3LZ0A

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 1)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz0A00
3LZ0C 3RELC 5B40B 2RVQD 2YFVB 5AV5B 4E44A 3TU4C 5B0YC 4Z5TC 5GT3B 3X1UA 1BH8B 3W98C 4WV4B 4XZQB 5B0ZC 3MGQC 5CHLB 3AZJB 5G49B 3REHC 5BNVB 4G91C 4J8WB 5CPIC 1WWSA 3X1SC 3W97D 3W97A 4H9SA 3VH5W 2F8NA 3KUYC 3AFAC 1P3OB 3W99D 5GSUD 2AROD 1R4VA 2AROA 3VH5A 5GSUA 5JRGD 3KXBD 5JRGA 3KXBA 3MGPA 3X1TC 2NZDB 4QLCB 4Z2MH 3MNNC 1U35C 5B2ID 3W99B 5B2IA 1M1AB 1BH9B 2FJ7C 1S32C 3WTPC 1P3FB 3AZKD 3AZKA 5B31B 4DRBA 3REJC 3WA9C 4ZUXC 1TAFA 4WU9C 5AV8D 4WU8B 5AV8A 1P3GD 4CAYB 5B2JC 3R45B 2RVQC 4YM6A 3NQUB 2F8NK 1P3GB 5JA4B 3LJAD 1TZYB 3AZGB 2NQBB 3X1UC 5GT0A 4NFTA 2BYKB 3REKD 3LJAB 5CP6D 3AZHB 5CP6A 4WZSB 3AZIB 5DNMB 4CSRB 3AZMB 3REIA 4HGAC 2PYOD 2F8NH 2L5AA 5BNXB 1KX5B 1KX3A 3W97C 4H9SC 3AZFB 5DNND 5DNNA 1N1JA 4KGCC 2IO5C 1KX4D 3X1VD 3X1VA 5GSUC 3MGPC 5JRGC 1P3MB 1AOID 4R8PD 3V9RB 1KU5A 3A6ND 3A6NA 1ZLAB 5B24B 1P3IA 5FUGB 5KDMB 3O62A 2JSSA 5AV8C 3NQJB 2HIOA 1F66A 3LZ1D 3LZ1A 5C3IC 2HUEC 4YM6C 3MGSB 4G92B 3AV1C 1EQZB 5AV9B 4Z66A 5GT0C 3AV2D 3AV2A 4LD9B 3KWQD 1P3BA 4JJNB 4H9RB 3MGRB 3UTAB 3REIC 3AZND 3AZNA 3B0DB 3C1BD 3KWQB 3C1BA 5B33A 3AN2B 1KX3C 1P3LB 4J8UA 5DNNC 3LELA 3B6GB 3X1VC 3MVDA 4J8XB 4YS3B 2YFWB 1P3PB 4EO5C 1HQ3A 1M19D 1M19A 3LZ0B 5CPKD 5B32D 5B32A 4J8VC 3TU4B 5B0YB 1P3IC 1M18D 4X23D 3O62C 4X23A 1H3OB 5AV6A 2CV5B 3B0CT 5B0ZB 3AZEC 3REHB 2HIOC 5B40D 4NE3A 5AV5D 4ZBJB 2YFVA 3AYWC 1F66C 3WTPE 3B6FB 5CPIB 5GT3D 5GT3A 3X1SB 4Z66C 3AV2C 4XZQD 3KUYB 4Z2MG 3AZJD 3AFAB 3AZJA 1P34B 1P3BC 4WNNA 5BNVA 5B1LB 3AZNC 4J8WD 4J8WA 5BT1C 3MNNB 3C1BC 5B33C 5CPJB 2FJ7B 1S32B 3WTPB 5AVBB 4J8UC 3LELC 1P3OD 3MVDC 4KUDD 5GXQB 4ZUXB 2NZDD 2NZDA 4QLCD 1P3KC 1HQ3C 3W99A 1M1AD 4KUDB 1M1AA 1P3FD 5B1MB 1P3FA 5B31D 5B32C 5B2JB 2CWEA 3WAAB 5F99B 3X1UB 4H9PB 5AV6C 4WU8D 4M6BA 2F8NG 3UT9B 4XUJB 3W96D 3R45A 4HGAB 1ID3B 5AY8B 3NQUA 1P3GA 3AZGD 1TZYD 3AZGA 2NQBD 3W96B 3B0BA 3AZLB 3VH5T 2F8NB 2BYKA 4DRAA 3AZHD 3LJAA 2IO5B 3AZIA 3AZID 5DNMD 3AZJC 5DNMA 4KGCB 4CSRA 3AZMD 3AZMA 3MGPB 3UTBD 2BYMA 3REKA 1KX5D 5BNXA 4J8WC 1KX5A 5AVCB 3UTBB 3AZFD 3AZFA 2PYOA 1JFIA 3VH6W 1P3MD 1KX4A 3V9RA 3W99C 3KXBC 2AROC 1P3FC 1AOIA 4R8PA 1ZLAD 1ZLAA 5B24D 5B2IC 5B24A 5C3IB 2HUEB 3AV1B 5FUGA 3AZKC 5KDMA 3NQJA 5E5AD 3MGSD 3MGSA 1A7WA 1P3AB 1P3GC 1EQZD 4KHAB 3AZGC 5E5AB 5AV9D 1KX3B 4H9OB 4LD9D 4LD9A 3LJAC 5DNMC 4JJND 3AZMC 3MGRD 4H9RA 4H9QB 3MGRA 3C1CB 3UTAD 3UTAA 3REKC 5CP6C 1KX5C 3AN2D 3KWQA 1P3LD 3WKJD 1P3LA 2PYOC 3B6GD 4J8VB 4J8XD 4J8XA 4YS3D 3WKJB 2YFWA 1P3PD 1P3PA 1KX4C 3O62B 4H9NB 3LZ0D 1AOIC 4R8PC 3AZEB 2HIOB 3AYWB 1F66B 1ZLAC 5B24C 3TU4D 3TU4A 5B0YD 5B0YA 3A6NC 4UUZB 5CPKA 3RELB 2CV5D 1H3OA 2CV5A 5B0ZD 5BS7A 1M18A 1BFMA 4Z5TB 3REHD 1P3BB 3W98B 3MGQB 3B6FD 3B6FA 5CPID 5B33B 3X1SD 5B40A 4G91B 5AV5A 3LZ1C 3LELB 3KUYD 3KUYA 4LD9C 5B32G 5BO0B 3AFAD 1P34D 1P34A 3MVDB 3MGRC 1BH8A 5B1LD 5B1LA 4XZQA 1P3KB 5G49A 3MNND 3MNNA 3KWQC 1HQ3B 5CPJD 5CPJA 4AWLC 3X1TB 2FJ7D 1S32D 5AVBD 3WTPD 5AVBA 3WTPA 1P3LC 2FJ7A 1F1EA 1U35B 4J8XC 3WA9D 5GXQD 4ZUXD 5GXQA 1P3PC 4WU9D 1P3OA 3REJB 4KUDA 3WA9B 1ULYA 5B1MD 5B1MA 4QLCA 4WU9B 5B2JD 3WAAD 5B2JA 3WAAA 1BH9A 1M19C 5F99D 5F99A 5CPKC 5B31A 3X1UD 4H9PA 2CV5C 5BS7C 3UT9D 3UT9A 1M18C 4XUJD 4XUJA 4X23C 4WNNB 4ZBJC 1ID3D 5AY8D 4WU8A 5AY8A 1ID3A 3B6FC 4CAYA 3W96A 1B67A 5AV5C 5B40C 3AZLD 2F8ND 3AZLA 5JA4A 4KGCD 2NQBA 1TZYA 4KGCA 5B31G 1P34C 5GT3C 3W97B 3MGPD 5B1LC 4XZQC 3AZHA 4NE6A 5AVCD 5AVCA 5GSUB 3KXBB 2AROB 3UTBA 5CPJC 5JRGB 5AVBC 5B2IB 5GXQC 3AZKB 1P3OC 4KUDC 1P3MA 2NZDC 5B1MC 1TAFB 4QLCC 3WAAC 3VH6A 4YM6D 3AV1A 5AV8B 3AV1D 1M1AC 5F99C 5B31C 5GT0D 4YM6B 3UT9C 4XUJC 5GT0B 2BYMB 3REID 1P3AD 4WU8C 1P3AA 1B6WA 5AY8C 3REKB 1ID3C 5CP6B 4KHAA 5E5AA 3W96C 1KX3D 3REIB 4H9OA 3AZLC 2PYOB 1EQZA 2NQBC 1TZYC 5AV9A 1JFIB 4H9QA 3C1CD 3VH6T 3C1CA 5DNNB 1N1JB 3AZHC 3AZIC 1KX4B 3X1VB 5AVCC 4JJNA 3UTBC 1AOIB 4R8PB 3KSYA 4EO5B 3AN2A 4J8VD 4J8VA 3AZFC 1P3ID 3WKJA 3A6NB 3O62D 3B6GA 4H9NA 1WWIA 4YS3A 1P3IB 1HTAA 1P3MC 3AZED 3AZEA 2HIOD 3AYWD 1F66D 3AYWA 4NE5A 3LZ0A 4UUZA 3RELD 3RELA 4Z66D 3LZ1B 4Z5TD 4Z5TA 1P3BD 4Z66B 3AV2B 3W98D 3W98A 3B0CW 5B0ZA 1Q9CA 3MGQA 3MGQD 1P3AC 5BT1D 3REHA 5E5AC 5B33D 2LY8A 4AWLB 3MGSC 4G92C 4J8UD 3AZNB 3LELD 1EQZC 5CPIA 3C1BB 5BO0A 5AV9C 3X1SA 3MVDD 3C1CC 4J8UB 1P3KD 3AFAA 1P3KA 1HQ3D 4JJNC 3X1TD 3UTAC 3X1TA 3B0DC 1U35D 1U35A 3AN2C 1M19B 1S32A 3WKJC 5CPKB 5B32B 3B6GC 3REJD 5AV6D 3REJA 4YS3C 3WA9A 4ZUXA 1M18B 4E45A 4WU9A 4X23B 5AV6B
chains in the Genus database with same CATH superfamily
3LZ0C 3P5JB 3RELC 5B40B 2RVQD 2YFVB 5AV5B 4E44A 3TU4C 5B0YC 4Z5TC 5GT3B 3X1UA 1BH8B 3W98C 4WV4B 4XZQB 5B0ZC 3MGQC 5CHLB 3AZJB 5G49B 3REHC 5BNVB 4G91C 4J8WB 5CPIC 1WWSA 2FFFB 3X1SC 3W97D 3W97A 4H9SA 3VH5W 2F8NA 2Y2KA 3KUYC 2DF4C 3AFAC 1P3OB 3W99D 5GSUD 2AROD 1R4VA 2AROA 3VH5A 5GSUA 5JRGD 3KXBD 5JRGA 3KXBA 3MGPA 3X1TC 2NZDB 4QLCB 4Z2MH 3MNNC 1U35C 5B2ID 3W99B 5B2IA 1M1AB 1BH9B 2FJ7C 2Y2NA 3WTPC 1S32C 1P3FB 3AZKD 3AZKA 5B31B 4DRBA 3H0RC 3REJC 3WA9C 3EPLA 4ZUXC 2JE5A 1TAFA 4WU9C 5AV8D 4WU8B 5AV8A 1P3GD 4CAYB 5B2JC 3R45B 2RVQC 4YM6A 3NQUB 2F8NK 1P3GB 5JA4B 3LJAD 1TZYB 3AZGB 2NQBB 3X1UC 5GT0A 4NFTA 2BYKB 3REKD 3LJAB 5CP6D 3AZHB 5CP6A 4WZSB 3AZIB 5DNMB 3A1IA 4CSRB 3AZMB 2UWXA 3REIA 4HGAC 2PYOD 2F8NH 2L5AA 5BNXB 1KX5B 3EPHA 1KX3A 3W97C 4H9SC 3AZFB 5DNND 5DNNA 1N1JA 4KGCC 2IO5C 1KX4D 3X1VD 3KFUG 3X1VA 3H0MC 5GSUC 3MGPC 5JRGC 1P3MB 1AOID 4R8PD 3V9RB 1KU5A 3A6ND 3A6NA 1ZLAB 1Z2CB 5B24B 2JCHA 1P3IA 5FUGB 5KDMB 3O62A 2JSSA 5AV8C 3NQJB 2HIOA 1F66A 3LZ1D 3LZ1A 5C3IC 2HUEC 4YM6C 3MGSB 4G92B 3AV1C 1EQZB 5AV9B 4Z66A 5GT0C 3AV2D 3AV2A 4LD9B 3KWQD 1P3BA 4JJNB 4H9RB 3MGRB 3UTAB 3REIC 3AZND 3AZNA 3B0DB 3C1BD 3KWQB 3C1BA 5B33A 3AN2B 1KX3C 1P3LB 4J8UA 5DNNC 3LELA 3B6GB 3X1VC 3MVDA 4J8XB 4YS3B 2YFWB 1P3PB 4EO5C 1HQ3A 1M19D 3EPJA 1M19A 3LZ0B 5CPKD 5B32D 5B32A 4J8VC 3TU4B 5B0YB 1P3IC 1M18D 4X23D 3O62C 4X23A 1H3OB 5AV6A 2CV5B 3B0CT 5B0ZB 3AZEC 3REHB 2HIOC 5B40D 4NE3A 5AV5D 4ZBJB 2YFVA 3AYWC 1F66C 3WTPE 4WJ3C 3B6FB 5CPIB 3IP4C 5GT3D 5GT3A 3X1SB 4Z66C 3AV2C 4XZQD 3KUYB 4Z2MG 3AZJD 3AFAB 3AZJA 1P34B 1P3BC 4WNNA 5BNVA 5B1LB 3AZNC 4J8WD 4J8WA 5BT1C 3MNNB 3C1BC 5B33C 2F2AC 5CPJB 2FJ7B 1S32B 3WTPB 5AVBB 4J8UC 3LELC 1P3OD 3MVDC 4KUDD 5GXQB 4ZUXB 2NZDD 2NZDA 4QLCD 1P3KC 1HQ3C 3W99A 1M1AD 4KUDB 1M1AA 1P3FD 5B1MB 1P3FA 2G5IC 5B31D 5B32C 5B2JB 2CWEA 3WAAB 5F99B 3X1UB 4H9PB 5AV6C 4WU8D 4M6BA 2F8NG 3UT9B 4XUJB 3W96D 3R45A 4HGAB 1ID3B 5AY8B 3NQUA 1P3GA 3AZGD 1TZYD 3AZGA 2NQBD 3W96B 3B0BA 3AZLB 3VH5T 2F8NB 2BYKA 4DRAA 3AZHD 3LJAA 2IO5B 3AZIA 3AZID 5DNMD 3AZJC 5DNMA 4KGCB 4CSRA 3AZMD 3AZMA 3MGPB 3UTBD 2BYMA 3REKA 1KX5D 5BNXA 4J8WC 1KX5A 5AVCB 3UTBB 3AZFD 3AZFA 2PYOA 2W8SA 1JFIA 3VH6W 1P3MD 1KX4A 3V9RA 3W99C 3KXBC 2AROC 1P3FC 1AOIA 4R8PA 1ZLAD 1ZLAA 5B24D 5B2IC 5B24A 5C3IB 2HUEB 3AV1B 3AL0C 5FUGA 3AZKC 5KDMA 3NQJA 5E5AD 2ZM5A 3MGSD 3MGSA 1A7WA 1P3AB 1P3GC 1EQZD 4KHAB 3AZGC 5E5AB 5AV9D 1KX3B 4H9OB 4LD9D 4LD9A 3LJAC 2VQRA 5DNMC 4JJND 3AZMC 3MGRD 4H9RA 4H9QB 3MGRA 2Y2PA 3C1CB 3UTAD 3UTAA 3REKC 5CP6C 1KX5C 3AN2D 3KWQA 1P3LD 3WKJD 1P3LA 2PYOC 3B6GD 4J8VB 2G5HC 4J8XD 4J8XA 4YS3D 3WKJB 2YFWA 1P3PD 2Y2JA 1P3PA 3FDDA 1KX4C 3O62B 4H9NB 3LZ0D 1AOIC 4R8PC 3AZEB 2HIOB 3AYWB 1F66B 1ZLAC 5B24C 3TU4D 3TU4A 5B0YD 5B0YA 3A6NC 4UUZB 5CPKA 3RELB 2CV5D 1H3OA 2CV5A 5B0ZD 5BS7A 1M18A 1BFMA 4Z5TB 3REHD 1P3BB 2ZY4A 3W98B 3MGQB 3B6FD 3B6FA 5CPID 2Y2LA 5B33B 3X1SD 5B40A 4G91B 5AV5A 3LZ1C 3LELB 3KUYD 3KUYA 4LD9C 2XD1A 5B32G 5BO0B 3AFAD 1P34D 1P34A 3MVDB 2ZY2A 2Y2MA 1BH8A 3MGRC 5B1LD 5B1LA 4XZQA 1P3KB 2BG1A 5G49A 3MNND 3MNNA 1HQ3B 3KWQC 5CPJD 5CPJA 4AWLC 3X1TB 2FJ7D 1S32D 5AVBD 3WTPD 5AVBA 3WTPA 1P3LC 2FJ7A 1F1EA 1U35B 4J8XC 3WA9D 5GXQD 4ZUXD 5GXQA 1P3PC 4WU9D 2XD5A 1P3OA 3REJB 4KUDA 3WA9B 1ULYA 5B1MD 5B1MA 4QLCA 4WU9B 5B2JD 1W2EA 5B2JA 3WAAD 3WAAA 1BH9A 1M19C 5F99D 5F99A 5CPKC 5B31A 3X1UD 4H9PA 2CV5C 5BS7C 3UT9D 3UT9A 1M18C 4XUJD 2RIQA 4XUJA 4X23C 4WNNB 4ZBJC 1ID3D 5AY8D 4WU8A 5AY8A 1ID3A 3B6FC 3EG5B 4CAYA 3W96A 1B67A 5AV5C 1PZRA 5B40C 2Y2OA 3AZLD 3AZLA 2F8ND 5JA4A 4KGCD 2NQBA 1TZYA 4KGCA 5B31G 1P34C 5GT3C 2ZY5A 3W97B 4UPKA 3MGPD 1T3UA 5B1LC 4XZQC 3AZHA 4NE6A 5AVCD 5AVCA 5GSUB 3KXBB 2AROB 3UTBA 5CPJC 5JRGB 5AVBC 5B2IB 5GXQC 3AZKB 1P3OC 4KUDC 3A1KA 1P3MA 2NZDC 5B1MC 1TAFB 4QLCC 3WAAC 3VH6A 4YM6D 3AV1A 5AV8B 3AV1D 1M1AC 5F99C 5B31C 5GT0D 4YM6B 4DQYB 3UT9C 4XUJC 3F6TA 5GT0B 2BYMB 3REID 1P3AD 4WU8C 1P3AA 1B6WA 5AY8C 3REKB 1ID3C 5CP6B 4KHAA 2Y2HA 5E5AA 2J8PA 3W96C 1KX3D 3REIB 4H9OA 3AZLC 2PYOB 1EQZA 2NQBC 1TZYC 5AV9A 1JFIB 4H9QA 3C1CD 3VH6T 3C1CA 5DNNB 1N1JB 3AZHC 3AZIC 1KX4B 3X1VB 5AVCC 4JJNA 3UTBC 1AOIB 4R8PB 3KSYA 4EO5B 3AN2A 4J8VD 4J8VA 2DQNC 3AZFC 1P3ID 3WKJA 3A6NB 3O62D 3B6GA 4H9NA 1WWIA 4YS3A 1P3IB 1HTAA 1P3MC 2Y2IA 3AZED 3AZEA 2HIOD 3AYWD 1F66D 3AYWA 4NE5A 3LZ0A 4UUZA 3RELD 3RELA 4Z66D 3LZ1B 2Y2GA 3H0LC 2Y2QA 4Z5TD 4Z5TA 3EPKA 1P3BD 4Z66B 3AV2B 3W98D 3W98A 3B0CW 5B0ZA 1Q9CA 3MGQA 3MGQD 1P3AC 5BT1D 3REHA 5E5AC 5B33D 2LY8A 4AWLB 3MGSC 4G92C 2ZY3A 4J8UD 3AZNB 3LELD 1EQZC 5CPIA 3C1BB 5BO0A 5AV9C 3X1SA 3MVDD 3C1CC 4J8UB 1P3KD 3AFAA 1P3KA 1HQ3D 4JJNC 3X1TD 3UTAC 3X1TA 3B0DC 1U35D 1U35A 3AN2C 1M19B 1S32A 3WKJC 5CPKB 5B32B 3B6GC 3REJD 5AV6D 3REJA 4YS3C 3WA9A 4ZUXA 1M18B 4E45A 4WU9A 4X23B 5AV6B
chains in the Genus database with same CATH topology
3LZ0C 3P5JB 3RELC 5B40B 2RVQD 2YFVB 5AV5B 4E44A 3TU4C 5B0YC 4Z5TC 5GT3B 3X1UA 1BH8B 3W98C 4WV4B 4XZQB 5B0ZC 3MGQC 5CHLB 3AZJB 5G49B 3REHC 5BNVB 4G91C 4J8WB 5CPIC 1WWSA 2FFFB 3X1SC 3W97D 3W97A 4H9SA 3VH5W 2F8NA 2Y2KA 3KUYC 2DF4C 3AFAC 1P3OB 3W99D 5GSUD 2AROD 1R4VA 2AROA 3VH5A 5GSUA 5JRGD 3KXBD 5JRGA 3KXBA 3MGPA 3X1TC 2NZDB 4QLCB 4Z2MH 3MNNC 1U35C 5B2ID 3W99B 5B2IA 1M1AB 1BH9B 2FJ7C 2Y2NA 3WTPC 1S32C 1P3FB 3AZKD 3AZKA 5B31B 4DRBA 3H0RC 3REJC 3WA9C 3EPLA 4ZUXC 2JE5A 1TAFA 4WU9C 5AV8D 4WU8B 5AV8A 1P3GD 4CAYB 5B2JC 3R45B 2RVQC 4YM6A 3NQUB 2F8NK 1P3GB 5JA4B 3LJAD 1TZYB 3AZGB 2NQBB 3X1UC 5GT0A 4NFTA 2BYKB 3REKD 3LJAB 5CP6D 3AZHB 5CP6A 4WZSB 3AZIB 5DNMB 3A1IA 4CSRB 3AZMB 2UWXA 3REIA 4HGAC 2PYOD 2F8NH 2L5AA 5BNXB 1KX5B 3EPHA 1KX3A 3W97C 4H9SC 3AZFB 5DNND 5DNNA 1N1JA 4KGCC 2IO5C 1KX4D 3X1VD 3KFUG 3X1VA 3H0MC 5GSUC 3MGPC 5JRGC 1P3MB 1AOID 4R8PD 3V9RB 1KU5A 3A6ND 3A6NA 1ZLAB 1Z2CB 5B24B 2JCHA 1P3IA 5FUGB 5KDMB 3O62A 2JSSA 5AV8C 3NQJB 2HIOA 1F66A 3LZ1D 3LZ1A 5C3IC 2HUEC 4YM6C 3MGSB 4G92B 3AV1C 1EQZB 5AV9B 4Z66A 5GT0C 3AV2D 3AV2A 4LD9B 3KWQD 1P3BA 4JJNB 4H9RB 3MGRB 3UTAB 3REIC 3AZND 3AZNA 3B0DB 3C1BD 3KWQB 3C1BA 5B33A 3AN2B 1KX3C 1P3LB 4J8UA 5DNNC 3LELA 3B6GB 3X1VC 3MVDA 4J8XB 4YS3B 2YFWB 1P3PB 4EO5C 1HQ3A 1M19D 3EPJA 1M19A 3LZ0B 5CPKD 5B32D 5B32A 4J8VC 3TU4B 5B0YB 1P3IC 1M18D 4X23D 3O62C 4X23A 1H3OB 5AV6A 2CV5B 3B0CT 5B0ZB 3AZEC 3REHB 2HIOC 5B40D 4NE3A 5AV5D 4ZBJB 2YFVA 3AYWC 1F66C 3WTPE 4WJ3C 3B6FB 5CPIB 3IP4C 5GT3D 5GT3A 3X1SB 4Z66C 3AV2C 4XZQD 3KUYB 4Z2MG 3AZJD 3AFAB 3AZJA 1P34B 1P3BC 4WNNA 5BNVA 5B1LB 3AZNC 4J8WD 4J8WA 5BT1C 3MNNB 3C1BC 5B33C 2F2AC 5CPJB 2FJ7B 1S32B 3WTPB 5AVBB 4J8UC 3LELC 1P3OD 3MVDC 4KUDD 5GXQB 4ZUXB 2NZDD 2NZDA 4QLCD 1P3KC 1HQ3C 3W99A 1M1AD 4KUDB 1M1AA 1P3FD 5B1MB 1P3FA 2G5IC 5B31D 5B32C 5B2JB 2CWEA 3WAAB 5F99B 3X1UB 4H9PB 5AV6C 4WU8D 4M6BA 2F8NG 3UT9B 4XUJB 3W96D 3R45A 4HGAB 1ID3B 5AY8B 3NQUA 1P3GA 3AZGD 1TZYD 3AZGA 2NQBD 3W96B 3B0BA 3AZLB 3VH5T 2F8NB 2BYKA 4DRAA 3AZHD 3LJAA 2IO5B 3AZIA 3AZID 5DNMD 3AZJC 5DNMA 4KGCB 4CSRA 3AZMD 3AZMA 3MGPB 3UTBD 2BYMA 3REKA 1KX5D 5BNXA 4J8WC 1KX5A 5AVCB 3UTBB 3AZFD 3AZFA 2PYOA 2W8SA 1JFIA 3VH6W 1P3MD 1KX4A 3V9RA 3W99C 3KXBC 2AROC 1P3FC 1AOIA 4R8PA 1ZLAD 1ZLAA 5B24D 5B2IC 5B24A 5C3IB 2HUEB 3AV1B 3AL0C 5FUGA 3AZKC 5KDMA 3NQJA 5E5AD 2ZM5A 3MGSD 3MGSA 1A7WA 1P3AB 1P3GC 1EQZD 4KHAB 3AZGC 5E5AB 5AV9D 1KX3B 4H9OB 4LD9D 4LD9A 3LJAC 2VQRA 5DNMC 4JJND 3AZMC 3MGRD 4H9RA 4H9QB 3MGRA 2Y2PA 3C1CB 3UTAD 3UTAA 3REKC 5CP6C 1KX5C 3AN2D 3KWQA 1P3LD 3WKJD 1P3LA 2PYOC 3B6GD 4J8VB 2G5HC 4J8XD 4J8XA 4YS3D 3WKJB 2YFWA 1P3PD 2Y2JA 1P3PA 3FDDA 1KX4C 3O62B 4H9NB 3LZ0D 1AOIC 4R8PC 3AZEB 2HIOB 3AYWB 1F66B 1ZLAC 5B24C 3TU4D 3TU4A 5B0YD 5B0YA 3A6NC 4UUZB 5CPKA 3RELB 2CV5D 1H3OA 2CV5A 5B0ZD 5BS7A 1M18A 1BFMA 4Z5TB 3REHD 1P3BB 2ZY4A 3W98B 3MGQB 3B6FD 3B6FA 5CPID 2Y2LA 5B33B 3X1SD 5B40A 4G91B 5AV5A 3LZ1C 3LELB 3KUYD 3KUYA 4LD9C 2XD1A 5B32G 5BO0B 3AFAD 1P34D 1P34A 3MVDB 2ZY2A 2Y2MA 1BH8A 3MGRC 5B1LD 5B1LA 4XZQA 1P3KB 2BG1A 5G49A 3MNND 3MNNA 1HQ3B 3KWQC 5CPJD 5CPJA 4AWLC 3X1TB 2FJ7D 1S32D 5AVBD 3WTPD 5AVBA 3WTPA 1P3LC 2FJ7A 1F1EA 1U35B 4J8XC 3WA9D 5GXQD 4ZUXD 5GXQA 1P3PC 4WU9D 2XD5A 1P3OA 3REJB 4KUDA 3WA9B 1ULYA 5B1MD 5B1MA 4QLCA 4WU9B 5B2JD 1W2EA 5B2JA 3WAAD 3WAAA 1BH9A 1M19C 5F99D 5F99A 5CPKC 5B31A 3X1UD 4H9PA 2CV5C 5BS7C 3UT9D 3UT9A 1M18C 4XUJD 2RIQA 4XUJA 4X23C 4WNNB 4ZBJC 1ID3D 5AY8D 4WU8A 5AY8A 1ID3A 3B6FC 3EG5B 4CAYA 3W96A 1B67A 5AV5C 1PZRA 5B40C 2Y2OA 3AZLD 3AZLA 2F8ND 5JA4A 4KGCD 2NQBA 1TZYA 4KGCA 5B31G 1P34C 5GT3C 2ZY5A 3W97B 4UPKA 3MGPD 1T3UA 5B1LC 4XZQC 3AZHA 4NE6A 5AVCD 5AVCA 5GSUB 3KXBB 2AROB 3UTBA 5CPJC 5JRGB 5AVBC 5B2IB 5GXQC 3AZKB 1P3OC 4KUDC 3A1KA 1P3MA 2NZDC 5B1MC 1TAFB 4QLCC 3WAAC 3VH6A 4YM6D 3AV1A 5AV8B 3AV1D 1M1AC 5F99C 5B31C 5GT0D 4YM6B 4DQYB 3UT9C 4XUJC 3F6TA 5GT0B 2BYMB 3REID 1P3AD 4WU8C 1P3AA 1B6WA 5AY8C 3REKB 1ID3C 5CP6B 4KHAA 2Y2HA 5E5AA 2J8PA 3W96C 1KX3D 3REIB 4H9OA 3AZLC 2PYOB 1EQZA 2NQBC 1TZYC 5AV9A 1JFIB 4H9QA 3C1CD 3VH6T 3C1CA 5DNNB 1N1JB 3AZHC 3AZIC 1KX4B 3X1VB 5AVCC 4JJNA 3UTBC 1AOIB 4R8PB 3KSYA 4EO5B 3AN2A 4J8VD 4J8VA 2DQNC 3AZFC 1P3ID 3WKJA 3A6NB 3O62D 3B6GA 4H9NA 1WWIA 4YS3A 1P3IB 1HTAA 1P3MC 2Y2IA 3AZED 3AZEA 2HIOD 3AYWD 1F66D 3AYWA 4NE5A 3LZ0A 4UUZA 3RELD 3RELA 4Z66D 3LZ1B 2Y2GA 3H0LC 2Y2QA 4Z5TD 4Z5TA 3EPKA 1P3BD 4Z66B 3AV2B 3W98D 3W98A 3B0CW 5B0ZA 1Q9CA 3MGQA 3MGQD 1P3AC 5BT1D 3REHA 5E5AC 5B33D 2LY8A 4AWLB 3MGSC 4G92C 2ZY3A 4J8UD 3AZNB 3LELD 1EQZC 5CPIA 3C1BB 5BO0A 5AV9C 3X1SA 3MVDD 3C1CC 4J8UB 1P3KD 3AFAA 1P3KA 1HQ3D 4JJNC 3X1TD 3UTAC 3X1TA 3B0DC 1U35D 1U35A 3AN2C 1M19B 1S32A 3WKJC 5CPKB 5B32B 3B6GC 3REJD 5AV6D 3REJA 4YS3C 3WA9A 4ZUXA 1M18B 4E45A 4WU9A 4X23B 5AV6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ0 C;  3REL C;  5B40 B;  2RVQ D;  2YFV B;  5AV5 B;  4E44 A;  3TU4 C;  5B0Y C;  4Z5T C;  5GT3 B;  3X1U A;  1BH8 B;  3W98 C;  4WV4 B;  4XZQ B;  5B0Z C;  3MGQ C;  5CHL B;  3AZJ B;  5G49 B;  3REH C;  5BNV B;  4G91 C;  4J8W B;  5CPI C;  1WWS A;  3X1S C;  3W97 D;  3W97 A;  4H9S A;  3VH5 W;  2F8N A;  3KUY C;  3AFA C;  1P3O B;  3W99 D;  5GSU D;  2ARO D;  1R4V A;  2ARO A;  3VH5 A;  5GSU A;  5JRG D;  3KXB D;  5JRG A;  3KXB A;  3MGP A;  3X1T C;  2NZD B;  4QLC B;  4Z2M H;  3MNN C;  1U35 C;  5B2I D;  3W99 B;  5B2I A;  1M1A B;  1BH9 B;  2FJ7 C;  1S32 C;  3WTP C;  1P3F B;  3AZK D;  3AZK A;  5B31 B;  4DRB A;  3REJ C;  3WA9 C;  4ZUX C;  1TAF A;  4WU9 C;  5AV8 D;  4WU8 B;  5AV8 A;  1P3G D;  4CAY B;  5B2J C;  3R45 B;  2RVQ C;  4YM6 A;  3NQU B;  2F8N K;  1P3G B;  5JA4 B;  3LJA D;  1TZY B;  3AZG B;  2NQB B;  3X1U C;  5GT0 A;  4NFT A;  2BYK B;  3REK D;  3LJA B;  5CP6 D;  3AZH B;  5CP6 A;  4WZS B;  3AZI B;  5DNM B;  4CSR B;  3AZM B;  3REI A;  4HGA C;  2PYO D;  2F8N H;  2L5A A;  5BNX B;  1KX5 B;  1KX3 A;  3W97 C;  4H9S C;  3AZF B;  5DNN D;  5DNN A;  1N1J A;  4KGC C;  2IO5 C;  1KX4 D;  3X1V D;  3X1V A;  5GSU C;  3MGP C;  5JRG C;  1P3M B;  1AOI D;  4R8P D;  3V9R B;  1KU5 A;  3A6N D;  3A6N A;  1ZLA B;  5B24 B;  1P3I A;  5FUG B;  5KDM B;  3O62 A;  2JSS A;  5AV8 C;  3NQJ B;  2HIO A;  1F66 A;  3LZ1 D;  3LZ1 A;  5C3I C;  2HUE C;  4YM6 C;  3MGS B;  4G92 B;  3AV1 C;  1EQZ B;  5AV9 B;  4Z66 A;  5GT0 C;  3AV2 D;  3AV2 A;  4LD9 B;  3KWQ D;  1P3B A;  4JJN B;  4H9R B;  3MGR B;  3UTA B;  3REI C;  3AZN D;  3AZN A;  3B0D B;  3C1B D;  3KWQ B;  3C1B A;  5B33 A;  3AN2 B;  1KX3 C;  1P3L B;  4J8U A;  5DNN C;  3LEL A;  3B6G B;  3X1V C;  3MVD A;  4J8X B;  4YS3 B;  2YFW B;  1P3P B;  4EO5 C;  1HQ3 A;  1M19 D;  1M19 A;  3LZ0 B;  5CPK D;  5B32 D;  5B32 A;  4J8V C;  3TU4 B;  5B0Y B;  1P3I C;  1M18 D;  4X23 D;  3O62 C;  4X23 A;  1H3O B;  5AV6 A;  2CV5 B;  3B0C T;  5B0Z B;  3AZE C;  3REH B;  2HIO C;  5B40 D;  4NE3 A;  5AV5 D;  4ZBJ B;  2YFV A;  3AYW C;  1F66 C;  3WTP E;  3B6F B;  5CPI B;  5GT3 D;  5GT3 A;  3X1S B;  4Z66 C;  3AV2 C;  4XZQ D;  3KUY B;  4Z2M G;  3AZJ D;  3AFA B;  3AZJ A;  1P34 B;  1P3B C;  4WNN A;  5BNV A;  5B1L B;  3AZN C;  4J8W D;  4J8W A;  5BT1 C;  3MNN B;  3C1B C;  5B33 C;  5CPJ B;  2FJ7 B;  1S32 B;  3WTP B;  5AVB B;  4J8U C;  3LEL C;  1P3O D;  3MVD C;  4KUD D;  5GXQ B;  4ZUX B;  2NZD D;  2NZD A;  4QLC D;  1P3K C;  1HQ3 C;  3W99 A;  1M1A D;  4KUD B;  1M1A A;  1P3F D;  5B1M B;  1P3F A;  5B31 D;  5B32 C;  5B2J B;  2CWE A;  3WAA B;  5F99 B;  3X1U B;  4H9P B;  5AV6 C;  4WU8 D;  4M6B A;  2F8N G;  3UT9 B;  4XUJ B;  3W96 D;  3R45 A;  4HGA B;  1ID3 B;  5AY8 B;  3NQU A;  1P3G A;  3AZG D;  1TZY D;  3AZG A;  2NQB D;  3W96 B;  3B0B A;  3AZL B;  3VH5 T;  2F8N B;  2BYK A;  4DRA A;  3AZH D;  3LJA A;  2IO5 B;  3AZI A;  3AZI D;  5DNM D;  3AZJ C;  5DNM A;  4KGC B;  4CSR A;  3AZM D;  3AZM A;  3MGP B;  3UTB D;  2BYM A;  3REK A;  1KX5 D;  5BNX A;  4J8W C;  1KX5 A;  5AVC B;  3UTB B;  3AZF D;  3AZF A;  2PYO A;  1JFI A;  3VH6 W;  1P3M D;  1KX4 A;  3V9R A;  3W99 C;  3KXB C;  2ARO C;  1P3F C;  1AOI A;  4R8P A;  1ZLA D;  1ZLA A;  5B24 D;  5B2I C;  5B24 A;  5C3I B;  2HUE B;  3AV1 B;  5FUG A;  3AZK C;  5KDM A;  3NQJ A;  5E5A D;  3MGS D;  3MGS A;  1A7W A;  1P3A B;  1P3G C;  1EQZ D;  4KHA B;  3AZG C;  5E5A B;  5AV9 D;  1KX3 B;  4H9O B;  4LD9 D;  4LD9 A;  3LJA C;  5DNM C;  4JJN D;  3AZM C;  3MGR D;  4H9R A;  4H9Q B;  3MGR A;  3C1C B;  3UTA D;  3UTA A;  3REK C;  5CP6 C;  1KX5 C;  3AN2 D;  3KWQ A;  1P3L D;  3WKJ D;  1P3L A;  2PYO C;  3B6G D;  4J8V B;  4J8X D;  4J8X A;  4YS3 D;  3WKJ B;  2YFW A;  1P3P D;  1P3P A;  1KX4 C;  3O62 B;  4H9N B;  3LZ0 D;  1AOI C;  4R8P C;  3AZE B;  2HIO B;  3AYW B;  1F66 B;  1ZLA C;  5B24 C;  3TU4 D;  3TU4 A;  5B0Y D;  5B0Y A;  3A6N C;  4UUZ B;  5CPK A;  3REL B;  2CV5 D;  1H3O A;  2CV5 A;  5B0Z D;  5BS7 A;  1M18 A;  1BFM A;  4Z5T B;  3REH D;  1P3B B;  3W98 B;  3MGQ B;  3B6F D;  3B6F A;  5CPI D;  5B33 B;  3X1S D;  5B40 A;  4G91 B;  5AV5 A;  3LZ1 C;  3LEL B;  3KUY D;  3KUY A;  4LD9 C;  5B32 G;  5BO0 B;  3AFA D;  1P34 D;  1P34 A;  3MVD B;  3MGR C;  1BH8 A;  5B1L D;  5B1L A;  4XZQ A;  1P3K B;  5G49 A;  3MNN D;  3MNN A;  3KWQ C;  1HQ3 B;  5CPJ D;  5CPJ A;  4AWL C;  3X1T B;  2FJ7 D;  1S32 D;  5AVB D;  3WTP D;  5AVB A;  3WTP A;  1P3L C;  2FJ7 A;  1F1E A;  1U35 B;  4J8X C;  3WA9 D;  5GXQ D;  4ZUX D;  5GXQ A;  1P3P C;  4WU9 D;  1P3O A;  3REJ B;  4KUD A;  3WA9 B;  1ULY A;  5B1M D;  5B1M A;  4QLC A;  4WU9 B;  5B2J D;  3WAA D;  5B2J A;  3WAA A;  1BH9 A;  1M19 C;  5F99 D;  5F99 A;  5CPK C;  5B31 A;  3X1U D;  4H9P A;  2CV5 C;  5BS7 C;  3UT9 D;  3UT9 A;  1M18 C;  4XUJ D;  4XUJ A;  4X23 C;  4WNN B;  4ZBJ C;  1ID3 D;  5AY8 D;  4WU8 A;  5AY8 A;  1ID3 A;  3B6F C;  4CAY A;  3W96 A;  1B67 A;  5AV5 C;  5B40 C;  3AZL D;  2F8N D;  3AZL A;  5JA4 A;  4KGC D;  2NQB A;  1TZY A;  4KGC A;  5B31 G;  1P34 C;  5GT3 C;  3W97 B;  3MGP D;  5B1L C;  4XZQ C;  3AZH A;  4NE6 A;  5AVC D;  5AVC A;  5GSU B;  3KXB B;  2ARO B;  3UTB A;  5CPJ C;  5JRG B;  5AVB C;  5B2I B;  5GXQ C;  3AZK B;  1P3O C;  4KUD C;  1P3M A;  2NZD C;  5B1M C;  1TAF B;  4QLC C;  3WAA C;  3VH6 A;  4YM6 D;  3AV1 A;  5AV8 B;  3AV1 D;  1M1A C;  5F99 C;  5B31 C;  5GT0 D;  4YM6 B;  3UT9 C;  4XUJ C;  5GT0 B;  2BYM B;  3REI D;  1P3A D;  4WU8 C;  1P3A A;  1B6W A;  5AY8 C;  3REK B;  1ID3 C;  5CP6 B;  4KHA A;  5E5A A;  3W96 C;  1KX3 D;  3REI B;  4H9O A;  3AZL C;  2PYO B;  1EQZ A;  2NQB C;  1TZY C;  5AV9 A;  1JFI B;  4H9Q A;  3C1C D;  3VH6 T;  3C1C A;  5DNN B;  1N1J B;  3AZH C;  3AZI C;  1KX4 B;  3X1V B;  5AVC C;  4JJN A;  3UTB C;  1AOI B;  4R8P B;  3KSY A;  4EO5 B;  3AN2 A;  4J8V D;  4J8V A;  3AZF C;  1P3I D;  3WKJ A;  3A6N B;  3O62 D;  3B6G A;  4H9N A;  1WWI A;  4YS3 A;  1P3I B;  1HTA A;  1P3M C;  3AZE D;  3AZE A;  2HIO D;  3AYW D;  1F66 D;  3AYW A;  4NE5 A;  3LZ0 A;  4UUZ A;  3REL D;  3REL A;  4Z66 D;  3LZ1 B;  4Z5T D;  4Z5T A;  1P3B D;  4Z66 B;  3AV2 B;  3W98 D;  3W98 A;  3B0C W;  5B0Z A;  1Q9C A;  3MGQ A;  3MGQ D;  1P3A C;  5BT1 D;  3REH A;  5E5A C;  5B33 D;  2LY8 A;  4AWL B;  3MGS C;  4G92 C;  4J8U D;  3AZN B;  3LEL D;  1EQZ C;  5CPI A;  3C1B B;  5BO0 A;  5AV9 C;  3X1S A;  3MVD D;  3C1C C;  4J8U B;  1P3K D;  3AFA A;  1P3K A;  1HQ3 D;  4JJN C;  3X1T D;  3UTA C;  3X1T A;  3B0D C;  1U35 D;  1U35 A;  3AN2 C;  1M19 B;  1S32 A;  3WKJ C;  5CPK B;  5B32 B;  3B6G C;  3REJ D;  5AV6 D;  3REJ A;  4YS3 C;  3WA9 A;  4ZUX A;  1M18 B;  4E45 A;  4WU9 A;  4X23 B;  5AV6 B; 
#chains in the Genus database with same CATH topology
 3LZ0 C;  3P5J B;  3REL C;  5B40 B;  2RVQ D;  2YFV B;  5AV5 B;  4E44 A;  3TU4 C;  5B0Y C;  4Z5T C;  5GT3 B;  3X1U A;  1BH8 B;  3W98 C;  4WV4 B;  4XZQ B;  5B0Z C;  3MGQ C;  5CHL B;  3AZJ B;  5G49 B;  3REH C;  5BNV B;  4G91 C;  4J8W B;  5CPI C;  1WWS A;  2FFF B;  3X1S C;  3W97 D;  3W97 A;  4H9S A;  3VH5 W;  2F8N A;  2Y2K A;  3KUY C;  2DF4 C;  3AFA C;  1P3O B;  3W99 D;  5GSU D;  2ARO D;  1R4V A;  2ARO A;  3VH5 A;  5GSU A;  5JRG D;  3KXB D;  5JRG A;  3KXB A;  3MGP A;  3X1T C;  2NZD B;  4QLC B;  4Z2M H;  3MNN C;  1U35 C;  5B2I D;  3W99 B;  5B2I A;  1M1A B;  1BH9 B;  2FJ7 C;  2Y2N A;  3WTP C;  1S32 C;  1P3F B;  3AZK D;  3AZK A;  5B31 B;  4DRB A;  3H0R C;  3REJ C;  3WA9 C;  3EPL A;  4ZUX C;  2JE5 A;  1TAF A;  4WU9 C;  5AV8 D;  4WU8 B;  5AV8 A;  1P3G D;  4CAY B;  5B2J C;  3R45 B;  2RVQ C;  4YM6 A;  3NQU B;  2F8N K;  1P3G B;  5JA4 B;  3LJA D;  1TZY B;  3AZG B;  2NQB B;  3X1U C;  5GT0 A;  4NFT A;  2BYK B;  3REK D;  3LJA B;  5CP6 D;  3AZH B;  5CP6 A;  4WZS B;  3AZI B;  5DNM B;  3A1I A;  4CSR B;  3AZM B;  2UWX A;  3REI A;  4HGA C;  2PYO D;  2F8N H;  2L5A A;  5BNX B;  1KX5 B;  3EPH A;  1KX3 A;  3W97 C;  4H9S C;  3AZF B;  5DNN D;  5DNN A;  1N1J A;  4KGC C;  2IO5 C;  1KX4 D;  3X1V D;  3KFU G;  3X1V A;  3H0M C;  5GSU C;  3MGP C;  5JRG C;  1P3M B;  1AOI D;  4R8P D;  3V9R B;  1KU5 A;  3A6N D;  3A6N A;  1ZLA B;  1Z2C B;  5B24 B;  2JCH A;  1P3I A;  5FUG B;  5KDM B;  3O62 A;  2JSS A;  5AV8 C;  3NQJ B;  2HIO A;  1F66 A;  3LZ1 D;  3LZ1 A;  5C3I C;  2HUE C;  4YM6 C;  3MGS B;  4G92 B;  3AV1 C;  1EQZ B;  5AV9 B;  4Z66 A;  5GT0 C;  3AV2 D;  3AV2 A;  4LD9 B;  3KWQ D;  1P3B A;  4JJN B;  4H9R B;  3MGR B;  3UTA B;  3REI C;  3AZN D;  3AZN A;  3B0D B;  3C1B D;  3KWQ B;  3C1B A;  5B33 A;  3AN2 B;  1KX3 C;  1P3L B;  4J8U A;  5DNN C;  3LEL A;  3B6G B;  3X1V C;  3MVD A;  4J8X B;  4YS3 B;  2YFW B;  1P3P B;  4EO5 C;  1HQ3 A;  1M19 D;  3EPJ A;  1M19 A;  3LZ0 B;  5CPK D;  5B32 D;  5B32 A;  4J8V C;  3TU4 B;  5B0Y B;  1P3I C;  1M18 D;  4X23 D;  3O62 C;  4X23 A;  1H3O B;  5AV6 A;  2CV5 B;  3B0C T;  5B0Z B;  3AZE C;  3REH B;  2HIO C;  5B40 D;  4NE3 A;  5AV5 D;  4ZBJ B;  2YFV A;  3AYW C;  1F66 C;  3WTP E;  4WJ3 C;  3B6F B;  5CPI B;  3IP4 C;  5GT3 D;  5GT3 A;  3X1S B;  4Z66 C;  3AV2 C;  4XZQ D;  3KUY B;  4Z2M G;  3AZJ D;  3AFA B;  3AZJ A;  1P34 B;  1P3B C;  4WNN A;  5BNV A;  5B1L B;  3AZN C;  4J8W D;  4J8W A;  5BT1 C;  3MNN B;  3C1B C;  5B33 C;  2F2A C;  5CPJ B;  2FJ7 B;  1S32 B;  3WTP B;  5AVB B;  4J8U C;  3LEL C;  1P3O D;  3MVD C;  4KUD D;  5GXQ B;  4ZUX B;  2NZD D;  2NZD A;  4QLC D;  1P3K C;  1HQ3 C;  3W99 A;  1M1A D;  4KUD B;  1M1A A;  1P3F D;  5B1M B;  1P3F A;  2G5I C;  5B31 D;  5B32 C;  5B2J B;  2CWE A;  3WAA B;  5F99 B;  3X1U B;  4H9P B;  5AV6 C;  4WU8 D;  4M6B A;  2F8N G;  3UT9 B;  4XUJ B;  3W96 D;  3R45 A;  4HGA B;  1ID3 B;  5AY8 B;  3NQU A;  1P3G A;  3AZG D;  1TZY D;  3AZG A;  2NQB D;  3W96 B;  3B0B A;  3AZL B;  3VH5 T;  2F8N B;  2BYK A;  4DRA A;  3AZH D;  3LJA A;  2IO5 B;  3AZI A;  3AZI D;  5DNM D;  3AZJ C;  5DNM A;  4KGC B;  4CSR A;  3AZM D;  3AZM A;  3MGP B;  3UTB D;  2BYM A;  3REK A;  1KX5 D;  5BNX A;  4J8W C;  1KX5 A;  5AVC B;  3UTB B;  3AZF D;  3AZF A;  2PYO A;  2W8S A;  1JFI A;  3VH6 W;  1P3M D;  1KX4 A;  3V9R A;  3W99 C;  3KXB C;  2ARO C;  1P3F C;  1AOI A;  4R8P A;  1ZLA D;  1ZLA A;  5B24 D;  5B2I C;  5B24 A;  5C3I B;  2HUE B;  3AV1 B;  3AL0 C;  5FUG A;  3AZK C;  5KDM A;  3NQJ A;  5E5A D;  2ZM5 A;  3MGS D;  3MGS A;  1A7W A;  1P3A B;  1P3G C;  1EQZ D;  4KHA B;  3AZG C;  5E5A B;  5AV9 D;  1KX3 B;  4H9O B;  4LD9 D;  4LD9 A;  3LJA C;  2VQR A;  5DNM C;  4JJN D;  3AZM C;  3MGR D;  4H9R A;  4H9Q B;  3MGR A;  2Y2P A;  3C1C B;  3UTA D;  3UTA A;  3REK C;  5CP6 C;  1KX5 C;  3AN2 D;  3KWQ A;  1P3L D;  3WKJ D;  1P3L A;  2PYO C;  3B6G D;  4J8V B;  2G5H C;  4J8X D;  4J8X A;  4YS3 D;  3WKJ B;  2YFW A;  1P3P D;  2Y2J A;  1P3P A;  3FDD A;  1KX4 C;  3O62 B;  4H9N B;  3LZ0 D;  1AOI C;  4R8P C;  3AZE B;  2HIO B;  3AYW B;  1F66 B;  1ZLA C;  5B24 C;  3TU4 D;  3TU4 A;  5B0Y D;  5B0Y A;  3A6N C;  4UUZ B;  5CPK A;  3REL B;  2CV5 D;  1H3O A;  2CV5 A;  5B0Z D;  5BS7 A;  1M18 A;  1BFM A;  4Z5T B;  3REH D;  1P3B B;  2ZY4 A;  3W98 B;  3MGQ B;  3B6F D;  3B6F A;  5CPI D;  2Y2L A;  5B33 B;  3X1S D;  5B40 A;  4G91 B;  5AV5 A;  3LZ1 C;  3LEL B;  3KUY D;  3KUY A;  4LD9 C;  2XD1 A;  5B32 G;  5BO0 B;  3AFA D;  1P34 D;  1P34 A;  3MVD B;  2ZY2 A;  2Y2M A;  1BH8 A;  3MGR C;  5B1L D;  5B1L A;  4XZQ A;  1P3K B;  2BG1 A;  5G49 A;  3MNN D;  3MNN A;  1HQ3 B;  3KWQ C;  5CPJ D;  5CPJ A;  4AWL C;  3X1T B;  2FJ7 D;  1S32 D;  5AVB D;  3WTP D;  5AVB A;  3WTP A;  1P3L C;  2FJ7 A;  1F1E A;  1U35 B;  4J8X C;  3WA9 D;  5GXQ D;  4ZUX D;  5GXQ A;  1P3P C;  4WU9 D;  2XD5 A;  1P3O A;  3REJ B;  4KUD A;  3WA9 B;  1ULY A;  5B1M D;  5B1M A;  4QLC A;  4WU9 B;  5B2J D;  1W2E A;  5B2J A;  3WAA D;  3WAA A;  1BH9 A;  1M19 C;  5F99 D;  5F99 A;  5CPK C;  5B31 A;  3X1U D;  4H9P A;  2CV5 C;  5BS7 C;  3UT9 D;  3UT9 A;  1M18 C;  4XUJ D;  2RIQ A;  4XUJ A;  4X23 C;  4WNN B;  4ZBJ C;  1ID3 D;  5AY8 D;  4WU8 A;  5AY8 A;  1ID3 A;  3B6F C;  3EG5 B;  4CAY A;  3W96 A;  1B67 A;  5AV5 C;  1PZR A;  5B40 C;  2Y2O A;  3AZL D;  3AZL A;  2F8N D;  5JA4 A;  4KGC D;  2NQB A;  1TZY A;  4KGC A;  5B31 G;  1P34 C;  5GT3 C;  2ZY5 A;  3W97 B;  4UPK A;  3MGP D;  1T3U A;  5B1L C;  4XZQ C;  3AZH A;  4NE6 A;  5AVC D;  5AVC A;  5GSU B;  3KXB B;  2ARO B;  3UTB A;  5CPJ C;  5JRG B;  5AVB C;  5B2I B;  5GXQ C;  3AZK B;  1P3O C;  4KUD C;  3A1K A;  1P3M A;  2NZD C;  5B1M C;  1TAF B;  4QLC C;  3WAA C;  3VH6 A;  4YM6 D;  3AV1 A;  5AV8 B;  3AV1 D;  1M1A C;  5F99 C;  5B31 C;  5GT0 D;  4YM6 B;  4DQY B;  3UT9 C;  4XUJ C;  3F6T A;  5GT0 B;  2BYM B;  3REI D;  1P3A D;  4WU8 C;  1P3A A;  1B6W A;  5AY8 C;  3REK B;  1ID3 C;  5CP6 B;  4KHA A;  2Y2H A;  5E5A A;  2J8P A;  3W96 C;  1KX3 D;  3REI B;  4H9O A;  3AZL C;  2PYO B;  1EQZ A;  2NQB C;  1TZY C;  5AV9 A;  1JFI B;  4H9Q A;  3C1C D;  3VH6 T;  3C1C A;  5DNN B;  1N1J B;  3AZH C;  3AZI C;  1KX4 B;  3X1V B;  5AVC C;  4JJN A;  3UTB C;  1AOI B;  4R8P B;  3KSY A;  4EO5 B;  3AN2 A;  4J8V D;  4J8V A;  2DQN C;  3AZF C;  1P3I D;  3WKJ A;  3A6N B;  3O62 D;  3B6G A;  4H9N A;  1WWI A;  4YS3 A;  1P3I B;  1HTA A;  1P3M C;  2Y2I A;  3AZE D;  3AZE A;  2HIO D;  3AYW D;  1F66 D;  3AYW A;  4NE5 A;  3LZ0 A;  4UUZ A;  3REL D;  3REL A;  4Z66 D;  3LZ1 B;  2Y2G A;  3H0L C;  2Y2Q A;  4Z5T D;  4Z5T A;  3EPK A;  1P3B D;  4Z66 B;  3AV2 B;  3W98 D;  3W98 A;  3B0C W;  5B0Z A;  1Q9C A;  3MGQ A;  3MGQ D;  1P3A C;  5BT1 D;  3REH A;  5E5A C;  5B33 D;  2LY8 A;  4AWL B;  3MGS C;  4G92 C;  2ZY3 A;  4J8U D;  3AZN B;  3LEL D;  1EQZ C;  5CPI A;  3C1B B;  5BO0 A;  5AV9 C;  3X1S A;  3MVD D;  3C1C C;  4J8U B;  1P3K D;  3AFA A;  1P3K A;  1HQ3 D;  4JJN C;  3X1T D;  3UTA C;  3X1T A;  3B0D C;  1U35 D;  1U35 A;  3AN2 C;  1M19 B;  1S32 A;  3WKJ C;  5CPK B;  5B32 B;  3B6G C;  3REJ D;  5AV6 D;  3REJ A;  4YS3 C;  3WA9 A;  4ZUX A;  1M18 B;  4E45 A;  4WU9 A;  4X23 B;  5AV6 B; 
#chains in the Genus database with same CATH homology
 3LZ0 C;  3P5J B;  3REL C;  5B40 B;  2RVQ D;  2YFV B;  5AV5 B;  4E44 A;  3TU4 C;  5B0Y C;  4Z5T C;  5GT3 B;  3X1U A;  1BH8 B;  3W98 C;  4WV4 B;  4XZQ B;  5B0Z C;  3MGQ C;  5CHL B;  3AZJ B;  5G49 B;  3REH C;  5BNV B;  4G91 C;  4J8W B;  5CPI C;  1WWS A;  2FFF B;  3X1S C;  3W97 D;  3W97 A;  4H9S A;  3VH5 W;  2F8N A;  2Y2K A;  3KUY C;  2DF4 C;  3AFA C;  1P3O B;  3W99 D;  5GSU D;  2ARO D;  1R4V A;  2ARO A;  3VH5 A;  5GSU A;  5JRG D;  3KXB D;  5JRG A;  3KXB A;  3MGP A;  3X1T C;  2NZD B;  4QLC B;  4Z2M H;  3MNN C;  1U35 C;  5B2I D;  3W99 B;  5B2I A;  1M1A B;  1BH9 B;  2FJ7 C;  2Y2N A;  3WTP C;  1S32 C;  1P3F B;  3AZK D;  3AZK A;  5B31 B;  4DRB A;  3H0R C;  3REJ C;  3WA9 C;  3EPL A;  4ZUX C;  2JE5 A;  1TAF A;  4WU9 C;  5AV8 D;  4WU8 B;  5AV8 A;  1P3G D;  4CAY B;  5B2J C;  3R45 B;  2RVQ C;  4YM6 A;  3NQU B;  2F8N K;  1P3G B;  5JA4 B;  3LJA D;  1TZY B;  3AZG B;  2NQB B;  3X1U C;  5GT0 A;  4NFT A;  2BYK B;  3REK D;  3LJA B;  5CP6 D;  3AZH B;  5CP6 A;  4WZS B;  3AZI B;  5DNM B;  3A1I A;  4CSR B;  3AZM B;  2UWX A;  3REI A;  4HGA C;  2PYO D;  2F8N H;  2L5A A;  5BNX B;  1KX5 B;  3EPH A;  1KX3 A;  3W97 C;  4H9S C;  3AZF B;  5DNN D;  5DNN A;  1N1J A;  4KGC C;  2IO5 C;  1KX4 D;  3X1V D;  3KFU G;  3X1V A;  3H0M C;  5GSU C;  3MGP C;  5JRG C;  1P3M B;  1AOI D;  4R8P D;  3V9R B;  1KU5 A;  3A6N D;  3A6N A;  1ZLA B;  1Z2C B;  5B24 B;  2JCH A;  1P3I A;  5FUG B;  5KDM B;  3O62 A;  2JSS A;  5AV8 C;  3NQJ B;  2HIO A;  1F66 A;  3LZ1 D;  3LZ1 A;  5C3I C;  2HUE C;  4YM6 C;  3MGS B;  4G92 B;  3AV1 C;  1EQZ B;  5AV9 B;  4Z66 A;  5GT0 C;  3AV2 D;  3AV2 A;  4LD9 B;  3KWQ D;  1P3B A;  4JJN B;  4H9R B;  3MGR B;  3UTA B;  3REI C;  3AZN D;  3AZN A;  3B0D B;  3C1B D;  3KWQ B;  3C1B A;  5B33 A;  3AN2 B;  1KX3 C;  1P3L B;  4J8U A;  5DNN C;  3LEL A;  3B6G B;  3X1V C;  3MVD A;  4J8X B;  4YS3 B;  2YFW B;  1P3P B;  4EO5 C;  1HQ3 A;  1M19 D;  3EPJ A;  1M19 A;  3LZ0 B;  5CPK D;  5B32 D;  5B32 A;  4J8V C;  3TU4 B;  5B0Y B;  1P3I C;  1M18 D;  4X23 D;  3O62 C;  4X23 A;  1H3O B;  5AV6 A;  2CV5 B;  3B0C T;  5B0Z B;  3AZE C;  3REH B;  2HIO C;  5B40 D;  4NE3 A;  5AV5 D;  4ZBJ B;  2YFV A;  3AYW C;  1F66 C;  3WTP E;  4WJ3 C;  3B6F B;  5CPI B;  3IP4 C;  5GT3 D;  5GT3 A;  3X1S B;  4Z66 C;  3AV2 C;  4XZQ D;  3KUY B;  4Z2M G;  3AZJ D;  3AFA B;  3AZJ A;  1P34 B;  1P3B C;  4WNN A;  5BNV A;  5B1L B;  3AZN C;  4J8W D;  4J8W A;  5BT1 C;  3MNN B;  3C1B C;  5B33 C;  2F2A C;  5CPJ B;  2FJ7 B;  1S32 B;  3WTP B;  5AVB B;  4J8U C;  3LEL C;  1P3O D;  3MVD C;  4KUD D;  5GXQ B;  4ZUX B;  2NZD D;  2NZD A;  4QLC D;  1P3K C;  1HQ3 C;  3W99 A;  1M1A D;  4KUD B;  1M1A A;  1P3F D;  5B1M B;  1P3F A;  2G5I C;  5B31 D;  5B32 C;  5B2J B;  2CWE A;  3WAA B;  5F99 B;  3X1U B;  4H9P B;  5AV6 C;  4WU8 D;  4M6B A;  2F8N G;  3UT9 B;  4XUJ B;  3W96 D;  3R45 A;  4HGA B;  1ID3 B;  5AY8 B;  3NQU A;  1P3G A;  3AZG D;  1TZY D;  3AZG A;  2NQB D;  3W96 B;  3B0B A;  3AZL B;  3VH5 T;  2F8N B;  2BYK A;  4DRA A;  3AZH D;  3LJA A;  2IO5 B;  3AZI A;  3AZI D;  5DNM D;  3AZJ C;  5DNM A;  4KGC B;  4CSR A;  3AZM D;  3AZM A;  3MGP B;  3UTB D;  2BYM A;  3REK A;  1KX5 D;  5BNX A;  4J8W C;  1KX5 A;  5AVC B;  3UTB B;  3AZF D;  3AZF A;  2PYO A;  2W8S A;  1JFI A;  3VH6 W;  1P3M D;  1KX4 A;  3V9R A;  3W99 C;  3KXB C;  2ARO C;  1P3F C;  1AOI A;  4R8P A;  1ZLA D;  1ZLA A;  5B24 D;  5B2I C;  5B24 A;  5C3I B;  2HUE B;  3AV1 B;  3AL0 C;  5FUG A;  3AZK C;  5KDM A;  3NQJ A;  5E5A D;  2ZM5 A;  3MGS D;  3MGS A;  1A7W A;  1P3A B;  1P3G C;  1EQZ D;  4KHA B;  3AZG C;  5E5A B;  5AV9 D;  1KX3 B;  4H9O B;  4LD9 D;  4LD9 A;  3LJA C;  2VQR A;  5DNM C;  4JJN D;  3AZM C;  3MGR D;  4H9R A;  4H9Q B;  3MGR A;  2Y2P A;  3C1C B;  3UTA D;  3UTA A;  3REK C;  5CP6 C;  1KX5 C;  3AN2 D;  3KWQ A;  1P3L D;  3WKJ D;  1P3L A;  2PYO C;  3B6G D;  4J8V B;  2G5H C;  4J8X D;  4J8X A;  4YS3 D;  3WKJ B;  2YFW A;  1P3P D;  2Y2J A;  1P3P A;  3FDD A;  1KX4 C;  3O62 B;  4H9N B;  3LZ0 D;  1AOI C;  4R8P C;  3AZE B;  2HIO B;  3AYW B;  1F66 B;  1ZLA C;  5B24 C;  3TU4 D;  3TU4 A;  5B0Y D;  5B0Y A;  3A6N C;  4UUZ B;  5CPK A;  3REL B;  2CV5 D;  1H3O A;  2CV5 A;  5B0Z D;  5BS7 A;  1M18 A;  1BFM A;  4Z5T B;  3REH D;  1P3B B;  2ZY4 A;  3W98 B;  3MGQ B;  3B6F D;  3B6F A;  5CPI D;  2Y2L A;  5B33 B;  3X1S D;  5B40 A;  4G91 B;  5AV5 A;  3LZ1 C;  3LEL B;  3KUY D;  3KUY A;  4LD9 C;  2XD1 A;  5B32 G;  5BO0 B;  3AFA D;  1P34 D;  1P34 A;  3MVD B;  2ZY2 A;  2Y2M A;  1BH8 A;  3MGR C;  5B1L D;  5B1L A;  4XZQ A;  1P3K B;  2BG1 A;  5G49 A;  3MNN D;  3MNN A;  1HQ3 B;  3KWQ C;  5CPJ D;  5CPJ A;  4AWL C;  3X1T B;  2FJ7 D;  1S32 D;  5AVB D;  3WTP D;  5AVB A;  3WTP A;  1P3L C;  2FJ7 A;  1F1E A;  1U35 B;  4J8X C;  3WA9 D;  5GXQ D;  4ZUX D;  5GXQ A;  1P3P C;  4WU9 D;  2XD5 A;  1P3O A;  3REJ B;  4KUD A;  3WA9 B;  1ULY A;  5B1M D;  5B1M A;  4QLC A;  4WU9 B;  5B2J D;  1W2E A;  5B2J A;  3WAA D;  3WAA A;  1BH9 A;  1M19 C;  5F99 D;  5F99 A;  5CPK C;  5B31 A;  3X1U D;  4H9P A;  2CV5 C;  5BS7 C;  3UT9 D;  3UT9 A;  1M18 C;  4XUJ D;  2RIQ A;  4XUJ A;  4X23 C;  4WNN B;  4ZBJ C;  1ID3 D;  5AY8 D;  4WU8 A;  5AY8 A;  1ID3 A;  3B6F C;  3EG5 B;  4CAY A;  3W96 A;  1B67 A;  5AV5 C;  1PZR A;  5B40 C;  2Y2O A;  3AZL D;  3AZL A;  2F8N D;  5JA4 A;  4KGC D;  2NQB A;  1TZY A;  4KGC A;  5B31 G;  1P34 C;  5GT3 C;  2ZY5 A;  3W97 B;  4UPK A;  3MGP D;  1T3U A;  5B1L C;  4XZQ C;  3AZH A;  4NE6 A;  5AVC D;  5AVC A;  5GSU B;  3KXB B;  2ARO B;  3UTB A;  5CPJ C;  5JRG B;  5AVB C;  5B2I B;  5GXQ C;  3AZK B;  1P3O C;  4KUD C;  3A1K A;  1P3M A;  2NZD C;  5B1M C;  1TAF B;  4QLC C;  3WAA C;  3VH6 A;  4YM6 D;  3AV1 A;  5AV8 B;  3AV1 D;  1M1A C;  5F99 C;  5B31 C;  5GT0 D;  4YM6 B;  4DQY B;  3UT9 C;  4XUJ C;  3F6T A;  5GT0 B;  2BYM B;  3REI D;  1P3A D;  4WU8 C;  1P3A A;  1B6W A;  5AY8 C;  3REK B;  1ID3 C;  5CP6 B;  4KHA A;  2Y2H A;  5E5A A;  2J8P A;  3W96 C;  1KX3 D;  3REI B;  4H9O A;  3AZL C;  2PYO B;  1EQZ A;  2NQB C;  1TZY C;  5AV9 A;  1JFI B;  4H9Q A;  3C1C D;  3VH6 T;  3C1C A;  5DNN B;  1N1J B;  3AZH C;  3AZI C;  1KX4 B;  3X1V B;  5AVC C;  4JJN A;  3UTB C;  1AOI B;  4R8P B;  3KSY A;  4EO5 B;  3AN2 A;  4J8V D;  4J8V A;  2DQN C;  3AZF C;  1P3I D;  3WKJ A;  3A6N B;  3O62 D;  3B6G A;  4H9N A;  1WWI A;  4YS3 A;  1P3I B;  1HTA A;  1P3M C;  2Y2I A;  3AZE D;  3AZE A;  2HIO D;  3AYW D;  1F66 D;  3AYW A;  4NE5 A;  3LZ0 A;  4UUZ A;  3REL D;  3REL A;  4Z66 D;  3LZ1 B;  2Y2G A;  3H0L C;  2Y2Q A;  4Z5T D;  4Z5T A;  3EPK A;  1P3B D;  4Z66 B;  3AV2 B;  3W98 D;  3W98 A;  3B0C W;  5B0Z A;  1Q9C A;  3MGQ A;  3MGQ D;  1P3A C;  5BT1 D;  3REH A;  5E5A C;  5B33 D;  2LY8 A;  4AWL B;  3MGS C;  4G92 C;  2ZY3 A;  4J8U D;  3AZN B;  3LEL D;  1EQZ C;  5CPI A;  3C1B B;  5BO0 A;  5AV9 C;  3X1S A;  3MVD D;  3C1C C;  4J8U B;  1P3K D;  3AFA A;  1P3K A;  1HQ3 D;  4JJN C;  3X1T D;  3UTA C;  3X1T A;  3B0D C;  1U35 D;  1U35 A;  3AN2 C;  1M19 B;  1S32 A;  3WKJ C;  5CPK B;  5B32 B;  3B6G C;  3REJ D;  5AV6 D;  3REJ A;  4YS3 C;  3WA9 A;  4ZUX A;  1M18 B;  4E45 A;  4WU9 A;  4X23 B;  5AV6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...