ZETA 4F4XA 2BQ3A 3A0BU 3WKCA 4QZIA
chains in the Genus database with same CATH topology
4AYBF 2W7PA 2ZIXA 4GFJA 2WAQC 2WB1C 3LVVA 2BDUA 4CGZA 3HKZC 4P0PA 2ZXHA 2F76X 4FZNA 3F5AA 2PMZF 1UPHA 3CRXA 2RHFA 2KICA 2F77X 2ZIXB 1XNSA 1HIWA 2LYBA 3O0FA 2KD1A 1CRXA 2JH7A 2LKYA 1XO0A 1NZBA 4PL1A 2KJ5A 2K89A 2WAQF 2H3VA 2WB1F 3RF9A 3SAHA 3K1ZA 3PZPA 1PVQA 2K4EA 3SQIA 2YB1A 1URJA 4AYBC 2MRLA 2CN1A 3SMVA 3H0LB 3D2NA 2XI9A 2XIDA 2YB4A 4OJPA 3M7DA 1WUDA 4BUGA 4BX9C 2KKPA 2K4IA 4NV0A 3N7RC 2KJ8A 2NV3A 2E1FA 1HEKA 2G5HB 4O3MA 1PVRA 2K8AA 1KBUA 2KJ9A 3VCBA 1OUQA 3AQFA 2KEYA 3LVWA 3H0RB 4NWIA 4FZLA 4QIWC 2OH2A 2Y0SF 1PVPA 2HOIA 1YT3A 1SZHA 2M0NA 3ALRA 3N7PD 2G5IB 3DEEA 3LYSA 2R18A 2ZIUA 3ONNA 4KMOB 3SAGA 1Z19A 3F2BA 5C0YA 2G08A 4P0QB 3L3FX 2D6FC 2HOQA 1P7DA 2KOBA 5CRXA 2JMGA 3NRWA 4NLBA 2CPRA 4QIWF 2ZIUB 3GU3A 2HBMA 3F2DA 3SAFA 3KZXA 2G07A 2GOLA 3OPXA 4CDGA 2XVTA 2KHQA 2Y0SC 2ZXIA 2F2AB 3PSFA 4U6PA 1IIPA 4ICAA 2G06A 2G0AA 1F44A 2OM6A 4IC9A 2E5SA 2H3FA 2KV2A 3M6ZA 1T94A 2CRXA 1D8BA 2OYYA 3CYMA 1TAMA 1A0PA 2VKQA 4OJLA 1MA7A 4ACOA 3CP8A 2HBJA 4P0QA 2RRDA 4NLCA 4FE3A 2ZG6A 1Z1BA 2VJ4A 3PSPA 2ZIWB 5T14A 2LHTA 1Q3UA 1GO3F 4KX5A 3AL0B 3GZFA 4WJ3B 3N7SC 2VJ5A 2ZIVB 4C0ZA 4FZMA 3C29A 3T79A 1DRGA 1Q3VA 5HR6A 2HBKA 3D2QA 1ED1A 2KHVA 3AQEA 3F2CA 3IN5A 2G09A 2JHDA 3F53A 2Z7JA 2YX8A 3E0FA 4OJ6A 4QJFB 2XICA 3IP4B 4BJQA 3F5EA 3NUQA 2JH1A 2HMXA 3IG8A 3H0MB 1ECWA 2A3VA 1ZQ1C 2F8LA 2W04A 3KFUF 3ICXA 3IG5A 4PL2A 3VC8A 2H3IA 2H3ZA 2DF4B 2W03A 3C28A 1L6NA 2JGAA 2KIWA 2KNJA 2MA1A 2OXOA 2ZIWA 3M6KA 3PSIA 4KX3A 5KL1B 4P0PB 3MGVA 2K4HA 2K8CB 4OJ5A 2ZIVA 3RFAA 5KL8B 2DGZA 2Q4TA 3HKZF 2K8BB 4U7CA 3D2SA 1A6SA 4OO1J 2DQNB 2HOFA 2KVCA 2KKVA 2VIXA 2E1EA 4JMUA 2N1RA 2PMZC 5A0LA 2W7OA 4CRXA 2LBOA 4A8EA 2H3QA 2HBLA 2RP5A 2LYAA 4QNLA 4OJOA 2GH1A 3PSTA 5HR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJ9 A;  1OUQ A;  2KEY A;  1F44 A;  2A3V A;  2CRX A;  1A0P A;  1PVP A;  3CRX A;  1MA7 A;  2HOI A;  4ACO A;  1XNS A;  3C28 A;  2KIW A;  2OXO A;  3LYS A;  2KD1 A;  1Z19 A;  1Z1B A;  1CRX A;  3MGV A;  1XO0 A;  1NZB A;  2KJ5 A;  1P7D A;  2KOB A;  1PVQ A;  3NRW A;  1Q3U A;  5CRX A;  2HOF A;  3C29 A;  2KKV A;  1DRG A;  1Q3V A;  2KHV A;  2KKP A;  4CRX A;  2KHQ A;  2KJ8 A;  4A8E A;  1PVR A;  1KBU A; 
#chains in the Genus database with same CATH topology
 1OXJ A;  3EWA A;  5J29 A;  2C2R A;  3JPT A;  5AKG A;  1BPB A;  3IV6 A;  9ICF A;  2FPM A;  1SV0 A;  4MFC A;  3G6X A;  4FO6 A;  5ALG A;  1BPZ A;  1XSL A;  3PML A;  4NV0 A;  3TQ1 A;  3Q8R B;  5ALL A;  4Y2X A;  2Y0S F;  3ETL A;  5KFS A;  4M9N A;  1P7D A;  3NRZ A;  3WK4 A;  4QIW F;  4DQS A;  1SWW A;  4F4K A;  4CDG A;  3EPG A;  9ICK A;  3C2K A;  5DG8 A;  4QZA A;  2FMQ A;  4Y2Y A;  2J6T A;  1S76 D;  2KIV A;  1ZQW A;  1K1S A;  1UHU A;  5J0Q A;  5KTQ A;  5ALT A;  3UMC A;  3I28 A;  1Z1B A;  1NJX A;  3Q8S B;  4MF2 A;  2YQE A;  3PV8 A;  4P2H A;  5DDM A;  5AKJ A;  5KFI A;  1N61 A;  3IN5 A;  5DBB A;  4DFJ A;  1SKS A;  4M0A A;  5EE1 A;  4PZN A;  1N60 A;  3H0M B;  4DL2 A;  1SV0 C;  5L1L A;  1S5L U;  3V72 A;  4DLE A;  1KN5 A;  1ZQZ A;  2JEF A;  3C28 A;  2JEJ A;  2P6R A;  4YMM A;  1XWL A;  4DQR A;  1ZQR A;  2KVS A;  2MAX A;  4PZO A;  2NRW A;  4BXO A;  3AU6 A;  3NS1 A;  4UB2 A;  5HR7 A;  1WWU A;  4YR3 A;  4MEX A;  2J6S A;  3WKA A;  4ED2 A;  1UT8 A;  3ED5 A;  1IV8 A;  1BNP A;  2FMP A;  5J0R A;  1XO0 A;  4DF4 A;  2JZB B;  4KLJ A;  2CN1 A;  1A77 A;  3WK7 A;  5KFK A;  1B0X A;  4CCH A;  2KJ8 A;  1TK5 A;  3C1Y A;  3EW9 A;  4DL5 A;  2MUT B;  2R8J A;  1KBU A;  8ICM A;  1ZQY A;  3GIK A;  5F9N A;  3QU9 A;  4DSJ A;  2OH2 A;  4KLE A;  4R66 A;  3RB6 A;  1Q8K A;  5E79 U;  5ALQ A;  1KFS A;  3AEV A;  5KG6 A;  4RQ0 A;  2G08 A;  2D6F C;  4ELU A;  2E8N A;  3BS5 B;  2O6K A;  2KSO B;  3UMG A;  9ICI A;  3SR6 A;  4I2B A;  3ISB A;  1IIP A;  4ECV A;  2BR0 A;  1N48 A;  7ICM A;  2OM6 A;  2KV2 A;  3TKA A;  5ALW A;  4UB5 A;  2BGW A;  2CRX A;  1VDV A;  3UQ2 A;  4Y2J A;  3L4P A;  1K1Q A;  2WF5 A;  5HML A;  1HUZ A;  3MDA A;  7ICK A;  3RH6 A;  3FAH A;  2ALZ A;  1GO3 F;  4OCZ A;  5TZV A;  1BNO A;  4FZM A;  3GV7 B;  4PPX A;  4HYK A;  1ZOL A;  1ZQQ A;  3Q8M A;  1KRP A;  2EZY A;  1KLN A;  4F5Q A;  3MAB A;  2F8L A;  2LPE A;  3HPO A;  4TUQ A;  3KHL A;  1MQ3 A;  5HNK A;  8ICY A;  4BWM A;  5KL8 B;  2NRV A;  1KKX A;  1J2M A;  2HCF A;  5G5H A;  1RXV A;  1ZQV A;  1WCL A;  2W7O A;  9ICQ A;  5J2H A;  2J6U A;  2RP5 A;  4EZ6 A;  5KG2 A;  3C5G A;  2E3T A;  8ICJ A;  4GFJ A;  3GQC A;  3TAR A;  5ALE A;  3B0Y A;  4QZD A;  2YMM A;  1QCK A;  4F72 A;  3HRD D;  3QU4 A;  3OTQ A;  5ALR A;  3UPQ A;  2BCU A;  2HVH A;  2FLN A;  1NZB A;  2W9A A;  3M9N B;  4RQN A;  1L7N A;  2K4E A;  3NVZ A;  3WK8 A;  1NKC A;  2YB4 A;  4KLS A;  2W11 A;  3N7R C;  5KFB A;  2DUY A;  7ICT A;  4DS5 A;  1X6J A;  3VCB A;  1OUQ A;  1T8E A;  1NNL A;  1COO A;  4BWJ A;  1L7O A;  1PVP A;  5KFH A;  5KFM A;  1MQ2 A;  2R18 A;  2GWS A;  4ED0 A;  1N2X A;  5IIL A;  2MSN A;  2HHX A;  4I29 A;  8ICT A;  3BZK A;  5AKZ A;  1UA0 A;  3K4G A;  8ICI A;  2MUT A;  4F5N A;  5G5G A;  2JV3 A;  5AI8 A;  1S8O A;  4RQ8 A;  5KAI U;  2ZTE A;  1VJ5 A;  3HP6 A;  1F44 A;  9ICL A;  4IQV A;  5H2F U;  2R8I A;  2BDP A;  7ICS A;  5AKL A;  4KMU A;  4F4Z A;  2QB0 B;  1ZYQ A;  4ED7 A;  1JX4 A;  2XY5 A;  4IRK A;  2ES6 A;  1Q3U A;  2P6U A;  4LZG A;  2HDO A;  1NKB A;  2I9G A;  4I2G A;  4O9M A;  3GIL A;  4C80 A;  4IQW A;  4QWB A;  5D46 A;  3JPQ A;  3TAP A;  2F44 A;  2DF4 B;  2W03 A;  3LWM A;  4J9O A;  5D4B A;  2KG5 A;  4NL9 A;  2A19 A;  4QW9 A;  4QWA A;  2C2D A;  3K1R B;  2I6X A;  5KFJ A;  3V7K A;  4M47 A;  3JPO A;  1MSW D;  2VIX A;  2E1E A;  4DFP A;  4USA A;  2HHQ A;  5F3X B;  3V7L A;  2E8O A;  8ICE A;  3FDS A;  5KG1 A;  4XUS A;  3PST A;  4DQP A;  1LKY B;  2PFQ A;  4QZH A;  5CHG A;  3WKB A;  1RYS A;  2LYB A;  4KLO A;  5F9L A;  3RJI A;  3TAN A;  2H3V A;  2BCR A;  3D2N A;  2RDJ A;  3PW5 A;  3GDX A;  4UB3 A;  1SKR A;  4ZH4 A;  4Z6F A;  4AP9 A;  3V7J A;  4RU9 A;  1UA1 A;  1FFU A;  2PI5 A;  1PVR A;  1ZJN A;  3SV3 A;  1C20 A;  5AKE A;  1BPY A;  4C4T A;  5KFC A;  4UB8 U;  4PJ0 U;  4JB3 A;  3LDA A;  3QU2 A;  2FI1 A;  3N7P D;  2V4R A;  2KE7 A;  5KNI A;  3PW2 A;  4P0Q B;  3PW4 A;  1B22 A;  4DSI A;  2ZIU B;  1QLN A;  4QWC A;  4O5C A;  2GOL A;  2Y0S C;  4NL9 C;  2KN7 A;  4YD2 A;  4M6W B;  5KFZ A;  3AU2 A;  2HHT A;  2LMR A;  2IBK A;  1L3T A;  5AHX A;  2Y1J A;  1U49 A;  1XU4 A;  5KT3 A;  2B0C A;  1SV4 A;  2YML A;  5B66 U;  3M8R A;  4JV1 A;  4C0Z A;  4CE6 A;  4ECQ A;  2HBK A;  3D2Q A;  1ZQD A;  4UAW A;  5J2K A;  3F53 A;  4QZ9 A;  3KTQ A;  3QXG A;  3IP4 B;  1BGX T;  4J9Q A;  5KG4 A;  1D9F A;  1S77 D;  4CF3 A;  5J8Y A;  4Q8E A;  2R8G A;  4GIB A;  2OXO A;  1T4G A;  3MGV A;  4DSL A;  2K8C B;  4JWN A;  4DLG A;  3HKZ F;  3QE9 Y;  1TKD A;  3PX6 A;  5KT6 A;  3Q8Q B;  2ISO A;  4F4Y A;  4JMU A;  5AM3 A;  4B9S A;  5GTH U;  4Z6C A;  2NO5 A;  1S10 A;  1H38 A;  1JAL A;  2VA8 A;  2WB1 C;  8ICR A;  1XNS A;  3O0F A;  2VA2 A;  1ZQL A;  3E58 A;  4UB4 A;  2XID A;  2W55 A;  4OJP A;  4BX9 C;  2Y9U A;  5J2J A;  3QZ8 A;  1T3N A;  3E2E A;  5AK4 A;  2E1F A;  4KN4 A;  1LKY A;  1ZD5 A;  4M9J A;  2I1Q A;  1NZP A;  2RQ5 A;  3RB4 A;  1YT3 A;  1SXE A;  1KFD A;  1S9F A;  3PX4 A;  2ASJ A;  1RPL A;  3UQ0 A;  2XY7 A;  2KOB A;  5K4L A;  4XRH A;  2LYH A;  2AQ4 A;  2BPG A;  3HT3 A;  3GU3 A;  2W54 A;  5J8Y C;  2VA3 A;  2W3S A;  1S0O A;  4FS1 A;  1T94 A;  4Z6D A;  4ACO A;  3CP8 A;  4P0Q A;  1NK8 A;  1F0M A;  2ZUD A;  2ZIW B;  5ALN A;  3GZF A;  4QZF A;  2KHV A;  4M6W A;  4KN7 A;  3ORY A;  5ALX A;  4B9U A;  2XIC A;  4Q43 A;  3CW2 C;  3RJE A;  4EZ9 A;  7ICL A;  3KFU F;  4F71 A;  2AHO B;  3VC8 A;  4F2R A;  4MEY A;  1TFR A;  3WK6 A;  2DKZ A;  3R9K A;  5ALI A;  2F1I A;  3MC1 A;  2ZJ5 A;  2HOF A;  2HI0 A;  5CEH A;  1RQN A;  3NVY A;  5J2D A;  3IDW A;  2W9M A;  2ZJ8 A;  4YCX A;  4BXO B;  5ALV A;  3LK9 A;  5EWE A;  1ZD4 A;  4FZN A;  2NYV A;  2RHF A;  3PR5 B;  1X9X A;  1PK3 A;  4P4O A;  3GV8 B;  4PL1 A;  4UAV A;  1L3V A;  3RF9 A;  1PVQ A;  1MN8 A;  2YB1 A;  4KLF A;  3M7D A;  4TUS A;  4RT2 A;  2KKP A;  1ZQK A;  3M9M B;  2R8K A;  1D9D A;  4DL3 A;  2G5H B;  2KFN A;  5HHH A;  9ICO A;  4DWI A;  4KLD A;  4RPZ A;  5BOM A;  3RTV A;  7ICJ A;  3KKA C;  4EX7 A;  3M9O B;  1SZH A;  3UMB A;  5J2A A;  1KTQ A;  3LYS A;  2C28 A;  1QTM A;  4FBT A;  2HVI A;  4XQ8 A;  4DL4 A;  3KBB A;  5DB8 A;  5KFE A;  5L9X A;  2EZX A;  3F2D A;  5DQI A;  1CUK A;  3UXO A;  4J9N A;  1COK A;  4B9M A;  4MFA A;  4DFK A;  1KDH A;  1TAM A;  9ICM A;  2F1J A;  2IMW P;  4FE3 A;  3SZ2 A;  3T5J A;  4NLN A;  3ZDB A;  2W8K A;  4QWE A;  5DG7 A;  4IQT A;  5AM5 A;  3T5H A;  1O08 A;  1QQ6 A;  2VJ5 A;  1DRG A;  3MR2 A;  4UAU A;  1U48 A;  5AIA A;  4UBB A;  5ALF A;  4YQW A;  1ZQI A;  5ALS A;  3ICX A;  4YR0 A;  2H3I A;  2QKQ A;  5J0U A;  2JGA A;  2ZIW A;  3PSI A;  3GII A;  2ESE A;  1QSL A;  5KFY A;  5ALP A;  3BQT A;  4JK1 A;  4O3P A;  4KLQ A;  1OW5 A;  1ZQE A;  1XO1 A;  4A8E A;  2HBL A;  4UAZ A;  1SXD A;  4Q8F A;  5CWR A;  2BDU A;  5J0W A;  3H8W A;  3SEN A;  4F93 B;  1N56 A;  2JH7 A;  4IRC A;  4IQU A;  3GFK B;  5AI5 A;  2WB1 F;  4JV2 A;  8ICX A;  3SQI A;  1K5O A;  3BQ0 A;  5AM2 A;  1JXL A;  1JMS A;  4RPX A;  1XSP A;  4EX6 A;  4I2E A;  4I2A A;  3RR7 A;  2HOI A;  2OEH A;  1N62 A;  2JXJ A;  5C0Y A;  5IIN A;  3RB3 A;  2HOQ A;  2JMG A;  1DK3 A;  4C8K A;  4JUZ A;  4UB1 A;  3B9J A;  4KIT B;  1SGG A;  2EAP A;  4GLX A;  7ICE A;  5AK6 A;  2BPC A;  5L1M A;  2G0A A;  5DLF A;  4OD0 A;  2AGQ A;  4OJL A;  1KFT A;  2ZJA A;  4FFD A;  4NM2 A;  2AU0 A;  4ECZ A;  1X6I A;  3C29 A;  3SI8 A;  4O5K A;  2I5H A;  4LJX A;  1ED1 A;  3Q8K A;  2UVW A;  4R65 A;  8ICF A;  2PKE A;  3IG8 A;  1CI4 A;  2A3V A;  3AN1 A;  3QU5 A;  2K4H A;  4DSF A;  2ISP A;  1NJZ A;  1V9P A;  3KOO A;  2NRX A;  2B21 A;  1L3U A;  4IR9 A;  2KZM A;  3C1Z A;  4KLH A;  4J9L A;  4UQG A;  1HUO A;  1SWV A;  1ZQJ A;  3M1Y A;  1X40 A;  2ZIX A;  5AI0 A;  2WFA A;  9ICR A;  3HKZ C;  9ICG A;  2QAR B;  2DFL A;  4EBC A;  1JRP A;  1HIW A;  5HP4 A;  5ALH A;  5J0X A;  8ICG A;  2EQY A;  2MRL A;  7ICR A;  3SMV A;  4B9N A;  3T5L A;  5EE9 A;  4YN4 A;  4NLK A;  4US8 A;  2K4I A;  2OHF A;  3U26 A;  1CEZ A;  1JN3 A;  5AKK A;  5J2G A;  4CF4 A;  2KEY A;  5KFU A;  3H0R B;  4KLI A;  1X9S A;  2A1J A;  3QEA Z;  1Z19 A;  2AH5 A;  4XA5 A;  4P4P A;  2HSZ A;  2EAN A;  3OHA A;  1AQ6 A;  2CPR A;  2ODG A;  1ZQA A;  5B5E U;  3SAF A;  5ALK A;  4J9K A;  5ALJ A;  4U6P A;  3KHG A;  9ICT A;  5DQH A;  2OYY A;  3ZDA A;  1NKE A;  4DSK A;  3ZD9 A;  2ZG6 A;  2BCQ A;  4PGQ A;  2DBY A;  4M04 A;  2MU2 A;  4J9M A;  5J2B A;  2LHT A;  5C5J A;  2E8P A;  1L7M A;  1Z1V A;  4F3O A;  2YX8 A;  5KFP A;  4TQR A;  1FFV A;  3N28 A;  3F5E A;  1TV9 A;  3RAQ A;  4I27 A;  5GTI U;  2KNJ A;  3G6V A;  5DG9 A;  1KW4 A;  3QUC A;  2LM4 A;  2DGZ A;  1L8L A;  3OJU A;  1S0N A;  4O3Q A;  1Y88 A;  4E0D A;  2BQU A;  1KEJ A;  4PH5 A;  4LVS A;  4AYB F;  3DDH A;  2YY6 A;  4DOA A;  2F8K A;  1YZ6 A;  1JUD A;  2ZXH A;  3TI0 A;  3OHB A;  1ZQO A;  5KFR A;  1KL9 A;  5HMM A;  5IIJ A;  1Z4N A;  2ATL A;  3MR3 A;  4G9B A;  2UVU A;  2FLP A;  3RJG A;  2L5Y A;  5CP2 A;  4F50 A;  3TAC B;  1TAQ A;  4O3R A;  2QAR A;  4IRD A;  2OWO A;  4P4M A;  1S97 A;  7ICG A;  5CA7 A;  4GXI A;  5BOL A;  3PX0 A;  4C7Y A;  4NM1 A;  5DGB A;  3JPP A;  2IOF A;  1ZQU A;  4Q44 A;  1ZJM A;  1ZQF A;  1D8Y A;  2WF6 A;  5DLG A;  4RQ5 A;  3PY8 A;  4RQ2 A;  4DL7 A;  1RZT A;  2EAO A;  1NK7 A;  2E5S A;  2H3F A;  5FP0 A;  1N5X A;  2JR5 A;  5ALD A;  3HWT A;  1NI3 A;  2WF9 A;  1NK0 A;  2VJ4 A;  5IIO A;  1IG6 A;  4NXZ A;  1N63 A;  4WJ3 B;  5DB7 A;  1U45 A;  1J97 A;  4F92 B;  3GV5 B;  2DPJ A;  2XCP A;  4YVZ A;  2WTF A;  2EAM A;  5J2I A;  4PHE A;  2HHV A;  2QB1 A;  3IG5 A;  4C8O A;  2BQR A;  1ZQM A;  1DK2 A;  5KL1 B;  3RB0 A;  4DFD A;  1Z3E B;  4Y2U A;  3MFI A;  1A6S A;  2XC9 A;  1TK0 A;  5EE3 A;  5KT5 A;  5AM0 A;  3PR4 A;  3PVX A;  2GH1 A;  2W7P A;  2OCE A;  3EUB 2;  3LVV A;  1DGJ A;  3Q8P B;  2DKX A;  9ICA A;  3CRX A;  1IXR A;  2F77 X;  1L8O A;  4J9P A;  4KLT A;  2YMQ A;  1ZD3 A;  3UM9 A;  3D6J A;  1ZQN A;  4QZB A;  4J9S A;  3IHQ B;  1X9M A;  4KTQ A;  1QSY A;  3SD7 A;  4F4W A;  3H0L B;  8ICZ A;  1BPE A;  1F5S A;  1WUD A;  2HHW A;  5AK3 A;  5III A;  4F5R A;  2E8M A;  2KJ9 A;  1WYG A;  2KTQ A;  2W3R A;  5J2C A;  2A1A A;  1ZQS A;  3C5F A;  3ETR A;  1KQQ A;  3DEE A;  5JTI A;  1FIQ A;  3F2B A;  3BQ2 A;  5AK5 A;  3RRH A;  1L3S A;  3RJH A;  3V6H A;  2XGP A;  2D8C A;  3OGU A;  1T3Q A;  4O3S A;  2F2A B;  3PSF A;  3V6K A;  3BJY A;  4IC9 A;  2BPF A;  4EBD A;  2LM1 A;  3IM1 A;  3BQ7 A;  4NY8 A;  2AGP A;  1LVH A;  1T7P A;  2BKE A;  1RYU A;  1WG8 A;  2FDR A;  4EBE A;  3PSP A;  5JU5 A;  5J2F A;  5KG5 A;  4ECY A;  5DB6 A;  2V4Q A;  2BCV A;  7ICQ A;  1VLB A;  3QZ7 A;  1QH9 A;  1BPD A;  4PGY A;  8ICP A;  3KD3 A;  2W04 A;  2DWQ A;  2KP7 A;  5EOZ A;  4M2Y A;  5AM1 A;  4B9V A;  4EEY A;  3WKE A;  1SL2 A;  3GIM A;  5CB1 A;  3ISD A;  8ICC A;  1U9L A;  2DQN B;  1FO4 A;  4RNO A;  4EEK A;  1U4B A;  4I2F A;  4RQM A;  1PUZ A;  2H3Q A;  2FPL A;  2IHM A;  4Y2R A;  3GIJ A;  4CGZ A;  2JRZ A;  3RH5 A;  2K60 A;  3KHR A;  4UAT A;  7ICH A;  1Z4O A;  4Z6E A;  2FMS A;  1ZQX A;  2KJ5 A;  2WHE A;  3QUQ A;  3EZ5 A;  4RQ1 A;  1QQ5 A;  4DEZ A;  3JPR A;  4ELT A;  5EWF A;  4B9L A;  5AI9 A;  4DCC A;  4KLU A;  5DBC A;  4DQQ A;  2F1H A;  4C7Z A;  4C4S A;  1DXS A;  3B0X A;  1UCV A;  4R8U A;  4ED8 A;  4DFM A;  2BZF A;  3L3F X;  3RRG A;  5CRX A;  4DO9 A;  2P66 A;  4NJ8 A;  2G07 A;  3OPX A;  1SKW A;  2XY6 A;  4UAR A;  4UB6 U;  2NRZ A;  3BQ1 A;  2PI4 A;  4YG2 A;  2G06 A;  2AXT U;  2QLT A;  3CYM A;  3QX7 A;  1YZ7 A;  2EH9 A;  4M9H A;  4TQS A;  5JUM A;  4I2J A;  4Y2V A;  4Y2Q A;  4FBU A;  1RG6 A;  1EXN A;  3FC4 A;  4MFF A;  3AQE A;  2JEI A;  2Z7J A;  3E0F A;  5TIS U;  5AKX A;  5CR0 A;  1ZQ1 C;  5DB9 A;  1JRO A;  1SL1 A;  5KFW A;  1L6N A;  5ALU A;  3TFS A;  1ZXI A;  4OJ5 A;  4PHP A;  4O0I A;  4F91 B;  4ECT A;  3HIL A;  5A0L A;  3BDP A;  3QNM A;  3RH4 A;  4JV0 A;  5IIM A;  1V85 A;  1NJW A;  4KLL A;  2WAQ C;  1S0V A;  5IIK A;  3S6J A;  2P35 A;  3F5A A;  1UPH A;  2ZIX B;  3LWL A;  3NVV A;  2KD1 A;  2RDI A;  2H5X A;  2XCA A;  1BVS A;  3QU7 A;  2K89 A;  3MR5 A;  9ICV A;  3WU2 U;  4AYB C;  5KFV A;  3DV9 A;  2XI9 A;  2F3N A;  4BUG A;  2DPI A;  2YTU A;  2PXI A;  2IOH A;  1XSN A;  2K8A A;  4RQ7 A;  3AQF A;  3LVW A;  2PFO A;  1V38 A;  4RNN A;  4YMO A;  1ZQH A;  1SB3 C;  5KG0 A;  9ICJ A;  2A1J B;  4NLB A;  4EYH B;  4KLG A;  2XVT A;  4M9G A;  2ZXI A;  1Z00 A;  4DOB A;  4QZC A;  1N5W A;  3T5K A;  3PO4 A;  4PHA A;  4ZOH C;  3TFR A;  4YP3 A;  4RPY A;  5DDY A;  1DGS A;  2HBJ A;  4LZD A;  3HW8 A;  4C8M A;  3RBD A;  3PMN A;  4DS4 A;  1Q46 A;  1MC8 A;  2ZIV B;  5KFA A;  5HR6 A;  1XC9 A;  3ZI4 A;  2Y9T A;  4Y2S A;  4I28 A;  7ICP A;  1NK6 A;  1ECW A;  3JPN A;  4QWD A;  3N4M B;  3QUT A;  4EEL A;  5EWG A;  2H3Z A;  3AM9 A;  1D8L A;  4C8N A;  1X2I A;  3RFA A;  9ICS A;  2VAN A;  5KFF A;  1NJY A;  2KVC A;  2KZZ A;  4QZ8 A;  9ICN A;  2PMZ C;  5DQG A;  4RQ3 A;  1U47 A;  3H40 A;  4Y2P A;  4QNL A;  4UW9 A;  3ALR A;  5KG7 A;  3A0H U;  2FPK A;  4C4R A;  7ICU A;  3MDC A;  5DGA A;  2AJQ A;  1HJP A;  1ZRM A;  3K75 D;  4YFK A;  2M9N A;  4Q45 A;  5AM4 A;  1QSS A;  1JIH A;  3AMZ A;  2Y1I A;  4HAI A;  2LKY A;  3RJF A;  4UAS A;  3PW0 A;  3K1Z A;  1RM6 C;  2FLL A;  5KFX A;  4YXM A;  1X66 A;  2EDU A;  5J0Y A;  1TE2 A;  1RYR A;  2IHN A;  4O3M A;  2LI6 A;  3H8S A;  4RUC A;  1NK4 A;  9ICH A;  3PW7 A;  5JRT A;  2W9C B;  5KT4 A;  4ELV A;  3Q8L A;  4DF8 A;  3RR8 A;  5D49 A;  5J0T A;  3ONN A;  4Y2T A;  4F5O A;  1B43 A;  2YN4 A;  3NRW A;  1UQV A;  2W43 A;  4GXK A;  8ICV A;  2GO7 A;  2KHQ A;  1X42 A;  4GC6 A;  4IR1 A;  3IRU A;  3HJE A;  2C22 A;  5L1K A;  4RQ6 A;  4KLM A;  3L5K A;  5KFN A;  1C7Y A;  3M6Z A;  5AIC A;  2VKQ A;  1L7P A;  3H4B A;  4F5P A;  2RRD A;  4O5E A;  3EPI A;  1O03 A;  4I2I A;  3I1Y A;  4RUA A;  3AUO A;  2IA6 A;  1SIJ A;  2FE9 A;  5AKI A;  4F8R A;  4NLG A;  3MGI A;  2ZTC A;  1QQ7 A;  4RNM A;  4ECX A;  8ICN A;  3NTU A;  8ICL A;  7ICI A;  4QJF B;  3NUQ A;  2HMX A;  4RQ4 A;  2ZUC A;  4BDP A;  7ICV A;  4B9T A;  4KX3 A;  4P0P B;  1PK1 B;  2ZIV A;  3N97 B;  2Q4T A;  3D2S A;  1S0M A;  1PZN A;  3RJJ A;  4CRX A;  2LYA A;  4FS2 A;  4OJO A;  4M9L A;  4QW8 A;  1X9W A;  3BZC A;  2F76 X;  1JXE A;  4C8L A;  2JZB A;  2KIC A;  9ICX A;  1CRX A;  1FEZ A;  2WAQ F;  4DSE A;  3TAD A;  1ZQG A;  1XS9 D;  4IS7 A;  3C2L A;  4K4H A;  4ECS A;  4FZL A;  2ZUB A;  2HW3 A;  4EEN A;  3T3F A;  3BS5 A;  2KSO A;  2IOF K;  2HBM A;  5AKY A;  4F2S A;  4I2H A;  9ICE A;  4J03 A;  4YD1 A;  2W9C A;  2KFZ A;  3SV4 A;  4J9R A;  4ICA A;  5DKW A;  1TVA A;  5KFG A;  3UXP A;  2XGQ A;  2HHU A;  4US9 A;  1A0P A;  4QZE A;  1ZRN A;  4PGX A;  3PNC A;  5T14 A;  1ZD2 P;  5KAF U;  2W9B B;  3ZD8 A;  5L1I A;  1UT5 A;  3M8S A;  2AGO A;  2KZ3 A;  2Q0Z X;  3PO5 A;  3WK5 A;  3F2C A;  8ICK A;  3MBY A;  2G09 A;  3KZI U;  4OJ6 A;  3G6Y A;  4MF8 A;  4BJQ A;  4DL6 A;  8ICH A;  2JH1 A;  3C21 A;  8ICS A;  1ZQP A;  2WF7 A;  3TAD C;  4ECU A;  2CXY A;  4TUP A;  3C2M A;  4K4I A;  4RT3 A;  4EYI B;  5ALM A;  1RQL A;  3H7I A;  8ICO A;  5J0S A;  2UVV A;  1LB2 B;  1RXW A;  5AI6 A;  2LBO A;  2PFP A;  2BHN A;  5KFL A;  3MGH A;  1WWV A;  1SZP A;  4B6J A;  5KFO A;  2ASL A;  4P0P A;  2PMZ F;  1PK1 A;  3BS7 A;  1ZQC A;  8ICB A;  5L1J A;  2W8L A;  5J0O A;  2WF8 A;  5HHI A;  3PZP A;  4O3N A;  1KSP A;  3QYP A;  1IM4 A;  2FJ6 A;  1DOQ A;  2NV3 A;  2XO7 A;  5DBA A;  4UAY A;  4R63 A;  3H8J A;  3SEI A;  4TUR A;  3ZDE A;  4QIW C;  3HX0 A;  2M0N A;  2G5I B;  3NVW A;  1LV5 A;  4DQI A;  1TAU A;  5KG3 A;  5J0P A;  7ICN A;  1TK8 A;  2DL0 A;  5BPC A;  8ICU A;  4R8U B;  3KZX A;  5CJ7 A;  1A76 A;  2K4P A;  4MHV A;  2KMD A;  3H8M A;  3ISC A;  3J81 j;  7ICO A;  3RAX A;  1M6Y A;  1NK9 A;  2BCS A;  4RZR A;  3MR6 A;  2QB0 A;  9ICW A;  4JWM A;  3OSN A;  4K4G A;  5KT7 A;  2AQ0 A;  4O3O A;  4ED6 A;  1NOM A;  3UXN A;  7ICF A;  3AL0 B;  3QUB A;  1Q3V A;  1V97 A;  9ICB A;  2YMP A;  2V9W A;  2EZZ A;  4X5V A;  1L5U A;  4QZG A;  3CNH A;  2MA1 A;  4UBC A;  2W9B A;  5KFD A;  2D3D A;  2K8B B;  4U7C A;  4ECW A;  5KT2 A;  3SYZ A;  4OO1 J;  2KKV A;  8ICW A;  2N1R A;  2NO4 A;  2HHS A;  1NK5 A;  1ARO P;  3OJS A;  9ICU A;  9ICC A;  8ICA A;  4R64 A;  1BPX A;  3QEB Z;  4YMN A;  9ICP A;  2NRT A;  4CNQ A;  4GC7 A;  2UVR A;  3SAH A;  1URJ A;  3JPS A;  1J2N A;  4BGD A;  2R8H A;  1ZQT A;  3OSP A;  3C23 A;  5ALY A;  5AIB A;  1HEK A;  3FM9 A;  2JEG A;  4PHD A;  4NWI A;  2C2E A;  3NAS A;  4GXJ A;  4ED3 A;  4KMO B;  3SAG A;  2ZIU A;  5ALZ A;  1WCN A;  4YR2 A;  3NGD A;  3KKA A;  2GLE A;  4CF5 A;  5KFT A;  5AKH A;  1B4F A;  2ASD A;  1SL0 A;  3RJK A;  4YXJ A;  3FYH A;  4ED1 A;  4ECR A;  1Z00 B;  3TAQ A;  1D8B A;  1MA7 A;  4NLC A;  3WKD A;  5J2E A;  4IL6 U;  3I76 A;  3V6J A;  4NLZ A;  2KK0 A;  3H4D A;  4KX5 A;  3ZDD A;  3N7S C;  3T79 A;  1ZQB A;  1RDF A;  2JHD A;  3MFH A;  5AI4 A;  3EYZ A;  2ZTD A;  1JI7 A;  5EE0 A;  3KHH A;  3RBE A;  4DOC A;  4I2C A;  3THV A;  4PL2 A;  3WK9 A;  5ALO A;  2B6G A;  3M6K A;  2KIW A;  4I2D A;  2RLT A;  3ZDC A;  8ICQ A;  5KFQ A;  2PFN A;  4G3I A;  1ZET A;  4F4X A;  2BQ3 A;  3A0B U;  3WKC A;  4QZI A; 
#chains in the Genus database with same CATH homology
 4AYB F;  2W7P A;  2ZIX A;  4GFJ A;  2WAQ C;  2WB1 C;  3LVV A;  2BDU A;  4CGZ A;  3HKZ C;  4P0P A;  2ZXH A;  2F76 X;  4FZN A;  3F5A A;  2PMZ F;  1UPH A;  3CRX A;  2RHF A;  2KIC A;  2F77 X;  2ZIX B;  1XNS A;  1HIW A;  2LYB A;  3O0F A;  2KD1 A;  1CRX A;  2JH7 A;  2LKY A;  1XO0 A;  1NZB A;  4PL1 A;  2KJ5 A;  2K89 A;  2WAQ F;  2H3V A;  2WB1 F;  3RF9 A;  3SAH A;  3K1Z A;  3PZP A;  1PVQ A;  2K4E A;  3SQI A;  2YB1 A;  1URJ A;  4AYB C;  2MRL A;  2CN1 A;  3SMV A;  3H0L B;  3D2N A;  2XI9 A;  2XID A;  2YB4 A;  4OJP A;  3M7D A;  1WUD A;  4BUG A;  4BX9 C;  2KKP A;  2K4I A;  4NV0 A;  3N7R C;  2KJ8 A;  2NV3 A;  2E1F A;  1HEK A;  2G5H B;  4O3M A;  1PVR A;  2K8A A;  1KBU A;  2KJ9 A;  3VCB A;  1OUQ A;  3AQF A;  2KEY A;  3LVW A;  3H0R B;  4NWI A;  4FZL A;  4QIW C;  2OH2 A;  2Y0S F;  1PVP A;  2HOI A;  1YT3 A;  1SZH A;  2M0N A;  3ALR A;  3N7P D;  2G5I B;  3DEE A;  3LYS A;  2R18 A;  2ZIU A;  3ONN A;  4KMO B;  3SAG A;  1Z19 A;  3F2B A;  5C0Y A;  2G08 A;  4P0Q B;  3L3F X;  2D6F C;  2HOQ A;  1P7D A;  2KOB A;  5CRX A;  2JMG A;  3NRW A;  4NLB A;  2CPR A;  4QIW F;  2ZIU B;  3GU3 A;  2HBM A;  3F2D A;  3SAF A;  3KZX A;  2G07 A;  2GOL A;  3OPX A;  4CDG A;  2XVT A;  2KHQ A;  2Y0S C;  2ZXI A;  2F2A B;  3PSF A;  4U6P A;  1IIP A;  4ICA A;  2G06 A;  2G0A A;  1F44 A;  2OM6 A;  4IC9 A;  2E5S A;  2H3F A;  2KV2 A;  3M6Z A;  1T94 A;  2CRX A;  1D8B A;  2OYY A;  3CYM A;  1TAM A;  1A0P A;  2VKQ A;  4OJL A;  1MA7 A;  4ACO A;  3CP8 A;  2HBJ A;  4P0Q A;  2RRD A;  4NLC A;  4FE3 A;  2ZG6 A;  1Z1B A;  2VJ4 A;  3PSP A;  2ZIW B;  5T14 A;  2LHT A;  1Q3U A;  1GO3 F;  4KX5 A;  3AL0 B;  3GZF A;  4WJ3 B;  3N7S C;  2VJ5 A;  2ZIV B;  4C0Z A;  4FZM A;  3C29 A;  3T79 A;  1DRG A;  1Q3V A;  5HR6 A;  2HBK A;  3D2Q A;  1ED1 A;  2KHV A;  3AQE A;  3F2C A;  3IN5 A;  2G09 A;  2JHD A;  3F53 A;  2Z7J A;  2YX8 A;  3E0F A;  4OJ6 A;  4QJF B;  2XIC A;  3IP4 B;  4BJQ A;  3F5E A;  3NUQ A;  2JH1 A;  2HMX A;  3IG8 A;  3H0M B;  1ECW A;  2A3V A;  1ZQ1 C;  2F8L A;  2W04 A;  3KFU F;  3ICX A;  3IG5 A;  4PL2 A;  3VC8 A;  2H3I A;  2H3Z A;  2DF4 B;  2W03 A;  3C28 A;  1L6N A;  2JGA A;  2KIW A;  2KNJ A;  2MA1 A;  2OXO A;  2ZIW A;  3M6K A;  3PSI A;  4KX3 A;  5KL1 B;  4P0P B;  3MGV A;  2K4H A;  2K8C B;  4OJ5 A;  2ZIV A;  3RFA A;  5KL8 B;  2DGZ A;  2Q4T A;  3HKZ F;  2K8B B;  4U7C A;  3D2S A;  1A6S A;  4OO1 J;  2DQN B;  2HOF A;  2KVC A;  2KKV A;  2VIX A;  2E1E A;  4JMU A;  2N1R A;  2PMZ C;  5A0L A;  2W7O A;  4CRX A;  2LBO A;  4A8E A;  2H3Q A;  2HBL A;  2RP5 A;  2LYA A;  4QNL A;  4OJO A;  2GH1 A;  3PST A;  5HR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...