3LYXA

Crystal structure of the pas domain of the protein cps_1291 from colwellia psychrerythraea. northeast structural genomics consortium target id csr222b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
DILKQRAKAFDYVFDAIVVTDLQGFIIDWNKGSETLYGYSKEQAIGQPVNMLHVPGDTEHITSEVISAVENQGKWTGEIRMLHKDGHIGWIESMCVPIYGENYQMVGALGINRDITKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensory box/GGDEF domain protein
publication title Crystal structure of the PAS domain of the protein CPS_1291 from Colwellia psychrerythraea. Northeast Structural Genomics Consortium target id CsR222B
rcsb
source organism Colwellia psychrerythraea
molecule tags Transcription
total genus 33
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3lyxA00
2PR6A 4I3IA 5F6AA 1DP8A 1V9YA 1Y28A 4HJ4A 3MR0A 2CMNA 4EQ1A 4K08A 3LIEA 2VLGA 3MQQA 4GS9B 4MN6A 1UGUA 3H9WA 2QKPA 3P7NA 2YKHA 1OT9A 4XT2A 3H7WA 5AVFA 3MFXA 1F9IA 1OJGA 3UE6A 3A0RA 1S1ZA 5DKLA 2M1CA 4NXGA 5J7EA 3E4QA 4WL9A 3IS2B 2OWJA 2OWHA 1D7EA 4H6JB 1F98A 3OLOA 4LRXC 1MZUA 3IBRA 1T1CA 2V0UA 2WKRA 4F3LB 5IS1A 1XJ6A 1GSXA 4WUJA 3F1OA 2QHKA 3CAXA 1OJ5A 4DJ3A 2YKFA 3LI8A 2PHYA 1X0OA 4HP4A 1S66L 5A8BA 5F68A 2W0NA 2L4RA 5TBMB 4GS9A 2J80A 3PYPA 4I38A 3C8CA 1S67L 5DJTA 1P0ZA 3LIAA 3UB7A 4EETB 2VEAA 4HH3A 2WKQA 2V1AA 3GDIA 1XJ4A 2Z6CA 4GW9A 5I5LA 3HJKA 1N9OA 1LSXA 1GSVA 1T19A 5HZHA 2L1MA 3H82B 2PR5A 1OT6A 4EW7A 3EEHA 4JGQA 4BBTA 5HD5A 1T1BA 5HDDA 2VV7A 3IS2A 4H6JA 4HP9A 2L0WA 3FC7A 4HOIA 2PYRA 3FG8A 3UB9A 3K3DA 1LT0A 3EWKA 3BY8A 4F3LA 4JGPA 2R78A 4HY8A 2H28A 4HNBA 2QJ7A 5EFWA 2PYPA 3VOLA 4EESA 2HV1A 4NXEA 5DJUA 3UMEA 4GHIB 5TBMA 1BYWA 4EEUA 1JNUA 1ODVA 3UB6A 1LSWA 3VE3A 1OTBA 4KUKA 2V1BA 4B9OA 1S4RA 3F1PB 4I5SA 1WA9A 1OTEA 2K7SA 1XFNA 4WN5A 2KX6A 5DKKA 2JN7A 2INWA 1N9LA 3VE4A 5HD3A 4HJ6A 3H82A 1T1AA 4I3JA 3ZQ5A 4KUOA 3KX0X 2ZOHA 5F5YA 1UWNX 1VB6A 3E4OA 1DRMA 4EERA 1TS8A 2PD7A 4PKYA 1OTDA 3NOTC 2D01A 1KOUA 3NHQA 4HQAA 4NXBA 3MQOA 3MXQA 4XT2B 1S1YA 2PD8A 2B02A 1LSVA 1LL8A 3LIBA 4HIAA 4GHIA 3E4PA 3LIFA 3F1NB 2QJ5A 2JHEA 4LPZA 4E04A 2V9AA 5HSQA 1S4SA 4R3AA 2EA9A 3F1PA 3K3CA 4MN5A 3MJQA 2PDRA 2ZBBA 1DP6A 4BBVA 3D72A 2W27A 3GECA 1XJ3A 4NXFA 4R6LA 2I9VA 1NWZA 4L9GA 3NJAA 1OTAA 5HWTA 4JGOA 5KIZA 3C2WA 2V0WA 3A0SA 4M4XA 2P7JA 2D02A 4BBUA 5J3WA 4HH2A 3F1OB 5HDCA 4PKYG 3G6OA 2BASA 3NOUC 4HHDA 4GCZA 5HWWA 3LIDA 3UMDA 3UB8A 2ZOIA 4R70A 3HJIA 4WF0A 3LUQA 3CWFA 4HI4A 4L9EA 1D06A 3LICA 1P97A 1XJ2A 5F69A 4EEPA 2KDKA 4JGRA 3BY9A 4I39A 5IU1A 3RTYA 3T50A 4L9FA 3F1NA 2Z6DA 2A24B 1OTIA 2VV6A 5AVEA 5G4ZA 1UWPX 4I3AA 4HJ3A 1N9NA 4WLAA 3B33A 5G4YA 3ULFA 1XFQA 2OOLA 3CLOA 4RQ9A 1EW0A 3H7WB 3BWLA 3A0VA 3LYXA 3PHYA 4LLOB 2VV8A 3LI9A 1DP9A 1G28A 3SW1A 5HWVA 3ICYA 5J4EA 1TS7A 4LRZE 4EXOA 4R38A 3NOPC 4KQDA 5HDSA 4LRYC 4DJ2A 2GJ3A 2QWSA 2WKPA 1V9ZA 3RH8B 4YWZA 1TS0A 1GSWA 1TS6A 2A24A 1T18A
chains in the Genus database with same CATH superfamily
1ZHHB 1ES5A 4E3NA 2VJWA 5EVIA 3PXPA 4DMZA 4JXGA 2JCHA 3G2YA 2V8FA 5F6AA 1QMEA 4S2MA 3MR0A 3LIEA 4GS9B 3AGEA 4MN6A 5BOHA 3M2JA 3T4SA 2QKPA 1LL9A 1FIKA 2YKHA 3T1QB 3V5MA 1STZA 4XT2A 3DWKA 1I2SA 3MFXA 4GN2A 4EBLA 2ZLYA 1P9WA 2ZL1B 2ZQCA 4Y17A 1OJGA 4MEZA 4OH0A 3A0RA 1YM1A 4UQIS 3RJUA 5EOEA 1XGJA 5FQMA 5DKLA 5J7EA 4GNUA 4NK3A 4WL9A 2OWHA 2OLVA 4FCFA 1D7EA 1F98A 3DTKA 1W79A 2PU2A 4GD6A 3ITBA 1MZUA 1T1CA 2LB9A 3PBSA 1FQGA 4C75A 2ZQ9A 3QP6A 4LCMA 4NKPA 3N4IA 2XR0A 4JF4A 2WKRA 4WZ5C 5HX9A 2Q9NA 3CAXA 1IYPA 1BSGA 4GDNA 1S66L 5A8BA 1FCMA 4BJPA 4ZTKA 4OONA 5TBMB 4E3LA 5L8MA 4GS9A 2J80A 4LV1A 3PYPA 2EFXA 3N8LA 5DJTA 1ESIA 2JKFA 1P0ZA 4M3KA 2J8YA 2Y2OA 3UB7A 3VP0A 3ZVWA 1XA7A 4U3TA 5F1FA 1NLYA 4DDYA 3GDIA 1XJ4A 3D9YA 1YMSA 2ZL1A 1GHPA 1N9OA 3P01A 3V3SA 2L1MA 1MWUA 3OBFA 1F5MA 4ME4A 2PR5A 5FEGA 3QNCA 1PW8A 2J9OA 3EEHA 1K54A 5HD5A 2FH5A 4S2NC 3TJZC 5CHUA 2CC1A 3QP5A 2ZM0A 3W2ZA 3VP4A 2W1TB 1W5DA 2EWWA 4X55A 2PYRA 4GDBA 1SCWA 4YINA 1CEGA 3GTCA 4IJGA 5A92A 1KVLA 1JWZA 5FQIA 1AXBA 3N8SA 1YLYA 3T1SA 3VSKA 3FKVA 5G18A 3WS4A 2ZJ9A 3VV4A 1YQSA 2B5RA 3D4FA 1SHVA 3PBQA 4EESA 3SOIA 2HDUA 3WS0A 2ZMFA 5DJUA 3UMEA 5TBMA 3G35A 3TSGA 1G6OA 4GD8A 2XEPA 2Y59A 1RGYA 3IXGA 4FOFA 2V1BA 3S22A 1S4RA 1K25A 1WA9A 1IEMA 2K7SA 1XFNA 1NRJA 2RL3A 1PIOA 2INWA 4PM8A 3S1YA 1N9LA 4BWIA 3VE4A 2HZ5A 5FA7A 3SZTA 1PFLA 4BQMA 1EI5A 4JF6A 1T1AA 4I3JA 1NRFA 3PBTA 3SH9A 5L07A 4PHTA 4KZ3A 4KUOA 3JVVA 3IT9A 2Z2MB 5IHVA 2W1TA 3BJNA 4DF6A 4O8GA 3E4OA 1DRMA 3TG9A 1HLUP 1MXOA 1TS8A 5CRFA 3IXBA 4X1MA 1OTDA 2D01A 4QY5A 1SDEA 4DXBA 4NXBA 1VHMA 2ZC7A 5EV0A 1XPBA 3SH7A 5HFOA 3T4KA 4EU0A 1S1YA 1LSVA 3BLMA 2VGKA 1H0MA 5FI2A 4HIAA 2WAFA 4E3JA 4EBPA 4R0QA 2QJ5A 3E0YA 1KDWA 1YPRA 3LEQA 4MNRA 2GX5A 4NEED 3SS3A 4G3KA 3JPUA 1KGEA 3LR5A 4Y2FA 2X71A 3K3CA 2PDRA 3CUEC 4ZBEA 2W27A 1Y4OA 2XA7S 2P9VB 2WZXA 3Q1FA 3EQVA 4PAUA 3HL9A 5E2HA 5HWTA 4JGOA 1OPXA 5HAPA 3C2WA 3PR6A 3A0SA 4BBUA 2PT7A 1VETB 4DRTA 5TGFA 4CLCD 5M1AA 1NXYA 3DTMA 1GA0A 3CI6A 3CJMA 4PPRA 1O07A 3LIDA 3PAGA 4BL3A 1IKGA 5TR7A 1N4OA 3LR0A 4O01A 1YSPA 2ZOIA 1JTDA 4U0TA 1VM1A 4WF0A 1TEMA 1ACFA 4X56A 4X6TA 2WKHA 2B95A 5DFYA 2FFYA 5JYOA 2QPNA 1PRQA 1BT5A 4OQIA 2FFFB 4R4SA 4JGRA 3BY9A 4IVIA 5IU1A 1IYSA 2K31A 2J3TC 2V1ZA 1NYYA 4L9FA 3VP1A 3BFFA 5AVEA 3MKEA 3MBZA 3WS5A 5FDSA 5KSHA 1H8YA 1L0DA 2P9VA 5G4YA 3I7JA 4OPQA 3QHYA 3OZHA 2WGVA 3Q82A 3V39A 2Y4AA 1XFQA 5E43A 2XFSA 2HJ9C 4QWOA 1VETA 3BEBA 4P6BA 1EW0A 3E98A 3OOVA 1K4EA 5TFQA 3LYXA 3TOIA 3MFDA 3IHAA 2ZC6B 4ID4A 4LV3A 3IXDA 1CI8A 2XRNA 1G28A 3GV9A 3FZCA 2H5SA 5F83A 1W8QA 3MQ0A 4EBNA 3ZG7B 4EXOA 4R38A 1YMXA 3PBOA 4MLLA 3EGDC 3UE3A 2XD5A 2QWSA 5CTNA 2W3HA 4E6WA 5HAQA 3CUEA 4Y3IA 4UHUA 1TS6A 3HLDA 2ZM8A 1H8ZA 2ZM2A 3UO9A 5KZHA 3CZDA 3PAEA 1C3BA 2ZQDA 4I3IA 3V67A 1V9YA 4K08A 3GRJA 3NULA 1CQAA 5HPIA 3P7NA 1RP5A 4PM9A 3B47A 2QYBA 4GKUA 3BFCA 4H8RA 2Y79A 1YKDA 4K91A 1YLWA 3QP2A 2P74A 1S0WA 4Y0OA 2GZAA 1PYYA 3OC2A 5DF9A 5MC7A 2Y2LA 3OPHA 1FCOA 4FH2A 1HD8A 2C6WB 1DY6A 2OWJA 2JKRM 1GHMA 4DN0A 3Q7ZA 4DE0A 2JC7A 3IBRA 2QZ6A 4UA6A 2V0UA 2WKEA 3IHBA 5CGXA 3B42A 4F3LB 1JWVA 2XDMA 4CLCB 5IS1A 1XJ6A 3ZG8B 4DJ3A 2G7UA 4ESPA 2PHYA 3E2KA 3CHWP 4E6XA 2NUPC 3O87A 3VFFA 1LLBA 1PW1A 3IXHA 3C8CA 1YLJA 1S67L 4MDZA 4N1HA 5D3OA 3ZG5A 4QHCA 4X69A 3G32A 4FSFA 5FAQA 3W4OA 2WKQA 1ZKJA 1K6RA 2V1AA 5EM0A 3UDFA 4EUVA 3RXXA 3A3JA 3HJKA 2Y2NA 1LSXA 1MKMA 3WRZA 4MBFA 5GLDA 5L10A 1HVBA 4JGQA 4BBTA 2FZ0A 4Y7PA 1T1BA 5HDDA 2H0TA 5HPFA 2WGIA 2PU4A 3EQUA 3SS4A 2BG1A 2HPBA 2L0WA 3FV7A 3FC7A 4HOIA 1BZAA 1TVFA 5CTMA 3SH8A 4QD4A 3IWOA 1L3LA 1LI0A 1NJ4A 4D2OA 5DTKA 4F3LA 4CLCA 4JGPA 3IX4A 4C3QA 3GR2A 4BL2A 3CPTB 3VOLA 3KYZA 4NXEA 4E3IA 4EUZA 1QMFA 5GHYA 3GMWA 1JNUA 1G68A 3UB6A 1MBLA 4S2OA 1LSWA 2XQZA 3VE3A 2WGWB 4KUKA 3FPVA 3HUMA 3F1PB 1FR1A 1IELA 3GQZA 4OPYA 3L7HA 3VP3A 2V8CA 4OPRA 3ITAA 2VX8A 1ES3A 3HLCA 4EWFA 4YNRA 1HTZA 1BLPA 1XX2A 1PNEA 1KVMA 1Z6FA 2EXBA 3DW0A 3DTIA 1L0EA 3MKFA 2ZOHA 3S4XA 1UWNX 4PM6A 1VB6A 4PM5A 4OOLA 4EERA 4NETA 4E3MA 1PZOA 2H0YA 1XA1A 3GVBA 5EE8A 3TE8A 3MXQA 4IHQA 4XUXA 4HBUA 2E8IA 3CPTA 4S2KA 2G2WA 2B02A 4OVDA 1SKFA 1RGZA 1I2WA 2VGLS 1FR6A 3IF6C 1PI5A 3RXWA 1ALQA 4LPZA 5HL6A 4Y5FA 3U2AA 5A90A 3F1PA 4LFUA 1DP6A 4LENA 3C4PA 4L9GA 5AQ7A 5DFXA 1YLPA 2V0WA 3ZGAB 3WRTA 2D02A 2VKSA 2WKIA 1Y54A 3F1OB 4OOYA 5HDCA 3C7VA 2BASA 2ZMVA 1FCNA 3UY6A 4HHDA 2PAVP 3ZNYA 4IUKA 5FASA 3HREA 2HJEA 5M18A 3O5YA 4K0XA 4CPKA 4R70A 3ZFZA 3HJIA 1K4FA 3LUQA 3TRCA 3CWFA 4Z1WA 1N9BA 4WEJA 5CERA 1LHYA 1S6RA 2J3TD 3BYDA 4KZ6A 4IUHA 3ZG9B 1ES4A 4I39A 5HW3A 5EOOA 3N6IA 2A24B 5G4ZA 3M6HA 4K0WA 4I3AA 4DXCA 5E2FA 3T1XA 1SZVA 4WZ5A 2LB5A 1BUEA 3MF0A 5FQQA 2K2NA 2VGJA 3KO6A 4MBHA 5CEBA 3B3XA 3ULFA 3HLGA 2R9WA 3WS2A 2W1RA 4R3BA 2QMIA 3A3EA 3JVUA 1M6KA 3BWLA 1W63Q 3A0VA 3U4LP 2AVXA 4LLOB 3OPPA 4R4RA 1G6AA 4KZ7A 3EGXC 4UAAA 2XFTA 1PWDA 5CEDA 1HZOA 4QB8A 1YLZA 3O88A 4JKTA 2ZD8A 1W63M 1RCJA 1BLHA 4JBFA 3MXSA 4PMAA 4DJ2A 1CK3A 4G3VA 2WUQA 4S2NA 5K5BA 1V9ZA 3SS5A 3V50A 2XH9A 4DDSA 2A24A 1K57C 2WAEA 1A0KA 4JXSA 4GOGA 4OOMA 1GHIA 4RYEA 5CXWA 2JKTM 2IWBA 1XKZA 5EECA 1DP8A 4NG2A 3EOIA 1L2SA 2ACGA 3MQQA 2DCFA 4P0MA 2PBYA 4R3JA 5FL3A 2IA2A 1OT9A 4ETZA 3IQAA 4WYYA 2NUTC 2Y2HA 5AVFA 4B88A 1ONGA 1TF1A 2Q0OA 4ZDXA 3VFHA 4LV0A 5C5KA 1F9IA 3UPOA 1W8YA 2Y2PA 3HLEA 5AJGA 3LO7A 4E3OA 2EXAA 2ZQAA 3UN7A 1MWRA 1S1ZA 2M1CA 4NXGA 3E4QA 1H5XA 5CECA 3IS2B 4BD0A 4R23A 4H6JB 3OLOA 3N7WA 4LRXC 4U0XA 3PBNA 2JE5A 3IF5A 2PRFA 3NDEA 5F82A 4JLFA 2GDNA 5CGWA 3C38A 4FTXA 3MXRA 1GSXA 5EVEA 1OJ5A 2KLIA 2YKFA 3LI8A 3Q07A 4LCLA 2W0NA 3ZG0A 5I94A 2L4RA 1P9RA 3ZCZA 4YOFA 1E25A 4IBXA 1YAXA 3LIAA 4OLDA 5HAIA 3BQ8A 4EETB 2W3EA 4HH3A 4UA7A 5M19A 3G2ZA 4KQRA 2O99A 1IYOA 3MMHA 4QPRA 1JWPA 4FD8A 2Y2MA 2Z6CA 5EVLA 3HLBA 4AFIA 1T19A 5HZHA 1VQQA 3N8RA 1KGFA 4EW7A 3T4LA 1FILA 1XP4A 5DF7A 1WE4A 3IS2A 4RVAA 5FQKA 5J8XA 2HF6A 4H6JA 4HP9A 4ZJ1A 4OQGA 2Y91A 1U60A 1LT0A 5FEFA 2A2LA 5AQBA 3PTEA 1E3UD 5EVIC 4HBTA 4N1XA 4BENA 2R78A 2Y2KA 5FI6A 2H28A 2JKTI 4HNBA 5EFWA 2PYPA 1Z09A 4DE3A 4MN7A 2HDRA 1ERMA 3ZVTA 2J3WA 4S2LA 1IFQA 1BYWA 4A5RA 3Q81A 1ODVA 3FKWA 3R7WB 1W7FA 3V3RA 3ZYTA 1OTBA 3W8KA 4C6YA 4B9OA 1IKIA 3HUOA 3E2LA 1ZTUA 1GCEA 4I5SA 1F2KA 3IH8A 3VMAA 3KSIA 3S7PA 1XXMA 2KX6A 5DKKA 4O0PA 3HCYA 2Y8HA 2M7UA 2JN7A 2DRWA 4QU3A 1CEFA 2W3GA 1BLSA 1MWSA 3BQAA 3L9KA 1KE4A 4OLGA 3ZQ5A 3QP1A 3VSLA 2HP5A 1E4DA 1WYBA 1MPLA 3LY4A 4GZBA 3S7NA 4WBGA 5F1GA 3MS6A 3MSHA 4RX3A 2EFUA 1CF0A 1SDNA 5GLBA 1NZUA 2XF3A 2PD7A 4PKYA 3NOTC 3NHQA 3CITA 4UEYA 5A93A 5EM1A 4KZAA 4XT2B 2P04A 3IWIA 5DVAA 4PM7A 5AQAA 3W4PA 3LIBA 4FUWA 4IBRA 5CHMA 1DJBA 3E4PA 4OP8A 2JHEA 3R7WA 2OLUA 3HLWA 2BLSA 5HL1A 1MWTA 4JPMA 4E04A 1NYMA 2V9AA 5HSQA 1S4SA 4R3AA 3FYZA 3UE0A 2RCXA 4X1LA 3NECA 2UV0E 3HLFA 3D72A 3GECA 4YFMA 4R6LA 2I9VA 5LBRA 1NWZA 2I72A 2XD1A 1OTAA 4MMNA 5KIZA 4Q8IA 4KZ9A 5J3WA 2VK3A 4PKYG 3O86A 3G6OA 1CI9A 3T4QA 5GLAA 2Y2QA 3NOUC 4X25A 2XROA 4Y0UA 2UWXA 4P6ZM 2XA7M 3UMDA 2VZWA 4P87A 4IEDA 3NIAA 5FSRA 1NLZA 3LICA 1P97A 5EUAA 5DF8A 3T1RA 4KQOA 5F69A 4LV2A 2IWCA 1TDLA 1K56D 2KDKA 3R4KA 3RTYA 5KSCA 3T50A 4CLCE 4WEKA 2Z6DA 1K55C 3S7OA 3NCKA 1OTIA 5DTTA 2VV6A 2B18A 1UWPX 3KYQA 4S2IA 3ZHHA 1YSQA 2JKRI 2O9CA 3IWQA 2XK1A 5GL9A 2DNSA 4RX2A 1N9NA 1FSYA 3G30A 3OCLA 4WLAA 3B33A 1YT4A 1SKOB 2HGVA 3VP2A 2WZZA 4WMCD 2OOLA 2WYXA 3WS1A 4RQ9A 2Y55A 3CG5A 3H7WB 3LY3A 3PHYA 2VV8A 2A49A 2XLNA 2H10A 3LI9A 4II7A 1DP9A 1ERQA 5FQ9A 4Y0TA 3LEZA 3W4QA 1ZG6A 2WGWA 3ICYA 4JXWA 4KQDA 4Y15A 4Q0JA 4ARZB 4Y13A 2WKPA 2Q9MA 5JYPA 1IYQA 3MZDA 3JYIA 1DJCA 2OSUA 4B4ZA 3MZEA 3C30A 1MC0A 2JBFA 3UNWA 3BW6A 3G34A 4XXRA 1NY0A 2V20A 2PR6A 4GB7A 5KMWA 1E3UA 1H3QA 1Y28A 4HJ4A 2CMNA 3UDIA 4EQ1A 1SKOA 5GHZA 2VLGA 3CMZA 1UGUA 3H9WA 4X68A 1EWZA 3FPWA 5E2GA 3H7WA 3IF6B 3VOZA 2EX8A 4QY6A 1ESUA 2E8JA 5EPHA 4OQHA 4D60A 3BFGA 3HUNA 3UE6A 3UE1A 1O7EA 4HEFA 4FH4A 1CJFA 3P98A 3GSGA 4ZAMA 1K55A 2OV5A 4MCWA 3AGFA 4S2PA 4ARZA 3NI9A 2O0YA 3LFVA 3FWLA 4ETXA 5CX7A 2Z2LB 4KZ8A 3IX8A 2HDSA 4QJGA 1JTGA 3WWXA 2ZC3B 4WUJA 4DE2A 4ZRRA 3OPRA 1AWIA 3F1OA 2DMWA 2QHKA 1GA9A 2W3FA 4P85A 4BMWA 1X0OA 4HP4A 5CHJA 5F68A 1MY8A 3MZFA 3HVFA 4O7DA 4ZJ3A 3BFEA 3LR3A 3A3FA 4I38A 2ZQ8A 2W3DA 2M7VA 3AGDA 2VEAA 3IF6A 2X02A 3NDGA 4LGWA 1FOFA 4GW9A 5I5LA 2HDQA 1PWGA 5IT5A 2OAP1 1GSVA 3KSGA 2OAQ1 2EX9A 4KZBA 3H82B 4Z9QA 1OT6A 2ZMAA 1WYCA 5FATA 1ZC2A 2VV7A 4L0LA 2HP9A 1ZG4A 3ZDJA 3BRMA 3M2KA 4P6ZS 5FAOA 3UDXA 3FG8A 3KSFA 4MBKA 5EVID 4CQHA 3UB9A 3K3DA 5FI7A 3EWKA 3BY8A 1LI9A 3ISGA 1BULA 4X53A 1ES2A 1LL5A 2MJ6A 3LGOA 4DE1A 4OP5A 4HY8A 5U47A 4BD1A 1KGGA 3QP8A 1KDSA 1KE3A 2J7VA 2QJ7A 3DWZA 3S7QA 4Q0IA 2XGNA 2HV1A 5A91A 2PBDP 4E3KA 4GHIB 4EEUA 4G3WA 1XGIA 3IH9A 3UPPA 1PI4A 3OPLA 5FDHA 2IWDA 1OTEA 1K56A 4WN5A 2ZC5B 1OMEA 4ZJ2A 1YLTA 3M6BA 2Y2IA 2V2FF 5AQ9A 1ONHA 3BLSA 5GHXA 1M40A 5HD3A 3UPNA 4HJ6A 3IBJA 3H82A 3BECA 1G5UA 2EX2A 1FSWA 2O9BA 4UQIM 2GNXA 3A3DA 3HBRA 3KX0X 4KZ4A 3G4PA 2XSSA 5F5YA 3Q7VB 4WMCA 3T4OA 3DAVA 4KENB 1KOUA 4HQAA 3MQOA 3VOYA 4B93A 3C7UA 1PWCA 4BLMA 3DBAA 1PZPA 3PBRA 2EWVA 3IX3A 1TD5A 1BTLA 2PD8A 1LL8A 2X01A 3OCNA 4Q0HA 4EV4A 2KOIA 4GHIA 2ZC4B 4OQ0A 1L0FA 3LIFA 3BM6A 3F1NB 1Q2QA 5GLCA 1J3WA 3NC8A 5L2FA 1K38A 3EEAA 2EA9A 5L09A 3QP4A 4MN5A 3MJQA 2ZBBA 4BBVA 3TW8A 1K57A 5HARA 3BFDA 1XJ3A 3DTEA 4NXFA 4HESA 3K2NA 1K6SA 2ZQ7A 3NJAA 2VGLM 3T4JA 4M4XA 1NZOA 2P7JA 5FAPA 3NY4A 4HH2A 4XUZA 4OKPA 5FQJA 4JF5A 3QNBA 1KE0A 1Q2PA 4CLCC 3Q7VA 4GCZA 5HWWA 2WADA 2R9XA 2EX6A 2A3UA 2HP6A 3UB8A 2G2UA 4GJ4A 4F94A 4HI4A 2Y2GA 4L9EA 1D06A 4WZ4A 1XJ2A 1L0GA 1MKIA 3T4TA 2VA0A 4EEPA 3LCEA 1VEUB 3F1NA 5TJJA 2Y2JA 1JVJA 3P09A 5CGSA 1K0KA 4HJ3A 4WM9A 5EVIB 3ZNTA 4KG5A 3UB5P 2C5WB 2BTFP 4N9LA 2JKGA 4N9KA 1DJAA 1TDGA 2P08A 3CLOA 4EQIA 3C5AA 1H8MA 4KZ5A 1I5QA 3KYEA 4WELA 4CJNA 2WK0A 2O9AA 4KQQA 3KSHA 4DKIA 3T12B 3SW1A 4KG6A 3LR4A 4R1GA 5HWVA 1EROA 3G31A 5J4EA 1TS7A 4LRZE 1J9MA 3NOPC 4UA9A 5E2EA 3D3OA 4B4XA 4RA7A 3O3VA 4IVKA 1D1JA 5HDSA 2J9PA 4LRYC 3NBLA 2GJ3A 4JXVA 1BLCA 4GLQA 3RH8B 1K54C 4S2JA 4YWZA 1TS0A 3RFBA 3A3IA 1VEUA 3C4OA 4KG2A 4OPZA 1GSWA 1IOUA 4N92A 1T18A 5DTSA
chains in the Genus database with same CATH topology
1ZHHB 3BW6A 2VJWA 4OOMA 3PXPA 2JKTM 4DMZA 2PR6A 4I3IA 5F6AA 1DP8A 3V67A 1V9YA 1H3QA 1Y28A 4HJ4A 3MR0A 2CMNA 4EQ1A 3EOIA 4K08A 3LIEA 2VLGA 3MQQA 4GS9B 4MN6A 1UGUA 3H9WA 2QKPA 3T4SA 5HPIA 3P7NA 2YKHA 5FL3A 2IA2A 1STZA 1OT9A 3B47A 3FPWA 4XT2A 4ETZA 2NUTC 3H7WA 2QYBA 5AVFA 1TF1A 3MFXA 2Y79A 1YKDA 5C5KA 1F9IA 1P9WA 5AJGA 1OJGA 3UE6A 2GZAA 3A0RA 3OC2A 5DF9A 4UQIS 5MC7A 1S1ZA 5DKLA 2M1CA 4NXGA 5J7EA 3E4QA 4WL9A 3IS2B 2OWJA 2OWHA 2JKRM 1D7EA 4H6JB 4MCWA 4DN0A 1F98A 4ARZA 3OLOA 4LRXC 3PBNA 1MZUA 2O0YA 3IBRA 1T1CA 2V0UA 2LB9A 3LFVA 3PBSA 5CX7A 4ETXA 3B42A 4NKPA 3C38A 2WKRA 4F3LB 4CLCB 5IS1A 1XJ6A 1GSXA 4WUJA 4ZRRA 3F1OA 2DMWA 2QHKA 3CAXA 1OJ5A 2KLIA 2W3FA 4DJ3A 2G7UA 2YKFA 3LI8A 4BMWA 2PHYA 1X0OA 4HP4A 1S66L 5A8BA 4BJPA 5F68A 2W0NA 2NUPC 2L4RA 5TBMB 5L8MA 3LR3A 2J80A 4GS9A 1P9RA 3PYPA 4I38A 2W3DA 3C8CA 4YOFA 2M7VA 1S67L 5DJTA 4MDZA 1P0ZA 1YAXA 3LIAA 3UB7A 4FSFA 3BQ8A 4EETB 2W3EA 2VEAA 4HH3A 2WKQA 2O99A 2V1AA 3MMHA 4QPRA 4EUVA 1NLYA 3GDIA 1XJ4A 2Z6CA 4GW9A 5I5LA 3HJKA 1N9OA 3P01A 5IT5A 1LSXA 2OAP1 1GSVA 4AFIA 1MKMA 1T19A 3KSGA 2L1MA 5HZHA 2OAQ1 3OBFA 1F5MA 3H82B 4ME4A 2PR5A 1OT6A 4EW7A 3EEHA 3T4LA 4JGQA 4BBTA 2FZ0A 5HD5A 2FH5A 1T1BA 5HDDA 2VV7A 3TJZC 4L0LA 5HPFA 3IS2A 3W2ZA 3EQUA 2HF6A 4H6JA 4HP9A 2W1TB 2L0WA 2EWWA 4P6ZS 3FC7A 4HOIA 2PYRA 3FG8A 3KSFA 4CQHA 3UB9A 3K3DA 1LT0A 3EWKA 2A2LA 4IJGA 3BY8A 4F3LA 4CLCA 4JGPA 2R78A 2MJ6A 4HY8A 2H28A 2JKTI 4HNBA 2QJ7A 3VV4A 5EFWA 2PYPA 3VOLA 3S7QA 4Q0IA 3KYZA 4MN7A 3PBQA 4EESA 2HV1A 2J3WA 1IFQA 4NXEA 2ZMFA 5DJUA 3UMEA 4GHIB 5TBMA 1BYWA 4EEUA 1G6OA 4G3WA 1JNUA 1ODVA 3UB6A 3R7WB 1LSWA 3VE3A 3ZYTA 1OTBA 4FOFA 4KUKA 2V1BA 3FPVA 4B9OA 1S4RA 1ZTUA 3F1PB 4I5SA 1WA9A 3KSIA 1OTEA 2K7SA 1XFNA 4WN5A 3S7PA 1NRJA 2KX6A 5DKKA 4O0PA 3HCYA 2Y8HA 2M7UA 2JN7A 2INWA 1N9LA 2W3GA 2VX8A 4BWIA 3VE4A 5HD3A 4YNRA 4HJ6A 3IBJA 3H82A 3BQAA 1T1AA 4I3JA 3PBTA 2O9BA 4UQIM 2GNXA 3ZQ5A 4PHTA 4KUOA 3JVVA 3KX0X 3S7NA 2W1TA 2ZOHA 2XSSA 5F5YA 1UWNX 3BJNA 1VB6A 4O8GA 3E4OA 4OOLA 1DRMA 4EERA 3T4OA 1TS8A 2PD7A 4PKYA 1OTDA 3NOTC 2D01A 1KOUA 3NHQA 4HQAA 4NXBA 3MQOA 1VHMA 4B93A 3TE8A 3CITA 3MXQA 4UEYA 4IHQA 3DBAA 4XT2B 3T4KA 4EU0A 3PBRA 2EWVA 1TD5A 1S1YA 2P04A 2PD8A 2B02A 1LSVA 1LL8A 3LIBA 3OCNA 4Q0HA 4HIAA 2KOIA 4GHIA 2VGLS 3E4PA 3LIFA 3F1NB 2QJ5A 2JHEA 3R7WA 3E0YA 4LPZA 5HL6A 2GX5A 4NEED 4Y5FA 4E04A 2V9AA 5HSQA 4G3KA 3EEAA 3U2AA 1S4SA 4R3AA 2EA9A 3LR5A 3F1PA 4Y2FA 3K3CA 4MN5A 3MJQA 2PDRA 2ZBBA 1DP6A 4BBVA 3CUEC 3TW8A 3D72A 2W27A 3GECA 1XJ3A 4NXFA 2XA7S 3EQVA 4R6LA 2I9VA 3K2NA 1NWZA 5LBRA 4PAUA 4L9GA 3NJAA 5DFXA 1OTAA 2VGLM 5HWTA 4JGOA 1OPXA 4MMNA 3T4JA 5KIZA 3C2WA 3PR6A 2V0WA 3A0SA 4M4XA 2P7JA 2D02A 4BBUA 5J3WA 2VKSA 2PT7A 4HH2A 3F1OB 5HDCA 4CLCD 4PKYG 3G6OA 2BASA 2ZMVA 3T4QA 3NOUC 3CI6A 2XROA 4HHDA 4CLCC 4GCZA 5HWWA 3LIDA 4IUKA 4P6ZM 2HJEA 2XA7M 3UMDA 3O5YA 3LR0A 4O01A 3UB8A 1YSPA 2ZOIA 2VZWA 4R70A 3HJIA 4GJ4A 4WF0A 3LUQA 3TRCA 1NLZA 3CWFA 4HI4A 5DFYA 4L9EA 4Z1WA 1D06A 4WEJA 3LICA 1P97A 1XJ2A 2J3TD 4KQOA 5F69A 3T4TA 4IUHA 2VA0A 4EEPA 2KDKA 3R4KA 3BY9A 4I39A 4JGRA 5IU1A 2K31A 3RTYA 2J3TC 3T50A 4L9FA 4CLCE 4WEKA 3F1NA 2Z6DA 5TJJA 3S7OA 2A24B 1OTIA 2VV6A 5AVEA 2B18A 5G4ZA 1UWPX 3KYQA 1YSQA 2JKRI 2O9CA 4I3AA 4HJ3A 5KSHA 2LB5A 1N9NA 3MF0A 2K2NA 3OCLA 4WLAA 3B33A 5G4YA 3KO6A 3ULFA 2HGVA 1XFQA 2OOLA 2HJ9C 2W1RA 2P08A 3CLOA 3JVUA 4RQ9A 1H8MA 1EW0A 3E98A 3H7WB 3OOVA 3BWLA 1W63Q 3A0VA 3LYXA 3PHYA 4WELA 4LLOB 2VV8A 3EGXC 2O9AA 3LI9A 4II7A 1DP9A 2XRNA 1G28A 3KSHA 3SW1A 3LR4A 5HWVA 3MQ0A 3ICYA 5J4EA 1TS7A 4LRZE 1W63M 4EXOA 4R38A 3NOPC 4KQDA 3D3OA 5HDSA 3PBOA 3EGDC 4Q0JA 4LRYC 4DJ2A 3UE3A 4ARZB 2GJ3A 4G3VA 2QWSA 2WKPA 5K5BA 1V9ZA 4GLQA 3RH8B 4YWZA 1TS0A 2W3HA 3RFBA 3CUEA 4Y3IA 1GSWA 1IOUA 1TS6A 2A24A 1T18A 3C30A 1MC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR6 A;  4I3I A;  5F6A A;  1DP8 A;  1V9Y A;  1Y28 A;  4HJ4 A;  3MR0 A;  2CMN A;  4EQ1 A;  4K08 A;  3LIE A;  2VLG A;  3MQQ A;  4GS9 B;  4MN6 A;  1UGU A;  3H9W A;  2QKP A;  3P7N A;  2YKH A;  1OT9 A;  4XT2 A;  3H7W A;  5AVF A;  3MFX A;  1F9I A;  1OJG A;  3UE6 A;  3A0R A;  1S1Z A;  5DKL A;  2M1C A;  4NXG A;  5J7E A;  3E4Q A;  4WL9 A;  3IS2 B;  2OWJ A;  2OWH A;  1D7E A;  4H6J B;  1F98 A;  3OLO A;  4LRX C;  1MZU A;  3IBR A;  1T1C A;  2V0U A;  2WKR A;  4F3L B;  5IS1 A;  1XJ6 A;  1GSX A;  4WUJ A;  3F1O A;  2QHK A;  3CAX A;  1OJ5 A;  4DJ3 A;  2YKF A;  3LI8 A;  2PHY A;  1X0O A;  4HP4 A;  1S66 L;  5A8B A;  5F68 A;  2W0N A;  2L4R A;  5TBM B;  4GS9 A;  2J80 A;  3PYP A;  4I38 A;  3C8C A;  1S67 L;  5DJT A;  1P0Z A;  3LIA A;  3UB7 A;  4EET B;  2VEA A;  4HH3 A;  2WKQ A;  2V1A A;  3GDI A;  1XJ4 A;  2Z6C A;  4GW9 A;  5I5L A;  3HJK A;  1N9O A;  1LSX A;  1GSV A;  1T19 A;  5HZH A;  2L1M A;  3H82 B;  2PR5 A;  1OT6 A;  4EW7 A;  3EEH A;  4JGQ A;  4BBT A;  5HD5 A;  1T1B A;  5HDD A;  2VV7 A;  3IS2 A;  4H6J A;  4HP9 A;  2L0W A;  3FC7 A;  4HOI A;  2PYR A;  3FG8 A;  3UB9 A;  3K3D A;  1LT0 A;  3EWK A;  3BY8 A;  4F3L A;  4JGP A;  2R78 A;  4HY8 A;  2H28 A;  4HNB A;  2QJ7 A;  5EFW A;  2PYP A;  3VOL A;  4EES A;  2HV1 A;  4NXE A;  5DJU A;  3UME A;  4GHI B;  5TBM A;  1BYW A;  4EEU A;  1JNU A;  1ODV A;  3UB6 A;  1LSW A;  3VE3 A;  1OTB A;  4KUK A;  2V1B A;  4B9O A;  1S4R A;  3F1P B;  4I5S A;  1WA9 A;  1OTE A;  2K7S A;  1XFN A;  4WN5 A;  2KX6 A;  5DKK A;  2JN7 A;  2INW A;  1N9L A;  3VE4 A;  5HD3 A;  4HJ6 A;  3H82 A;  1T1A A;  4I3J A;  3ZQ5 A;  4KUO A;  3KX0 X;  2ZOH A;  5F5Y A;  1UWN X;  1VB6 A;  3E4O A;  1DRM A;  4EER A;  1TS8 A;  2PD7 A;  4PKY A;  1OTD A;  3NOT C;  2D01 A;  1KOU A;  3NHQ A;  4HQA A;  4NXB A;  3MQO A;  3MXQ A;  4XT2 B;  1S1Y A;  2PD8 A;  2B02 A;  1LSV A;  1LL8 A;  3LIB A;  4HIA A;  4GHI A;  3E4P A;  3LIF A;  3F1N B;  2QJ5 A;  2JHE A;  4LPZ A;  4E04 A;  2V9A A;  5HSQ A;  1S4S A;  4R3A A;  2EA9 A;  3F1P A;  3K3C A;  4MN5 A;  3MJQ A;  2PDR A;  2ZBB A;  1DP6 A;  4BBV A;  3D72 A;  2W27 A;  3GEC A;  1XJ3 A;  4NXF A;  4R6L A;  2I9V A;  1NWZ A;  4L9G A;  3NJA A;  1OTA A;  5HWT A;  4JGO A;  5KIZ A;  3C2W A;  2V0W A;  3A0S A;  4M4X A;  2P7J A;  2D02 A;  4BBU A;  5J3W A;  4HH2 A;  3F1O B;  5HDC A;  4PKY G;  3G6O A;  2BAS A;  3NOU C;  4HHD A;  4GCZ A;  5HWW A;  3LID A;  3UMD A;  3UB8 A;  2ZOI A;  4R70 A;  3HJI A;  4WF0 A;  3LUQ A;  3CWF A;  4HI4 A;  4L9E A;  1D06 A;  3LIC A;  1P97 A;  1XJ2 A;  5F69 A;  4EEP A;  2KDK A;  4JGR A;  3BY9 A;  4I39 A;  5IU1 A;  3RTY A;  3T50 A;  4L9F A;  3F1N A;  2Z6D A;  2A24 B;  1OTI A;  2VV6 A;  5AVE A;  5G4Z A;  1UWP X;  4I3A A;  4HJ3 A;  1N9N A;  4WLA A;  3B33 A;  5G4Y A;  3ULF A;  1XFQ A;  2OOL A;  3CLO A;  4RQ9 A;  1EW0 A;  3H7W B;  3BWL A;  3A0V A;  3LYX A;  3PHY A;  4LLO B;  2VV8 A;  3LI9 A;  1DP9 A;  1G28 A;  3SW1 A;  5HWV A;  3ICY A;  5J4E A;  1TS7 A;  4LRZ E;  4EXO A;  4R38 A;  3NOP C;  4KQD A;  5HDS A;  4LRY C;  4DJ2 A;  2GJ3 A;  2QWS A;  2WKP A;  1V9Z A;  3RH8 B;  4YWZ A;  1TS0 A;  1GSW A;  1TS6 A;  2A24 A;  1T18 A; 
#chains in the Genus database with same CATH topology
 1ZHH B;  1ES5 A;  4E3N A;  2VJW A;  5EVI A;  3PXP A;  4DMZ A;  4JXG A;  2JCH A;  3G2Y A;  2V8F A;  5F6A A;  1QME A;  4S2M A;  3MR0 A;  3LIE A;  4GS9 B;  3AGE A;  4MN6 A;  5BOH A;  3M2J A;  3T4S A;  2QKP A;  1LL9 A;  1FIK A;  2YKH A;  3T1Q B;  3V5M A;  1STZ A;  4XT2 A;  3DWK A;  1I2S A;  3MFX A;  4GN2 A;  4EBL A;  2ZLY A;  1P9W A;  2ZL1 B;  2ZQC A;  4Y17 A;  1OJG A;  4MEZ A;  4OH0 A;  3A0R A;  1YM1 A;  4UQI S;  3RJU A;  5EOE A;  1XGJ A;  5FQM A;  5DKL A;  5J7E A;  4GNU A;  4NK3 A;  4WL9 A;  2OWH A;  2OLV A;  4FCF A;  1D7E A;  1F98 A;  3DTK A;  1W79 A;  2PU2 A;  4GD6 A;  3ITB A;  1MZU A;  1T1C A;  2LB9 A;  3PBS A;  1FQG A;  4C75 A;  2ZQ9 A;  3QP6 A;  4LCM A;  4NKP A;  3N4I A;  2XR0 A;  4JF4 A;  2WKR A;  4WZ5 C;  5HX9 A;  2Q9N A;  3CAX A;  1IYP A;  1BSG A;  4GDN A;  1S66 L;  5A8B A;  1FCM A;  4BJP A;  4ZTK A;  4OON A;  5TBM B;  4E3L A;  5L8M A;  4GS9 A;  2J80 A;  4LV1 A;  3PYP A;  2EFX A;  3N8L A;  5DJT A;  1ESI A;  2JKF A;  1P0Z A;  4M3K A;  2J8Y A;  2Y2O A;  3UB7 A;  3VP0 A;  3ZVW A;  1XA7 A;  4U3T A;  5F1F A;  1NLY A;  4DDY A;  3GDI A;  1XJ4 A;  3D9Y A;  1YMS A;  2ZL1 A;  1GHP A;  1N9O A;  3P01 A;  3V3S A;  2L1M A;  1MWU A;  3OBF A;  1F5M A;  4ME4 A;  2PR5 A;  5FEG A;  3QNC A;  1PW8 A;  2J9O A;  3EEH A;  1K54 A;  5HD5 A;  2FH5 A;  4S2N C;  3TJZ C;  5CHU A;  2CC1 A;  3QP5 A;  2ZM0 A;  3W2Z A;  3VP4 A;  2W1T B;  1W5D A;  2EWW A;  4X55 A;  2PYR A;  4GDB A;  1SCW A;  4YIN A;  1CEG A;  3GTC A;  4IJG A;  5A92 A;  1KVL A;  1JWZ A;  5FQI A;  1AXB A;  3N8S A;  1YLY A;  3T1S A;  3VSK A;  3FKV A;  5G18 A;  3WS4 A;  2ZJ9 A;  3VV4 A;  1YQS A;  2B5R A;  3D4F A;  1SHV A;  3PBQ A;  4EES A;  3SOI A;  2HDU A;  3WS0 A;  2ZMF A;  5DJU A;  3UME A;  5TBM A;  3G35 A;  3TSG A;  1G6O A;  4GD8 A;  2XEP A;  2Y59 A;  1RGY A;  3IXG A;  4FOF A;  2V1B A;  3S22 A;  1S4R A;  1K25 A;  1WA9 A;  1IEM A;  2K7S A;  1XFN A;  1NRJ A;  2RL3 A;  1PIO A;  2INW A;  4PM8 A;  3S1Y A;  1N9L A;  4BWI A;  3VE4 A;  2HZ5 A;  5FA7 A;  3SZT A;  1PFL A;  4BQM A;  1EI5 A;  4JF6 A;  1T1A A;  4I3J A;  1NRF A;  3PBT A;  3SH9 A;  5L07 A;  4PHT A;  4KZ3 A;  4KUO A;  3JVV A;  3IT9 A;  2Z2M B;  5IHV A;  2W1T A;  3BJN A;  4DF6 A;  4O8G A;  3E4O A;  1DRM A;  3TG9 A;  1HLU P;  1MXO A;  1TS8 A;  5CRF A;  3IXB A;  4X1M A;  1OTD A;  2D01 A;  4QY5 A;  1SDE A;  4DXB A;  4NXB A;  1VHM A;  2ZC7 A;  5EV0 A;  1XPB A;  3SH7 A;  5HFO A;  3T4K A;  4EU0 A;  1S1Y A;  1LSV A;  3BLM A;  2VGK A;  1H0M A;  5FI2 A;  4HIA A;  2WAF A;  4E3J A;  4EBP A;  4R0Q A;  2QJ5 A;  3E0Y A;  1KDW A;  1YPR A;  3LEQ A;  4MNR A;  2GX5 A;  4NEE D;  3SS3 A;  4G3K A;  3JPU A;  1KGE A;  3LR5 A;  4Y2F A;  2X71 A;  3K3C A;  2PDR A;  3CUE C;  4ZBE A;  2W27 A;  1Y4O A;  2XA7 S;  2P9V B;  2WZX A;  3Q1F A;  3EQV A;  4PAU A;  3HL9 A;  5E2H A;  5HWT A;  4JGO A;  1OPX A;  5HAP A;  3C2W A;  3PR6 A;  3A0S A;  4BBU A;  2PT7 A;  1VET B;  4DRT A;  5TGF A;  4CLC D;  5M1A A;  1NXY A;  3DTM A;  1GA0 A;  3CI6 A;  3CJM A;  4PPR A;  1O07 A;  3LID A;  3PAG A;  4BL3 A;  1IKG A;  5TR7 A;  1N4O A;  3LR0 A;  4O01 A;  1YSP A;  2ZOI A;  1JTD A;  4U0T A;  1VM1 A;  4WF0 A;  1TEM A;  1ACF A;  4X56 A;  4X6T A;  2WKH A;  2B95 A;  5DFY A;  2FFY A;  5JYO A;  2QPN A;  1PRQ A;  1BT5 A;  4OQI A;  2FFF B;  4R4S A;  4JGR A;  3BY9 A;  4IVI A;  5IU1 A;  1IYS A;  2K31 A;  2J3T C;  2V1Z A;  1NYY A;  4L9F A;  3VP1 A;  3BFF A;  5AVE A;  3MKE A;  3MBZ A;  3WS5 A;  5FDS A;  5KSH A;  1H8Y A;  1L0D A;  2P9V A;  5G4Y A;  3I7J A;  4OPQ A;  3QHY A;  3OZH A;  2WGV A;  3Q82 A;  3V39 A;  2Y4A A;  1XFQ A;  5E43 A;  2XFS A;  2HJ9 C;  4QWO A;  1VET A;  3BEB A;  4P6B A;  1EW0 A;  3E98 A;  3OOV A;  1K4E A;  5TFQ A;  3LYX A;  3TOI A;  3MFD A;  3IHA A;  2ZC6 B;  4ID4 A;  4LV3 A;  3IXD A;  1CI8 A;  2XRN A;  1G28 A;  3GV9 A;  3FZC A;  2H5S A;  5F83 A;  1W8Q A;  3MQ0 A;  4EBN A;  3ZG7 B;  4EXO A;  4R38 A;  1YMX A;  3PBO A;  4MLL A;  3EGD C;  3UE3 A;  2XD5 A;  2QWS A;  5CTN A;  2W3H A;  4E6W A;  5HAQ A;  3CUE A;  4Y3I A;  4UHU A;  1TS6 A;  3HLD A;  2ZM8 A;  1H8Z A;  2ZM2 A;  3UO9 A;  5KZH A;  3CZD A;  3PAE A;  1C3B A;  2ZQD A;  4I3I A;  3V67 A;  1V9Y A;  4K08 A;  3GRJ A;  3NUL A;  1CQA A;  5HPI A;  3P7N A;  1RP5 A;  4PM9 A;  3B47 A;  2QYB A;  4GKU A;  3BFC A;  4H8R A;  2Y79 A;  1YKD A;  4K91 A;  1YLW A;  3QP2 A;  2P74 A;  1S0W A;  4Y0O A;  2GZA A;  1PYY A;  3OC2 A;  5DF9 A;  5MC7 A;  2Y2L A;  3OPH A;  1FCO A;  4FH2 A;  1HD8 A;  2C6W B;  1DY6 A;  2OWJ A;  2JKR M;  1GHM A;  4DN0 A;  3Q7Z A;  4DE0 A;  2JC7 A;  3IBR A;  2QZ6 A;  4UA6 A;  2V0U A;  2WKE A;  3IHB A;  5CGX A;  3B42 A;  4F3L B;  1JWV A;  2XDM A;  4CLC B;  5IS1 A;  1XJ6 A;  3ZG8 B;  4DJ3 A;  2G7U A;  4ESP A;  2PHY A;  3E2K A;  3CHW P;  4E6X A;  2NUP C;  3O87 A;  3VFF A;  1LLB A;  1PW1 A;  3IXH A;  3C8C A;  1YLJ A;  1S67 L;  4MDZ A;  4N1H A;  5D3O A;  3ZG5 A;  4QHC A;  4X69 A;  3G32 A;  4FSF A;  5FAQ A;  3W4O A;  2WKQ A;  1ZKJ A;  1K6R A;  2V1A A;  5EM0 A;  3UDF A;  4EUV A;  3RXX A;  3A3J A;  3HJK A;  2Y2N A;  1LSX A;  1MKM A;  3WRZ A;  4MBF A;  5GLD A;  5L10 A;  1HVB A;  4JGQ A;  4BBT A;  2FZ0 A;  4Y7P A;  1T1B A;  5HDD A;  2H0T A;  5HPF A;  2WGI A;  2PU4 A;  3EQU A;  3SS4 A;  2BG1 A;  2HPB A;  2L0W A;  3FV7 A;  3FC7 A;  4HOI A;  1BZA A;  1TVF A;  5CTM A;  3SH8 A;  4QD4 A;  3IWO A;  1L3L A;  1LI0 A;  1NJ4 A;  4D2O A;  5DTK A;  4F3L A;  4CLC A;  4JGP A;  3IX4 A;  4C3Q A;  3GR2 A;  4BL2 A;  3CPT B;  3VOL A;  3KYZ A;  4NXE A;  4E3I A;  4EUZ A;  1QMF A;  5GHY A;  3GMW A;  1JNU A;  1G68 A;  3UB6 A;  1MBL A;  4S2O A;  1LSW A;  2XQZ A;  3VE3 A;  2WGW B;  4KUK A;  3FPV A;  3HUM A;  3F1P B;  1FR1 A;  1IEL A;  3GQZ A;  4OPY A;  3L7H A;  3VP3 A;  2V8C A;  4OPR A;  3ITA A;  2VX8 A;  1ES3 A;  3HLC A;  4EWF A;  4YNR A;  1HTZ A;  1BLP A;  1XX2 A;  1PNE A;  1KVM A;  1Z6F A;  2EXB A;  3DW0 A;  3DTI A;  1L0E A;  3MKF A;  2ZOH A;  3S4X A;  1UWN X;  4PM6 A;  1VB6 A;  4PM5 A;  4OOL A;  4EER A;  4NET A;  4E3M A;  1PZO A;  2H0Y A;  1XA1 A;  3GVB A;  5EE8 A;  3TE8 A;  3MXQ A;  4IHQ A;  4XUX A;  4HBU A;  2E8I A;  3CPT A;  4S2K A;  2G2W A;  2B02 A;  4OVD A;  1SKF A;  1RGZ A;  1I2W A;  2VGL S;  1FR6 A;  3IF6 C;  1PI5 A;  3RXW A;  1ALQ A;  4LPZ A;  5HL6 A;  4Y5F A;  3U2A A;  5A90 A;  3F1P A;  4LFU A;  1DP6 A;  4LEN A;  3C4P A;  4L9G A;  5AQ7 A;  5DFX A;  1YLP A;  2V0W A;  3ZGA B;  3WRT A;  2D02 A;  2VKS A;  2WKI A;  1Y54 A;  3F1O B;  4OOY A;  5HDC A;  3C7V A;  2BAS A;  2ZMV A;  1FCN A;  3UY6 A;  4HHD A;  2PAV P;  3ZNY A;  4IUK A;  5FAS A;  3HRE A;  2HJE A;  5M18 A;  3O5Y A;  4K0X A;  4CPK A;  4R70 A;  3ZFZ A;  3HJI A;  1K4F A;  3LUQ A;  3TRC A;  3CWF A;  4Z1W A;  1N9B A;  4WEJ A;  5CER A;  1LHY A;  1S6R A;  2J3T D;  3BYD A;  4KZ6 A;  4IUH A;  3ZG9 B;  1ES4 A;  4I39 A;  5HW3 A;  5EOO A;  3N6I A;  2A24 B;  5G4Z A;  3M6H A;  4K0W A;  4I3A A;  4DXC A;  5E2F A;  3T1X A;  1SZV A;  4WZ5 A;  2LB5 A;  1BUE A;  3MF0 A;  5FQQ A;  2K2N A;  2VGJ A;  3KO6 A;  4MBH A;  5CEB A;  3B3X A;  3ULF A;  3HLG A;  2R9W A;  3WS2 A;  2W1R A;  4R3B A;  2QMI A;  3A3E A;  3JVU A;  1M6K A;  3BWL A;  1W63 Q;  3A0V A;  3U4L P;  2AVX A;  4LLO B;  3OPP A;  4R4R A;  1G6A A;  4KZ7 A;  3EGX C;  4UAA A;  2XFT A;  1PWD A;  5CED A;  1HZO A;  4QB8 A;  1YLZ A;  3O88 A;  4JKT A;  2ZD8 A;  1W63 M;  1RCJ A;  1BLH A;  4JBF A;  3MXS A;  4PMA A;  4DJ2 A;  1CK3 A;  4G3V A;  2WUQ A;  4S2N A;  5K5B A;  1V9Z A;  3SS5 A;  3V50 A;  2XH9 A;  4DDS A;  2A24 A;  1K57 C;  2WAE A;  1A0K A;  4JXS A;  4GOG A;  4OOM A;  1GHI A;  4RYE A;  5CXW A;  2JKT M;  2IWB A;  1XKZ A;  5EEC A;  1DP8 A;  4NG2 A;  3EOI A;  1L2S A;  2ACG A;  3MQQ A;  2DCF A;  4P0M A;  2PBY A;  4R3J A;  5FL3 A;  2IA2 A;  1OT9 A;  4ETZ A;  3IQA A;  4WYY A;  2NUT C;  2Y2H A;  5AVF A;  4B88 A;  1ONG A;  1TF1 A;  2Q0O A;  4ZDX A;  3VFH A;  4LV0 A;  5C5K A;  1F9I A;  3UPO A;  1W8Y A;  2Y2P A;  3HLE A;  5AJG A;  3LO7 A;  4E3O A;  2EXA A;  2ZQA A;  3UN7 A;  1MWR A;  1S1Z A;  2M1C A;  4NXG A;  3E4Q A;  1H5X A;  5CEC A;  3IS2 B;  4BD0 A;  4R23 A;  4H6J B;  3OLO A;  3N7W A;  4LRX C;  4U0X A;  3PBN A;  2JE5 A;  3IF5 A;  2PRF A;  3NDE A;  5F82 A;  4JLF A;  2GDN A;  5CGW A;  3C38 A;  4FTX A;  3MXR A;  1GSX A;  5EVE A;  1OJ5 A;  2KLI A;  2YKF A;  3LI8 A;  3Q07 A;  4LCL A;  2W0N A;  3ZG0 A;  5I94 A;  2L4R A;  1P9R A;  3ZCZ A;  4YOF A;  1E25 A;  4IBX A;  1YAX A;  3LIA A;  4OLD A;  5HAI A;  3BQ8 A;  4EET B;  2W3E A;  4HH3 A;  4UA7 A;  5M19 A;  3G2Z A;  4KQR A;  2O99 A;  1IYO A;  3MMH A;  4QPR A;  1JWP A;  4FD8 A;  2Y2M A;  2Z6C A;  5EVL A;  3HLB A;  4AFI A;  1T19 A;  5HZH A;  1VQQ A;  3N8R A;  1KGF A;  4EW7 A;  3T4L A;  1FIL A;  1XP4 A;  5DF7 A;  1WE4 A;  3IS2 A;  4RVA A;  5FQK A;  5J8X A;  2HF6 A;  4H6J A;  4HP9 A;  4ZJ1 A;  4OQG A;  2Y91 A;  1U60 A;  1LT0 A;  5FEF A;  2A2L A;  5AQB A;  3PTE A;  1E3U D;  5EVI C;  4HBT A;  4N1X A;  4BEN A;  2R78 A;  2Y2K A;  5FI6 A;  2H28 A;  2JKT I;  4HNB A;  5EFW A;  2PYP A;  1Z09 A;  4DE3 A;  4MN7 A;  2HDR A;  1ERM A;  3ZVT A;  2J3W A;  4S2L A;  1IFQ A;  1BYW A;  4A5R A;  3Q81 A;  1ODV A;  3FKW A;  3R7W B;  1W7F A;  3V3R A;  3ZYT A;  1OTB A;  3W8K A;  4C6Y A;  4B9O A;  1IKI A;  3HUO A;  3E2L A;  1ZTU A;  1GCE A;  4I5S A;  1F2K A;  3IH8 A;  3VMA A;  3KSI A;  3S7P A;  1XXM A;  2KX6 A;  5DKK A;  4O0P A;  3HCY A;  2Y8H A;  2M7U A;  2JN7 A;  2DRW A;  4QU3 A;  1CEF A;  2W3G A;  1BLS A;  1MWS A;  3BQA A;  3L9K A;  1KE4 A;  4OLG A;  3ZQ5 A;  3QP1 A;  3VSL A;  2HP5 A;  1E4D A;  1WYB A;  1MPL A;  3LY4 A;  4GZB A;  3S7N A;  4WBG A;  5F1G A;  3MS6 A;  3MSH A;  4RX3 A;  2EFU A;  1CF0 A;  1SDN A;  5GLB A;  1NZU A;  2XF3 A;  2PD7 A;  4PKY A;  3NOT C;  3NHQ A;  3CIT A;  4UEY A;  5A93 A;  5EM1 A;  4KZA A;  4XT2 B;  2P04 A;  3IWI A;  5DVA A;  4PM7 A;  5AQA A;  3W4P A;  3LIB A;  4FUW A;  4IBR A;  5CHM A;  1DJB A;  3E4P A;  4OP8 A;  2JHE A;  3R7W A;  2OLU A;  3HLW A;  2BLS A;  5HL1 A;  1MWT A;  4JPM A;  4E04 A;  1NYM A;  2V9A A;  5HSQ A;  1S4S A;  4R3A A;  3FYZ A;  3UE0 A;  2RCX A;  4X1L A;  3NEC A;  2UV0 E;  3HLF A;  3D72 A;  3GEC A;  4YFM A;  4R6L A;  2I9V A;  5LBR A;  1NWZ A;  2I72 A;  2XD1 A;  1OTA A;  4MMN A;  5KIZ A;  4Q8I A;  4KZ9 A;  5J3W A;  2VK3 A;  4PKY G;  3O86 A;  3G6O A;  1CI9 A;  3T4Q A;  5GLA A;  2Y2Q A;  3NOU C;  4X25 A;  2XRO A;  4Y0U A;  2UWX A;  4P6Z M;  2XA7 M;  3UMD A;  2VZW A;  4P87 A;  4IED A;  3NIA A;  5FSR A;  1NLZ A;  3LIC A;  1P97 A;  5EUA A;  5DF8 A;  3T1R A;  4KQO A;  5F69 A;  4LV2 A;  2IWC A;  1TDL A;  1K56 D;  2KDK A;  3R4K A;  3RTY A;  5KSC A;  3T50 A;  4CLC E;  4WEK A;  2Z6D A;  1K55 C;  3S7O A;  3NCK A;  1OTI A;  5DTT A;  2VV6 A;  2B18 A;  1UWP X;  3KYQ A;  4S2I A;  3ZHH A;  1YSQ A;  2JKR I;  2O9C A;  3IWQ A;  2XK1 A;  5GL9 A;  2DNS A;  4RX2 A;  1N9N A;  1FSY A;  3G30 A;  3OCL A;  4WLA A;  3B33 A;  1YT4 A;  1SKO B;  2HGV A;  3VP2 A;  2WZZ A;  4WMC D;  2OOL A;  2WYX A;  3WS1 A;  4RQ9 A;  2Y55 A;  3CG5 A;  3H7W B;  3LY3 A;  3PHY A;  2VV8 A;  2A49 A;  2XLN A;  2H10 A;  3LI9 A;  4II7 A;  1DP9 A;  1ERQ A;  5FQ9 A;  4Y0T A;  3LEZ A;  3W4Q A;  1ZG6 A;  2WGW A;  3ICY A;  4JXW A;  4KQD A;  4Y15 A;  4Q0J A;  4ARZ B;  4Y13 A;  2WKP A;  2Q9M A;  5JYP A;  1IYQ A;  3MZD A;  3JYI A;  1DJC A;  2OSU A;  4B4Z A;  3MZE A;  3C30 A;  1MC0 A;  2JBF A;  3UNW A;  3BW6 A;  3G34 A;  4XXR A;  1NY0 A;  2V20 A;  2PR6 A;  4GB7 A;  5KMW A;  1E3U A;  1H3Q A;  1Y28 A;  4HJ4 A;  2CMN A;  3UDI A;  4EQ1 A;  1SKO A;  5GHZ A;  2VLG A;  3CMZ A;  1UGU A;  3H9W A;  4X68 A;  1EWZ A;  3FPW A;  5E2G A;  3H7W A;  3IF6 B;  3VOZ A;  2EX8 A;  4QY6 A;  1ESU A;  2E8J A;  5EPH A;  4OQH A;  4D60 A;  3BFG A;  3HUN A;  3UE6 A;  3UE1 A;  1O7E A;  4HEF A;  4FH4 A;  1CJF A;  3P98 A;  3GSG A;  4ZAM A;  1K55 A;  2OV5 A;  4MCW A;  3AGF A;  4S2P A;  4ARZ A;  3NI9 A;  2O0Y A;  3LFV A;  3FWL A;  4ETX A;  5CX7 A;  2Z2L B;  4KZ8 A;  3IX8 A;  2HDS A;  4QJG A;  1JTG A;  3WWX A;  2ZC3 B;  4WUJ A;  4DE2 A;  4ZRR A;  3OPR A;  1AWI A;  3F1O A;  2DMW A;  2QHK A;  1GA9 A;  2W3F A;  4P85 A;  4BMW A;  1X0O A;  4HP4 A;  5CHJ A;  5F68 A;  1MY8 A;  3MZF A;  3HVF A;  4O7D A;  4ZJ3 A;  3BFE A;  3LR3 A;  3A3F A;  4I38 A;  2ZQ8 A;  2W3D A;  2M7V A;  3AGD A;  2VEA A;  3IF6 A;  2X02 A;  3NDG A;  4LGW A;  1FOF A;  4GW9 A;  5I5L A;  2HDQ A;  1PWG A;  5IT5 A;  2OAP 1;  1GSV A;  3KSG A;  2OAQ 1;  2EX9 A;  4KZB A;  3H82 B;  4Z9Q A;  1OT6 A;  2ZMA A;  1WYC A;  5FAT A;  1ZC2 A;  2VV7 A;  4L0L A;  2HP9 A;  1ZG4 A;  3ZDJ A;  3BRM A;  3M2K A;  4P6Z S;  5FAO A;  3UDX A;  3FG8 A;  3KSF A;  4MBK A;  5EVI D;  4CQH A;  3UB9 A;  3K3D A;  5FI7 A;  3EWK A;  3BY8 A;  1LI9 A;  3ISG A;  1BUL A;  4X53 A;  1ES2 A;  1LL5 A;  2MJ6 A;  3LGO A;  4DE1 A;  4OP5 A;  4HY8 A;  5U47 A;  4BD1 A;  1KGG A;  3QP8 A;  1KDS A;  1KE3 A;  2J7V A;  2QJ7 A;  3DWZ A;  3S7Q A;  4Q0I A;  2XGN A;  2HV1 A;  5A91 A;  2PBD P;  4E3K A;  4GHI B;  4EEU A;  4G3W A;  1XGI A;  3IH9 A;  3UPP A;  1PI4 A;  3OPL A;  5FDH A;  2IWD A;  1OTE A;  1K56 A;  4WN5 A;  2ZC5 B;  1OME A;  4ZJ2 A;  1YLT A;  3M6B A;  2Y2I A;  2V2F F;  5AQ9 A;  1ONH A;  3BLS A;  5GHX A;  1M40 A;  5HD3 A;  3UPN A;  4HJ6 A;  3IBJ A;  3H82 A;  3BEC A;  1G5U A;  2EX2 A;  1FSW A;  2O9B A;  4UQI M;  2GNX A;  3A3D A;  3HBR A;  3KX0 X;  4KZ4 A;  3G4P A;  2XSS A;  5F5Y A;  3Q7V B;  4WMC A;  3T4O A;  3DAV A;  4KEN B;  1KOU A;  4HQA A;  3MQO A;  3VOY A;  4B93 A;  3C7U A;  1PWC A;  4BLM A;  3DBA A;  1PZP A;  3PBR A;  2EWV A;  3IX3 A;  1TD5 A;  1BTL A;  2PD8 A;  1LL8 A;  2X01 A;  3OCN A;  4Q0H A;  4EV4 A;  2KOI A;  4GHI A;  2ZC4 B;  4OQ0 A;  1L0F A;  3LIF A;  3BM6 A;  3F1N B;  1Q2Q A;  5GLC A;  1J3W A;  3NC8 A;  5L2F A;  1K38 A;  3EEA A;  2EA9 A;  5L09 A;  3QP4 A;  4MN5 A;  3MJQ A;  2ZBB A;  4BBV A;  3TW8 A;  1K57 A;  5HAR A;  3BFD A;  1XJ3 A;  3DTE A;  4NXF A;  4HES A;  3K2N A;  1K6S A;  2ZQ7 A;  3NJA A;  2VGL M;  3T4J A;  4M4X A;  1NZO A;  2P7J A;  5FAP A;  3NY4 A;  4HH2 A;  4XUZ A;  4OKP A;  5FQJ A;  4JF5 A;  3QNB A;  1KE0 A;  1Q2P A;  4CLC C;  3Q7V A;  4GCZ A;  5HWW A;  2WAD A;  2R9X A;  2EX6 A;  2A3U A;  2HP6 A;  3UB8 A;  2G2U A;  4GJ4 A;  4F94 A;  4HI4 A;  2Y2G A;  4L9E A;  1D06 A;  4WZ4 A;  1XJ2 A;  1L0G A;  1MKI A;  3T4T A;  2VA0 A;  4EEP A;  3LCE A;  1VEU B;  3F1N A;  5TJJ A;  2Y2J A;  1JVJ A;  3P09 A;  5CGS A;  1K0K A;  4HJ3 A;  4WM9 A;  5EVI B;  3ZNT A;  4KG5 A;  3UB5 P;  2C5W B;  2BTF P;  4N9L A;  2JKG A;  4N9K A;  1DJA A;  1TDG A;  2P08 A;  3CLO A;  4EQI A;  3C5A A;  1H8M A;  4KZ5 A;  1I5Q A;  3KYE A;  4WEL A;  4CJN A;  2WK0 A;  2O9A A;  4KQQ A;  3KSH A;  4DKI A;  3T12 B;  3SW1 A;  4KG6 A;  3LR4 A;  4R1G A;  5HWV A;  1ERO A;  3G31 A;  5J4E A;  1TS7 A;  4LRZ E;  1J9M A;  3NOP C;  4UA9 A;  5E2E A;  3D3O A;  4B4X A;  4RA7 A;  3O3V A;  4IVK A;  1D1J A;  5HDS A;  2J9P A;  4LRY C;  3NBL A;  2GJ3 A;  4JXV A;  1BLC A;  4GLQ A;  3RH8 B;  1K54 C;  4S2J A;  4YWZ A;  1TS0 A;  3RFB A;  3A3I A;  1VEU A;  3C4O A;  4KG2 A;  4OPZ A;  1GSW A;  1IOU A;  4N92 A;  1T18 A;  5DTS A; 
#chains in the Genus database with same CATH homology
 1ZHH B;  3BW6 A;  2VJW A;  4OOM A;  3PXP A;  2JKT M;  4DMZ A;  2PR6 A;  4I3I A;  5F6A A;  1DP8 A;  3V67 A;  1V9Y A;  1H3Q A;  1Y28 A;  4HJ4 A;  3MR0 A;  2CMN A;  4EQ1 A;  3EOI A;  4K08 A;  3LIE A;  2VLG A;  3MQQ A;  4GS9 B;  4MN6 A;  1UGU A;  3H9W A;  2QKP A;  3T4S A;  5HPI A;  3P7N A;  2YKH A;  5FL3 A;  2IA2 A;  1STZ A;  1OT9 A;  3B47 A;  3FPW A;  4XT2 A;  4ETZ A;  2NUT C;  3H7W A;  2QYB A;  5AVF A;  1TF1 A;  3MFX A;  2Y79 A;  1YKD A;  5C5K A;  1F9I A;  1P9W A;  5AJG A;  1OJG A;  3UE6 A;  2GZA A;  3A0R A;  3OC2 A;  5DF9 A;  4UQI S;  5MC7 A;  1S1Z A;  5DKL A;  2M1C A;  4NXG A;  5J7E A;  3E4Q A;  4WL9 A;  3IS2 B;  2OWJ A;  2OWH A;  2JKR M;  1D7E A;  4H6J B;  4MCW A;  4DN0 A;  1F98 A;  4ARZ A;  3OLO A;  4LRX C;  3PBN A;  1MZU A;  2O0Y A;  3IBR A;  1T1C A;  2V0U A;  2LB9 A;  3LFV A;  3PBS A;  5CX7 A;  4ETX A;  3B42 A;  4NKP A;  3C38 A;  2WKR A;  4F3L B;  4CLC B;  5IS1 A;  1XJ6 A;  1GSX A;  4WUJ A;  4ZRR A;  3F1O A;  2DMW A;  2QHK A;  3CAX A;  1OJ5 A;  2KLI A;  2W3F A;  4DJ3 A;  2G7U A;  2YKF A;  3LI8 A;  4BMW A;  2PHY A;  1X0O A;  4HP4 A;  1S66 L;  5A8B A;  4BJP A;  5F68 A;  2W0N A;  2NUP C;  2L4R A;  5TBM B;  5L8M A;  3LR3 A;  2J80 A;  4GS9 A;  1P9R A;  3PYP A;  4I38 A;  2W3D A;  3C8C A;  4YOF A;  2M7V A;  1S67 L;  5DJT A;  4MDZ A;  1P0Z A;  1YAX A;  3LIA A;  3UB7 A;  4FSF A;  3BQ8 A;  4EET B;  2W3E A;  2VEA A;  4HH3 A;  2WKQ A;  2O99 A;  2V1A A;  3MMH A;  4QPR A;  4EUV A;  1NLY A;  3GDI A;  1XJ4 A;  2Z6C A;  4GW9 A;  5I5L A;  3HJK A;  1N9O A;  3P01 A;  5IT5 A;  1LSX A;  2OAP 1;  1GSV A;  4AFI A;  1MKM A;  1T19 A;  3KSG A;  2L1M A;  5HZH A;  2OAQ 1;  3OBF A;  1F5M A;  3H82 B;  4ME4 A;  2PR5 A;  1OT6 A;  4EW7 A;  3EEH A;  3T4L A;  4JGQ A;  4BBT A;  2FZ0 A;  5HD5 A;  2FH5 A;  1T1B A;  5HDD A;  2VV7 A;  3TJZ C;  4L0L A;  5HPF A;  3IS2 A;  3W2Z A;  3EQU A;  2HF6 A;  4H6J A;  4HP9 A;  2W1T B;  2L0W A;  2EWW A;  4P6Z S;  3FC7 A;  4HOI A;  2PYR A;  3FG8 A;  3KSF A;  4CQH A;  3UB9 A;  3K3D A;  1LT0 A;  3EWK A;  2A2L A;  4IJG A;  3BY8 A;  4F3L A;  4CLC A;  4JGP A;  2R78 A;  2MJ6 A;  4HY8 A;  2H28 A;  2JKT I;  4HNB A;  2QJ7 A;  3VV4 A;  5EFW A;  2PYP A;  3VOL A;  3S7Q A;  4Q0I A;  3KYZ A;  4MN7 A;  3PBQ A;  4EES A;  2HV1 A;  2J3W A;  1IFQ A;  4NXE A;  2ZMF A;  5DJU A;  3UME A;  4GHI B;  5TBM A;  1BYW A;  4EEU A;  1G6O A;  4G3W A;  1JNU A;  1ODV A;  3UB6 A;  3R7W B;  1LSW A;  3VE3 A;  3ZYT A;  1OTB A;  4FOF A;  4KUK A;  2V1B A;  3FPV A;  4B9O A;  1S4R A;  1ZTU A;  3F1P B;  4I5S A;  1WA9 A;  3KSI A;  1OTE A;  2K7S A;  1XFN A;  4WN5 A;  3S7P A;  1NRJ A;  2KX6 A;  5DKK A;  4O0P A;  3HCY A;  2Y8H A;  2M7U A;  2JN7 A;  2INW A;  1N9L A;  2W3G A;  2VX8 A;  4BWI A;  3VE4 A;  5HD3 A;  4YNR A;  4HJ6 A;  3IBJ A;  3H82 A;  3BQA A;  1T1A A;  4I3J A;  3PBT A;  2O9B A;  4UQI M;  2GNX A;  3ZQ5 A;  4PHT A;  4KUO A;  3JVV A;  3KX0 X;  3S7N A;  2W1T A;  2ZOH A;  2XSS A;  5F5Y A;  1UWN X;  3BJN A;  1VB6 A;  4O8G A;  3E4O A;  4OOL A;  1DRM A;  4EER A;  3T4O A;  1TS8 A;  2PD7 A;  4PKY A;  1OTD A;  3NOT C;  2D01 A;  1KOU A;  3NHQ A;  4HQA A;  4NXB A;  3MQO A;  1VHM A;  4B93 A;  3TE8 A;  3CIT A;  3MXQ A;  4UEY A;  4IHQ A;  3DBA A;  4XT2 B;  3T4K A;  4EU0 A;  3PBR A;  2EWV A;  1TD5 A;  1S1Y A;  2P04 A;  2PD8 A;  2B02 A;  1LSV A;  1LL8 A;  3LIB A;  3OCN A;  4Q0H A;  4HIA A;  2KOI A;  4GHI A;  2VGL S;  3E4P A;  3LIF A;  3F1N B;  2QJ5 A;  2JHE A;  3R7W A;  3E0Y A;  4LPZ A;  5HL6 A;  2GX5 A;  4NEE D;  4Y5F A;  4E04 A;  2V9A A;  5HSQ A;  4G3K A;  3EEA A;  3U2A A;  1S4S A;  4R3A A;  2EA9 A;  3LR5 A;  3F1P A;  4Y2F A;  3K3C A;  4MN5 A;  3MJQ A;  2PDR A;  2ZBB A;  1DP6 A;  4BBV A;  3CUE C;  3TW8 A;  3D72 A;  2W27 A;  3GEC A;  1XJ3 A;  4NXF A;  2XA7 S;  3EQV A;  4R6L A;  2I9V A;  3K2N A;  1NWZ A;  5LBR A;  4PAU A;  4L9G A;  3NJA A;  5DFX A;  1OTA A;  2VGL M;  5HWT A;  4JGO A;  1OPX A;  4MMN A;  3T4J A;  5KIZ A;  3C2W A;  3PR6 A;  2V0W A;  3A0S A;  4M4X A;  2P7J A;  2D02 A;  4BBU A;  5J3W A;  2VKS A;  2PT7 A;  4HH2 A;  3F1O B;  5HDC A;  4CLC D;  4PKY G;  3G6O A;  2BAS A;  2ZMV A;  3T4Q A;  3NOU C;  3CI6 A;  2XRO A;  4HHD A;  4CLC C;  4GCZ A;  5HWW A;  3LID A;  4IUK A;  4P6Z M;  2HJE A;  2XA7 M;  3UMD A;  3O5Y A;  3LR0 A;  4O01 A;  3UB8 A;  1YSP A;  2ZOI A;  2VZW A;  4R70 A;  3HJI A;  4GJ4 A;  4WF0 A;  3LUQ A;  3TRC A;  1NLZ A;  3CWF A;  4HI4 A;  5DFY A;  4L9E A;  4Z1W A;  1D06 A;  4WEJ A;  3LIC A;  1P97 A;  1XJ2 A;  2J3T D;  4KQO A;  5F69 A;  3T4T A;  4IUH A;  2VA0 A;  4EEP A;  2KDK A;  3R4K A;  3BY9 A;  4I39 A;  4JGR A;  5IU1 A;  2K31 A;  3RTY A;  2J3T C;  3T50 A;  4L9F A;  4CLC E;  4WEK A;  3F1N A;  2Z6D A;  5TJJ A;  3S7O A;  2A24 B;  1OTI A;  2VV6 A;  5AVE A;  2B18 A;  5G4Z A;  1UWP X;  3KYQ A;  1YSQ A;  2JKR I;  2O9C A;  4I3A A;  4HJ3 A;  5KSH A;  2LB5 A;  1N9N A;  3MF0 A;  2K2N A;  3OCL A;  4WLA A;  3B33 A;  5G4Y A;  3KO6 A;  3ULF A;  2HGV A;  1XFQ A;  2OOL A;  2HJ9 C;  2W1R A;  2P08 A;  3CLO A;  3JVU A;  4RQ9 A;  1H8M A;  1EW0 A;  3E98 A;  3H7W B;  3OOV A;  3BWL A;  1W63 Q;  3A0V A;  3LYX A;  3PHY A;  4WEL A;  4LLO B;  2VV8 A;  3EGX C;  2O9A A;  3LI9 A;  4II7 A;  1DP9 A;  2XRN A;  1G28 A;  3KSH A;  3SW1 A;  3LR4 A;  5HWV A;  3MQ0 A;  3ICY A;  5J4E A;  1TS7 A;  4LRZ E;  1W63 M;  4EXO A;  4R38 A;  3NOP C;  4KQD A;  3D3O A;  5HDS A;  3PBO A;  3EGD C;  4Q0J A;  4LRY C;  4DJ2 A;  3UE3 A;  4ARZ B;  2GJ3 A;  4G3V A;  2QWS A;  2WKP A;  5K5B A;  1V9Z A;  4GLQ A;  3RH8 B;  4YWZ A;  1TS0 A;  2W3H A;  3RFB A;  3CUE A;  4Y3I A;  1GSW A;  1IOU A;  1TS6 A;  2A24 A;  1T18 A;  3C30 A;  1MC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...