3LYXA

Crystal structure of the pas domain of the protein cps_1291 from colwellia psychrerythraea. northeast structural genomics consortium target id csr222b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
DILKQRAKAFDYVFDAIVVTDLQGFIIDWNKGSETLYGYSKEQAIGQPVNMLHVPGDTEHITSEVISAVENQGKWTGEIRMLHKDGHIGWIESMCVPIYGENYQMVGALGINRDITKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PAS domain of the protein CPS_1291 from Colwellia psychrerythraea. Northeast Structural Genomics Consortium target id CsR222B
rcsb
source organism Colwellia psychrerythraea
molecule tags Transcription
molecule keywords Sensory box/GGDEF domain protein
total genus 33
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3lyxA00
2PYPA 3B33A 5HDDA 3H7WA 5J4EA 4HOIA 4R38A 5IS1A 3E4PA 3LI8A 3F1OB 4GCZA 4HH3A 4HQAA 4NXEA 2VV8A 4EEUA 2PR5A 1XJ6A 2KDKA 3GECA 1F98A 3KX0X 3C8CA 4HP4A 3ULFA 4EETB 1T18A 1S4SA 2JHEA 4HH2A 1DRMA 1S67L 4GHIA 5HDCA 3MJQA 5J7EA 1JNUA 2VV6A 2PD8A 4LRYC 4MN5A 4HHDA 5F5YA 1OTEA 1V9YA 3MXQA 5DJTA 3LIAA 3NOUC 4XT2B 4EW7A 1UGUA 2ZBBA 3EEHA 4I3JA 4H6JB 2GJ3A 5EFWA 4DJ3A 1T1BA 3LICA 1N9NA 2INWA 3NOTC 5F69A 1XFNA 1S1ZA 2WKQA 4LPZA 3VOLA 2V0WA 2QJ7A 2L1MA 3MQOA 1TS0A 2D01A 5TBMA 4F3LA 1S4RA 4RQ9A 3IBRA 2PD7A 2ZOIA 4WUJA 3G6OA 3FG8A 3E4OA 1T1CA 1VB6A 3BWLA 3ICYA 3OLOA 5HWWA 2L0WA 1G28A 5HWVA 5J3WA 4R70A 3H9WA 3H82B 3MFXA 1OJ5A 4WL9A 3F1NA 4JGOA 4GS9B 1GSVA 3CAXA 4BBUA 3SW1A 1P0ZA 4GHIB 4EXOA 5HSQA 4GS9A 4HJ4A 2VLGA 1ODVA 3BY9A 5F6AA 1DP9A 4EERA 4MN6A 2KX6A 1UWPX 3A0VA 3K3CA 4KUOA 1TS8A 5G4YA 4HNBA 4JGQA 4L9EA 4R6LA 1WA9A 4KQDA 3BY8A 2V0UA 2YKFA 3LI9A 4LRZE 5DKLA 3C2WA 4M4XA 4PKYA 2JN7A 5HDSA 1KOUA 5IU1A 3HJKA 5TBMB 5F68A 2PDRA 4E04A 2HV1A 4F3LB 1XJ3A 2CMNA 2YKHA 1X0OA 1NWZA 1N9LA 1OTBA 2V1AA 3LUQA 3PHYA 2PHYA 4WF0A 2M1CA 2BASA 1OJGA 1S66L 2W27A 2PR6A 2J80A 1N9OA 4NXFA 2H28A 3LIBA 4I3AA 4H6JA 1DP8A 1D06A 2D02A 2ZOHA 3CWFA 4NXGA 4WN5A 3K3DA 2B02A 1LL8A 4PKYG 1OTDA 1T19A 3NOPC 1TS6A 5HWTA 3UB7A 1D7EA 2PYRA 1TS7A 3F1NB 3P7NA 3UB6A 3T50A 4HI4A 4EQ1A 2V9AA 3H82A 1LSVA 1GSWA 3F1OA 3H7WB 3UMEA 3NHQA 4I38A 3LIFA 4LRXC 3EWKA 3A0SA 3FC7A 1P97A 1S1YA 4HP9A 3PYPA 4NXBA 1OT6A 1XJ4A 1LSWA 2QHKA 3NJAA 4I39A 4JGPA 5HZHA 1GSXA 1OTAA 1V9ZA 3HJIA 5AVFA 3UE6A 4HJ6A 4HJ3A 4B9OA 4YWZA 1MZUA 2A24A 1OTIA 4I5SA 1LSXA 3LIEA 4R3AA 2OWHA 5DJUA 3RTYA 5DKKA 5A8BA 4LLOB 2OOLA 4EEPA 4WLAA 3LIDA 4L9FA 2V1BA 1DP6A 2VEAA 4XT2A 3UMDA 3RH8B 3LYXA 1F9IA 4BBTA 2W0NA 5KIZA 1EW0A 1T1AA 2Z6DA 3E4QA 3GDIA 4K08A 4L9GA 5HD5A 3F1PB 2WKRA 3IS2B 3IS2A 3MR0A 4KUKA 2EA9A 3UB8A 1Y28A 3F1PA 1OT9A 4BBVA 3ZQ5A 4HIAA 4JGRA 1LT0A 1BYWA 2OWJA 5HD3A 3D72A 5AVEA 2K7SA 4GW9A 3VE4A 3VE3A 2WKPA 5I5LA 4DJ2A 2A24B 2L4RA 2R78A 2Z6CA 5G4ZA 3MQQA 2QJ5A 3UB9A 1XJ2A 4EESA 4HY8A 1XFQA 2P7JA 2VV7A 3A0RA 2I9VA 4I3IA 2QWSA 1UWNX 3CLOA 2QKPA
chains in the Genus database with same CATH superfamily
3PR6A 3TG9A 1NXYA 3FPWA 3E4PA 3MFDA 2MJ6A 4BD1A 4MEZA 1TEMA 2JKGA 4ZRRA 3LIAA 2B95A 5CGSA 3OPRA 4H6JB 4BLMA 3NOTC 1J3WA 1S1ZA 2WKQA 2XA7M 1S6RA 4NG2A 4F3LA 1BTLA 4ZJ1A 5A90A 2PD7A 3HUMA 2J9OA 1ERMA 4MN7A 1ONHA 4OPRA 1NRJA 2XR0A 3SW1A 3WS5A 4MLLA 5HSQA 4ARZA 1ODVA 2VGKA 4IHQA 2FFFB 3UPPA 3CUEA 3LR3A 4IUHA 4S2KA 1Q2PA 4G3VA 1MBLA 5EVIC 4QY5A 3M2JA 4E3OA 3NOPC 5AJGA 4YNRA 3W4QA 5F1GA 4II7A 2HDRA 2BTFP 4E6WA 4CLCE 3LIFA 3BJNA 2ZQDA 5AVFA 3PBQA 2V1ZA 3RTYA 4JF6A 2UWXA 4EEPA 1ES5A 2W3GA 1EW0A 1KDSA 1XPBA 4N92A 2WKRA 3MR0A 3LCEA 4QPRA 3V3RA 1E3UD 4GOGA 4XUXA 2Y2NA 2WKPA 2EWVA 1CJFA 3IWQA 1YLJA 1IKGA 3ZVTA 1PNEA 2O99A 2XLNA 1BLPA 3JVUA 3O86A 4Y0TA 3ITAA 5GHXA 5JYPA 2KDKA 2XK1A 1YM1A 1AWIA 3V50A 2GX5A 2HJ9C 3VFHA 2QPNA 4X1LA 5GHYA 5TJJA 1CI9A 4KZ3A 4N1XA 4RVAA 5EM0A 2QJ7A 5TBMA 5FQQA 3DTEA 1PFLA 4Q0JA 5CHMA 3DWZA 2O9AA 5HWVA 1IEMA 2KLIA 5FI2A 1K54C 5EPHA 4S2IA 4EXOA 2Y2OA 4N9LA 4OQ0A 1ES4A 2ZL1B 4KUOA 3WS0A 4KZ7A 2V0UA 1YLYA 3Q7VB 3ZYTA 4P6ZS 3R7WA 3WRZA 1OTBA 3NULA 1KE0A 3NECA 3V5MA 4NXFA 2XD1A 2XROA 3S7PA 1GCEA 3BRMA 3T50A 2JC7A 2I72A 1HVBA 2XQZA 1OT6A 4Y0OA 3UE6A 1O07A 3HBRA 2OWHA 1DJBA 4OLDA 1DP6A 4MCWA 3CI6A 3WS2A 2O9BA 5AQBA 2LB9A 2C6WB 4X55A 3IS2B 1BT5A 3UB8A 1LLBA 2K7SA 5FAQA 3MQQA 1FIKA 3S22A 1XFQA 2VV7A 3KYZA 2DMWA 4O01A 5A93A 3ZGAB 4MBFA 3BECA 2Q9MA 3DBAA 1DRMA 4QHCA 1YLWA 3ZG0A 4CLCC 3EEHA 3N7WA 2GJ3A 3FYZA 1Y4OA 4WZ5A 3QP2A 4EBNA 1XA7A 3QHYA 5EECA 2Y2KA 5HWWA 2Y2GA 4DE0A 2WGWB 3UN7A 5HL6A 1Y54A 4FTXA 1OJ5A 3F1NA 4GHIB 1IYOA 5HARA 2Y2HA 5FSRA 4JGQA 3L9KA 3N8SA 4Y0UA 3OOVA 1S66L 5AQAA 4I3AA 1K55A 1K56A 4IEDA 2NUTC 3D3OA 4AFIA 2CC1A 3VP0A 3CZDA 2DRWA 4I38A 4PPRA 1TDGA 3ZFZA 2PU4A 2K2NA 3KSHA 2OAP1 4BENA 2IWDA 4GDNA 3HVFA 1Q2QA 1NZOA 2W0NA 2Z6DA 1SKFA 2ZMFA 1VQQA 2EA9A 5F82A 2WZXA 5CX7A 3VOZA 4E3MA 1W63M 4GW9A 3VE4A 2EXBA 2WAFA 4K0WA 4C6YA 3CG5A 4JPMA 5AQ7A 2PR5A 5EVLA 4Y2FA 2JKFA 3C8CA 4FCFA 1T18A 1S4SA 2JKRM 4B93A 4HHDA 4P0MA 1OTEA 4NK3A 4KZ5A 1MWTA 3CMZA 4RQ9A 5K5BA 3IQAA 4WELA 2JBFA 5J3WA 4NETA 3MFXA 5FDSA 3MXSA 2O0YA 5MC7A 1GSVA 4MBKA 3BM6A 1P0ZA 4OP5A 4OKPA 3OPHA 3O3VA 3HCYA 1K0KA 4DKIA 4K91A 4N9KA 4EV4A 3M6BA 4M4XA 4E04A 5IU1A 4EUZA 5CGWA 1E25A 4IUKA 1JVJA 2ZM0A 1FSYA 4DE2A 1MC0A 4DXBA 3VSLA 4ETZA 3F1OA 3NHQA 3SOIA 1P97A 2PRFA 3DTIA 4DF6A 2QHKA 2M7VA 3FPVA 1HD8A 2BG1A 3B47A 3OCLA 1K6RA 4BL3A 5HAIA 4OQIA 2ZC6B 3IS2A 1L0FA 1Y28A 1CEGA 4DE3A 2HP9A 1DY6A 5EVEA 2H0TA 5HFOA 5I5LA 4DXCA 3SH7A 4HY8A 1E3UA 3LEQA 4Y3IA 4WN5A 1WE4A 4B4XA 3H7WA 3F1OB 2J7VA 1FR1A 2VGJA 3KX0X 3PBNA 4ETXA 4HP4A 3IHBA 5HDCA 4GHIA 3MZEA 3MZDA 3TE8A 3UDXA 2ZQ8A 1MY8A 5EFWA 1TS0A 1ZHHB 5L07A 3AGEA 3RXWA 4O8GA 2EFXA 2Y59A 3H82B 1YT4A 3HUNA 4WL9A 5M1AA 3KYEA 4K0XA 4FD8A 2XFTA 3BY9A 4MNRA 2HDUA 3Q07A 1DP9A 3GSGA 3Q1FA 1C3BA 1WYCA 3EGDC 3SH8A 2JKTM 2NUPC 1XJ3A 1STZA 4P85A 2J80A 1N9OA 3C38A 2V20A 3CWFA 3K3DA 5HWTA 1YSQA 3W8KA 2QYBA 5L09A 1BUEA 4G3WA 2WADA 3A0SA 4KZ6A 3FC7A 4YOFA 3NJAA 3NC8A 4JGPA 3C7UA 3KO6A 4KQOA 1ESIA 3MKFA 4WMCD 1G68A 5DTKA 2HZ5A 4S2MA 1H5XA 3V3SA 4L9FA 4Q0HA 2V2FF 2LB5A 3E4QA 2IWBA 2XFSA 3C4OA 2HDSA 3KSGA 1GA9A 1YMSA 2Z6CA 4G3KA 4R23A 1SZVA 1FOFA 3UB9A 1XJ2A 1YLPA 3UB7A 2Y2QA 3IX3A 4BJPA 1H8ZA 5C5KA 3IWOA 3T4LA 1YKDA 1DJCA 2X02A 4GB7A 1PWGA 5L8MA 1NLYA 4WZ4A 1A0KA 4YFMA 4KENB 3QNCA 1ALQA 4LV1A 3MQ0A 1NYYA 3IBRA 4FOFA 3GTCA 2E8JA 4UQIM 3V67A 2L0WA 3HLGA 4Q0IA 5HPFA 2A2LA 3ZG9B 3LR4A 3N6IA 1BLCA 4S2NA 2EX6A 2VLGA 4BL2A 3PAEA 2VGLS 5G4YA 3VOYA 4R6LA 1SDNA 3HREA 1XGJA 3Q7VA 2EXAA 3S1YA 5CERA 2Y55A 3LUQA 4E3IA 2PT7A 3PHYA 4DN0A 4QWOA 2ZMAA 2EX8A 4H6JA 1DP8A 3UO9A 1W5DA 3QP4A 4GJ4A 2B02A 3LO7A 1TS6A 5FQJA 4OOYA 4HI4A 3WWXA 4RX2A 2J3TD 4DE1A 3P09A 1I2WA 1MWRA 2RL3A 1K6SA 4HBUA 1KGGA 1S1YA 2UV0E 2W3HA 3IHAA 3S7QA 2P04A 4PM5A 1ONGA 3FZCA 4PAUA 5FL3A 2O9CA 2QMIA 3BFGA 3ZG5A 3ZG7B 1T1AA 2HJEA 3F1PB 4KUKA 1OT9A 1IOUA 3GQZA 4OP8A 3BFEA 2OWJA 4OLGA 3D72A 1KDWA 2Y8HA 4DJ2A 2B18A 4KZ8A 3EQUA 4A5RA 1L3LA 3T4SA 4QY6A 3JYIA 5DTTA 3BFDA 2QKPA 2Y79A 3C5AA 1FSWA 3A3IA 5GL9A 1FILA 2ACGA 5F1FA 1DJAA 5DFYA 5I94A 1XFNA 2OV5A 3SS3A 4P6BA 2D01A 2HGVA 4WM9A 4GD6A 4GZBA 1T1CA 4YINA 3CHWP 3ICYA 1G28A 4E3LA 4S2OA 2R9WA 2G2WA 2HF6A 1RP5A 3ZNYA 3DTKA 2XSSA 4UAAA 4UHUA 3HLEA 1LHYA 2OLUA 5GLBA 5GLAA 3QP6A 4LRZE 2EWWA 5HL1A 5TBMB 2W27A 3E98A 5CXWA 4KG2A 1RCJA 4Y17A 2EX2A 2P08A 3T4QA 2VKSA 3JVVA 4JF4A 4CLCB 1LSVA 3Q7ZA 3A3DA 1Z6FA 4NXBA 3HJIA 1ES2A 3PAGA 3NBLA 4YWZA 3BLMA 1PW8A 1HLUP 2BLSA 3T1XA 1F9IA 3N8RA 3GDIA 3MZFA 4S2NC 4IBRA 5EV0A 5CEDA 1PRQA 4MDZA 1LT0A 1GHMA 2A24B 4CLCD 3ZNTA 3A0RA 2V8FA 3VMAA 4WZ5C 3HL9A 3UE3A 3T4JA 3S7OA 1BULA 1YLTA 1U60A 4CLCA 3GECA 5E2FA 2ZLYA 1YMXA 1JNUA 5FQMA 3DAVA 1IYPA 1XA1A 1IELA 3LICA 3K2NA 3QP1A 1VEUB 2L1MA 1BLSA 3SH9A 3FKWA 3G6OA 5EOOA 3T1QB 3CPTB 4LCMA 1SHVA 5CEBA 2ZM2A 4PM8A 1KVLA 1NY0A 1L0DA 3GVBA 4HJ4A 3GRJA 3BLSA 4MN6A 3A0VA 2Y4AA 5M19A 4CJNA 2IWCA 4L9EA 3G30A 4X56A 4N1HA 5CRFA 3A3EA 4KZ9A 4MMNA 1LL8A 1OTDA 2WKEA 3LY4A 3T4KA 4QD4A 5KSHA 3UB6A 5FEFA 4JKTA 4LENA 1GSWA 4WEJA 3CPTA 3HLBA 3NI9A 2W1RA 3UPNA 4HJ6A 4C3QA 1SKOA 4R3AA 4OVDA 2Y2JA 1S0WA 1K4FA 4BBTA 3LYXA 3GR2A 1EWZA 1IYSA 5FDHA 1K4EA 2Y2PA 5GLCA 3F1PA 1CF0A 2ZQCA 3C7VA 1K54A 5TGFA 4R4RA 3RJUA 1TVFA 1I5QA 1KE4A 4UA6A 4R38A 2GZAA 2VV8A 2HDQA 1G6OA 1XJ6A 2J3WA 2VV6A 3O88A 3G35A 4JXWA 4HBTA 1YAXA 5F69A 4Y13A 2JKRI 5HAQA 3L7HA 3ZHHA 1W8YA 2RCXA 1QMEA 1P9RA 1H8MA 3PBRA 4GS9B 4Y5FA 3G32A 4OOLA 1XGIA 1G6AA 5F83A 3QNBA 1ZG4A 3SZTA 3T12B 3B3XA 4LFUA 3C2WA 4JBFA 2P74A 1KOUA 3IXBA 4OH0A 4FSFA 2Y2LA 4U0TA 5TFQA 1ZKJA 2QZ6A 1D06A 3WS4A 3EGXC 2Y2IA 4OONA 1H8YA 1PYYA 2PBYA 2W1TB 2WK0A 3SS5A 3UMEA 2ZQAA 1VETA 3PYPA 1XJ4A 2JCHA 1GSXA 5FATA 2A24A 4I5SA 4LV3A 5A8BA 1G5UA 3W4PA 3UB5P 1VHMA 1JTDA 2XRNA 3MKEA 1IFQA 2ZC7A 1QMFA 4HIAA 5M18A 3BFCA 2OSUA 3KYQA 4OPYA 2QJ5A 1UWNX 4DDSA 3IT9A 3T1SA 5F5YA 4O7DA 5DJTA 1T1BA 2G2UA 4DRTA 3ITBA 2ZM8A 4EUVA 3IWIA 1FR6A 5DF7A 3H9WA 2OAQ1 4HESA 3FKVA 4D2OA 1W7FA 3MMHA 3PBTA 3OPPA 3IH9A 4UA7A 4CQHA 3RFBA 4EBLA 1N9BA 4KQDA 5DKLA 2XF3A 1TD5A 2X71A 3WS1A 1L0GA 3ZVWA 2PDRA 1TF1A 3QP5A 5U47A 2YKHA 3LR5A 1OJGA 1D1JA 4MBHA 1H0MA 4EWFA 1PWCA 1FCOA 4Z1WA 5BOHA 4BQMA 4X68A 4EQ1A 4ZBEA 4X1MA 5FAOA 1K55C 4Q8IA 3I7JA 3JPUA 2XGNA 4ZJ2A 3ISGA 4EQIA 2FZ0A 5DFXA 1LSXA 2V1BA 1MXOA 1PIOA 4UQIS 3LGOA 3IXHA 3TSGA 4D60A 4E6XA 4KQRA 4JGRA 5HD3A 2R9XA 1XKZA 3BYDA 2XH9A 2P7JA 4I3IA 2I9VA 2M7UA 5J4EA 2X01A 4EETB 4HH2A 2PD8A 1HZOA 3S4XA 4KG5A 5G18A 4BWIA 1EROA 2ZBBA 4DJ3A 5JYOA 3BQ8A 2Q9NA 2WKHA 3MQOA 2JKTI 4PM7A 3WRTA 1P9WA 5GLDA 3NDEA 2WUQA 2E8IA 1ACFA 2K31A 4ZTKA 1NRFA 3TW8A 4P6ZM 1XP4A 3IX4A 1BZAA 3RXXA 3UY6A 4PKYA 2HV1A 3EEAA 4X53A 1NWZA 4XUZA 1ZC2A 3OCNA 2PHYA 2M1CA 2BASA 4EESA 2PR6A 4F94A 4Z9QA 4EU0A 4NXGA 1NJ4A 1E4DA 3HLWA 4ID4A 1TS7A 3A3JA 3P7NA 3VP1A 3R4KA 3H82A 3IH8A 1RGZA 2ZC5B 5KMWA 5FI7A 2GDNA 5EOEA 1CEFA 2FH5A 2OOLA 5HW3A 1YSPA 4OQHA 1K57A 4XT2A 3BQAA 2H10A 1J9MA 2Q0OA 3AGFA 5AVEA 4PM6A 1OMEA 4JLFA 3B33A 3U2AA 5HDDA 2W3EA 5IS1A 4GCZA 4L0LA 1PWDA 5FI6A 2WKIA 4EW7A 4I3JA 4IBXA 2INWA 1M40A 4LPZA 5FA7A 3VOLA 2V0WA 1ZTUA 1XX2A 4KZAA 1GHPA 2XA7S 4OOMA 3NDGA 3B42A 4UA9A 2DNSA 3FWLA 4O0PA 4ZJ3A 3K3CA 2J3TC 2WGWA 4HNBA 3HLFA 1H3QA 1JTGA 2Z2MB 4OQGA 4Y15A 5F68A 1NYMA 2H0YA 4JXGA 2G7UA 4JF5A 2ZOHA 1KE3A 4R1GA 5FQKA 4JXSA 4CPKA 3D4FA 4X69A 2PYRA 3BEBA 4R0QA 5EVIA 2XDMA 3N4IA 3H7WB 5FEGA 5E43A 4R70A 1LSWA 5HZHA 3IF6B 3OPLA 3A3FA 3DTMA 2OLVA 3CUEC 3EOIA 4X6TA 1ES3A 4KZBA 5DJUA 5EVID 4DMZA 2VX8A 3M2KA 2VEAA 2AVXA 5J8XA 4K08A 4L9GA 5HD5A 4X25A 1VM1A 2EX9A 3MXRA 1MWUA 4R3JA 4WMCA 4DDYA 5E2GA 1NLZA 3PXPA 3G4PA 1GA0A 2Y91A 3VE3A 5G4ZA 4E3KA 3OC2A 3IF6A 2XEPA 5HAPA 5CECA 1JWVA 5CHUA 3CLOA 1KGEA 3IF5A 3ZCZA 4EEUA 5EVIB 4NXEA 4S2PA 5E2HA 4LGWA 1S67L 2WAEA 2J8YA 3MXQA 3IBJA 3NOUC 4XT2B 1MPLA 1PZPA 5KSCA 3CITA 2ZOIA 1IYQA 1Z09A 3BWLA 4P87A 1ERQA 4JGOA 2VA0A 2WYXA 1JWZA 2PU2A 2VK3A 1SCWA 4JXVA 5EUAA 1KVMA 2V8CA 3M6HA 3S7NA 3BY8A 2YKFA 5HDSA 3G2ZA 4C75A 2CMNA 1X0OA 5A92A 3AGDA 2ZC3B 2D02A 4GNUA 1OPXA 1T19A 1I2SA 1D7EA 3F1NB 3BW6A 3T1RA 1MKIA 2FFYA 3IXDA 1YLZA 5LBRA 1OTAA 1V9ZA 3ZDJA 4B88A 4HJ3A 1BLHA 1IKIA 4U0XA 4LLOB 4WLAA 3LIDA 5A91A 3RH8B 1JWPA 5KIZA 3T4OA 4OPQA 3MS6A 1ESUA 1ZG6A 2DCFA 4NKPA 2VGLM 1BYWA 2VZWA 3LY3A 5FASA 2R78A 4RYEA 3P98A 4KQQA 4GKUA 4BD0A 2WGVA 1LI0A 4HQAA 1MKMA 1F98A 2W1TA 3ULFA 4QJGA 4QB8A 2C5WB 3HUOA 1UGUA 2HP6A 3IF6C 2W3FA 5DTSA 3DW0A 1VB6A 2Z2LB 3O5YA 2HP5A 4FH2A 2WZZA 4ARZB 1RGYA 4KZ4A 2Y2MA 2KX6A 2GNXA 3IX8A 1XXMA 4ZDXA 3E2KA 2ZQ9A 4R4SA 3QP8A 3R7WB 3PBSA 1YQSA 3HJKA 5AQ9A 4E3NA 1N9LA 4WF0A 2ZL1A 5EE8A 4E3JA 2ZQ7A 2ZD8A 1EI5A 3UNWA 5DF9A 5CTMA 3TRCA 3PTEA 3Q81A 4LRXC 1K56D 1LI9A 4S2JA 3NIAA 3LIEA 4NEED 3Q82A 1L0EA 3NY4A 4RX3A 1CQAA 1AXBA 2H5SA 1PI5A 4PMAA 3ZQ5A 3V39A 1L2SA 3HLCA 3VFFA 5CGXA 2L4RA 4ME4A 2IA2A 1KGFA 2WGIA 2ZC4B 3TOIA 4BMWA 5F6AA 1PI4A 3TJZC 4HOIA 4WBGA 5KZHA 3LI8A 5J7EA 1W8QA 4LRYC 4MN5A 3W2ZA 1V9YA 3KSFA 1F2KA 1N9NA 3E2LA 3KSIA 3MF0A 5HX9A 1GHIA 4LCLA 3FG8A 5FAPA 3OLOA 1W79A 4PHTA 2W3DA 3CAXA 4HEFA 3N8LA 3EQVA 4BBUA 3VV4A 4M3KA 5L2FA 4B4ZA 5HPIA 1K57C 4EERA 2VJWA 2B5RA 1UWPX 1WYBA 4Y7PA 1WA9A 2A3UA 3LI9A 3VSKA 5DF8A 2JN7A 3OZHA 1CI8A 3LIBA 3G34A 1M6KA 3W4OA 3VP4A 3IXGA 1SDEA 5DVAA 5D3OA 3UPOA 4RA7A 3LR0A 1FCNA 3GV9A 4ESPA 4OPZA 2EFUA 3PBOA 3EWKA 3LFVA 1SKOB 1OTIA 1N4OA 4XXRA 4BBVA 4LV2A 3UE0A 3O87A 3UMDA 1HTZA 3C4PA 4GDBA 3UDFA 3CJMA 4GLQA 5IHVA 1W63Q 2J9PA 1FCMA 1YPRA 4GN2A 4IVKA 4FUWA 3P01A 5FQ9A 4ZAMA 4FH4A 3FV7A 1VETB 1TS8A 2QWSA 2PYPA 2XD5A 4HH3A 3G31A 2KOIA 2JHEA 3MJQA 3BFFA 1LL9A 2P9VA 2PAVP 3C30A 1F5MA 1S4RA 4EBPA 4WUJA 3E4OA 1VEUA 4S2LA 3VP2A 4U3TA 1PZOA 2P9VB 3GMWA 5CTNA 1NZUA 3DWKA 4GS9A 3HLDA 4KG6A 2PBDP 3UE1A 4WEKA 3MSHA 2A49A 4F3LB 5FQIA 1O7EA 5EM1A 1K25A 2V1AA 4LV0A 4H8RA 4QU3A 4IVIA 1BSGA 2H28A 3G2YA 4PKYG 3SS4A 4PM9A 5GHZA 3U4LP 3T4TA 1K38A 2V9AA 3VP3A 3MBZA 4HP9A 4IJGA 4I39A 1MWSA 4B9OA 1MZUA 4UEYA 3ZG8B 5DKKA 2HPBA 5E2EA 5TR7A 1LL5A 3NCKA 4WYYA 5IT5A 3D9YA 4R3BA 3OBFA 1PW1A 4GD8A 2ZJ9A 3LEZA 3E0YA 3UDIA 5CHJA 1FQGA 1CK3A 1TDLA 2ZMVA 2JE5A 5L10A
chains in the Genus database with same CATH topology
3PR6A 3H7WA 4R38A 3FPWA 3E4PA 4EEUA 2GZAA 3F1OB 4NXEA 2VV8A 1G6OA 1XJ6A 2MJ6A 3PBNA 3KX0X 4ETXA 4HP4A 2J3WA 5HDCA 1S67L 4GHIA 2VV6A 4ZRRA 3TE8A 3MXQA 3IBJA 3LIAA 3NOUC 4XT2B 4H6JB 5EFWA 1YAXA 3NOTC 5F69A 1S1ZA 2WKQA 2XA7M 4F3LA 1TS0A 1ZHHB 2JKRI 3CITA 4O8GA 2PD7A 2ZOIA 3BWLA 4MN7A 1P9RA 3H82B 1H8MA 3PBRA 4WL9A 4JGOA 4GS9B 1NRJA 2VA0A 3SW1A 5HSQA 4Y5FA 4OOLA 4ARZA 1ODVA 3BY9A 1DP9A 4IHQA 3EGDC 3S7NA 3CUEA 3BY8A 2YKFA 3LR3A 3C2WA 4IUHA 5HDSA 1KOUA 2JKTM 2NUPC 1XJ3A 2CMNA 1STZA 1X0OA 4FSFA 4G3VA 2J80A 1N9OA 3C38A 1D06A 2D02A 3CWFA 3K3DA 3EGXC 1OPXA 1T19A 3NOPC 4YNRA 5AJGA 5HWTA 1D7EA 1YSQA 3F1NB 2W1TB 3BW6A 4II7A 2QYBA 4G3WA 3UMEA 4CLCE 3LIFA 3A0SA 3BJNA 3FC7A 4YOFA 3PYPA 1XJ4A 3NJAA 4JGPA 5LBRA 3KO6A 1GSXA 1OTAA 1V9ZA 5AVFA 3PBQA 4HJ3A 4KQOA 2A24A 4I5SA 3RTYA 5A8BA 4LLOB 4EEPA 4WLAA 3LIDA 4L9FA 1VHMA 4Q0HA 2LB5A 3RH8B 2XRNA 2W3GA 5KIZA 1EW0A 3E4QA 3T4OA 2WKRA 1IFQA 3MR0A 4QPRA 4NKPA 3KSGA 2VGLM 4HIAA 1BYWA 3KYQA 2VZWA 2EWVA 2WKPA 2R78A 2Z6CA 4G3KA 2QJ5A 3UB9A 1XJ2A 1UWNX 3UB7A 2O99A 3JVUA 4BJPA 4HQAA 5C5KA 1MKMA 2KDKA 1F98A 3T4LA 2W1TA 3ULFA 1YKDA 5L8MA 5F5YA 1NLYA 2GX5A 2HJ9C 5DJTA 1UGUA 5TJJA 1T1BA 3MQ0A 2QJ7A 5TBMA 3IBRA 4FOFA 4EUVA 4Q0JA 4UQIM 2W3FA 3V67A 1VB6A 2O9AA 2L0WA 4Q0IA 5HWVA 5HPFA 2KLIA 3H9WA 2OAQ1 2A2LA 3LR4A 3O5YA 3MMHA 4ARZB 3PBTA 4EXOA 2VLGA 4CQHA 2KX6A 2GNXA 4KUOA 3RFBA 2VGLS 5G4YA 4R6LA 4KQDA 5DKLA 2V0UA 1TD5A 3ZYTA 4P6ZS 3R7WB 3R7WA 3PBSA 3HJKA 2PDRA 1TF1A 2YKHA 3LUQA 2PT7A 1N9LA 1OTBA 3PHYA 4DN0A 4WF0A 3LR5A 1OJGA 4NXFA 2XROA 4H6JA 1DP8A 3S7PA 4GJ4A 2B02A 4Z1WA 1TS6A 4EQ1A 3T50A 4HI4A 5DF9A 2J3TD 3TRCA 4LRXC 1S1YA 1OT6A 2W3HA 3UE6A 3S7QA 2FZ0A 5DFXA 2P04A 1LSXA 3LIEA 4NEED 2OWHA 4PAUA 5FL3A 2O9CA 2V1BA 1DP6A 4MCWA 3CI6A 2O9BA 2LB9A 1T1AA 2HJEA 4UQIS 3F1PB 3IS2B 3UB8A 4KUKA 1OT9A 1IOUA 3ZQ5A 4JGRA 2OWJA 5HD3A 3D72A 2K7SA 2Y8HA 4DJ2A 2B18A 2L4RA 3EQUA 4ME4A 2IA2A 3MQQA 3T4SA 1XFQA 2P7JA 2VV7A 3KYZA 2I9VA 4I3IA 5F6AA 4BMWA 2DMWA 2QKPA 2Y79A 4O01A 2M7UA 5J4EA 3TJZC 4HOIA 3LI8A 4EETB 3DBAA 4HH2A 1DRMA 5DFYA 5J7EA 2PD8A 4LRYC 4MN5A 3W2ZA 1V9YA 3KSFA 4CLCC 4BWIA 2ZBBA 3EEHA 2GJ3A 4DJ3A 1N9NA 3KSIA 1XFNA 3BQ8A 3MF0A 3MQOA 2D01A 2HGVA 2JKTI 1P9WA 3FG8A 1T1CA 5HWWA 3ICYA 3OLOA 1G28A 2HF6A 5HL6A 1OJ5A 4PHTA 3F1NA 2W3DA 3CAXA 3EQVA 4BBUA 2XSSA 3VV4A 4GHIB 2K31A 5HPIA 3TW8A 4EERA 2VJWA 1UWPX 4JGQA 4P6ZM 1WA9A 4LRZE 3LI9A 2EWWA 4PKYA 2JN7A 5TBMB 2HV1A 3EEAA 3OOVA 1NWZA 3OCNA 2PHYA 2M1CA 2BASA 1S66L 4EESA 2W27A 2PR6A 3LIBA 3E98A 4I3AA 4EU0A 4NXGA 2NUTC 3D3OA 4AFIA 2P08A 3T4QA 1TS7A 2VKSA 3P7NA 3JVVA 3LR0A 3R4KA 4CLCB 3H82A 1LSVA 3PBOA 4I38A 3EWKA 4NXBA 3LFVA 3HJIA 2K2NA 3KSHA 4YWZA 2OAP1 1OTIA 2FH5A 2OOLA 1YSPA 4BBVA 3UMDA 4XT2A 1F9IA 2W0NA 2Z6DA 3BQAA 3GDIA 2ZMFA 4GLQA 2EA9A 5CX7A 4MDZA 1W63Q 1LT0A 1W63M 5AVEA 4GW9A 3VE4A 2A24B 3P01A 4CLCD 3A0RA 2QWSA 1TS8A 2PYPA 3B33A 3U2AA 5HDDA 2W3EA 5IS1A 4HH3A 4GCZA 3UE3A 3S7OA 3T4JA 2KOIA 2PR5A 4Y2FA 4CLCA 4L0LA 3GECA 3C8CA 1T18A 1S4SA 2JHEA 3MJQA 2JKRM 1JNUA 4B93A 4HHDA 1OTEA 4EW7A 4I3JA 3LICA 3C30A 2INWA 3K2NA 4LPZA 3VOLA 2V0WA 1ZTUA 1F5MA 2L1MA 1S4RA 4RQ9A 5K5BA 4WUJA 3G6OA 4WELA 3E4OA 2XA7S 4OOMA 5J3WA 3MFXA 2O0YA 5MC7A 3B42A 1GSVA 4O0PA 1P0ZA 4GS9A 4HJ4A 4MN6A 3A0VA 3K3CA 2J3TC 4HNBA 3HCYA 1H3QA 4L9EA 4WEKA 4M4XA 4E04A 5IU1A 4F3LB 5F68A 4IUKA 2V1AA 2G7UA 2H28A 1MC0A 2ZOHA 4MMNA 1LL8A 4PKYG 1OTDA 3T4KA 5KSHA 3T4TA 2PYRA 3UB6A 4ETZA 2V9AA 3F1OA 1GSWA 4WEJA 3H7WB 3NHQA 1P97A 4HP9A 4R70A 4IJGA 2QHKA 1LSWA 4I39A 2M7VA 5HZHA 2W1RA 3FPVA 4HJ6A 4B9OA 1MZUA 3B47A 3OCLA 3CUEC 3EOIA 4UEYA 4R3AA 5DJUA 5DKKA 4DMZA 2VX8A 2VEAA 4BBTA 3LYXA 4K08A 4L9GA 5HD5A 3IS2A 5IT5A 1Y28A 3F1PA 1NLZA 3PXPA 3OBFA 3E0YA 3VE3A 5I5LA 5G4ZA 3OC2A 2ZMVA 4HY8A 4Y3IA 4WN5A 3CLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYP A;  3B33 A;  5HDD A;  3H7W A;  5J4E A;  4HOI A;  4R38 A;  5IS1 A;  3E4P A;  3LI8 A;  3F1O B;  4GCZ A;  4HH3 A;  4HQA A;  4NXE A;  2VV8 A;  4EEU A;  2PR5 A;  1XJ6 A;  2KDK A;  3GEC A;  1F98 A;  3KX0 X;  3C8C A;  4HP4 A;  3ULF A;  4EET B;  1T18 A;  1S4S A;  2JHE A;  4HH2 A;  1DRM A;  1S67 L;  4GHI A;  5HDC A;  3MJQ A;  5J7E A;  1JNU A;  2VV6 A;  2PD8 A;  4LRY C;  4MN5 A;  4HHD A;  5F5Y A;  1OTE A;  1V9Y A;  3MXQ A;  5DJT A;  3LIA A;  3NOU C;  4XT2 B;  4EW7 A;  1UGU A;  2ZBB A;  3EEH A;  4I3J A;  4H6J B;  2GJ3 A;  5EFW A;  4DJ3 A;  1T1B A;  3LIC A;  1N9N A;  2INW A;  3NOT C;  5F69 A;  1XFN A;  1S1Z A;  2WKQ A;  4LPZ A;  3VOL A;  2V0W A;  2QJ7 A;  2L1M A;  3MQO A;  1TS0 A;  2D01 A;  5TBM A;  4F3L A;  1S4R A;  4RQ9 A;  3IBR A;  2PD7 A;  2ZOI A;  4WUJ A;  3G6O A;  3FG8 A;  3E4O A;  1T1C A;  1VB6 A;  3BWL A;  3ICY A;  3OLO A;  5HWW A;  2L0W A;  1G28 A;  5HWV A;  5J3W A;  4R70 A;  3H9W A;  3H82 B;  3MFX A;  1OJ5 A;  4WL9 A;  3F1N A;  4JGO A;  4GS9 B;  1GSV A;  3CAX A;  4BBU A;  3SW1 A;  1P0Z A;  4GHI B;  4EXO A;  5HSQ A;  4GS9 A;  4HJ4 A;  2VLG A;  1ODV A;  3BY9 A;  5F6A A;  1DP9 A;  4EER A;  4MN6 A;  2KX6 A;  1UWP X;  3A0V A;  3K3C A;  4KUO A;  1TS8 A;  5G4Y A;  4HNB A;  4JGQ A;  4L9E A;  4R6L A;  1WA9 A;  4KQD A;  3BY8 A;  2V0U A;  2YKF A;  3LI9 A;  4LRZ E;  5DKL A;  3C2W A;  4M4X A;  4PKY A;  2JN7 A;  5HDS A;  1KOU A;  5IU1 A;  3HJK A;  5TBM B;  5F68 A;  2PDR A;  4E04 A;  2HV1 A;  4F3L B;  1XJ3 A;  2CMN A;  2YKH A;  1X0O A;  1NWZ A;  1N9L A;  1OTB A;  2V1A A;  3LUQ A;  3PHY A;  2PHY A;  4WF0 A;  2M1C A;  2BAS A;  1OJG A;  1S66 L;  2W27 A;  2PR6 A;  2J80 A;  1N9O A;  4NXF A;  2H28 A;  3LIB A;  4I3A A;  4H6J A;  1DP8 A;  1D06 A;  2D02 A;  2ZOH A;  3CWF A;  4NXG A;  4WN5 A;  3K3D A;  2B02 A;  1LL8 A;  4PKY G;  1OTD A;  1T19 A;  3NOP C;  1TS6 A;  5HWT A;  3UB7 A;  1D7E A;  2PYR A;  1TS7 A;  3F1N B;  3P7N A;  3UB6 A;  3T50 A;  4HI4 A;  4EQ1 A;  2V9A A;  3H82 A;  1LSV A;  1GSW A;  3F1O A;  3H7W B;  3UME A;  3NHQ A;  4I38 A;  3LIF A;  4LRX C;  3EWK A;  3A0S A;  3FC7 A;  1P97 A;  1S1Y A;  4HP9 A;  3PYP A;  4NXB A;  1OT6 A;  1XJ4 A;  1LSW A;  2QHK A;  3NJA A;  4I39 A;  4JGP A;  5HZH A;  1GSX A;  1OTA A;  1V9Z A;  3HJI A;  5AVF A;  3UE6 A;  4HJ6 A;  4HJ3 A;  4B9O A;  4YWZ A;  1MZU A;  2A24 A;  1OTI A;  4I5S A;  1LSX A;  3LIE A;  4R3A A;  2OWH A;  5DJU A;  3RTY A;  5DKK A;  5A8B A;  4LLO B;  2OOL A;  4EEP A;  4WLA A;  3LID A;  4L9F A;  2V1B A;  1DP6 A;  2VEA A;  4XT2 A;  3UMD A;  3RH8 B;  3LYX A;  1F9I A;  4BBT A;  2W0N A;  5KIZ A;  1EW0 A;  1T1A A;  2Z6D A;  3E4Q A;  3GDI A;  4K08 A;  4L9G A;  5HD5 A;  3F1P B;  2WKR A;  3IS2 B;  3IS2 A;  3MR0 A;  4KUK A;  2EA9 A;  3UB8 A;  1Y28 A;  3F1P A;  1OT9 A;  4BBV A;  3ZQ5 A;  4HIA A;  4JGR A;  1LT0 A;  1BYW A;  2OWJ A;  5HD3 A;  3D72 A;  5AVE A;  2K7S A;  4GW9 A;  3VE4 A;  3VE3 A;  2WKP A;  5I5L A;  4DJ2 A;  2A24 B;  2L4R A;  2R78 A;  2Z6C A;  5G4Z A;  3MQQ A;  2QJ5 A;  3UB9 A;  1XJ2 A;  4EES A;  4HY8 A;  1XFQ A;  2P7J A;  2VV7 A;  3A0R A;  2I9V A;  4I3I A;  2QWS A;  1UWN X;  3CLO A;  2QKP A; 
#chains in the Genus database with same CATH topology
 3PR6 A;  3TG9 A;  1NXY A;  3FPW A;  3E4P A;  3MFD A;  2MJ6 A;  4BD1 A;  4MEZ A;  1TEM A;  2JKG A;  4ZRR A;  3LIA A;  2B95 A;  5CGS A;  3OPR A;  4H6J B;  4BLM A;  3NOT C;  1J3W A;  1S1Z A;  2WKQ A;  2XA7 M;  1S6R A;  4NG2 A;  4F3L A;  1BTL A;  4ZJ1 A;  5A90 A;  2PD7 A;  3HUM A;  2J9O A;  1ERM A;  4MN7 A;  1ONH A;  4OPR A;  1NRJ A;  2XR0 A;  3SW1 A;  3WS5 A;  4MLL A;  5HSQ A;  4ARZ A;  1ODV A;  2VGK A;  4IHQ A;  2FFF B;  3UPP A;  3CUE A;  3LR3 A;  4IUH A;  4S2K A;  1Q2P A;  4G3V A;  1MBL A;  5EVI C;  4QY5 A;  3M2J A;  4E3O A;  3NOP C;  5AJG A;  4YNR A;  3W4Q A;  5F1G A;  4II7 A;  2HDR A;  2BTF P;  4E6W A;  4CLC E;  3LIF A;  3BJN A;  2ZQD A;  5AVF A;  3PBQ A;  2V1Z A;  3RTY A;  4JF6 A;  2UWX A;  4EEP A;  1ES5 A;  2W3G A;  1EW0 A;  1KDS A;  1XPB A;  4N92 A;  2WKR A;  3MR0 A;  3LCE A;  4QPR A;  3V3R A;  1E3U D;  4GOG A;  4XUX A;  2Y2N A;  2WKP A;  2EWV A;  1CJF A;  3IWQ A;  1YLJ A;  1IKG A;  3ZVT A;  1PNE A;  2O99 A;  2XLN A;  1BLP A;  3JVU A;  3O86 A;  4Y0T A;  3ITA A;  5GHX A;  5JYP A;  2KDK A;  2XK1 A;  1YM1 A;  1AWI A;  3V50 A;  2GX5 A;  2HJ9 C;  3VFH A;  2QPN A;  4X1L A;  5GHY A;  5TJJ A;  1CI9 A;  4KZ3 A;  4N1X A;  4RVA A;  5EM0 A;  2QJ7 A;  5TBM A;  5FQQ A;  3DTE A;  1PFL A;  4Q0J A;  5CHM A;  3DWZ A;  2O9A A;  5HWV A;  1IEM A;  2KLI A;  5FI2 A;  1K54 C;  5EPH A;  4S2I A;  4EXO A;  2Y2O A;  4N9L A;  4OQ0 A;  1ES4 A;  2ZL1 B;  4KUO A;  3WS0 A;  4KZ7 A;  2V0U A;  1YLY A;  3Q7V B;  3ZYT A;  4P6Z S;  3R7W A;  3WRZ A;  1OTB A;  3NUL A;  1KE0 A;  3NEC A;  3V5M A;  4NXF A;  2XD1 A;  2XRO A;  3S7P A;  1GCE A;  3BRM A;  3T50 A;  2JC7 A;  2I72 A;  1HVB A;  2XQZ A;  1OT6 A;  4Y0O A;  3UE6 A;  1O07 A;  3HBR A;  2OWH A;  1DJB A;  4OLD A;  1DP6 A;  4MCW A;  3CI6 A;  3WS2 A;  2O9B A;  5AQB A;  2LB9 A;  2C6W B;  4X55 A;  3IS2 B;  1BT5 A;  3UB8 A;  1LLB A;  2K7S A;  5FAQ A;  3MQQ A;  1FIK A;  3S22 A;  1XFQ A;  2VV7 A;  3KYZ A;  2DMW A;  4O01 A;  5A93 A;  3ZGA B;  4MBF A;  3BEC A;  2Q9M A;  3DBA A;  1DRM A;  4QHC A;  1YLW A;  3ZG0 A;  4CLC C;  3EEH A;  3N7W A;  2GJ3 A;  3FYZ A;  1Y4O A;  4WZ5 A;  3QP2 A;  4EBN A;  1XA7 A;  3QHY A;  5EEC A;  2Y2K A;  5HWW A;  2Y2G A;  4DE0 A;  2WGW B;  3UN7 A;  5HL6 A;  1Y54 A;  4FTX A;  1OJ5 A;  3F1N A;  4GHI B;  1IYO A;  5HAR A;  2Y2H A;  5FSR A;  4JGQ A;  3L9K A;  3N8S A;  4Y0U A;  3OOV A;  1S66 L;  5AQA A;  4I3A A;  1K55 A;  1K56 A;  4IED A;  2NUT C;  3D3O A;  4AFI A;  2CC1 A;  3VP0 A;  3CZD A;  2DRW A;  4I38 A;  4PPR A;  1TDG A;  3ZFZ A;  2PU4 A;  2K2N A;  3KSH A;  2OAP 1;  4BEN A;  2IWD A;  4GDN A;  3HVF A;  1Q2Q A;  1NZO A;  2W0N A;  2Z6D A;  1SKF A;  2ZMF A;  1VQQ A;  2EA9 A;  5F82 A;  2WZX A;  5CX7 A;  3VOZ A;  4E3M A;  1W63 M;  4GW9 A;  3VE4 A;  2EXB A;  2WAF A;  4K0W A;  4C6Y A;  3CG5 A;  4JPM A;  5AQ7 A;  2PR5 A;  5EVL A;  4Y2F A;  2JKF A;  3C8C A;  4FCF A;  1T18 A;  1S4S A;  2JKR M;  4B93 A;  4HHD A;  4P0M A;  1OTE A;  4NK3 A;  4KZ5 A;  1MWT A;  3CMZ A;  4RQ9 A;  5K5B A;  3IQA A;  4WEL A;  2JBF A;  5J3W A;  4NET A;  3MFX A;  5FDS A;  3MXS A;  2O0Y A;  5MC7 A;  1GSV A;  4MBK A;  3BM6 A;  1P0Z A;  4OP5 A;  4OKP A;  3OPH A;  3O3V A;  3HCY A;  1K0K A;  4DKI A;  4K91 A;  4N9K A;  4EV4 A;  3M6B A;  4M4X A;  4E04 A;  5IU1 A;  4EUZ A;  5CGW A;  1E25 A;  4IUK A;  1JVJ A;  2ZM0 A;  1FSY A;  4DE2 A;  1MC0 A;  4DXB A;  3VSL A;  4ETZ A;  3F1O A;  3NHQ A;  3SOI A;  1P97 A;  2PRF A;  3DTI A;  4DF6 A;  2QHK A;  2M7V A;  3FPV A;  1HD8 A;  2BG1 A;  3B47 A;  3OCL A;  1K6R A;  4BL3 A;  5HAI A;  4OQI A;  2ZC6 B;  3IS2 A;  1L0F A;  1Y28 A;  1CEG A;  4DE3 A;  2HP9 A;  1DY6 A;  5EVE A;  2H0T A;  5HFO A;  5I5L A;  4DXC A;  3SH7 A;  4HY8 A;  1E3U A;  3LEQ A;  4Y3I A;  4WN5 A;  1WE4 A;  4B4X A;  3H7W A;  3F1O B;  2J7V A;  1FR1 A;  2VGJ A;  3KX0 X;  3PBN A;  4ETX A;  4HP4 A;  3IHB A;  5HDC A;  4GHI A;  3MZE A;  3MZD A;  3TE8 A;  3UDX A;  2ZQ8 A;  1MY8 A;  5EFW A;  1TS0 A;  1ZHH B;  5L07 A;  3AGE A;  3RXW A;  4O8G A;  2EFX A;  2Y59 A;  3H82 B;  1YT4 A;  3HUN A;  4WL9 A;  5M1A A;  3KYE A;  4K0X A;  4FD8 A;  2XFT A;  3BY9 A;  4MNR A;  2HDU A;  3Q07 A;  1DP9 A;  3GSG A;  3Q1F A;  1C3B A;  1WYC A;  3EGD C;  3SH8 A;  2JKT M;  2NUP C;  1XJ3 A;  1STZ A;  4P85 A;  2J80 A;  1N9O A;  3C38 A;  2V20 A;  3CWF A;  3K3D A;  5HWT A;  1YSQ A;  3W8K A;  2QYB A;  5L09 A;  1BUE A;  4G3W A;  2WAD A;  3A0S A;  4KZ6 A;  3FC7 A;  4YOF A;  3NJA A;  3NC8 A;  4JGP A;  3C7U A;  3KO6 A;  4KQO A;  1ESI A;  3MKF A;  4WMC D;  1G68 A;  5DTK A;  2HZ5 A;  4S2M A;  1H5X A;  3V3S A;  4L9F A;  4Q0H A;  2V2F F;  2LB5 A;  3E4Q A;  2IWB A;  2XFS A;  3C4O A;  2HDS A;  3KSG A;  1GA9 A;  1YMS A;  2Z6C A;  4G3K A;  4R23 A;  1SZV A;  1FOF A;  3UB9 A;  1XJ2 A;  1YLP A;  3UB7 A;  2Y2Q A;  3IX3 A;  4BJP A;  1H8Z A;  5C5K A;  3IWO A;  3T4L A;  1YKD A;  1DJC A;  2X02 A;  4GB7 A;  1PWG A;  5L8M A;  1NLY A;  4WZ4 A;  1A0K A;  4YFM A;  4KEN B;  3QNC A;  1ALQ A;  4LV1 A;  3MQ0 A;  1NYY A;  3IBR A;  4FOF A;  3GTC A;  2E8J A;  4UQI M;  3V67 A;  2L0W A;  3HLG A;  4Q0I A;  5HPF A;  2A2L A;  3ZG9 B;  3LR4 A;  3N6I A;  1BLC A;  4S2N A;  2EX6 A;  2VLG A;  4BL2 A;  3PAE A;  2VGL S;  5G4Y A;  3VOY A;  4R6L A;  1SDN A;  3HRE A;  1XGJ A;  3Q7V A;  2EXA A;  3S1Y A;  5CER A;  2Y55 A;  3LUQ A;  4E3I A;  2PT7 A;  3PHY A;  4DN0 A;  4QWO A;  2ZMA A;  2EX8 A;  4H6J A;  1DP8 A;  3UO9 A;  1W5D A;  3QP4 A;  4GJ4 A;  2B02 A;  3LO7 A;  1TS6 A;  5FQJ A;  4OOY A;  4HI4 A;  3WWX A;  4RX2 A;  2J3T D;  4DE1 A;  3P09 A;  1I2W A;  1MWR A;  2RL3 A;  1K6S A;  4HBU A;  1KGG A;  1S1Y A;  2UV0 E;  2W3H A;  3IHA A;  3S7Q A;  2P04 A;  4PM5 A;  1ONG A;  3FZC A;  4PAU A;  5FL3 A;  2O9C A;  2QMI A;  3BFG A;  3ZG5 A;  3ZG7 B;  1T1A A;  2HJE A;  3F1P B;  4KUK A;  1OT9 A;  1IOU A;  3GQZ A;  4OP8 A;  3BFE A;  2OWJ A;  4OLG A;  3D72 A;  1KDW A;  2Y8H A;  4DJ2 A;  2B18 A;  4KZ8 A;  3EQU A;  4A5R A;  1L3L A;  3T4S A;  4QY6 A;  3JYI A;  5DTT A;  3BFD A;  2QKP A;  2Y79 A;  3C5A A;  1FSW A;  3A3I A;  5GL9 A;  1FIL A;  2ACG A;  5F1F A;  1DJA A;  5DFY A;  5I94 A;  1XFN A;  2OV5 A;  3SS3 A;  4P6B A;  2D01 A;  2HGV A;  4WM9 A;  4GD6 A;  4GZB A;  1T1C A;  4YIN A;  3CHW P;  3ICY A;  1G28 A;  4E3L A;  4S2O A;  2R9W A;  2G2W A;  2HF6 A;  1RP5 A;  3ZNY A;  3DTK A;  2XSS A;  4UAA A;  4UHU A;  3HLE A;  1LHY A;  2OLU A;  5GLB A;  5GLA A;  3QP6 A;  4LRZ E;  2EWW A;  5HL1 A;  5TBM B;  2W27 A;  3E98 A;  5CXW A;  4KG2 A;  1RCJ A;  4Y17 A;  2EX2 A;  2P08 A;  3T4Q A;  2VKS A;  3JVV A;  4JF4 A;  4CLC B;  1LSV A;  3Q7Z A;  3A3D A;  1Z6F A;  4NXB A;  3HJI A;  1ES2 A;  3PAG A;  3NBL A;  4YWZ A;  3BLM A;  1PW8 A;  1HLU P;  2BLS A;  3T1X A;  1F9I A;  3N8R A;  3GDI A;  3MZF A;  4S2N C;  4IBR A;  5EV0 A;  5CED A;  1PRQ A;  4MDZ A;  1LT0 A;  1GHM A;  2A24 B;  4CLC D;  3ZNT A;  3A0R A;  2V8F A;  3VMA A;  4WZ5 C;  3HL9 A;  3UE3 A;  3T4J A;  3S7O A;  1BUL A;  1YLT A;  1U60 A;  4CLC A;  3GEC A;  5E2F A;  2ZLY A;  1YMX A;  1JNU A;  5FQM A;  3DAV A;  1IYP A;  1XA1 A;  1IEL A;  3LIC A;  3K2N A;  3QP1 A;  1VEU B;  2L1M A;  1BLS A;  3SH9 A;  3FKW A;  3G6O A;  5EOO A;  3T1Q B;  3CPT B;  4LCM A;  1SHV A;  5CEB A;  2ZM2 A;  4PM8 A;  1KVL A;  1NY0 A;  1L0D A;  3GVB A;  4HJ4 A;  3GRJ A;  3BLS A;  4MN6 A;  3A0V A;  2Y4A A;  5M19 A;  4CJN A;  2IWC A;  4L9E A;  3G30 A;  4X56 A;  4N1H A;  5CRF A;  3A3E A;  4KZ9 A;  4MMN A;  1LL8 A;  1OTD A;  2WKE A;  3LY4 A;  3T4K A;  4QD4 A;  5KSH A;  3UB6 A;  5FEF A;  4JKT A;  4LEN A;  1GSW A;  4WEJ A;  3CPT A;  3HLB A;  3NI9 A;  2W1R A;  3UPN A;  4HJ6 A;  4C3Q A;  1SKO A;  4R3A A;  4OVD A;  2Y2J A;  1S0W A;  1K4F A;  4BBT A;  3LYX A;  3GR2 A;  1EWZ A;  1IYS A;  5FDH A;  1K4E A;  2Y2P A;  5GLC A;  3F1P A;  1CF0 A;  2ZQC A;  3C7V A;  1K54 A;  5TGF A;  4R4R A;  3RJU A;  1TVF A;  1I5Q A;  1KE4 A;  4UA6 A;  4R38 A;  2GZA A;  2VV8 A;  2HDQ A;  1G6O A;  1XJ6 A;  2J3W A;  2VV6 A;  3O88 A;  3G35 A;  4JXW A;  4HBT A;  1YAX A;  5F69 A;  4Y13 A;  2JKR I;  5HAQ A;  3L7H A;  3ZHH A;  1W8Y A;  2RCX A;  1QME A;  1P9R A;  1H8M A;  3PBR A;  4GS9 B;  4Y5F A;  3G32 A;  4OOL A;  1XGI A;  1G6A A;  5F83 A;  3QNB A;  1ZG4 A;  3SZT A;  3T12 B;  3B3X A;  4LFU A;  3C2W A;  4JBF A;  2P74 A;  1KOU A;  3IXB A;  4OH0 A;  4FSF A;  2Y2L A;  4U0T A;  5TFQ A;  1ZKJ A;  2QZ6 A;  1D06 A;  3WS4 A;  3EGX C;  2Y2I A;  4OON A;  1H8Y A;  1PYY A;  2PBY A;  2W1T B;  2WK0 A;  3SS5 A;  3UME A;  2ZQA A;  1VET A;  3PYP A;  1XJ4 A;  2JCH A;  1GSX A;  5FAT A;  2A24 A;  4I5S A;  4LV3 A;  5A8B A;  1G5U A;  3W4P A;  3UB5 P;  1VHM A;  1JTD A;  2XRN A;  3MKE A;  1IFQ A;  2ZC7 A;  1QMF A;  4HIA A;  5M18 A;  3BFC A;  2OSU A;  3KYQ A;  4OPY A;  2QJ5 A;  1UWN X;  4DDS A;  3IT9 A;  3T1S A;  5F5Y A;  4O7D A;  5DJT A;  1T1B A;  2G2U A;  4DRT A;  3ITB A;  2ZM8 A;  4EUV A;  3IWI A;  1FR6 A;  5DF7 A;  3H9W A;  2OAQ 1;  4HES A;  3FKV A;  4D2O A;  1W7F A;  3MMH A;  3PBT A;  3OPP A;  3IH9 A;  4UA7 A;  4CQH A;  3RFB A;  4EBL A;  1N9B A;  4KQD A;  5DKL A;  2XF3 A;  1TD5 A;  2X71 A;  3WS1 A;  1L0G A;  3ZVW A;  2PDR A;  1TF1 A;  3QP5 A;  5U47 A;  2YKH A;  3LR5 A;  1OJG A;  1D1J A;  4MBH A;  1H0M A;  4EWF A;  1PWC A;  1FCO A;  4Z1W A;  5BOH A;  4BQM A;  4X68 A;  4EQ1 A;  4ZBE A;  4X1M A;  5FAO A;  1K55 C;  4Q8I A;  3I7J A;  3JPU A;  2XGN A;  4ZJ2 A;  3ISG A;  4EQI A;  2FZ0 A;  5DFX A;  1LSX A;  2V1B A;  1MXO A;  1PIO A;  4UQI S;  3LGO A;  3IXH A;  3TSG A;  4D60 A;  4E6X A;  4KQR A;  4JGR A;  5HD3 A;  2R9X A;  1XKZ A;  3BYD A;  2XH9 A;  2P7J A;  4I3I A;  2I9V A;  2M7U A;  5J4E A;  2X01 A;  4EET B;  4HH2 A;  2PD8 A;  1HZO A;  3S4X A;  4KG5 A;  5G18 A;  4BWI A;  1ERO A;  2ZBB A;  4DJ3 A;  5JYO A;  3BQ8 A;  2Q9N A;  2WKH A;  3MQO A;  2JKT I;  4PM7 A;  3WRT A;  1P9W A;  5GLD A;  3NDE A;  2WUQ A;  2E8I A;  1ACF A;  2K31 A;  4ZTK A;  1NRF A;  3TW8 A;  4P6Z M;  1XP4 A;  3IX4 A;  1BZA A;  3RXX A;  3UY6 A;  4PKY A;  2HV1 A;  3EEA A;  4X53 A;  1NWZ A;  4XUZ A;  1ZC2 A;  3OCN A;  2PHY A;  2M1C A;  2BAS A;  4EES A;  2PR6 A;  4F94 A;  4Z9Q A;  4EU0 A;  4NXG A;  1NJ4 A;  1E4D A;  3HLW A;  4ID4 A;  1TS7 A;  3A3J A;  3P7N A;  3VP1 A;  3R4K A;  3H82 A;  3IH8 A;  1RGZ A;  2ZC5 B;  5KMW A;  5FI7 A;  2GDN A;  5EOE A;  1CEF A;  2FH5 A;  2OOL A;  5HW3 A;  1YSP A;  4OQH A;  1K57 A;  4XT2 A;  3BQA A;  2H10 A;  1J9M A;  2Q0O A;  3AGF A;  5AVE A;  4PM6 A;  1OME A;  4JLF A;  3B33 A;  3U2A A;  5HDD A;  2W3E A;  5IS1 A;  4GCZ A;  4L0L A;  1PWD A;  5FI6 A;  2WKI A;  4EW7 A;  4I3J A;  4IBX A;  2INW A;  1M40 A;  4LPZ A;  5FA7 A;  3VOL A;  2V0W A;  1ZTU A;  1XX2 A;  4KZA A;  1GHP A;  2XA7 S;  4OOM A;  3NDG A;  3B42 A;  4UA9 A;  2DNS A;  3FWL A;  4O0P A;  4ZJ3 A;  3K3C A;  2J3T C;  2WGW A;  4HNB A;  3HLF A;  1H3Q A;  1JTG A;  2Z2M B;  4OQG A;  4Y15 A;  5F68 A;  1NYM A;  2H0Y A;  4JXG A;  2G7U A;  4JF5 A;  2ZOH A;  1KE3 A;  4R1G A;  5FQK A;  4JXS A;  4CPK A;  3D4F A;  4X69 A;  2PYR A;  3BEB A;  4R0Q A;  5EVI A;  2XDM A;  3N4I A;  3H7W B;  5FEG A;  5E43 A;  4R70 A;  1LSW A;  5HZH A;  3IF6 B;  3OPL A;  3A3F A;  3DTM A;  2OLV A;  3CUE C;  3EOI A;  4X6T A;  1ES3 A;  4KZB A;  5DJU A;  5EVI D;  4DMZ A;  2VX8 A;  3M2K A;  2VEA A;  2AVX A;  5J8X A;  4K08 A;  4L9G A;  5HD5 A;  4X25 A;  1VM1 A;  2EX9 A;  3MXR A;  1MWU A;  4R3J A;  4WMC A;  4DDY A;  5E2G A;  1NLZ A;  3PXP A;  3G4P A;  1GA0 A;  2Y91 A;  3VE3 A;  5G4Z A;  4E3K A;  3OC2 A;  3IF6 A;  2XEP A;  5HAP A;  5CEC A;  1JWV A;  5CHU A;  3CLO A;  1KGE A;  3IF5 A;  3ZCZ A;  4EEU A;  5EVI B;  4NXE A;  4S2P A;  5E2H A;  4LGW A;  1S67 L;  2WAE A;  2J8Y A;  3MXQ A;  3IBJ A;  3NOU C;  4XT2 B;  1MPL A;  1PZP A;  5KSC A;  3CIT A;  2ZOI A;  1IYQ A;  1Z09 A;  3BWL A;  4P87 A;  1ERQ A;  4JGO A;  2VA0 A;  2WYX A;  1JWZ A;  2PU2 A;  2VK3 A;  1SCW A;  4JXV A;  5EUA A;  1KVM A;  2V8C A;  3M6H A;  3S7N A;  3BY8 A;  2YKF A;  5HDS A;  3G2Z A;  4C75 A;  2CMN A;  1X0O A;  5A92 A;  3AGD A;  2ZC3 B;  2D02 A;  4GNU A;  1OPX A;  1T19 A;  1I2S A;  1D7E A;  3F1N B;  3BW6 A;  3T1R A;  1MKI A;  2FFY A;  3IXD A;  1YLZ A;  5LBR A;  1OTA A;  1V9Z A;  3ZDJ A;  4B88 A;  4HJ3 A;  1BLH A;  1IKI A;  4U0X A;  4LLO B;  4WLA A;  3LID A;  5A91 A;  3RH8 B;  1JWP A;  5KIZ A;  3T4O A;  4OPQ A;  3MS6 A;  1ESU A;  1ZG6 A;  2DCF A;  4NKP A;  2VGL M;  1BYW A;  2VZW A;  3LY3 A;  5FAS A;  2R78 A;  4RYE A;  3P98 A;  4KQQ A;  4GKU A;  4BD0 A;  2WGV A;  1LI0 A;  4HQA A;  1MKM A;  1F98 A;  2W1T A;  3ULF A;  4QJG A;  4QB8 A;  2C5W B;  3HUO A;  1UGU A;  2HP6 A;  3IF6 C;  2W3F A;  5DTS A;  3DW0 A;  1VB6 A;  2Z2L B;  3O5Y A;  2HP5 A;  4FH2 A;  2WZZ A;  4ARZ B;  1RGY A;  4KZ4 A;  2Y2M A;  2KX6 A;  2GNX A;  3IX8 A;  1XXM A;  4ZDX A;  3E2K A;  2ZQ9 A;  4R4S A;  3QP8 A;  3R7W B;  3PBS A;  1YQS A;  3HJK A;  5AQ9 A;  4E3N A;  1N9L A;  4WF0 A;  2ZL1 A;  5EE8 A;  4E3J A;  2ZQ7 A;  2ZD8 A;  1EI5 A;  3UNW A;  5DF9 A;  5CTM A;  3TRC A;  3PTE A;  3Q81 A;  4LRX C;  1K56 D;  1LI9 A;  4S2J A;  3NIA A;  3LIE A;  4NEE D;  3Q82 A;  1L0E A;  3NY4 A;  4RX3 A;  1CQA A;  1AXB A;  2H5S A;  1PI5 A;  4PMA A;  3ZQ5 A;  3V39 A;  1L2S A;  3HLC A;  3VFF A;  5CGX A;  2L4R A;  4ME4 A;  2IA2 A;  1KGF A;  2WGI A;  2ZC4 B;  3TOI A;  4BMW A;  5F6A A;  1PI4 A;  3TJZ C;  4HOI A;  4WBG A;  5KZH A;  3LI8 A;  5J7E A;  1W8Q A;  4LRY C;  4MN5 A;  3W2Z A;  1V9Y A;  3KSF A;  1F2K A;  1N9N A;  3E2L A;  3KSI A;  3MF0 A;  5HX9 A;  1GHI A;  4LCL A;  3FG8 A;  5FAP A;  3OLO A;  1W79 A;  4PHT A;  2W3D A;  3CAX A;  4HEF A;  3N8L A;  3EQV A;  4BBU A;  3VV4 A;  4M3K A;  5L2F A;  4B4Z A;  5HPI A;  1K57 C;  4EER A;  2VJW A;  2B5R A;  1UWP X;  1WYB A;  4Y7P A;  1WA9 A;  2A3U A;  3LI9 A;  3VSK A;  5DF8 A;  2JN7 A;  3OZH A;  1CI8 A;  3LIB A;  3G34 A;  1M6K A;  3W4O A;  3VP4 A;  3IXG A;  1SDE A;  5DVA A;  5D3O A;  3UPO A;  4RA7 A;  3LR0 A;  1FCN A;  3GV9 A;  4ESP A;  4OPZ A;  2EFU A;  3PBO A;  3EWK A;  3LFV A;  1SKO B;  1OTI A;  1N4O A;  4XXR A;  4BBV A;  4LV2 A;  3UE0 A;  3O87 A;  3UMD A;  1HTZ A;  3C4P A;  4GDB A;  3UDF A;  3CJM A;  4GLQ A;  5IHV A;  1W63 Q;  2J9P A;  1FCM A;  1YPR A;  4GN2 A;  4IVK A;  4FUW A;  3P01 A;  5FQ9 A;  4ZAM A;  4FH4 A;  3FV7 A;  1VET B;  1TS8 A;  2QWS A;  2PYP A;  2XD5 A;  4HH3 A;  3G31 A;  2KOI A;  2JHE A;  3MJQ A;  3BFF A;  1LL9 A;  2P9V A;  2PAV P;  3C30 A;  1F5M A;  1S4R A;  4EBP A;  4WUJ A;  3E4O A;  1VEU A;  4S2L A;  3VP2 A;  4U3T A;  1PZO A;  2P9V B;  3GMW A;  5CTN A;  1NZU A;  3DWK A;  4GS9 A;  3HLD A;  4KG6 A;  2PBD P;  3UE1 A;  4WEK A;  3MSH A;  2A49 A;  4F3L B;  5FQI A;  1O7E A;  5EM1 A;  1K25 A;  2V1A A;  4LV0 A;  4H8R A;  4QU3 A;  4IVI A;  1BSG A;  2H28 A;  3G2Y A;  4PKY G;  3SS4 A;  4PM9 A;  5GHZ A;  3U4L P;  3T4T A;  1K38 A;  2V9A A;  3VP3 A;  3MBZ A;  4HP9 A;  4IJG A;  4I39 A;  1MWS A;  4B9O A;  1MZU A;  4UEY A;  3ZG8 B;  5DKK A;  2HPB A;  5E2E A;  5TR7 A;  1LL5 A;  3NCK A;  4WYY A;  5IT5 A;  3D9Y A;  4R3B A;  3OBF A;  1PW1 A;  4GD8 A;  2ZJ9 A;  3LEZ A;  3E0Y A;  3UDI A;  5CHJ A;  1FQG A;  1CK3 A;  1TDL A;  2ZMV A;  2JE5 A;  5L10 A; 
#chains in the Genus database with same CATH homology
 3PR6 A;  3H7W A;  4R38 A;  3FPW A;  3E4P A;  4EEU A;  2GZA A;  3F1O B;  4NXE A;  2VV8 A;  1G6O A;  1XJ6 A;  2MJ6 A;  3PBN A;  3KX0 X;  4ETX A;  4HP4 A;  2J3W A;  5HDC A;  1S67 L;  4GHI A;  2VV6 A;  4ZRR A;  3TE8 A;  3MXQ A;  3IBJ A;  3LIA A;  3NOU C;  4XT2 B;  4H6J B;  5EFW A;  1YAX A;  3NOT C;  5F69 A;  1S1Z A;  2WKQ A;  2XA7 M;  4F3L A;  1TS0 A;  1ZHH B;  2JKR I;  3CIT A;  4O8G A;  2PD7 A;  2ZOI A;  3BWL A;  4MN7 A;  1P9R A;  3H82 B;  1H8M A;  3PBR A;  4WL9 A;  4JGO A;  4GS9 B;  1NRJ A;  2VA0 A;  3SW1 A;  5HSQ A;  4Y5F A;  4OOL A;  4ARZ A;  1ODV A;  3BY9 A;  1DP9 A;  4IHQ A;  3EGD C;  3S7N A;  3CUE A;  3BY8 A;  2YKF A;  3LR3 A;  3C2W A;  4IUH A;  5HDS A;  1KOU A;  2JKT M;  2NUP C;  1XJ3 A;  2CMN A;  1STZ A;  1X0O A;  4FSF A;  4G3V A;  2J80 A;  1N9O A;  3C38 A;  1D06 A;  2D02 A;  3CWF A;  3K3D A;  3EGX C;  1OPX A;  1T19 A;  3NOP C;  4YNR A;  5AJG A;  5HWT A;  1D7E A;  1YSQ A;  3F1N B;  2W1T B;  3BW6 A;  4II7 A;  2QYB A;  4G3W A;  3UME A;  4CLC E;  3LIF A;  3A0S A;  3BJN A;  3FC7 A;  4YOF A;  3PYP A;  1XJ4 A;  3NJA A;  4JGP A;  5LBR A;  3KO6 A;  1GSX A;  1OTA A;  1V9Z A;  5AVF A;  3PBQ A;  4HJ3 A;  4KQO A;  2A24 A;  4I5S A;  3RTY A;  5A8B A;  4LLO B;  4EEP A;  4WLA A;  3LID A;  4L9F A;  1VHM A;  4Q0H A;  2LB5 A;  3RH8 B;  2XRN A;  2W3G A;  5KIZ A;  1EW0 A;  3E4Q A;  3T4O A;  2WKR A;  1IFQ A;  3MR0 A;  4QPR A;  4NKP A;  3KSG A;  2VGL M;  4HIA A;  1BYW A;  3KYQ A;  2VZW A;  2EWV A;  2WKP A;  2R78 A;  2Z6C A;  4G3K A;  2QJ5 A;  3UB9 A;  1XJ2 A;  1UWN X;  3UB7 A;  2O99 A;  3JVU A;  4BJP A;  4HQA A;  5C5K A;  1MKM A;  2KDK A;  1F98 A;  3T4L A;  2W1T A;  3ULF A;  1YKD A;  5L8M A;  5F5Y A;  1NLY A;  2GX5 A;  2HJ9 C;  5DJT A;  1UGU A;  5TJJ A;  1T1B A;  3MQ0 A;  2QJ7 A;  5TBM A;  3IBR A;  4FOF A;  4EUV A;  4Q0J A;  4UQI M;  2W3F A;  3V67 A;  1VB6 A;  2O9A A;  2L0W A;  4Q0I A;  5HWV A;  5HPF A;  2KLI A;  3H9W A;  2OAQ 1;  2A2L A;  3LR4 A;  3O5Y A;  3MMH A;  4ARZ B;  3PBT A;  4EXO A;  2VLG A;  4CQH A;  2KX6 A;  2GNX A;  4KUO A;  3RFB A;  2VGL S;  5G4Y A;  4R6L A;  4KQD A;  5DKL A;  2V0U A;  1TD5 A;  3ZYT A;  4P6Z S;  3R7W B;  3R7W A;  3PBS A;  3HJK A;  2PDR A;  1TF1 A;  2YKH A;  3LUQ A;  2PT7 A;  1N9L A;  1OTB A;  3PHY A;  4DN0 A;  4WF0 A;  3LR5 A;  1OJG A;  4NXF A;  2XRO A;  4H6J A;  1DP8 A;  3S7P A;  4GJ4 A;  2B02 A;  4Z1W A;  1TS6 A;  4EQ1 A;  3T50 A;  4HI4 A;  5DF9 A;  2J3T D;  3TRC A;  4LRX C;  1S1Y A;  1OT6 A;  2W3H A;  3UE6 A;  3S7Q A;  2FZ0 A;  5DFX A;  2P04 A;  1LSX A;  3LIE A;  4NEE D;  2OWH A;  4PAU A;  5FL3 A;  2O9C A;  2V1B A;  1DP6 A;  4MCW A;  3CI6 A;  2O9B A;  2LB9 A;  1T1A A;  2HJE A;  4UQI S;  3F1P B;  3IS2 B;  3UB8 A;  4KUK A;  1OT9 A;  1IOU A;  3ZQ5 A;  4JGR A;  2OWJ A;  5HD3 A;  3D72 A;  2K7S A;  2Y8H A;  4DJ2 A;  2B18 A;  2L4R A;  3EQU A;  4ME4 A;  2IA2 A;  3MQQ A;  3T4S A;  1XFQ A;  2P7J A;  2VV7 A;  3KYZ A;  2I9V A;  4I3I A;  5F6A A;  4BMW A;  2DMW A;  2QKP A;  2Y79 A;  4O01 A;  2M7U A;  5J4E A;  3TJZ C;  4HOI A;  3LI8 A;  4EET B;  3DBA A;  4HH2 A;  1DRM A;  5DFY A;  5J7E A;  2PD8 A;  4LRY C;  4MN5 A;  3W2Z A;  1V9Y A;  3KSF A;  4CLC C;  4BWI A;  2ZBB A;  3EEH A;  2GJ3 A;  4DJ3 A;  1N9N A;  3KSI A;  1XFN A;  3BQ8 A;  3MF0 A;  3MQO A;  2D01 A;  2HGV A;  2JKT I;  1P9W A;  3FG8 A;  1T1C A;  5HWW A;  3ICY A;  3OLO A;  1G28 A;  2HF6 A;  5HL6 A;  1OJ5 A;  4PHT A;  3F1N A;  2W3D A;  3CAX A;  3EQV A;  4BBU A;  2XSS A;  3VV4 A;  4GHI B;  2K31 A;  5HPI A;  3TW8 A;  4EER A;  2VJW A;  1UWP X;  4JGQ A;  4P6Z M;  1WA9 A;  4LRZ E;  3LI9 A;  2EWW A;  4PKY A;  2JN7 A;  5TBM B;  2HV1 A;  3EEA A;  3OOV A;  1NWZ A;  3OCN A;  2PHY A;  2M1C A;  2BAS A;  1S66 L;  4EES A;  2W27 A;  2PR6 A;  3LIB A;  3E98 A;  4I3A A;  4EU0 A;  4NXG A;  2NUT C;  3D3O A;  4AFI A;  2P08 A;  3T4Q A;  1TS7 A;  2VKS A;  3P7N A;  3JVV A;  3LR0 A;  3R4K A;  4CLC B;  3H82 A;  1LSV A;  3PBO A;  4I38 A;  3EWK A;  4NXB A;  3LFV A;  3HJI A;  2K2N A;  3KSH A;  4YWZ A;  2OAP 1;  1OTI A;  2FH5 A;  2OOL A;  1YSP A;  4BBV A;  3UMD A;  4XT2 A;  1F9I A;  2W0N A;  2Z6D A;  3BQA A;  3GDI A;  2ZMF A;  4GLQ A;  2EA9 A;  5CX7 A;  4MDZ A;  1W63 Q;  1LT0 A;  1W63 M;  5AVE A;  4GW9 A;  3VE4 A;  2A24 B;  3P01 A;  4CLC D;  3A0R A;  2QWS A;  1TS8 A;  2PYP A;  3B33 A;  3U2A A;  5HDD A;  2W3E A;  5IS1 A;  4HH3 A;  4GCZ A;  3UE3 A;  3S7O A;  3T4J A;  2KOI A;  2PR5 A;  4Y2F A;  4CLC A;  4L0L A;  3GEC A;  3C8C A;  1T18 A;  1S4S A;  2JHE A;  3MJQ A;  2JKR M;  1JNU A;  4B93 A;  4HHD A;  1OTE A;  4EW7 A;  4I3J A;  3LIC A;  3C30 A;  2INW A;  3K2N A;  4LPZ A;  3VOL A;  2V0W A;  1ZTU A;  1F5M A;  2L1M A;  1S4R A;  4RQ9 A;  5K5B A;  4WUJ A;  3G6O A;  4WEL A;  3E4O A;  2XA7 S;  4OOM A;  5J3W A;  3MFX A;  2O0Y A;  5MC7 A;  3B42 A;  1GSV A;  4O0P A;  1P0Z A;  4GS9 A;  4HJ4 A;  4MN6 A;  3A0V A;  3K3C A;  2J3T C;  4HNB A;  3HCY A;  1H3Q A;  4L9E A;  4WEK A;  4M4X A;  4E04 A;  5IU1 A;  4F3L B;  5F68 A;  4IUK A;  2V1A A;  2G7U A;  2H28 A;  1MC0 A;  2ZOH A;  4MMN A;  1LL8 A;  4PKY G;  1OTD A;  3T4K A;  5KSH A;  3T4T A;  2PYR A;  3UB6 A;  4ETZ A;  2V9A A;  3F1O A;  1GSW A;  4WEJ A;  3H7W B;  3NHQ A;  1P97 A;  4HP9 A;  4R70 A;  4IJG A;  2QHK A;  1LSW A;  4I39 A;  2M7V A;  5HZH A;  2W1R A;  3FPV A;  4HJ6 A;  4B9O A;  1MZU A;  3B47 A;  3OCL A;  3CUE C;  3EOI A;  4UEY A;  4R3A A;  5DJU A;  5DKK A;  4DMZ A;  2VX8 A;  2VEA A;  4BBT A;  3LYX A;  4K08 A;  4L9G A;  5HD5 A;  3IS2 A;  5IT5 A;  1Y28 A;  3F1P A;  1NLZ A;  3PXP A;  3OBF A;  3E0Y A;  3VE3 A;  5I5L A;  5G4Z A;  3OC2 A;  2ZMV A;  4HY8 A;  4Y3I A;  4WN5 A;  3CLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...