3LYXA

Crystal structure of the pas domain of the protein cps_1291 from colwellia psychrerythraea. northeast structural genomics consortium target id csr222b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
b'DILKQRAKAFDYVFDAIVVTDLQGFIIDWNKGSETLYGYSKEQAIGQPVNMLHVPGDTEHITSEVISAVENQGKWTGEIRMLHKDGHIGWIESMCVPIYGENYQMVGALGINRDITKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensory box/GGDEF domain protein
publication title Crystal structure of the PAS domain of the protein CPS_1291 from Colwellia psychrerythraea. Northeast Structural Genomics Consortium target id CsR222B
rcsb
source organism Colwellia psychrerythraea
molecule tags Transcription
total genus 33
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3lyxA00
4WL9A 4GHIA 5HDSA 3RTYA 4DJ3A 5J7EA 5F68A 3NOTC 2PDRA 4HHDA 5TBMB 4KUOA 4HOIA 4WN5A 2VV6A 2M1CA 4M4XA 3RH8B 5HWWA 4KQDA 2J80A 4MN5A 1OTBA 3UMEA 2V9AA 2V1BA 3F1OA 4GS9A 4EW7A 3FC7A 3LIFA 3PYPA 1TS6A 3IBRA 4HH3A 4LRXC 2VEAA 4WLAA 3UB8A 4NXGA 2WKRA 4HY8A 4HI4A 4R38A 1LSVA 3UB7A 5G4ZA 4HH2A 3E4PA 2PD8A 5HSQA 1UWNX 2JN7A 3F1NB 2L1MA 2VV8A 5HWVA 3IS2B 2I9VA 4F3LB 4E04A 2V0WA 2OWJA 3H7WB 2YKFA 4DJ2A 1XJ4A 1T1CA 2KX6A 2PYRA 2QWSA 4R3AA 3FG8A 5IS1A 3BWLA 1S1YA 4HNBA 1EW0A 4WF0A 1LSXA 2D01A 1ODVA 2Z6DA 2EA9A 4JGQA 1F9IA 5HDCA 2H28A 3BY9A 1OJ5A 1G28A 3A0VA 3H9WA 4LRZE 5A8BA 3C8CA 5HZHA 4HJ4A 4LPZA 2A24B 4LLOB 1KOUA 3LI9A 4R70A 2L4RA 5DJTA 5F6AA 5EFWA 3ULFA 3LICA 2V0UA 3SW1A 1D7EA 4EEUA 2K7SA 4I38A 3D72A 4I5SA 3H82B 3MXQA 1T1BA 1BYWA 3F1PA 1OT9A 1TS7A 3CLOA 4H6JB 3LIEA 4YWZA 4JGOA 1XJ3A 3ICYA 3VE4A 2OWHA 4NXFA 1V9ZA 5DKLA 3MFXA 3CWFA 4B9OA 3H7WA 2ZOIA 5J4EA 2R78A 1OTEA 4HJ3A 3E4OA 5AVEA 3NHQA 2ZBBA 4EESA 4XT2A 1MZUA 1LSWA 1TS8A 1XFQA 3P7NA 2GJ3A 3T50A 3MJQA 3MQOA 5J3WA 3EEHA 4HP9A 1VB6A 4L9FA 1N9LA 4LRYC 1GSVA 1XJ6A 3UE6A 4K08A 3UB9A 2KDKA 1Y28A 5TBMA 2VLGA 2QHKA 4L9GA 5HD3A 2L0WA 3F1OB 5KIZA 5AVFA 2V1AA 1JNUA 3LIBA 4HP4A 3LI8A 3PHYA 3K3CA 3UB6A 2PR5A 1D06A 3NOUC 5G4YA 1OTDA 4I3JA 5HDDA 2VV7A 4I3IA 3HJKA 4KUKA 1N9NA 4I39A 3GECA 4GCZA 1UWPX 5F69A 1XFNA 1UGUA 4EQ1A 2PD7A 2W27A 3A0SA 1S67L 5DJUA 3G6OA 5HD5A 4JGRA 2JHEA 2P7JA 4WUJA 1P0ZA 2QJ5A 2INWA 3LUQA 4HJ6A 3F1NA 1S66L 3IS2A 4F3LA 4L9EA 3NJAA 5I5LA 3K3DA 3VOLA 1S4RA 2WKQA 4HQAA 1TS0A 2BASA 3LIDA 1N9OA 2D02A 2YKHA 4GHIB 4GW9A 3BY8A 1T18A 1X0OA 1GSWA 4PKYG 1XJ2A 3LIAA 3CAXA 5F5YA 3ZQ5A 3LYXA 5IU1A 4MN6A 5DKKA 2PHYA 3E4QA 4BBVA 1DP8A 4EERA 2W0NA 1DP6A 2PYPA 1DP9A 3VE3A 3OLOA 4EEPA 4BBTA 1OJGA 4PKYA 1OTAA 2A24A 1LL8A 3F1PB 1WA9A 1OT6A 1OTIA 4GS9B 1F98A 3MQQA 2HV1A 2OOLA 4JGPA 4R6LA 3H82A 2B02A 1GSXA 4BBUA 1S4SA 3MR0A 4NXBA 4H6JA 3UMDA 4HIAA 2ZOHA 3A0RA 2CMNA 4EXOA 1S1ZA 1LT0A 1T19A 2QJ7A 2PR6A 3GDIA 3KX0X 4XT2B 4I3AA 3C2WA 3EWKA 2WKPA 4NXEA 3NOPC 3HJIA 1NWZA 3B33A 4EETB 1DRMA 2QKPA 2Z6CA 1P97A 5HWTA 4RQ9A 1T1AA 1V9YA
chains in the Genus database with same CATH superfamily
5HL1A 1H3QA 4DJ3A 3E0YA 1MC0A 3IHAA 4OLDA 3HCYA 3NOTC 4HHDA 3IXHA 4WELA 1YMSA 2Q9MA 3D9YA 1W8YA 3C7UA 1K0KA 4KZ7A 4S2KA 3BJNA 3GVBA 4M4XA 3UE1A 2J80A 2JBFA 3UDIA 5L09A 2V1BA 1KVMA 3ZG7B 3IHBA 2W1RA 1BLSA 4S2OA 1K6SA 2G2UA 4BENA 2WZXA 5FQJA 2HZ5A 3MZFA 3T1XA 1XKZA 3MQ0A 2WKRA 3ZGAB 2XDMA 2Y55A 1LSVA 1N9BA 1PWDA 4Y0TA 1DY6A 2XLNA 5CEDA 4WMCD 1STZA 2W3GA 4WYYA 4HH2A 1BT5A 4LCMA 3WS5A 1M6KA 3QNBA 1LLBA 1XXMA 2WK0A 2ZD8A 5EE8A 3M2JA 4E3KA 2NUTC 3IF6B 5HX9A 3F1NB 2J9OA 3T1RA 5HWVA 2VJWA 4F3LB 2V0WA 3MBZA 2R9WA 3OCLA 2QWSA 5EM1A 4R3AA 4UAAA 2ZL1A 5KSHA 3MKEA 4OPYA 3IWOA 1MWSA 3GSGA 3NY4A 1SKOB 4FD8A 4HNBA 3V5MA 2J3TD 5EVIA 1K54A 5FL3A 4UQIM 1J3WA 1ODVA 2EX2A 1E4DA 3C4PA 2V2FF 1F9IA 4CLCA 1W79A 2FH5A 1GHIA 3AGEA 5HPFA 1ES2A 3C7VA 2ZQ9A 1G28A 4N1XA 2X01A 3CUEA 3H9WA 5FQMA 4LRZE 3T12B 4E3LA 2B5RA 5A8BA 3TSGA 1ZG6A 2G2WA 3C8CA 4LLOB 4KG2A 3UPNA 1KOUA 5M18A 3LI9A 5A93A 5DJTA 3S7QA 5C5KA 2WKHA 4IHQA 4ZRRA 2XROA 2V0UA 3SOIA 5EVLA 2WGWB 2XA7S 1W63M 1NZOA 3F1PA 1OT9A 4N9KA 4NETA 3VOYA 3SZTA 1TS7A 3CLOA 1SDNA 1NYYA 4PM9A 4E3NA 1ES5A 3T4JA 5GLAA 5CGSA 3ICYA 5FI7A 3MFXA 3IQAA 2R78A 3VP4A 4PM8A 2OLUA 1MZUA 1Y4OA 2ZC3B 3T4TA 4PMAA 3DTEA 1ERMA 3AGDA 1XP4A 5TFQA 2W1TB 3O86A 2ZC7A 3GTCA 2HP5A 1GHMA 1KVLA 2W3FA 1VB6A 1E3UD 4L9FA 5FATA 1N9LA 1C3BA 4LRYC 3KYEA 2NUPC 4IJGA 4U0XA 3UE6A 1Y28A 3BW6A 5EVEA 2VLGA 5HD3A 3FZCA 3D3OA 2P74A 2WKIA 1FCNA 1L0GA 3ZYTA 1JNUA 1K56D 4JPMA 1PRQA 3LIBA 3BLMA 4Y0UA 3K3CA 4N92A 2PR5A 1ZHHB 1S6RA 5GLBA 3OPHA 3DTKA 3PBQA 4KZ3A 4ZAMA 5G4YA 1ALQA 3BFGA 2BLSA 1LI9A 4I3JA 4KUKA 4I39A 3WS4A 3SH7A 3G34A 1PW1A 1F2KA 1JWZA 2W27A 5IHVA 2J7VA 3A0SA 4ZTKA 5HD5A 1RP5A 2Y2PA 4JGRA 4KQQA 1FILA 1WE4A 5CX7A 2Y2MA 2ZMVA 3BEBA 4GN2A 1P0ZA 2QJ5A 2PT7A 2EX9A 4QY5A 3IF6A 3ZG8B 3N8LA 3F1NA 3E2LA 1YLWA 2PAVP 5HFOA 4F3LA 2XH9A 5I5LA 1NLYA 3SS4A 2ZC5B 2HJEA 3VOLA 3HL9A 2W3HA 3FWLA 2XA7M 3HLWA 3HLCA 3CHWP 2V8CA 1TS0A 3LEQA 1SKOA 4CPKA 3MZDA 5A91A 3ZHHA 1N9OA 4Z1WA 5JYPA 3NC8A 4C3QA 2YKHA 5F1GA 2B95A 4GW9A 1X0OA 4IVIA 4EUVA 2ZQDA 1XJ2A 4B4XA 2QZ6A 2AVXA 2HPBA 4BJPA 4P6ZM 3OOVA 4MN6A 1FQGA 4PPRA 4XUXA 1SKFA 2PHYA 4EBNA 1NZUA 3RJUA 1GA0A 1DP6A 5DVAA 3O88A 5FAQA 3VE3A 4BBTA 4PKYA 1OTAA 4Y2FA 2JCHA 1YSQA 4GDNA 1WA9A 1IOUA 4X1MA 3SH9A 1YPRA 1YSPA 3N8SA 4WEKA 4QY6A 1F98A 1BULA 2V8FA 2HV1A 2B02A 1Z09A 4O0PA 4DXBA 1D1JA 3CJMA 4UA9A 4QPRA 4ARZB 5HAQA 3A0RA 2CMNA 4UA7A 4EUZA 2P08A 1ESUA 1S1ZA 1T19A 2ZC4B 5FQ9A 3KX0X 4QD4A 1FSYA 4XT2B 5CGXA 2LB5A 1SZVA 1TDGA 3N4IA 3NOPC 3HJIA 2XF3A 4MBKA 3IX3A 3UE3A 3MXRA 3T4KA 4CQHA 4DXCA 2C5WB 2Z6CA 1QMEA 5HWTA 1T1AA 3BFDA 5FEFA 5FDSA 2MJ6A 1EI5A 1BTLA 2X71A 3HVFA 5CTNA 1L3LA 1VETA 1BUEA 4RX2A 5F68A 4QU3A 5CERA 5CECA 2OV5A 2W1TA 1ZTUA 4MDZA 5TBMB 5CGWA 2ZL1B 4KUOA 4S2NC 3HLFA 5DTTA 5FEGA 3JVUA 2VV6A 2M1CA 4Y7PA 5AJGA 1CQAA 3L9KA 3AGFA 3JPUA 2H0TA 1ZKJA 4FTXA 4E3JA 1PIOA 3VV4A 3IX8A 2O99A 4CLCB 3IT9A 5EVIC 4GS9A 5FQKA 4EW7A 1K54C 3FC7A 3KO6A 4CJNA 1MPLA 3LIFA 3PYPA 4N1HA 3C5AA 3ZVTA 3IBRA 4HH3A 1IYQA 4LRXC 3W4QA 2VEAA 2Y2HA 4WLAA 2WAFA 3UB8A 4NXGA 5GHXA 3V39A 1H8YA 2ZM0A 3S7OA 4HI4A 1LI0A 3CUEC 3MF0A 2EWWA 4MCWA 3UB7A 4R3BA 4DDSA 1TVFA 2BG1A 1XGJA 3B3XA 5GL9A 5HW3A 4DE1A 2PD8A 1ONHA 4RVAA 3IX4A 3UY6A 1M40A 3WWXA 3UDFA 3DW0A 4X1LA 4P6BA 4UQIS 4GOGA 3VMAA 1HD8A 2ZM2A 1VEUB 2PYRA 2XR0A 2Y2NA 2ZC6B 3FPWA 3P98A 4R4SA 3FKVA 4B4ZA 5U47A 1LSXA 1NRJA 1W8QA 4GD8A 2Z6DA 4PM7A 5BOHA 2B18A 4WBGA 4HBTA 2FFFB 1KGEA 3VOZA 3LFVA 5TGFA 1CF0A 4BLMA 1SDEA 3PBNA 4X69A 2WAEA 1JVJA 4EBLA 1W63Q 3LCEA 3MSHA 3C30A 2HJ9C 4MBHA 5HZHA 4LPZA 1IKIA 2A24B 1CEGA 1K25A 3TE8A 4FCFA 2L4RA 2P9VA 1EROA 4GNUA 4YINA 4L0LA 1D7EA 1ACFA 4EEUA 3BRMA 4RX3A 3W8KA 4Q8IA 4H6JB 3HUNA 4OQIA 3DAVA 4KZBA 1XJ3A 2M7UA 4NXFA 1GHPA 4C6YA 4E6XA 4KG6A 5E2EA 1MBLA 1OTEA 2ZLYA 4ARZA 2Y79A 4X6TA 4KZAA 2ZBBA 4EESA 4X55A 4XT2A 1JTGA 1MKIA 2Y59A 1XFQA 2WUQA 3P7NA 1K4FA 2ZMFA 3T50A 3KSHA 3MQOA 3LY3A 1KE4A 3QP2A 3IBJA 5G18A 3DWKA 4GD6A 4YFMA 1FCMA 2HGVA 3CI6A 4HP9A 3MS6A 3SS5A 3UB9A 4OKPA 3WS2A 1MWRA 2KDKA 2A2LA 1FOFA 1G6AA 3IF6C 2CC1A 3R4KA 1FCOA 1FR6A 5TBMA 4OPZA 1MY8A 2QHKA 4L9GA 4Q0HA 2IWDA 1I5QA 3F1OB 4BL3A 1OPXA 2OLVA 4LV2A 4EWFA 1Q2PA 5HARA 2HF6A 3T1SA 4JXWA 1DJCA 3UB6A 1W7FA 3VP1A 4UEYA 2VV7A 5L10A 1MXOA 3IXGA 1G68A 1TD5A 5GLDA 4R1GA 2X02A 4AFIA 3V50A 5TR7A 1K4EA 2OAP1 1UWPX 3P09A 1XFNA 2ZQ8A 4OPRA 1UGUA 4HESA 2PD7A 2QMIA 1NXYA 4ME4A 5AQ9A 1ESIA 5DJUA 4S2JA 3A3DA 3G6OA 5DFXA 1DJAA 2O0YA 1RGZA 2P7JA 4JXSA 4HJ6A 1S66L 4S2LA 4JF6A 4EBPA 3CPTA 1K6RA 4L9EA 1JWPA 3T1QB 1S4RA 5L8MA 2WKQA 1VEUA 1BLHA 2EXAA 3M2KA 2JKGA 2Z2LB 4FH4A 2BASA 2XQZA 4P6ZS 5FI2A 1LL9A 4MBFA 3SH8A 4NG2A 3BY8A 1T18A 2ZQCA 4PKYG 1BSGA 4DKIA 1VETB 1NJ4A 1RCJA 3LYXA 5IU1A 4X25A 2O9AA 5L07A 1KDWA 2DRWA 2K31A 3L7HA 4EERA 4R4RA 2PYPA 5CHJA 4EEPA 3OPRA 4IBXA 5IT5A 2A24A 3V3RA 2Y8HA 4MN7A 4P0MA 4QWOA 4G3VA 4LGWA 1OTIA 1TEMA 4OQGA 4GS9B 3MQQA 4JGPA 2JKRM 3OZHA 3WRZA 2P04A 2DCFA 4BBUA 5KZHA 3NECA 4NK3A 2Q0OA 1GA9A 4ID4A 4Y17A 5EV0A 2QYBA 2HDUA 4H6JA 3UMDA 4LENA 3VFFA 4EU0A 4EXOA 2HDRA 2H5SA 2PR6A 3GDIA 1YMXA 1NYMA 5FQQA 4QB8A 4LV3A 2Z2MB 2WKPA 1CI8A 2W3EA 5EVID 4ZJ3A 3IWIA 3OPLA 4EETB 1DRMA 4OH0A 2IWBA 1PWCA 4CLCD 3FPVA 4RQ9A 1V9YA 5E2FA 3V67A 3Q82A 5CTMA 3VSLA 4GHIA 2PBDP 4ETXA 2VZWA 3W4OA 5F83A 3FKWA 1FIKA 1VHMA 5HDSA 3RTYA 2Y2GA 5AQAA 3NULA 2V20A 2K2NA 4HBUA 3KYZA 1H8MA 3U4LP 3G4PA 3IF5A 1G5UA 3OBFA 3T4LA 4OP5A 3QNCA 2ZMAA 4MN5A 1OTBA 3UMEA 2V9AA 4IEDA 2UV0E 3F1OA 3Q7ZA 3QP6A 4O01A 4DDYA 4EQIA 2Y2QA 1TS6A 2XD1A 3M6HA 2WYXA 3A3JA 4HY8A 4KENB 3LO7A 3IXDA 2P9VB 1IKGA 1LHYA 1O7EA 1OMEA 1XA1A 1DJBA 2M7VA 4KQRA 4R3JA 2VGKA 5HL6A 5HSQA 4GLQA 2VV8A 3V3SA 2I9VA 3BQAA 3G35A 3S7PA 1XJ4A 3S4XA 2LB9A 2KX6A 3FG8A 1PNEA 1K38A 5KSCA 3BWLA 1S1YA 4WZ5A 4WF0A 5A92A 2XFSA 1PZPA 4EV4A 2XGNA 1JTDA 4ETZA 2FFYA 3IXBA 2EA9A 5JYOA 2ZQ7A 2IWCA 3CG5A 3D4FA 5HDCA 1ONGA 1YLTA 4JF5A 1AWIA 1OJ5A 4P85A 3T4QA 3T4SA 2VA0A 4GDBA 4HJ4A 3UN7A 3NDEA 2JKTM 1P9WA 3BLSA 5EFWA 5CXWA 3LICA 5E43A 3DTMA 3TJZC 2O9BA 4I5SA 3H82B 4BD1A 4BL2A 3RFBA 4YNRA 4CLCE 1BYWA 2JE5A 3HUOA 4MMNA 1PZOA 1IYSA 2XSSA 4C75A 1KE3A 3LIEA 5E2HA 4YWZA 1V9ZA 1WYCA 1FSWA 3H7WA 3NCKA 4CLCC 3K2NA 5HAPA 3E4OA 4JXVA 5AVEA 3IH9A 4D60A 2WGIA 4KG5A 5EM0A 4WMCA 1HVBA 1TS8A 5DTSA 1HTZA 4E3IA 3FYZA 2VGJA 5GHYA 3MJQA 4NKPA 3RXWA 2Y4AA 3LEZA 2GDNA 5AQ7A 5DTKA 3VP2A 3Q07A 3A3FA 5FDHA 4KZ4A 5A90A 1IEMA 3CPTB 4B93A 2HDQA 4K08A 3HLEA 3GQZA 3PAEA 5D3OA 4ZDXA 4OOMA 4Z9QA 4IVKA 4DE0A 2Y2IA 3BECA 3QHYA 1CEFA 2L0WA 3B42A 2Y2KA 5KIZA 4S2PA 3UB5P 5AVFA 4JKTA 3S22A 3LGOA 4HP4A 1YLZA 3PBTA 3QP4A 3ZNYA 3ITBA 3LR3A 4E6WA 2EXBA 3Q7VB 1D06A 3S1YA 1YLYA 2EX6A 5GHZA 1RGYA 3HJKA 1N9NA 1IYPA 2WKEA 5GLCA 4DE3A 1IYOA 3NDGA 5F69A 1P9RA 1E25A 3ZFZA 5DF9A 1S67L 1MKMA 3N7WA 4YOFA 3M6BA 2EX8A 2HP9A 4FUWA 2JHEA 3I7JA 1KE0A 2VX8A 1N4OA 2INWA 3OPPA 3ZNTA 4D2OA 2VGLM 4S2IA 4LV1A 3UDXA 3WS1A 1PWGA 3NJAA 4R23A 1ES3A 1KGFA 3TG9A 3O3VA 2ACGA 2ZQAA 5F1FA 4Y5FA 4HQAA 1W5DA 4R0QA 2JKTI 3E2KA 3UO9A 4ESPA 4MNRA 3Q81A 4QHCA 4ZJ1A 1CJFA 2XRNA 2D02A 4GHIB 3SS3A 2VKSA 3PR6A 4Y13A 4FH2A 2PRFA 1BLPA 4KZ9A 4E3MA 4JF4A 1YKDA 4F94A 3HLGA 2XD5A 5F5YA 1O07A 2HDSA 1E3UA 3E4QA 1DP8A 3HREA 1K55A 1ZG4A 3CZDA 3TRCA 5DFYA 2VK3A 1L2SA 2W0NA 2QPNA 2H0YA 5L2FA 4FSFA 4OP8A 4OVDA 1A0KA 4B88A 2RL3A 4S2MA 1LL8A 3VP3A 1YLJA 3R7WB 3HLBA 3NI9A 1PI5A 5J8XA 1OT6A 4KZ8A 2G7UA 4OOYA 4JLFA 2ZM8A 3A3IA 3H82A 3W2ZA 4BWIA 3B47A 4S2NA 3EOIA 1K56A 4RA7A 5CEBA 3MR0A 3G31A 1LT0A 4PAUA 4K0WA 3O87A 4MLLA 3BM6A 3C2WA 2J9PA 2FZ0A 2XFTA 4Q0IA 4Q0JA 4WM9A 3QP8A 4GJ4A 3B33A 2Y2LA 2C6WB 3P01A 3GMWA 1MWUA 3MFDA 4WL9A 4E3OA 3EGXC 5J7EA 5DF7A 1SCWA 1EWZA 5HPIA 1K57A 2PDRA 5E2GA 2Q9NA 3PTEA 4WEJA 3E98A 4P87A 1NRFA 4N9LA 5HAIA 4HOIA 3G32A 4UHUA 5EOEA 4WN5A 5CHMA 3C38A 3IH8A 3TW8A 3RH8B 5HWWA 4KQDA 3VFHA 3S7NA 4WZ5C 3GRJA 4X56A 3C4OA 4OOLA 3JYIA 3N6IA 3QP1A 1Q2QA 1H0MA 5FA7A 1ERQA 5FI6A 3KSIA 5EUAA 4BQMA 4GKUA 2EWVA 1PI4A 3BQ8A 1Y54A 2WADA 2OAQ1 2PBYA 2RCXA 3EEAA 4R38A 1H5XA 3LR0A 2KOIA 2I72A 3Q7VA 2E8JA 3O5YA 4X68A 5K5BA 5G4ZA 3BYDA 4NEED 5EECA 4DN0A 2DNSA 3E4PA 3CITA 1XPBA 3NIAA 3G30A 1YT4A 3DBAA 1ES4A 3DWZA 1UWNX 1FR1A 1LL5A 2JN7A 4K91A 2L1MA 3ISGA 3IS2B 3QP5A 4E04A 5TJJA 2OWJA 3W4PA 3H7WB 2YKFA 5EOOA 4OQHA 4LV0A 4DJ2A 1T1CA 1U60A 5FASA 2OSUA 5IS1A 1EW0A 2GZAA 4O8GA 2BTFP 2EFXA 3ZG0A 2IA2A 3EQUA 3BFEA 2D01A 4MEZA 1KGGA 2J3WA 2J8YA 4GZBA 1XA7A 4JGQA 4O7DA 4DRTA 2H28A 5FAPA 1VM1A 3BY9A 1VQQA 4PM6A 3KYQA 3LY4A 1S0WA 4LCLA 3A0VA 3MMHA 3T4OA 3HBRA 3G2ZA 2HP6A 3ZVWA 4R70A 3ZG9B 4QJGA 3OC2A 5F6AA 3Q1FA 1CK3A 3ULFA 4JBFA 3KSFA 3SW1A 3RXXA 2K7SA 4I38A 3D72A 1L0EA 3MXQA 3GR2A 2XEPA 3CMZA 3VP0A 1T1BA 3R7WA 1XX2A 5M19A 4JXGA 2J3TC 3UNWA 4PM5A 5M1AA 4JGOA 3WRTA 2E8IA 3VE4A 2OWHA 3LR4A 1Z6FA 5DKLA 3CWFA 4KQOA 1GCEA 4B9OA 2ZOIA 5J4EA 4FOFA 1CI9A 4HJ3A 3G2YA 3PBOA 3ZDJA 3NHQA 4XXRA 1LSWA 1H8ZA 3PXPA 3IWQA 5I94A 1IELA 2GJ3A 1NY0A 4XUZA 4DF6A 4A5RA 5J3WA 3EEHA 1QMFA 1G6OA 1I2SA 1GSVA 5CRFA 1XJ6A 4HEFA 5FSRA 1YM1A 5DF8A 1BLCA 4Y3IA 4ZJ2A 1IFQA 4Y15A 2Y2OA 3FV7A 1L0FA 3N8RA 3A3EA 2V1ZA 2WGWA 3ZG5A 2V1AA 4G3WA 5CHUA 3UPPA 1L0DA 1ZC2A 4X53A 1XGIA 4II7A 2ZJ9A 2A3UA 3LI8A 1YQSA 3PHYA 4IUHA 4GB7A 3OCNA 3TOIA 3NOUC 5AQBA 3GV9A 1TF1A 2PU4A 2R9XA 2JKRI 1OTDA 1WYBA 5FQIA 5HDDA 3DTIA 4I3IA 4LFUA 4OLGA 5MC7A 2GNXA 3GECA 1J9MA 3EQVA 1HZOA 4G3KA 1K55C 3EGDC 3ITAA 4GCZA 2VGLS 1BZAA 4EQ1A 4BMWA 4UA6A 2H10A 2GX5A 1HLUP 2A49A 3UPOA 3BFFA 4DE2A 4BD0A 3U2AA 2O9CA 4WUJA 3LUQA 4IBRA 1TDLA 3JVVA 4PHTA 3KSGA 2Y2JA 3IS2A 3ZCZA 4WZ4A 3UE0A 3MKFA 3K3DA 2JC7A 5EVIB 1PW8A 1JWVA 4KZ5A 4OONA 3PBRA 5LBRA 3PAGA 1I2WA 3BFCA 3LIDA 2WGVA 1SHVA 2WZZA 4IUKA 4U0TA 1NLZA 1GSWA 3LIAA 4OQ0A 3CAXA 5F82A 3ZQ5A 1PFLA 4H8RA 1MWTA 2JKFA 1F5MA 5DKKA 1YAXA 4BBVA 3MZEA 1K57C 3VSKA 1DP9A 3OLOA 1OJGA 5KMWA 4Y0OA 2PU2A 1YLPA 3F1PB 3HLDA 3WS0A 2DMWA 2OOLA 4R6LA 5EPHA 1GSXA 2XK1A 1S4SA 2UWXA 4KZ6A 3LR5A 4M3KA 1AXBA 2KLIA 4NXBA 4HIAA 3NBLA 2ZOHA 2QJ7A 5FAOA 4U3TA 4I3AA 3EWKA 4OPQA 3HUMA 4NXEA 4RYEA 4K0XA 2Y91A 3MXSA 1KDSA 2EFUA 1NWZA 1PYYA 4DMZA 3PBSA 2QKPA 1P97A 4ZBEA 2W3DA
chains in the Genus database with same CATH topology
4WL9A 4GHIA 1H3QA 4ETXA 2MJ6A 2VZWA 3EGXC 1VHMA 5HDSA 3RTYA 4DJ3A 3E0YA 1MC0A 5J7EA 5F68A 3HCYA 3NOTC 5HPIA 2K2NA 2PDRA 2W1TA 4HHDA 1ZTUA 3KYZA 4MDZA 1H8MA 4WEJA 5TBMB 3E98A 4WELA 4KUOA 3OBFA 4HOIA 3T4LA 4WN5A 3JVUA 3C38A 2VV6A 3TW8A 2M1CA 3BJNA 4M4XA 5AJGA 3RH8B 5HWWA 4KQDA 2J80A 3S7NA 4MN5A 1OTBA 3UMEA 2V9AA 2V1BA 3VV4A 4OOLA 2O99A 4CLCB 3F1OA 4GS9A 2W1RA 4EW7A 3FC7A 3KO6A 4O01A 3LIFA 3PYPA 1TS6A 3IBRA 4HH3A 4LRXC 3KSIA 2VEAA 2EWVA 4WLAA 3MQ0A 3UB8A 4NXGA 3BQ8A 2WKRA 4HY8A 2OAQ1 3S7OA 3EEAA 4HI4A 4R38A 1LSVA 3LR0A 2KOIA 3CUEC 3MF0A 2EWWA 4MCWA 3O5YA 3UB7A 1STZA 5K5BA 5G4ZA 2W3GA 4NEED 4HH2A 4DN0A 3E4PA 3CITA 2M7VA 2PD8A 3DBAA 5HL6A 5HSQA 1UWNX 2NUTC 2JN7A 3F1NB 4GLQA 2L1MA 2VV8A 5HWVA 3IS2B 2I9VA 2VJWA 4F3LB 4E04A 3BQAA 5TJJA 2V0WA 4UQIS 2OWJA 3H7WB 2YKFA 3S7PA 4DJ2A 1XJ4A 2LB9A 1T1CA 2KX6A 3OCLA 2PYRA 2QWSA 4R3AA 3FG8A 5KSHA 5IS1A 3FPWA 3BWLA 1S1YA 4HNBA 1EW0A 4WF0A 2GZAA 4O8GA 2J3TD 2IA2A 1LSXA 5FL3A 3EQUA 1NRJA 4UQIM 2D01A 1ODVA 4ETZA 2J3WA 2Z6DA 2EA9A 4JGQA 1F9IA 4CLCA 2B18A 2FH5A 5HPFA 5HDCA 3LFVA 2H28A 3BY9A 1OJ5A 3KYQA 1G28A 3PBNA 3A0VA 3CUEA 3H9WA 3MMHA 3T4OA 4LRZE 3T4QA 1W63Q 3T4SA 5A8BA 2VA0A 3C30A 2HJ9C 3C8CA 5HZHA 4HJ4A 4LPZA 2A24B 4LLOB 1KOUA 3TE8A 3LI9A 4R70A 3OC2A 2L4RA 5DJTA 2JKTM 5F6AA 5C5KA 3S7QA 1P9WA 5EFWA 3ULFA 4IHQA 4ZRRA 3LICA 2XROA 2V0UA 4L0LA 3KSFA 3SW1A 1D7EA 3TJZC 4EEUA 2K7SA 4I38A 3D72A 2O9BA 4I5SA 3H82B 3MXQA 3RFBA 4YNRA 1T1BA 2XA7S 4CLCE 1BYWA 1W63M 4MMNA 3F1PA 1OT9A 3R7WA 2XSSA 1TS7A 3CLOA 2J3TC 4H6JB 3T4JA 3LIEA 4YWZA 4JGOA 1XJ3A 3ICYA 3VE4A 2OWHA 2M7UA 4NXFA 1V9ZA 3LR4A 5DKLA 3MFXA 3CWFA 4KQOA 4B9OA 3H7WA 2ZOIA 5J4EA 2R78A 4CLCC 4FOFA 3K2NA 1OTEA 4HJ3A 4ARZA 3E4OA 2Y79A 5AVEA 3PBOA 3NHQA 2ZBBA 4EESA 4XT2A 1MZUA 1LSWA 1TS8A 3PXPA 1XFQA 3T4TA 3P7NA 2GJ3A 2ZMFA 3T50A 3KSHA 3MJQA 3MQOA 4NKPA 2W1TB 3IBJA 5J3WA 3EEHA 2W3FA 2HGVA 1VB6A 3CI6A 4HP9A 4L9FA 1G6OA 1N9LA 4LRYC 1GSVA 2NUPC 4B93A 1XJ6A 4IJGA 3UE6A 4K08A 3UB9A 2KDKA 1Y28A 2A2LA 3BW6A 4OOMA 3R4KA 4Y3IA 5TBMA 2VLGA 1IFQA 2QHKA 4L9GA 5HD3A 3D3OA 4Q0HA 2L0WA 3B42A 3F1OB 5KIZA 1OPXA 5AVFA 3ZYTA 2V1AA 1JNUA 4G3WA 4II7A 3LIBA 2HF6A 4HP4A 3LI8A 3PBTA 3PHYA 4IUHA 3K3CA 3UB6A 2PR5A 3OCNA 1ZHHB 3LR3A 1D06A 3NOUC 1TF1A 3PBQA 4UEYA 2JKRI 5G4YA 1OTDA 4I3JA 5HDDA 2VV7A 4I3IA 3HJKA 4KUKA 1N9NA 4I39A 5MC7A 2GNXA 3GECA 1TD5A 3EQVA 4G3KA 4AFIA 3EGDC 4GCZA 2OAP1 2VGLS 1UWPX 5F69A 1XFNA 1P9RA 1UGUA 4EQ1A 2PD7A 2W27A 4ME4A 4BMWA 3A0SA 2GX5A 5DF9A 1S67L 1MKMA 5DJUA 4YOFA 3G6OA 5HD5A 5DFXA 4JGRA 2JHEA 5CX7A 3U2AA 2O9CA 2ZMVA 2O0YA 2P7JA 4WUJA 1P0ZA 2QJ5A 2VX8A 2PT7A 2INWA 3LUQA 4HJ6A 3JVVA 3F1NA 2VGLM 1S66L 4PHTA 3KSGA 3IS2A 4F3LA 4L9EA 3NJAA 5I5LA 1NLYA 3K3DA 2HJEA 3VOLA 2W3HA 1S4RA 5L8MA 2WKQA 2XA7M 3PBRA 5LBRA 4Y5FA 4HQAA 1TS0A 2BASA 4P6ZS 3LIDA 2JKTI 1N9OA 4Z1WA 2XRNA 2D02A 2YKHA 4GHIB 2VKSA 3PR6A 4IUKA 4GW9A 3BY8A 1T18A 1X0OA 4EUVA 1NLZA 1GSWA 4PKYG 1XJ2A 3LIAA 1YKDA 3CAXA 5F5YA 4BJPA 3ZQ5A 4P6ZM 3LYXA 5IU1A 3OOVA 2O9AA 4MN6A 1F5MA 5DKKA 2PHYA 1YAXA 3E4QA 4BBVA 1DP8A 2K31A 4EERA 3TRCA 5DFYA 2W0NA 1DP6A 2PYPA 1DP9A 3VE3A 3OLOA 4EEPA 4BBTA 4FSFA 1OJGA 4PKYA 5IT5A 1OTAA 4Y2FA 2A24A 2Y8HA 1LL8A 1YSQA 3F1PB 1WA9A 4MN7A 3R7WB 1IOUA 1YSPA 4G3VA 4WEKA 1OT6A 1OTIA 2G7UA 4GS9B 1F98A 3MQQA 2HV1A 2DMWA 2OOLA 2JKRM 4JGPA 4R6LA 3H82A 3W2ZA 4BWIA 2B02A 3B47A 2P04A 4O0PA 1GSXA 3EOIA 4BBUA 1S4SA 3LR5A 4QPRA 3MR0A 2QYBA 2KLIA 4NXBA 4H6JA 3UMDA 4HIAA 4ARZB 2ZOHA 3A0RA 2CMNA 4EU0A 4EXOA 2P08A 1S1ZA 1LT0A 1T19A 4PAUA 2QJ7A 2PR6A 3GDIA 3KX0X 4XT2B 4I3AA 2LB5A 3C2WA 2FZ0A 2WKPA 2W3EA 3EWKA 4Q0IA 4Q0JA 4NXEA 3NOPC 3HJIA 3UE3A 4GJ4A 1NWZA 3T4KA 3B33A 4DMZA 4EETB 4CQHA 1DRMA 3PBSA 2QKPA 4CLCD 2Z6CA 3FPVA 1P97A 4RQ9A 5HWTA 1T1AA 1V9YA 3P01A 3V67A 2W3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WL9 A;  4GHI A;  5HDS A;  3RTY A;  4DJ3 A;  5J7E A;  5F68 A;  3NOT C;  2PDR A;  4HHD A;  5TBM B;  4KUO A;  4HOI A;  4WN5 A;  2VV6 A;  2M1C A;  4M4X A;  3RH8 B;  5HWW A;  4KQD A;  2J80 A;  4MN5 A;  1OTB A;  3UME A;  2V9A A;  2V1B A;  3F1O A;  4GS9 A;  4EW7 A;  3FC7 A;  3LIF A;  3PYP A;  1TS6 A;  3IBR A;  4HH3 A;  4LRX C;  2VEA A;  4WLA A;  3UB8 A;  4NXG A;  2WKR A;  4HY8 A;  4HI4 A;  4R38 A;  1LSV A;  3UB7 A;  5G4Z A;  4HH2 A;  3E4P A;  2PD8 A;  5HSQ A;  1UWN X;  2JN7 A;  3F1N B;  2L1M A;  2VV8 A;  5HWV A;  3IS2 B;  2I9V A;  4F3L B;  4E04 A;  2V0W A;  2OWJ A;  3H7W B;  2YKF A;  4DJ2 A;  1XJ4 A;  1T1C A;  2KX6 A;  2PYR A;  2QWS A;  4R3A A;  3FG8 A;  5IS1 A;  3BWL A;  1S1Y A;  4HNB A;  1EW0 A;  4WF0 A;  1LSX A;  2D01 A;  1ODV A;  2Z6D A;  2EA9 A;  4JGQ A;  1F9I A;  5HDC A;  2H28 A;  3BY9 A;  1OJ5 A;  1G28 A;  3A0V A;  3H9W A;  4LRZ E;  5A8B A;  3C8C A;  5HZH A;  4HJ4 A;  4LPZ A;  2A24 B;  4LLO B;  1KOU A;  3LI9 A;  4R70 A;  2L4R A;  5DJT A;  5F6A A;  5EFW A;  3ULF A;  3LIC A;  2V0U A;  3SW1 A;  1D7E A;  4EEU A;  2K7S A;  4I38 A;  3D72 A;  4I5S A;  3H82 B;  3MXQ A;  1T1B A;  1BYW A;  3F1P A;  1OT9 A;  1TS7 A;  3CLO A;  4H6J B;  3LIE A;  4YWZ A;  4JGO A;  1XJ3 A;  3ICY A;  3VE4 A;  2OWH A;  4NXF A;  1V9Z A;  5DKL A;  3MFX A;  3CWF A;  4B9O A;  3H7W A;  2ZOI A;  5J4E A;  2R78 A;  1OTE A;  4HJ3 A;  3E4O A;  5AVE A;  3NHQ A;  2ZBB A;  4EES A;  4XT2 A;  1MZU A;  1LSW A;  1TS8 A;  1XFQ A;  3P7N A;  2GJ3 A;  3T50 A;  3MJQ A;  3MQO A;  5J3W A;  3EEH A;  4HP9 A;  1VB6 A;  4L9F A;  1N9L A;  4LRY C;  1GSV A;  1XJ6 A;  3UE6 A;  4K08 A;  3UB9 A;  2KDK A;  1Y28 A;  5TBM A;  2VLG A;  2QHK A;  4L9G A;  5HD3 A;  2L0W A;  3F1O B;  5KIZ A;  5AVF A;  2V1A A;  1JNU A;  3LIB A;  4HP4 A;  3LI8 A;  3PHY A;  3K3C A;  3UB6 A;  2PR5 A;  1D06 A;  3NOU C;  5G4Y A;  1OTD A;  4I3J A;  5HDD A;  2VV7 A;  4I3I A;  3HJK A;  4KUK A;  1N9N A;  4I39 A;  3GEC A;  4GCZ A;  1UWP X;  5F69 A;  1XFN A;  1UGU A;  4EQ1 A;  2PD7 A;  2W27 A;  3A0S A;  1S67 L;  5DJU A;  3G6O A;  5HD5 A;  4JGR A;  2JHE A;  2P7J A;  4WUJ A;  1P0Z A;  2QJ5 A;  2INW A;  3LUQ A;  4HJ6 A;  3F1N A;  1S66 L;  3IS2 A;  4F3L A;  4L9E A;  3NJA A;  5I5L A;  3K3D A;  3VOL A;  1S4R A;  2WKQ A;  4HQA A;  1TS0 A;  2BAS A;  3LID A;  1N9O A;  2D02 A;  2YKH A;  4GHI B;  4GW9 A;  3BY8 A;  1T18 A;  1X0O A;  1GSW A;  4PKY G;  1XJ2 A;  3LIA A;  3CAX A;  5F5Y A;  3ZQ5 A;  3LYX A;  5IU1 A;  4MN6 A;  5DKK A;  2PHY A;  3E4Q A;  4BBV A;  1DP8 A;  4EER A;  2W0N A;  1DP6 A;  2PYP A;  1DP9 A;  3VE3 A;  3OLO A;  4EEP A;  4BBT A;  1OJG A;  4PKY A;  1OTA A;  2A24 A;  1LL8 A;  3F1P B;  1WA9 A;  1OT6 A;  1OTI A;  4GS9 B;  1F98 A;  3MQQ A;  2HV1 A;  2OOL A;  4JGP A;  4R6L A;  3H82 A;  2B02 A;  1GSX A;  4BBU A;  1S4S A;  3MR0 A;  4NXB A;  4H6J A;  3UMD A;  4HIA A;  2ZOH A;  3A0R A;  2CMN A;  4EXO A;  1S1Z A;  1LT0 A;  1T19 A;  2QJ7 A;  2PR6 A;  3GDI A;  3KX0 X;  4XT2 B;  4I3A A;  3C2W A;  3EWK A;  2WKP A;  4NXE A;  3NOP C;  3HJI A;  1NWZ A;  3B33 A;  4EET B;  1DRM A;  2QKP A;  2Z6C A;  1P97 A;  5HWT A;  4RQ9 A;  1T1A A;  1V9Y A; 
#chains in the Genus database with same CATH topology
 5HL1 A;  1H3Q A;  4DJ3 A;  3E0Y A;  1MC0 A;  3IHA A;  4OLD A;  3HCY A;  3NOT C;  4HHD A;  3IXH A;  4WEL A;  1YMS A;  2Q9M A;  3D9Y A;  1W8Y A;  3C7U A;  1K0K A;  4KZ7 A;  4S2K A;  3BJN A;  3GVB A;  4M4X A;  3UE1 A;  2J80 A;  2JBF A;  3UDI A;  5L09 A;  2V1B A;  1KVM A;  3ZG7 B;  3IHB A;  2W1R A;  1BLS A;  4S2O A;  1K6S A;  2G2U A;  4BEN A;  2WZX A;  5FQJ A;  2HZ5 A;  3MZF A;  3T1X A;  1XKZ A;  3MQ0 A;  2WKR A;  3ZGA B;  2XDM A;  2Y55 A;  1LSV A;  1N9B A;  1PWD A;  4Y0T A;  1DY6 A;  2XLN A;  5CED A;  4WMC D;  1STZ A;  2W3G A;  4WYY A;  4HH2 A;  1BT5 A;  4LCM A;  3WS5 A;  1M6K A;  3QNB A;  1LLB A;  1XXM A;  2WK0 A;  2ZD8 A;  5EE8 A;  3M2J A;  4E3K A;  2NUT C;  3IF6 B;  5HX9 A;  3F1N B;  2J9O A;  3T1R A;  5HWV A;  2VJW A;  4F3L B;  2V0W A;  3MBZ A;  2R9W A;  3OCL A;  2QWS A;  5EM1 A;  4R3A A;  4UAA A;  2ZL1 A;  5KSH A;  3MKE A;  4OPY A;  3IWO A;  1MWS A;  3GSG A;  3NY4 A;  1SKO B;  4FD8 A;  4HNB A;  3V5M A;  2J3T D;  5EVI A;  1K54 A;  5FL3 A;  4UQI M;  1J3W A;  1ODV A;  2EX2 A;  1E4D A;  3C4P A;  2V2F F;  1F9I A;  4CLC A;  1W79 A;  2FH5 A;  1GHI A;  3AGE A;  5HPF A;  1ES2 A;  3C7V A;  2ZQ9 A;  1G28 A;  4N1X A;  2X01 A;  3CUE A;  3H9W A;  5FQM A;  4LRZ E;  3T12 B;  4E3L A;  2B5R A;  5A8B A;  3TSG A;  1ZG6 A;  2G2W A;  3C8C A;  4LLO B;  4KG2 A;  3UPN A;  1KOU A;  5M18 A;  3LI9 A;  5A93 A;  5DJT A;  3S7Q A;  5C5K A;  2WKH A;  4IHQ A;  4ZRR A;  2XRO A;  2V0U A;  3SOI A;  5EVL A;  2WGW B;  2XA7 S;  1W63 M;  1NZO A;  3F1P A;  1OT9 A;  4N9K A;  4NET A;  3VOY A;  3SZT A;  1TS7 A;  3CLO A;  1SDN A;  1NYY A;  4PM9 A;  4E3N A;  1ES5 A;  3T4J A;  5GLA A;  5CGS A;  3ICY A;  5FI7 A;  3MFX A;  3IQA A;  2R78 A;  3VP4 A;  4PM8 A;  2OLU A;  1MZU A;  1Y4O A;  2ZC3 B;  3T4T A;  4PMA A;  3DTE A;  1ERM A;  3AGD A;  1XP4 A;  5TFQ A;  2W1T B;  3O86 A;  2ZC7 A;  3GTC A;  2HP5 A;  1GHM A;  1KVL A;  2W3F A;  1VB6 A;  1E3U D;  4L9F A;  5FAT A;  1N9L A;  1C3B A;  4LRY C;  3KYE A;  2NUP C;  4IJG A;  4U0X A;  3UE6 A;  1Y28 A;  3BW6 A;  5EVE A;  2VLG A;  5HD3 A;  3FZC A;  3D3O A;  2P74 A;  2WKI A;  1FCN A;  1L0G A;  3ZYT A;  1JNU A;  1K56 D;  4JPM A;  1PRQ A;  3LIB A;  3BLM A;  4Y0U A;  3K3C A;  4N92 A;  2PR5 A;  1ZHH B;  1S6R A;  5GLB A;  3OPH A;  3DTK A;  3PBQ A;  4KZ3 A;  4ZAM A;  5G4Y A;  1ALQ A;  3BFG A;  2BLS A;  1LI9 A;  4I3J A;  4KUK A;  4I39 A;  3WS4 A;  3SH7 A;  3G34 A;  1PW1 A;  1F2K A;  1JWZ A;  2W27 A;  5IHV A;  2J7V A;  3A0S A;  4ZTK A;  5HD5 A;  1RP5 A;  2Y2P A;  4JGR A;  4KQQ A;  1FIL A;  1WE4 A;  5CX7 A;  2Y2M A;  2ZMV A;  3BEB A;  4GN2 A;  1P0Z A;  2QJ5 A;  2PT7 A;  2EX9 A;  4QY5 A;  3IF6 A;  3ZG8 B;  3N8L A;  3F1N A;  3E2L A;  1YLW A;  2PAV P;  5HFO A;  4F3L A;  2XH9 A;  5I5L A;  1NLY A;  3SS4 A;  2ZC5 B;  2HJE A;  3VOL A;  3HL9 A;  2W3H A;  3FWL A;  2XA7 M;  3HLW A;  3HLC A;  3CHW P;  2V8C A;  1TS0 A;  3LEQ A;  1SKO A;  4CPK A;  3MZD A;  5A91 A;  3ZHH A;  1N9O A;  4Z1W A;  5JYP A;  3NC8 A;  4C3Q A;  2YKH A;  5F1G A;  2B95 A;  4GW9 A;  1X0O A;  4IVI A;  4EUV A;  2ZQD A;  1XJ2 A;  4B4X A;  2QZ6 A;  2AVX A;  2HPB A;  4BJP A;  4P6Z M;  3OOV A;  4MN6 A;  1FQG A;  4PPR A;  4XUX A;  1SKF A;  2PHY A;  4EBN A;  1NZU A;  3RJU A;  1GA0 A;  1DP6 A;  5DVA A;  3O88 A;  5FAQ A;  3VE3 A;  4BBT A;  4PKY A;  1OTA A;  4Y2F A;  2JCH A;  1YSQ A;  4GDN A;  1WA9 A;  1IOU A;  4X1M A;  3SH9 A;  1YPR A;  1YSP A;  3N8S A;  4WEK A;  4QY6 A;  1F98 A;  1BUL A;  2V8F A;  2HV1 A;  2B02 A;  1Z09 A;  4O0P A;  4DXB A;  1D1J A;  3CJM A;  4UA9 A;  4QPR A;  4ARZ B;  5HAQ A;  3A0R A;  2CMN A;  4UA7 A;  4EUZ A;  2P08 A;  1ESU A;  1S1Z A;  1T19 A;  2ZC4 B;  5FQ9 A;  3KX0 X;  4QD4 A;  1FSY A;  4XT2 B;  5CGX A;  2LB5 A;  1SZV A;  1TDG A;  3N4I A;  3NOP C;  3HJI A;  2XF3 A;  4MBK A;  3IX3 A;  3UE3 A;  3MXR A;  3T4K A;  4CQH A;  4DXC A;  2C5W B;  2Z6C A;  1QME A;  5HWT A;  1T1A A;  3BFD A;  5FEF A;  5FDS A;  2MJ6 A;  1EI5 A;  1BTL A;  2X71 A;  3HVF A;  5CTN A;  1L3L A;  1VET A;  1BUE A;  4RX2 A;  5F68 A;  4QU3 A;  5CER A;  5CEC A;  2OV5 A;  2W1T A;  1ZTU A;  4MDZ A;  5TBM B;  5CGW A;  2ZL1 B;  4KUO A;  4S2N C;  3HLF A;  5DTT A;  5FEG A;  3JVU A;  2VV6 A;  2M1C A;  4Y7P A;  5AJG A;  1CQA A;  3L9K A;  3AGF A;  3JPU A;  2H0T A;  1ZKJ A;  4FTX A;  4E3J A;  1PIO A;  3VV4 A;  3IX8 A;  2O99 A;  4CLC B;  3IT9 A;  5EVI C;  4GS9 A;  5FQK A;  4EW7 A;  1K54 C;  3FC7 A;  3KO6 A;  4CJN A;  1MPL A;  3LIF A;  3PYP A;  4N1H A;  3C5A A;  3ZVT A;  3IBR A;  4HH3 A;  1IYQ A;  4LRX C;  3W4Q A;  2VEA A;  2Y2H A;  4WLA A;  2WAF A;  3UB8 A;  4NXG A;  5GHX A;  3V39 A;  1H8Y A;  2ZM0 A;  3S7O A;  4HI4 A;  1LI0 A;  3CUE C;  3MF0 A;  2EWW A;  4MCW A;  3UB7 A;  4R3B A;  4DDS A;  1TVF A;  2BG1 A;  1XGJ A;  3B3X A;  5GL9 A;  5HW3 A;  4DE1 A;  2PD8 A;  1ONH A;  4RVA A;  3IX4 A;  3UY6 A;  1M40 A;  3WWX A;  3UDF A;  3DW0 A;  4X1L A;  4P6B A;  4UQI S;  4GOG A;  3VMA A;  1HD8 A;  2ZM2 A;  1VEU B;  2PYR A;  2XR0 A;  2Y2N A;  2ZC6 B;  3FPW A;  3P98 A;  4R4S A;  3FKV A;  4B4Z A;  5U47 A;  1LSX A;  1NRJ A;  1W8Q A;  4GD8 A;  2Z6D A;  4PM7 A;  5BOH A;  2B18 A;  4WBG A;  4HBT A;  2FFF B;  1KGE A;  3VOZ A;  3LFV A;  5TGF A;  1CF0 A;  4BLM A;  1SDE A;  3PBN A;  4X69 A;  2WAE A;  1JVJ A;  4EBL A;  1W63 Q;  3LCE A;  3MSH A;  3C30 A;  2HJ9 C;  4MBH A;  5HZH A;  4LPZ A;  1IKI A;  2A24 B;  1CEG A;  1K25 A;  3TE8 A;  4FCF A;  2L4R A;  2P9V A;  1ERO A;  4GNU A;  4YIN A;  4L0L A;  1D7E A;  1ACF A;  4EEU A;  3BRM A;  4RX3 A;  3W8K A;  4Q8I A;  4H6J B;  3HUN A;  4OQI A;  3DAV A;  4KZB A;  1XJ3 A;  2M7U A;  4NXF A;  1GHP A;  4C6Y A;  4E6X A;  4KG6 A;  5E2E A;  1MBL A;  1OTE A;  2ZLY A;  4ARZ A;  2Y79 A;  4X6T A;  4KZA A;  2ZBB A;  4EES A;  4X55 A;  4XT2 A;  1JTG A;  1MKI A;  2Y59 A;  1XFQ A;  2WUQ A;  3P7N A;  1K4F A;  2ZMF A;  3T50 A;  3KSH A;  3MQO A;  3LY3 A;  1KE4 A;  3QP2 A;  3IBJ A;  5G18 A;  3DWK A;  4GD6 A;  4YFM A;  1FCM A;  2HGV A;  3CI6 A;  4HP9 A;  3MS6 A;  3SS5 A;  3UB9 A;  4OKP A;  3WS2 A;  1MWR A;  2KDK A;  2A2L A;  1FOF A;  1G6A A;  3IF6 C;  2CC1 A;  3R4K A;  1FCO A;  1FR6 A;  5TBM A;  4OPZ A;  1MY8 A;  2QHK A;  4L9G A;  4Q0H A;  2IWD A;  1I5Q A;  3F1O B;  4BL3 A;  1OPX A;  2OLV A;  4LV2 A;  4EWF A;  1Q2P A;  5HAR A;  2HF6 A;  3T1S A;  4JXW A;  1DJC A;  3UB6 A;  1W7F A;  3VP1 A;  4UEY A;  2VV7 A;  5L10 A;  1MXO A;  3IXG A;  1G68 A;  1TD5 A;  5GLD A;  4R1G A;  2X02 A;  4AFI A;  3V50 A;  5TR7 A;  1K4E A;  2OAP 1;  1UWP X;  3P09 A;  1XFN A;  2ZQ8 A;  4OPR A;  1UGU A;  4HES A;  2PD7 A;  2QMI A;  1NXY A;  4ME4 A;  5AQ9 A;  1ESI A;  5DJU A;  4S2J A;  3A3D A;  3G6O A;  5DFX A;  1DJA A;  2O0Y A;  1RGZ A;  2P7J A;  4JXS A;  4HJ6 A;  1S66 L;  4S2L A;  4JF6 A;  4EBP A;  3CPT A;  1K6R A;  4L9E A;  1JWP A;  3T1Q B;  1S4R A;  5L8M A;  2WKQ A;  1VEU A;  1BLH A;  2EXA A;  3M2K A;  2JKG A;  2Z2L B;  4FH4 A;  2BAS A;  2XQZ A;  4P6Z S;  5FI2 A;  1LL9 A;  4MBF A;  3SH8 A;  4NG2 A;  3BY8 A;  1T18 A;  2ZQC A;  4PKY G;  1BSG A;  4DKI A;  1VET B;  1NJ4 A;  1RCJ A;  3LYX A;  5IU1 A;  4X25 A;  2O9A A;  5L07 A;  1KDW A;  2DRW A;  2K31 A;  3L7H A;  4EER A;  4R4R A;  2PYP A;  5CHJ A;  4EEP A;  3OPR A;  4IBX A;  5IT5 A;  2A24 A;  3V3R A;  2Y8H A;  4MN7 A;  4P0M A;  4QWO A;  4G3V A;  4LGW A;  1OTI A;  1TEM A;  4OQG A;  4GS9 B;  3MQQ A;  4JGP A;  2JKR M;  3OZH A;  3WRZ A;  2P04 A;  2DCF A;  4BBU A;  5KZH A;  3NEC A;  4NK3 A;  2Q0O A;  1GA9 A;  4ID4 A;  4Y17 A;  5EV0 A;  2QYB A;  2HDU A;  4H6J A;  3UMD A;  4LEN A;  3VFF A;  4EU0 A;  4EXO A;  2HDR A;  2H5S A;  2PR6 A;  3GDI A;  1YMX A;  1NYM A;  5FQQ A;  4QB8 A;  4LV3 A;  2Z2M B;  2WKP A;  1CI8 A;  2W3E A;  5EVI D;  4ZJ3 A;  3IWI A;  3OPL A;  4EET B;  1DRM A;  4OH0 A;  2IWB A;  1PWC A;  4CLC D;  3FPV A;  4RQ9 A;  1V9Y A;  5E2F A;  3V67 A;  3Q82 A;  5CTM A;  3VSL A;  4GHI A;  2PBD P;  4ETX A;  2VZW A;  3W4O A;  5F83 A;  3FKW A;  1FIK A;  1VHM A;  5HDS A;  3RTY A;  2Y2G A;  5AQA A;  3NUL A;  2V20 A;  2K2N A;  4HBU A;  3KYZ A;  1H8M A;  3U4L P;  3G4P A;  3IF5 A;  1G5U A;  3OBF A;  3T4L A;  4OP5 A;  3QNC A;  2ZMA A;  4MN5 A;  1OTB A;  3UME A;  2V9A A;  4IED A;  2UV0 E;  3F1O A;  3Q7Z A;  3QP6 A;  4O01 A;  4DDY A;  4EQI A;  2Y2Q A;  1TS6 A;  2XD1 A;  3M6H A;  2WYX A;  3A3J A;  4HY8 A;  4KEN B;  3LO7 A;  3IXD A;  2P9V B;  1IKG A;  1LHY A;  1O7E A;  1OME A;  1XA1 A;  1DJB A;  2M7V A;  4KQR A;  4R3J A;  2VGK A;  5HL6 A;  5HSQ A;  4GLQ A;  2VV8 A;  3V3S A;  2I9V A;  3BQA A;  3G35 A;  3S7P A;  1XJ4 A;  3S4X A;  2LB9 A;  2KX6 A;  3FG8 A;  1PNE A;  1K38 A;  5KSC A;  3BWL A;  1S1Y A;  4WZ5 A;  4WF0 A;  5A92 A;  2XFS A;  1PZP A;  4EV4 A;  2XGN A;  1JTD A;  4ETZ A;  2FFY A;  3IXB A;  2EA9 A;  5JYO A;  2ZQ7 A;  2IWC A;  3CG5 A;  3D4F A;  5HDC A;  1ONG A;  1YLT A;  4JF5 A;  1AWI A;  1OJ5 A;  4P85 A;  3T4Q A;  3T4S A;  2VA0 A;  4GDB A;  4HJ4 A;  3UN7 A;  3NDE A;  2JKT M;  1P9W A;  3BLS A;  5EFW A;  5CXW A;  3LIC A;  5E43 A;  3DTM A;  3TJZ C;  2O9B A;  4I5S A;  3H82 B;  4BD1 A;  4BL2 A;  3RFB A;  4YNR A;  4CLC E;  1BYW A;  2JE5 A;  3HUO A;  4MMN A;  1PZO A;  1IYS A;  2XSS A;  4C75 A;  1KE3 A;  3LIE A;  5E2H A;  4YWZ A;  1V9Z A;  1WYC A;  1FSW A;  3H7W A;  3NCK A;  4CLC C;  3K2N A;  5HAP A;  3E4O A;  4JXV A;  5AVE A;  3IH9 A;  4D60 A;  2WGI A;  4KG5 A;  5EM0 A;  4WMC A;  1HVB A;  1TS8 A;  5DTS A;  1HTZ A;  4E3I A;  3FYZ A;  2VGJ A;  5GHY A;  3MJQ A;  4NKP A;  3RXW A;  2Y4A A;  3LEZ A;  2GDN A;  5AQ7 A;  5DTK A;  3VP2 A;  3Q07 A;  3A3F A;  5FDH A;  4KZ4 A;  5A90 A;  1IEM A;  3CPT B;  4B93 A;  2HDQ A;  4K08 A;  3HLE A;  3GQZ A;  3PAE A;  5D3O A;  4ZDX A;  4OOM A;  4Z9Q A;  4IVK A;  4DE0 A;  2Y2I A;  3BEC A;  3QHY A;  1CEF A;  2L0W A;  3B42 A;  2Y2K A;  5KIZ A;  4S2P A;  3UB5 P;  5AVF A;  4JKT A;  3S22 A;  3LGO A;  4HP4 A;  1YLZ A;  3PBT A;  3QP4 A;  3ZNY A;  3ITB A;  3LR3 A;  4E6W A;  2EXB A;  3Q7V B;  1D06 A;  3S1Y A;  1YLY A;  2EX6 A;  5GHZ A;  1RGY A;  3HJK A;  1N9N A;  1IYP A;  2WKE A;  5GLC A;  4DE3 A;  1IYO A;  3NDG A;  5F69 A;  1P9R A;  1E25 A;  3ZFZ A;  5DF9 A;  1S67 L;  1MKM A;  3N7W A;  4YOF A;  3M6B A;  2EX8 A;  2HP9 A;  4FUW A;  2JHE A;  3I7J A;  1KE0 A;  2VX8 A;  1N4O A;  2INW A;  3OPP A;  3ZNT A;  4D2O A;  2VGL M;  4S2I A;  4LV1 A;  3UDX A;  3WS1 A;  1PWG A;  3NJA A;  4R23 A;  1ES3 A;  1KGF A;  3TG9 A;  3O3V A;  2ACG A;  2ZQA A;  5F1F A;  4Y5F A;  4HQA A;  1W5D A;  4R0Q A;  2JKT I;  3E2K A;  3UO9 A;  4ESP A;  4MNR A;  3Q81 A;  4QHC A;  4ZJ1 A;  1CJF A;  2XRN A;  2D02 A;  4GHI B;  3SS3 A;  2VKS A;  3PR6 A;  4Y13 A;  4FH2 A;  2PRF A;  1BLP A;  4KZ9 A;  4E3M A;  4JF4 A;  1YKD A;  4F94 A;  3HLG A;  2XD5 A;  5F5Y A;  1O07 A;  2HDS A;  1E3U A;  3E4Q A;  1DP8 A;  3HRE A;  1K55 A;  1ZG4 A;  3CZD A;  3TRC A;  5DFY A;  2VK3 A;  1L2S A;  2W0N A;  2QPN A;  2H0Y A;  5L2F A;  4FSF A;  4OP8 A;  4OVD A;  1A0K A;  4B88 A;  2RL3 A;  4S2M A;  1LL8 A;  3VP3 A;  1YLJ A;  3R7W B;  3HLB A;  3NI9 A;  1PI5 A;  5J8X A;  1OT6 A;  4KZ8 A;  2G7U A;  4OOY A;  4JLF A;  2ZM8 A;  3A3I A;  3H82 A;  3W2Z A;  4BWI A;  3B47 A;  4S2N A;  3EOI A;  1K56 A;  4RA7 A;  5CEB A;  3MR0 A;  3G31 A;  1LT0 A;  4PAU A;  4K0W A;  3O87 A;  4MLL A;  3BM6 A;  3C2W A;  2J9P A;  2FZ0 A;  2XFT A;  4Q0I A;  4Q0J A;  4WM9 A;  3QP8 A;  4GJ4 A;  3B33 A;  2Y2L A;  2C6W B;  3P01 A;  3GMW A;  1MWU A;  3MFD A;  4WL9 A;  4E3O A;  3EGX C;  5J7E A;  5DF7 A;  1SCW A;  1EWZ A;  5HPI A;  1K57 A;  2PDR A;  5E2G A;  2Q9N A;  3PTE A;  4WEJ A;  3E98 A;  4P87 A;  1NRF A;  4N9L A;  5HAI A;  4HOI A;  3G32 A;  4UHU A;  5EOE A;  4WN5 A;  5CHM A;  3C38 A;  3IH8 A;  3TW8 A;  3RH8 B;  5HWW A;  4KQD A;  3VFH A;  3S7N A;  4WZ5 C;  3GRJ A;  4X56 A;  3C4O A;  4OOL A;  3JYI A;  3N6I A;  3QP1 A;  1Q2Q A;  1H0M A;  5FA7 A;  1ERQ A;  5FI6 A;  3KSI A;  5EUA A;  4BQM A;  4GKU A;  2EWV A;  1PI4 A;  3BQ8 A;  1Y54 A;  2WAD A;  2OAQ 1;  2PBY A;  2RCX A;  3EEA A;  4R38 A;  1H5X A;  3LR0 A;  2KOI A;  2I72 A;  3Q7V A;  2E8J A;  3O5Y A;  4X68 A;  5K5B A;  5G4Z A;  3BYD A;  4NEE D;  5EEC A;  4DN0 A;  2DNS A;  3E4P A;  3CIT A;  1XPB A;  3NIA A;  3G30 A;  1YT4 A;  3DBA A;  1ES4 A;  3DWZ A;  1UWN X;  1FR1 A;  1LL5 A;  2JN7 A;  4K91 A;  2L1M A;  3ISG A;  3IS2 B;  3QP5 A;  4E04 A;  5TJJ A;  2OWJ A;  3W4P A;  3H7W B;  2YKF A;  5EOO A;  4OQH A;  4LV0 A;  4DJ2 A;  1T1C A;  1U60 A;  5FAS A;  2OSU A;  5IS1 A;  1EW0 A;  2GZA A;  4O8G A;  2BTF P;  2EFX A;  3ZG0 A;  2IA2 A;  3EQU A;  3BFE A;  2D01 A;  4MEZ A;  1KGG A;  2J3W A;  2J8Y A;  4GZB A;  1XA7 A;  4JGQ A;  4O7D A;  4DRT A;  2H28 A;  5FAP A;  1VM1 A;  3BY9 A;  1VQQ A;  4PM6 A;  3KYQ A;  3LY4 A;  1S0W A;  4LCL A;  3A0V A;  3MMH A;  3T4O A;  3HBR A;  3G2Z A;  2HP6 A;  3ZVW A;  4R70 A;  3ZG9 B;  4QJG A;  3OC2 A;  5F6A A;  3Q1F A;  1CK3 A;  3ULF A;  4JBF A;  3KSF A;  3SW1 A;  3RXX A;  2K7S A;  4I38 A;  3D72 A;  1L0E A;  3MXQ A;  3GR2 A;  2XEP A;  3CMZ A;  3VP0 A;  1T1B A;  3R7W A;  1XX2 A;  5M19 A;  4JXG A;  2J3T C;  3UNW A;  4PM5 A;  5M1A A;  4JGO A;  3WRT A;  2E8I A;  3VE4 A;  2OWH A;  3LR4 A;  1Z6F A;  5DKL A;  3CWF A;  4KQO A;  1GCE A;  4B9O A;  2ZOI A;  5J4E A;  4FOF A;  1CI9 A;  4HJ3 A;  3G2Y A;  3PBO A;  3ZDJ A;  3NHQ A;  4XXR A;  1LSW A;  1H8Z A;  3PXP A;  3IWQ A;  5I94 A;  1IEL A;  2GJ3 A;  1NY0 A;  4XUZ A;  4DF6 A;  4A5R A;  5J3W A;  3EEH A;  1QMF A;  1G6O A;  1I2S A;  1GSV A;  5CRF A;  1XJ6 A;  4HEF A;  5FSR A;  1YM1 A;  5DF8 A;  1BLC A;  4Y3I A;  4ZJ2 A;  1IFQ A;  4Y15 A;  2Y2O A;  3FV7 A;  1L0F A;  3N8R A;  3A3E A;  2V1Z A;  2WGW A;  3ZG5 A;  2V1A A;  4G3W A;  5CHU A;  3UPP A;  1L0D A;  1ZC2 A;  4X53 A;  1XGI A;  4II7 A;  2ZJ9 A;  2A3U A;  3LI8 A;  1YQS A;  3PHY A;  4IUH A;  4GB7 A;  3OCN A;  3TOI A;  3NOU C;  5AQB A;  3GV9 A;  1TF1 A;  2PU4 A;  2R9X A;  2JKR I;  1OTD A;  1WYB A;  5FQI A;  5HDD A;  3DTI A;  4I3I A;  4LFU A;  4OLG A;  5MC7 A;  2GNX A;  3GEC A;  1J9M A;  3EQV A;  1HZO A;  4G3K A;  1K55 C;  3EGD C;  3ITA A;  4GCZ A;  2VGL S;  1BZA A;  4EQ1 A;  4BMW A;  4UA6 A;  2H10 A;  2GX5 A;  1HLU P;  2A49 A;  3UPO A;  3BFF A;  4DE2 A;  4BD0 A;  3U2A A;  2O9C A;  4WUJ A;  3LUQ A;  4IBR A;  1TDL A;  3JVV A;  4PHT A;  3KSG A;  2Y2J A;  3IS2 A;  3ZCZ A;  4WZ4 A;  3UE0 A;  3MKF A;  3K3D A;  2JC7 A;  5EVI B;  1PW8 A;  1JWV A;  4KZ5 A;  4OON A;  3PBR A;  5LBR A;  3PAG A;  1I2W A;  3BFC A;  3LID A;  2WGV A;  1SHV A;  2WZZ A;  4IUK A;  4U0T A;  1NLZ A;  1GSW A;  3LIA A;  4OQ0 A;  3CAX A;  5F82 A;  3ZQ5 A;  1PFL A;  4H8R A;  1MWT A;  2JKF A;  1F5M A;  5DKK A;  1YAX A;  4BBV A;  3MZE A;  1K57 C;  3VSK A;  1DP9 A;  3OLO A;  1OJG A;  5KMW A;  4Y0O A;  2PU2 A;  1YLP A;  3F1P B;  3HLD A;  3WS0 A;  2DMW A;  2OOL A;  4R6L A;  5EPH A;  1GSX A;  2XK1 A;  1S4S A;  2UWX A;  4KZ6 A;  3LR5 A;  4M3K A;  1AXB A;  2KLI A;  4NXB A;  4HIA A;  3NBL A;  2ZOH A;  2QJ7 A;  5FAO A;  4U3T A;  4I3A A;  3EWK A;  4OPQ A;  3HUM A;  4NXE A;  4RYE A;  4K0X A;  2Y91 A;  3MXS A;  1KDS A;  2EFU A;  1NWZ A;  1PYY A;  4DMZ A;  3PBS A;  2QKP A;  1P97 A;  4ZBE A;  2W3D A; 
#chains in the Genus database with same CATH homology
 4WL9 A;  4GHI A;  1H3Q A;  4ETX A;  2MJ6 A;  2VZW A;  3EGX C;  1VHM A;  5HDS A;  3RTY A;  4DJ3 A;  3E0Y A;  1MC0 A;  5J7E A;  5F68 A;  3HCY A;  3NOT C;  5HPI A;  2K2N A;  2PDR A;  2W1T A;  4HHD A;  1ZTU A;  3KYZ A;  4MDZ A;  1H8M A;  4WEJ A;  5TBM B;  3E98 A;  4WEL A;  4KUO A;  3OBF A;  4HOI A;  3T4L A;  4WN5 A;  3JVU A;  3C38 A;  2VV6 A;  3TW8 A;  2M1C A;  3BJN A;  4M4X A;  5AJG A;  3RH8 B;  5HWW A;  4KQD A;  2J80 A;  3S7N A;  4MN5 A;  1OTB A;  3UME A;  2V9A A;  2V1B A;  3VV4 A;  4OOL A;  2O99 A;  4CLC B;  3F1O A;  4GS9 A;  2W1R A;  4EW7 A;  3FC7 A;  3KO6 A;  4O01 A;  3LIF A;  3PYP A;  1TS6 A;  3IBR A;  4HH3 A;  4LRX C;  3KSI A;  2VEA A;  2EWV A;  4WLA A;  3MQ0 A;  3UB8 A;  4NXG A;  3BQ8 A;  2WKR A;  4HY8 A;  2OAQ 1;  3S7O A;  3EEA A;  4HI4 A;  4R38 A;  1LSV A;  3LR0 A;  2KOI A;  3CUE C;  3MF0 A;  2EWW A;  4MCW A;  3O5Y A;  3UB7 A;  1STZ A;  5K5B A;  5G4Z A;  2W3G A;  4NEE D;  4HH2 A;  4DN0 A;  3E4P A;  3CIT A;  2M7V A;  2PD8 A;  3DBA A;  5HL6 A;  5HSQ A;  1UWN X;  2NUT C;  2JN7 A;  3F1N B;  4GLQ A;  2L1M A;  2VV8 A;  5HWV A;  3IS2 B;  2I9V A;  2VJW A;  4F3L B;  4E04 A;  3BQA A;  5TJJ A;  2V0W A;  4UQI S;  2OWJ A;  3H7W B;  2YKF A;  3S7P A;  4DJ2 A;  1XJ4 A;  2LB9 A;  1T1C A;  2KX6 A;  3OCL A;  2PYR A;  2QWS A;  4R3A A;  3FG8 A;  5KSH A;  5IS1 A;  3FPW A;  3BWL A;  1S1Y A;  4HNB A;  1EW0 A;  4WF0 A;  2GZA A;  4O8G A;  2J3T D;  2IA2 A;  1LSX A;  5FL3 A;  3EQU A;  1NRJ A;  4UQI M;  2D01 A;  1ODV A;  4ETZ A;  2J3W A;  2Z6D A;  2EA9 A;  4JGQ A;  1F9I A;  4CLC A;  2B18 A;  2FH5 A;  5HPF A;  5HDC A;  3LFV A;  2H28 A;  3BY9 A;  1OJ5 A;  3KYQ A;  1G28 A;  3PBN A;  3A0V A;  3CUE A;  3H9W A;  3MMH A;  3T4O A;  4LRZ E;  3T4Q A;  1W63 Q;  3T4S A;  5A8B A;  2VA0 A;  3C30 A;  2HJ9 C;  3C8C A;  5HZH A;  4HJ4 A;  4LPZ A;  2A24 B;  4LLO B;  1KOU A;  3TE8 A;  3LI9 A;  4R70 A;  3OC2 A;  2L4R A;  5DJT A;  2JKT M;  5F6A A;  5C5K A;  3S7Q A;  1P9W A;  5EFW A;  3ULF A;  4IHQ A;  4ZRR A;  3LIC A;  2XRO A;  2V0U A;  4L0L A;  3KSF A;  3SW1 A;  1D7E A;  3TJZ C;  4EEU A;  2K7S A;  4I38 A;  3D72 A;  2O9B A;  4I5S A;  3H82 B;  3MXQ A;  3RFB A;  4YNR A;  1T1B A;  2XA7 S;  4CLC E;  1BYW A;  1W63 M;  4MMN A;  3F1P A;  1OT9 A;  3R7W A;  2XSS A;  1TS7 A;  3CLO A;  2J3T C;  4H6J B;  3T4J A;  3LIE A;  4YWZ A;  4JGO A;  1XJ3 A;  3ICY A;  3VE4 A;  2OWH A;  2M7U A;  4NXF A;  1V9Z A;  3LR4 A;  5DKL A;  3MFX A;  3CWF A;  4KQO A;  4B9O A;  3H7W A;  2ZOI A;  5J4E A;  2R78 A;  4CLC C;  4FOF A;  3K2N A;  1OTE A;  4HJ3 A;  4ARZ A;  3E4O A;  2Y79 A;  5AVE A;  3PBO A;  3NHQ A;  2ZBB A;  4EES A;  4XT2 A;  1MZU A;  1LSW A;  1TS8 A;  3PXP A;  1XFQ A;  3T4T A;  3P7N A;  2GJ3 A;  2ZMF A;  3T50 A;  3KSH A;  3MJQ A;  3MQO A;  4NKP A;  2W1T B;  3IBJ A;  5J3W A;  3EEH A;  2W3F A;  2HGV A;  1VB6 A;  3CI6 A;  4HP9 A;  4L9F A;  1G6O A;  1N9L A;  4LRY C;  1GSV A;  2NUP C;  4B93 A;  1XJ6 A;  4IJG A;  3UE6 A;  4K08 A;  3UB9 A;  2KDK A;  1Y28 A;  2A2L A;  3BW6 A;  4OOM A;  3R4K A;  4Y3I A;  5TBM A;  2VLG A;  1IFQ A;  2QHK A;  4L9G A;  5HD3 A;  3D3O A;  4Q0H A;  2L0W A;  3B42 A;  3F1O B;  5KIZ A;  1OPX A;  5AVF A;  3ZYT A;  2V1A A;  1JNU A;  4G3W A;  4II7 A;  3LIB A;  2HF6 A;  4HP4 A;  3LI8 A;  3PBT A;  3PHY A;  4IUH A;  3K3C A;  3UB6 A;  2PR5 A;  3OCN A;  1ZHH B;  3LR3 A;  1D06 A;  3NOU C;  1TF1 A;  3PBQ A;  4UEY A;  2JKR I;  5G4Y A;  1OTD A;  4I3J A;  5HDD A;  2VV7 A;  4I3I A;  3HJK A;  4KUK A;  1N9N A;  4I39 A;  5MC7 A;  2GNX A;  3GEC A;  1TD5 A;  3EQV A;  4G3K A;  4AFI A;  3EGD C;  4GCZ A;  2OAP 1;  2VGL S;  1UWP X;  5F69 A;  1XFN A;  1P9R A;  1UGU A;  4EQ1 A;  2PD7 A;  2W27 A;  4ME4 A;  4BMW A;  3A0S A;  2GX5 A;  5DF9 A;  1S67 L;  1MKM A;  5DJU A;  4YOF A;  3G6O A;  5HD5 A;  5DFX A;  4JGR A;  2JHE A;  5CX7 A;  3U2A A;  2O9C A;  2ZMV A;  2O0Y A;  2P7J A;  4WUJ A;  1P0Z A;  2QJ5 A;  2VX8 A;  2PT7 A;  2INW A;  3LUQ A;  4HJ6 A;  3JVV A;  3F1N A;  2VGL M;  1S66 L;  4PHT A;  3KSG A;  3IS2 A;  4F3L A;  4L9E A;  3NJA A;  5I5L A;  1NLY A;  3K3D A;  2HJE A;  3VOL A;  2W3H A;  1S4R A;  5L8M A;  2WKQ A;  2XA7 M;  3PBR A;  5LBR A;  4Y5F A;  4HQA A;  1TS0 A;  2BAS A;  4P6Z S;  3LID A;  2JKT I;  1N9O A;  4Z1W A;  2XRN A;  2D02 A;  2YKH A;  4GHI B;  2VKS A;  3PR6 A;  4IUK A;  4GW9 A;  3BY8 A;  1T18 A;  1X0O A;  4EUV A;  1NLZ A;  1GSW A;  4PKY G;  1XJ2 A;  3LIA A;  1YKD A;  3CAX A;  5F5Y A;  4BJP A;  3ZQ5 A;  4P6Z M;  3LYX A;  5IU1 A;  3OOV A;  2O9A A;  4MN6 A;  1F5M A;  5DKK A;  2PHY A;  1YAX A;  3E4Q A;  4BBV A;  1DP8 A;  2K31 A;  4EER A;  3TRC A;  5DFY A;  2W0N A;  1DP6 A;  2PYP A;  1DP9 A;  3VE3 A;  3OLO A;  4EEP A;  4BBT A;  4FSF A;  1OJG A;  4PKY A;  5IT5 A;  1OTA A;  4Y2F A;  2A24 A;  2Y8H A;  1LL8 A;  1YSQ A;  3F1P B;  1WA9 A;  4MN7 A;  3R7W B;  1IOU A;  1YSP A;  4G3V A;  4WEK A;  1OT6 A;  1OTI A;  2G7U A;  4GS9 B;  1F98 A;  3MQQ A;  2HV1 A;  2DMW A;  2OOL A;  2JKR M;  4JGP A;  4R6L A;  3H82 A;  3W2Z A;  4BWI A;  2B02 A;  3B47 A;  2P04 A;  4O0P A;  1GSX A;  3EOI A;  4BBU A;  1S4S A;  3LR5 A;  4QPR A;  3MR0 A;  2QYB A;  2KLI A;  4NXB A;  4H6J A;  3UMD A;  4HIA A;  4ARZ B;  2ZOH A;  3A0R A;  2CMN A;  4EU0 A;  4EXO A;  2P08 A;  1S1Z A;  1LT0 A;  1T19 A;  4PAU A;  2QJ7 A;  2PR6 A;  3GDI A;  3KX0 X;  4XT2 B;  4I3A A;  2LB5 A;  3C2W A;  2FZ0 A;  2WKP A;  2W3E A;  3EWK A;  4Q0I A;  4Q0J A;  4NXE A;  3NOP C;  3HJI A;  3UE3 A;  4GJ4 A;  1NWZ A;  3T4K A;  3B33 A;  4DMZ A;  4EET B;  4CQH A;  1DRM A;  3PBS A;  2QKP A;  4CLC D;  2Z6C A;  3FPV A;  1P97 A;  4RQ9 A;  5HWT A;  1T1A A;  1V9Y A;  3P01 A;  3V67 A;  2W3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...