3LZ0A

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 1)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz0A00
5GXQB 3MGPA 3REKB 1P3BC 5B2JB 3WAAD 4Z66D 3W97B 3REID 4ZUXA 3AZNC 1ID3D 1WWIA 1H3OA 1P3FC 5GT3A 4XZQB 4WU9B 4DRBA 5CPIC 4J8UB 3MNNA 1U35D 3AZJB 3AV2B 2PYOC 5AV5A 5GT3D 1P3IA 5AY8C 3MNND 4H9OB 3AZHA 5B0ZB 4CSRB 5AV5D 1F66A 5AV9C 3UT9C 3W98C 1P3ID 4WNNA 3X1UC 5B2IB 3AFAA 3A6NC 2AROD 4R8PD 3C1CA 5BNVB 4H9PA 5E5AC 5GSUB 3X1SB 1F66D 3AZEA 1S32A 4WU8D 2RVQC 1AOIB 5DNNC 3MVDD 3AZED 1S32D 3AZKD 4J8VD 5JA4B 5BS7C 5C3IC 3REKD 5B2JD 1JFIA 3VH6T 2FJ7A 1BH9A 3AZLA 4KGCB 1B6WA 3WAAC 5B1MA 4XZQD 4Z66C 3REIC 3KUYA 3AN2A 1P3AB 3VH5A 4LD9B 1ID3C 3WKJB 4UUZA 3AV2D 2FJ7D 5FUGB 2HUEC 5BNXA 5B0YA 1KX3B 2F8NK 1U35C 3KUYD 3AN2D 3X1VC 5B0YD 5GT3C 3X1SA 5CPJA 1KX4A 5AVBB 1EQZB 3MNNC 3UTAB 1M18A 5B40B 1HQ3B 1AOIA 4YM6B 5AV5C 3AYWA 4XUJB 3X1SD 1KX4D 3C1BB 5DNMB 3B6FA 2AROC 4R8PC 1M18D 5JA4A 1AOID 3AYWD 1F66C 5CP6A 4WU8C 5CPKB 3B6FD 5B32A 5B1LB 3NQJB 3MVDC 2BYMB 3AZEC 1S32C 3AZKC 5CP6D 5AV8B 1KX5B 5GT0B 5B32D 4J8VC 4J8XB 3REKC 4KGCD 5B2JC 3R45A 3AZMA 1P3MA 4LD9D 3WKJD 4KHAA 3AZNA 2F8NH 4JJNB 4XZQC 5AVCB 4H9QA 4X23A 3AV1A 3MGQB 3AZMD 1P3MD 3AV2C 5B40A 2FJ7C 1TZYB 3LELA 2PYOA 3KUYC 1M19B 3AN2C 1BH8A 1ZLAB 4X23D 4Z2MG 3AV1D 4G91C 5B40D 4KUDB 5B0YC 3V9RA 3REHB 1P3KB 3LELD 4NE6A 4YS3B 4XUJD 3C1BD 5AV6B 3UT9A 3W98A 5B24A 2HIOA 5B31B 3X1SC 1KX4C 5B24D 1M18C 2HIOD 1AOIC 2YFVB 3NQUA 3AYWC 5DNNA 4AWLB 3B6FC 5AV8D 4JJNA 5BS7A 5DNND 5CP6C 1P3OB 5B32C 1A7WA 1TZYA 4CAYA 4KGCC 1M1AB 4JJND 4Z66A 1TAFA 3REIA 4E45A 4LD9C 3WKJC 1ID3A 1TZYD 1P3GB 4M6BA 4E44A 3B0BA 2NQBA 1U35A 3AZMC 3LZ0B 5F99B 3RELB 1P3MC 1ZLAD 2CV5A 5BO0A 4H9RB 5B31A 3X1VA 1P3KD 2NQBD 4X23C 3AV1C 4H9NA 3AZIB 5B40C 1P34A 2CV5D 3LELC 3VH5T 5B31D 3B0DB 4XUJC 3X1VD 3C1BC 3W99A 4G92C 1P3PB 2AROA 4R8PA 1P34D 3TU4B 3W99D 5B32G 4Z5TB 5B24C 2HIOC 4WU8A 3B6GB 5JRGB 3MVDA 3B0CW 5AV8C 3AZKA 4J8VA 5KDMA 4J8WB 3WA9B 5GXQA 3REKA 4EO5C 5B2JA 3W97A 4JJNC 5GXQD 2LY8A 4XZQA 4WU9A 4H9SA 4J8UA 3W97D 3LZ0D 5F99D 2F8NB 3AZJA 1TZYC 3AV2A 1P3LB 4WU9D 1Q9CA 1ZLAC 4J8UD 4H9OA 3AZID 3AZJD 5B0ZA 1P3KC 4CSRA 2NQBC 3LZ1B 1P3PD 5B2IA 4WV4B 3B6GA 2CV5C 5BNVA 5B31C 5B0ZD 4Z2MH 5GSUA 1P34C 5B2ID 3B6GD 3W96B 3W99C 4HGAB 5JRGD 3O62B 4AWLC 5GSUD 4J8WD 3WA9D 3WTPB 3LJAB 3AZGB 1P3BB 4KGCA 2YFWB 1P3AA 4LD9A 3WKJA 1P3FB 5FUGA 1KX3A 5GXQC 2CWEA 5CPIB 4NE3A 3LZ1A 3W97C 3LZ0C 5B31G 5F99C 1P3AD 3MGRB 1KX3D 5AY8B 4WU9C 4H9SC 3LZ1D 5AVBA 1EQZA 4J8UC 3KWQB 3REJB 3UTAA 3AZIC 3AZJC 1HQ3A 3MGSB 4YM6A 1R4VA 4XUJA 3X1UB 2NZDB 3C1BA 4NFTA 5DNMA 5AVBD 3A6NB 3UTBB 1P3PC 1EQZD 3UTAD 3X1TB 5E5AB 5B0ZC 1HQ3D 4YM6D 5B33B 3O62D 3VH6W 5DNMD 1ULYA 4QLCB 5B2IC 5CPKA 3B6GC 5B1LA 1HTAA 3NQJA 5JRGC 2BYMA 5GSUC 5AV8A 5CPKD 5GT0A 3KXBB 1KX5A 4J8WC 5B1LD 3AZGD 3WA9C 4J8XA 1KX5D 5GT0D 3WAAB 4J8XD 5AVCA 3KWQA 2HUEB 3MGPB 3MGQA 3MGRD 4ZUXB 5AVCD 1M19A 1P3AC 1KU5A 3KWQD 3X1TA 1ZLAA 1H3OB 3MGQD 5GT3B 4KUDA 3MGSD 1KX3C 3REHA 1P3KA 5B33A 3MNNB 4YS3A 3LZ1C 2NZDD 5AV6A 1M19D 4QLCA 3UTBD 4ZBJB 5AV5B 3X1TD 4KUDD 1P3IB 3REHD 5B33D 4YS3D 5AVBC 1EQZC 3AZHB 5AV6D 4QLCD 3UTAC 1HQ3C 1F66B 4YM6C 2YFVA 3O62C 4WNNB 3AFAB 5DNMC 3C1CB 3KXBD 4H9PB 3AZEB 1S32B 5CPKC 1P3OA 5B1LC 1WWSA 3AZGC 1M1AA 4NE5A 3MGPD 5GT0C 1P3OD 1KX5C 1N1JB 1P3GA 4J8XC 1M1AD 1JFIB 4ZUXD 2FJ7B 1BH9B 3LZ0A 5F99A 3RELA 3AZLB 3MGRC 5B1MB 5G49B 4H9RA 1P3GD 3KUYB 5AVCC 3AN2B 4G91B 4UUZB 3KWQC 3REJC 3MGQC 5BNXB 5B0YB 3RELD 3AZIA 3AZFB 3MGSC 1BFMA 3KSYA 2NZDC 1F1EA 1M19C 3UTBC 3AZHD 3X1TC 1P3PA 4KUDC 5CPJB 1KX4B 3REHC 3TU4A 5B33C 4YS3C 4Z5TA 3AFAD 3WTPE 5AV6C 1M18B 4QLCC 2IO5B 4WZSB 3C1CD 3AYWB 3TU4D 5JRGA 3B6FB 4Z5TD 3KXBC 1N1JA 4J8WA 3WA9A 5CP6B 5B32B 5G49A 2JSSA 3AZFA 3MGPC 1P3OC 2F8NA 1B67A 2BYKB 3VH5W 3AZLD 5B1MD 3R45B 1M1AC 4ZUXC 1P3LA 3AZMB 1P3MB 4KHAB 3AZNB 3AZFD 2F8ND 1P3GC 4H9QB 4X23B 3AV1B 1P3LD 4ZBJC 3RELC 3LELB 2PYOB 5CPJD 1P3IC 4G92B 1BH8B 3AZHC 3V9RB 4DRAA 3W96A 5AV9B 3UT9B 3W98B 3B0DC 5B24B 3AFAC 3O62A 2HIOB 3C1CC 3VH6A 3W96D 3TU4C 4Z5TC 3WTPA 2BYKA 3NQUB 3LJAA 5DNNB 4EO5B 3AZGA 1P3BA 2YFWA 5BT1D 3WTPD 3LJAD 5C3IB 1P3FA 2L5AA 1P3BD 5CPIA 3AZND 4CAYB 3AZLC 5B1MC 3MGRA 1P3FD 4Z66B 1TAFB 3REIB 5CPID 5AY8A 3B0CT 1ID3B 3REJA 3AZFC 2PYOD 2NQBB 3MGSA 5AV9A 1U35B 1P3LC 5AY8D 3X1UA 2NZDA 3A6NA 2CV5B 3UTBA 5BO0B 3REJD 3X1VB 5CPJC 5E5AA 5AV9D 3UT9D 3W98D 4H9NB 3X1UD 1P34B 2IO5C 3A6ND 3W99B 5E5AD 2AROB 4R8PB 2RVQD 3KXBA 3W96C 4HGAC 5CHLB 4WU8B 3MVDB 3WAAA 2F8NG 5BT1C 3AZKB 3WTPC 4J8VB 5KDMB 3LJAC
chains in the Genus database with same CATH superfamily
5GXQB 3MGPA 3REKB 1P3BC 5B2JB 3WAAD 4Z66D 3W97B 3REID 4ZUXA 3AZNC 1ID3D 1WWIA 1H3OA 2ZY3A 5GT3A 4XZQB 4WU9B 1P3FC 4DRBA 5CPIC 4J8UB 3MNNA 1U35D 3F6TA 3AZJB 3AV2B 2PYOC 5AV5A 5GT3D 1P3IA 5AY8C 3MNND 4H9OB 3AZHA 5B0ZB 4CSRB 5AV5D 1F66A 5AV9C 3UT9C 3W98C 1P3ID 4WNNA 3X1UC 5B2IB 3AFAA 3A6NC 2AROD 4R8PD 3C1CA 5BNVB 4H9PA 5E5AC 5GSUB 3X1SB 1F66D 3AZEA 1S32A 4WU8D 2RVQC 1AOIB 5DNNC 3MVDD 2UWXA 3AZED 1S32D 3AZKD 4J8VD 5JA4B 5BS7C 5C3IC 3REKD 5B2JD 1JFIA 3VH6T 2FJ7A 1BH9A 3AZLA 4KGCB 1B6WA 3WAAC 5B1MA 4XZQD 4Z66C 2VQRA 3KUYA 3REIC 3AN2A 1P3AB 3VH5A 4LD9B 1ID3C 3WKJB 2Y2PA 4UUZA 3AV2D 2FJ7D 5FUGB 2HUEC 5BNXA 5B0YA 1KX3B 2F8NK 1U35C 3KUYD 3AN2D 3X1VC 5B0YD 5GT3C 3X1SA 5CPJA 1KX4A 5AVBB 1EQZB 3MNNC 3UTAB 1M18A 5B40B 1HQ3B 3EPHA 1AOIA 4YM6B 5AV5C 3AYWA 4XUJB 3X1SD 1KX4D 3C1BB 5DNMB 3B6FA 2AROC 4R8PC 1M18D 5JA4A 1AOID 3AYWD 1F66C 5CP6A 4WU8C 5CPKB 3B6FD 5B32A 5B1LB 3NQJB 3MVDC 2BYMB 3KFUG 3AZEC 1S32C 3AZKC 5CP6D 2Y2JA 5AV8B 1KX5B 5GT0B 5B32D 4J8VC 4J8XB 3REKC 4KGCD 5B2JC 3R45A 3AZMA 1P3MA 4LD9D 3WKJD 4KHAA 3AZNA 2F8NH 4JJNB 3EPJA 4XZQC 5AVCB 4H9QA 4X23A 3AV1A 3MGQB 3AZMD 1P3MD 3AV2C 5B40A 2FJ7C 1TZYB 3LELA 2PYOA 3KUYC 2DF4C 1M19B 3AN2C 1BH8A 1ZLAB 4X23D 4Z2MG 3AV1D 4G91C 5B40D 4KUDB 4WJ3C 5B0YC 3V9RA 3REHB 1P3KB 3LELD 4NE6A 4YS3B 4XUJD 3C1BD 5AV6B 3UT9A 3W98A 5B24A 2HIOA 5B31B 2Y2HA 3X1SC 1KX4C 5B24D 1M18C 2HIOD 1AOIC 2YFVB 3NQUA 3AYWC 5DNNA 4AWLB 3B6FC 5AV8D 4JJNA 5BS7A 5DNND 5CP6C 1P3OB 5B32C 1A7WA 1TZYA 4CAYA 2RIQA 3EPLA 1M1AB 4KGCC 4JJND 2DQNC 4Z66A 1TAFA 3REIA 4E45A 4LD9C 3WKJC 1ID3A 1TZYD 1P3GB 4M6BA 4E44A 3B0BA 2NQBA 1U35A 3AZMC 3LZ0B 5F99B 3RELB 1P3MC 1ZLAD 2CV5A 5BO0A 4H9RB 5B31A 3X1VA 1P3KD 2NQBD 4X23C 3AV1C 2Y2NA 4H9NA 3AZIB 5B40C 1P34A 2CV5D 3LELC 3VH5T 5B31D 3B0DB 4XUJC 3X1VD 3C1BC 3W99A 4G92C 1P3PB 2AROA 4R8PA 1P34D 2F2AC 3TU4B 3W99D 5B32G 4Z5TB 5B24C 2Y2GA 2HIOC 4WU8A 3B6GB 5JRGB 3MVDA 3B0CW 5AV8C 3AZKA 4J8VA 5KDMA 4J8WB 3A1IA 5GXQA 3WA9B 3REKA 4EO5C 5B2JA 3W97A 4JJNC 5GXQD 2LY8A 4XZQA 4WU9A 4H9SA 4J8UA 3W97D 3LZ0D 5F99D 2F8NB 3AZJA 1TZYC 3AV2A 3AL0C 1P3LB 4WU9D 1Q9CA 1ZLAC 4J8UD 4H9OA 2Y2OA 3AZID 3AZJD 5B0ZA 1P3KC 4CSRA 2NQBC 3LZ1B 1P3PD 5B2IA 4WV4B 3B6GA 2CV5C 5BNVA 5B31C 5B0ZD 4Z2MH 5GSUA 1P34C 5B2ID 3B6GD 3W96B 3W99C 4HGAB 5JRGD 3O62B 4AWLC 5GSUD 3H0LC 4J8WD 3WA9D 3WTPB 3LJAB 3AZGB 1P3BB 4KGCA 2YFWB 1P3AA 3P5JB 4LD9A 3WKJA 3H0MC 1P3FB 5FUGA 1KX3A 5GXQC 2CWEA 5CPIB 4NE3A 3LZ1A 2J8PA 2ZY5A 3W97C 3LZ0C 5B31G 5F99C 1P3AD 3A1KA 2JE5A 3MGRB 1KX3D 2Y2LA 5AY8B 4WU9C 4H9SC 3LZ1D 5AVBA 1EQZA 4J8UC 3KWQB 3REJB 3UTAA 3AZIC 3AZJC 1HQ3A 2W8SA 3MGSB 4YM6A 2ZY2A 1R4VA 4XUJA 3X1UB 2NZDB 3C1BA 4NFTA 5DNMA 5AVBD 3A6NB 3UTBB 1P3PC 1EQZD 3UTAD 3X1TB 5E5AB 1HQ3D 5B0ZC 4YM6D 5B33B 3O62D 3VH6W 5DNMD 1ULYA 4QLCB 5B2IC 5CPKA 3B6GC 5B1LA 1HTAA 3NQJA 5JRGC 2BYMA 5GSUC 5AV8A 5CPKD 5GT0A 3KXBB 1KX5A 4J8WC 5B1LD 3AZGD 3WA9C 4J8XA 1KX5D 5GT0D 3WAAB 4J8XD 3H0RC 5AVCA 3KWQA 2HUEB 3MGPB 3MGQA 3MGRD 4ZUXB 5AVCD 1M19A 1P3AC 2G5HC 1KU5A 3KWQD 3X1TA 1H3OB 3MGQD 1ZLAA 5GT3B 4KUDA 3MGSD 1KX3C 3REHA 1P3KA 5B33A 3MNNB 4YS3A 3LZ1C 2NZDD 5AV6A 1M19D 4QLCA 3UTBD 4ZBJB 5AV5B 3X1TD 4KUDD 1P3IB 3REHD 5B33D 4YS3D 5AVBC 1EQZC 3AZHB 5AV6D 4QLCD 3UTAC 1HQ3C 1F66B 4YM6C 2YFVA 3O62C 4WNNB 3AFAB 5DNMC 3C1CB 3EPKA 3KXBD 4H9PB 3AZEB 1S32B 5CPKC 1P3OA 5B1LC 1WWSA 3AZGC 1M1AA 2Y2KA 2Y2QA 2ZM5A 4NE5A 3MGPD 5GT0C 1P3OD 1KX5C 1N1JB 1P3GA 4J8XC 1M1AD 1JFIB 4ZUXD 2FJ7B 1BH9B 3LZ0A 5F99A 3RELA 3AZLB 3MGRC 5B1MB 1W2EA 5G49B 4H9RA 1P3GD 3KUYB 5AVCC 3AN2B 4G91B 4UUZB 3KWQC 3REJC 3MGQC 5BNXB 5B0YB 3RELD 3AZIA 3AZFB 3MGSC 1BFMA 3KSYA 2NZDC 1F1EA 1M19C 3UTBC 3AZHD 3EG5B 3X1TC 1P3PA 4KUDC 5CPJB 1KX4B 3REHC 3TU4A 5B33C 4YS3C 4Z5TA 3AFAD 3WTPE 5AV6C 1M18B 4QLCC 2IO5B 4WZSB 3C1CD 3AYWB 3TU4D 5JRGA 3B6FB 4Z5TD 3KXBC 1N1JA 4J8WA 3WA9A 5CP6B 5B32B 2XD1A 5G49A 2ZY4A 2JSSA 3AZFA 3MGPC 1P3OC 2F8NA 1B67A 2BYKB 3VH5W 2XD5A 3AZLD 5B1MD 3R45B 1M1AC 4ZUXC 1P3LA 3AZMB 1P3MB 4KHAB 3AZNB 3AZFD 2F8ND 1T3UA 1P3GC 4H9QB 4X23B 3AV1B 1P3LD 4ZBJC 3RELC 3LELB 2PYOB 5CPJD 1P3IC 2JCHA 4G92B 2Y2IA 1BH8B 3AZHC 3V9RB 4DRAA 3W96A 5AV9B 3UT9B 3W98B 3B0DC 5B24B 3AFAC 3O62A 2HIOB 3C1CC 3VH6A 3W96D 3TU4C 4UPKA 4Z5TC 3WTPA 1Z2CB 2BYKA 2FFFB 3NQUB 3LJAA 5DNNB 4EO5B 3AZGA 1P3BA 3IP4C 2YFWA 5BT1D 3WTPD 3LJAD 5C3IB 1P3FA 2L5AA 1P3BD 5CPIA 3AZND 4CAYB 3AZLC 2G5IC 5B1MC 2Y2MA 3MGRA 1P3FD 4Z66B 1TAFB 3REIB 5CPID 5AY8A 3B0CT 1ID3B 3FDDA 3REJA 3AZFC 2BG1A 2PYOD 2NQBB 3MGSA 5AV9A 1U35B 1P3LC 5AY8D 3X1UA 2NZDA 3A6NA 2CV5B 3UTBA 5BO0B 3REJD 3X1VB 4DQYB 5CPJC 5E5AA 5AV9D 3UT9D 3W98D 4H9NB 3X1UD 1P34B 2IO5C 3A6ND 3W99B 5E5AD 2AROB 4R8PB 2RVQD 3KXBA 3W96C 4HGAC 5CHLB 4WU8B 1PZRA 3MVDB 3WAAA 2F8NG 5BT1C 3AZKB 3WTPC 4J8VB 5KDMB 3LJAC
chains in the Genus database with same CATH topology
5GXQB 3MGPA 3REKB 1P3BC 5B2JB 3WAAD 4Z66D 3W97B 3REID 4ZUXA 3AZNC 1ID3D 1WWIA 1H3OA 2ZY3A 5GT3A 4XZQB 4WU9B 1P3FC 4DRBA 5CPIC 4J8UB 3MNNA 1U35D 3F6TA 3AZJB 3AV2B 2PYOC 5AV5A 5GT3D 1P3IA 5AY8C 3MNND 4H9OB 3AZHA 5B0ZB 4CSRB 5AV5D 1F66A 5AV9C 3UT9C 3W98C 1P3ID 4WNNA 3X1UC 5B2IB 3AFAA 3A6NC 2AROD 4R8PD 3C1CA 5BNVB 4H9PA 5E5AC 5GSUB 3X1SB 1F66D 3AZEA 1S32A 4WU8D 2RVQC 1AOIB 5DNNC 3MVDD 2UWXA 3AZED 1S32D 3AZKD 4J8VD 5JA4B 5BS7C 5C3IC 3REKD 5B2JD 1JFIA 3VH6T 2FJ7A 1BH9A 3AZLA 4KGCB 1B6WA 3WAAC 5B1MA 4XZQD 4Z66C 2VQRA 3KUYA 3REIC 3AN2A 1P3AB 3VH5A 4LD9B 1ID3C 3WKJB 2Y2PA 4UUZA 3AV2D 2FJ7D 5FUGB 2HUEC 5BNXA 5B0YA 1KX3B 2F8NK 1U35C 3KUYD 3AN2D 3X1VC 5B0YD 5GT3C 3X1SA 5CPJA 1KX4A 5AVBB 1EQZB 3MNNC 3UTAB 1M18A 5B40B 1HQ3B 3EPHA 1AOIA 4YM6B 5AV5C 3AYWA 4XUJB 3X1SD 1KX4D 3C1BB 5DNMB 3B6FA 2AROC 4R8PC 1M18D 5JA4A 1AOID 3AYWD 1F66C 5CP6A 4WU8C 5CPKB 3B6FD 5B32A 5B1LB 3NQJB 3MVDC 2BYMB 3KFUG 3AZEC 1S32C 3AZKC 5CP6D 2Y2JA 5AV8B 1KX5B 5GT0B 5B32D 4J8VC 4J8XB 3REKC 4KGCD 5B2JC 3R45A 3AZMA 1P3MA 4LD9D 3WKJD 4KHAA 3AZNA 2F8NH 4JJNB 3EPJA 4XZQC 5AVCB 4H9QA 4X23A 3AV1A 3MGQB 3AZMD 1P3MD 3AV2C 5B40A 2FJ7C 1TZYB 3LELA 2PYOA 3KUYC 2DF4C 1M19B 3AN2C 1BH8A 1ZLAB 4X23D 4Z2MG 3AV1D 4G91C 5B40D 4KUDB 4WJ3C 5B0YC 3V9RA 3REHB 1P3KB 3LELD 4NE6A 4YS3B 4XUJD 3C1BD 5AV6B 3UT9A 3W98A 5B24A 2HIOA 5B31B 2Y2HA 3X1SC 1KX4C 5B24D 1M18C 2HIOD 1AOIC 2YFVB 3NQUA 3AYWC 5DNNA 4AWLB 3B6FC 5AV8D 4JJNA 5BS7A 5DNND 5CP6C 1P3OB 5B32C 1A7WA 1TZYA 4CAYA 2RIQA 3EPLA 1M1AB 4KGCC 4JJND 2DQNC 4Z66A 1TAFA 3REIA 4E45A 4LD9C 3WKJC 1ID3A 1TZYD 1P3GB 4M6BA 4E44A 3B0BA 2NQBA 1U35A 3AZMC 3LZ0B 5F99B 3RELB 1P3MC 1ZLAD 2CV5A 5BO0A 4H9RB 5B31A 3X1VA 1P3KD 2NQBD 4X23C 3AV1C 2Y2NA 4H9NA 3AZIB 5B40C 1P34A 2CV5D 3LELC 3VH5T 5B31D 3B0DB 4XUJC 3X1VD 3C1BC 3W99A 4G92C 1P3PB 2AROA 4R8PA 1P34D 2F2AC 3TU4B 3W99D 5B32G 4Z5TB 5B24C 2Y2GA 2HIOC 4WU8A 3B6GB 5JRGB 3MVDA 3B0CW 5AV8C 3AZKA 4J8VA 5KDMA 4J8WB 3A1IA 5GXQA 3WA9B 3REKA 4EO5C 5B2JA 3W97A 4JJNC 5GXQD 2LY8A 4XZQA 4WU9A 4H9SA 4J8UA 3W97D 3LZ0D 5F99D 2F8NB 3AZJA 1TZYC 3AV2A 3AL0C 1P3LB 4WU9D 1Q9CA 1ZLAC 4J8UD 4H9OA 2Y2OA 3AZID 3AZJD 5B0ZA 1P3KC 4CSRA 2NQBC 3LZ1B 1P3PD 5B2IA 4WV4B 3B6GA 2CV5C 5BNVA 5B31C 5B0ZD 4Z2MH 5GSUA 1P34C 5B2ID 3B6GD 3W96B 3W99C 4HGAB 5JRGD 3O62B 4AWLC 5GSUD 3H0LC 4J8WD 3WA9D 3WTPB 3LJAB 3AZGB 1P3BB 4KGCA 2YFWB 1P3AA 3P5JB 4LD9A 3WKJA 3H0MC 1P3FB 5FUGA 1KX3A 5GXQC 2CWEA 5CPIB 4NE3A 3LZ1A 2J8PA 2ZY5A 3W97C 3LZ0C 5B31G 5F99C 1P3AD 3A1KA 2JE5A 3MGRB 1KX3D 2Y2LA 5AY8B 4WU9C 4H9SC 3LZ1D 5AVBA 1EQZA 4J8UC 3KWQB 3REJB 3UTAA 3AZIC 3AZJC 1HQ3A 2W8SA 3MGSB 4YM6A 2ZY2A 1R4VA 4XUJA 3X1UB 2NZDB 3C1BA 4NFTA 5DNMA 5AVBD 3A6NB 3UTBB 1P3PC 1EQZD 3UTAD 3X1TB 5E5AB 1HQ3D 5B0ZC 4YM6D 5B33B 3O62D 3VH6W 5DNMD 1ULYA 4QLCB 5B2IC 5CPKA 3B6GC 5B1LA 1HTAA 3NQJA 5JRGC 2BYMA 5GSUC 5AV8A 5CPKD 5GT0A 3KXBB 1KX5A 4J8WC 5B1LD 3AZGD 3WA9C 4J8XA 1KX5D 5GT0D 3WAAB 4J8XD 3H0RC 5AVCA 3KWQA 2HUEB 3MGPB 3MGQA 3MGRD 4ZUXB 5AVCD 1M19A 1P3AC 2G5HC 1KU5A 3KWQD 3X1TA 1H3OB 3MGQD 1ZLAA 5GT3B 4KUDA 3MGSD 1KX3C 3REHA 1P3KA 5B33A 3MNNB 4YS3A 3LZ1C 2NZDD 5AV6A 1M19D 4QLCA 3UTBD 4ZBJB 5AV5B 3X1TD 4KUDD 1P3IB 3REHD 5B33D 4YS3D 5AVBC 1EQZC 3AZHB 5AV6D 4QLCD 3UTAC 1HQ3C 1F66B 4YM6C 2YFVA 3O62C 4WNNB 3AFAB 5DNMC 3C1CB 3EPKA 3KXBD 4H9PB 3AZEB 1S32B 5CPKC 1P3OA 5B1LC 1WWSA 3AZGC 1M1AA 2Y2KA 2Y2QA 2ZM5A 4NE5A 3MGPD 5GT0C 1P3OD 1KX5C 1N1JB 1P3GA 4J8XC 1M1AD 1JFIB 4ZUXD 2FJ7B 1BH9B 3LZ0A 5F99A 3RELA 3AZLB 3MGRC 5B1MB 1W2EA 5G49B 4H9RA 1P3GD 3KUYB 5AVCC 3AN2B 4G91B 4UUZB 3KWQC 3REJC 3MGQC 5BNXB 5B0YB 3RELD 3AZIA 3AZFB 3MGSC 1BFMA 3KSYA 2NZDC 1F1EA 1M19C 3UTBC 3AZHD 3EG5B 3X1TC 1P3PA 4KUDC 5CPJB 1KX4B 3REHC 3TU4A 5B33C 4YS3C 4Z5TA 3AFAD 3WTPE 5AV6C 1M18B 4QLCC 2IO5B 4WZSB 3C1CD 3AYWB 3TU4D 5JRGA 3B6FB 4Z5TD 3KXBC 1N1JA 4J8WA 3WA9A 5CP6B 5B32B 2XD1A 5G49A 2ZY4A 2JSSA 3AZFA 3MGPC 1P3OC 2F8NA 1B67A 2BYKB 3VH5W 2XD5A 3AZLD 5B1MD 3R45B 1M1AC 4ZUXC 1P3LA 3AZMB 1P3MB 4KHAB 3AZNB 3AZFD 2F8ND 1T3UA 1P3GC 4H9QB 4X23B 3AV1B 1P3LD 4ZBJC 3RELC 3LELB 2PYOB 5CPJD 1P3IC 2JCHA 4G92B 2Y2IA 1BH8B 3AZHC 3V9RB 4DRAA 3W96A 5AV9B 3UT9B 3W98B 3B0DC 5B24B 3AFAC 3O62A 2HIOB 3C1CC 3VH6A 3W96D 3TU4C 4UPKA 4Z5TC 3WTPA 1Z2CB 2BYKA 2FFFB 3NQUB 3LJAA 5DNNB 4EO5B 3AZGA 1P3BA 3IP4C 2YFWA 5BT1D 3WTPD 3LJAD 5C3IB 1P3FA 2L5AA 1P3BD 5CPIA 3AZND 4CAYB 3AZLC 2G5IC 5B1MC 2Y2MA 3MGRA 1P3FD 4Z66B 1TAFB 3REIB 5CPID 5AY8A 3B0CT 1ID3B 3FDDA 3REJA 3AZFC 2BG1A 2PYOD 2NQBB 3MGSA 5AV9A 1U35B 1P3LC 5AY8D 3X1UA 2NZDA 3A6NA 2CV5B 3UTBA 5BO0B 3REJD 3X1VB 4DQYB 5CPJC 5E5AA 5AV9D 3UT9D 3W98D 4H9NB 3X1UD 1P34B 2IO5C 3A6ND 3W99B 5E5AD 2AROB 4R8PB 2RVQD 3KXBA 3W96C 4HGAC 5CHLB 4WU8B 1PZRA 3MVDB 3WAAA 2F8NG 5BT1C 3AZKB 3WTPC 4J8VB 5KDMB 3LJAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXQ B;  3MGP A;  3REK B;  1P3B C;  5B2J B;  3WAA D;  4Z66 D;  3W97 B;  3REI D;  4ZUX A;  3AZN C;  1ID3 D;  1WWI A;  1H3O A;  1P3F C;  5GT3 A;  4XZQ B;  4WU9 B;  4DRB A;  5CPI C;  4J8U B;  3MNN A;  1U35 D;  3AZJ B;  3AV2 B;  2PYO C;  5AV5 A;  5GT3 D;  1P3I A;  5AY8 C;  3MNN D;  4H9O B;  3AZH A;  5B0Z B;  4CSR B;  5AV5 D;  1F66 A;  5AV9 C;  3UT9 C;  3W98 C;  1P3I D;  4WNN A;  3X1U C;  5B2I B;  3AFA A;  3A6N C;  2ARO D;  4R8P D;  3C1C A;  5BNV B;  4H9P A;  5E5A C;  5GSU B;  3X1S B;  1F66 D;  3AZE A;  1S32 A;  4WU8 D;  2RVQ C;  1AOI B;  5DNN C;  3MVD D;  3AZE D;  1S32 D;  3AZK D;  4J8V D;  5JA4 B;  5BS7 C;  5C3I C;  3REK D;  5B2J D;  1JFI A;  3VH6 T;  2FJ7 A;  1BH9 A;  3AZL A;  4KGC B;  1B6W A;  3WAA C;  5B1M A;  4XZQ D;  4Z66 C;  3REI C;  3KUY A;  3AN2 A;  1P3A B;  3VH5 A;  4LD9 B;  1ID3 C;  3WKJ B;  4UUZ A;  3AV2 D;  2FJ7 D;  5FUG B;  2HUE C;  5BNX A;  5B0Y A;  1KX3 B;  2F8N K;  1U35 C;  3KUY D;  3AN2 D;  3X1V C;  5B0Y D;  5GT3 C;  3X1S A;  5CPJ A;  1KX4 A;  5AVB B;  1EQZ B;  3MNN C;  3UTA B;  1M18 A;  5B40 B;  1HQ3 B;  1AOI A;  4YM6 B;  5AV5 C;  3AYW A;  4XUJ B;  3X1S D;  1KX4 D;  3C1B B;  5DNM B;  3B6F A;  2ARO C;  4R8P C;  1M18 D;  5JA4 A;  1AOI D;  3AYW D;  1F66 C;  5CP6 A;  4WU8 C;  5CPK B;  3B6F D;  5B32 A;  5B1L B;  3NQJ B;  3MVD C;  2BYM B;  3AZE C;  1S32 C;  3AZK C;  5CP6 D;  5AV8 B;  1KX5 B;  5GT0 B;  5B32 D;  4J8V C;  4J8X B;  3REK C;  4KGC D;  5B2J C;  3R45 A;  3AZM A;  1P3M A;  4LD9 D;  3WKJ D;  4KHA A;  3AZN A;  2F8N H;  4JJN B;  4XZQ C;  5AVC B;  4H9Q A;  4X23 A;  3AV1 A;  3MGQ B;  3AZM D;  1P3M D;  3AV2 C;  5B40 A;  2FJ7 C;  1TZY B;  3LEL A;  2PYO A;  3KUY C;  1M19 B;  3AN2 C;  1BH8 A;  1ZLA B;  4X23 D;  4Z2M G;  3AV1 D;  4G91 C;  5B40 D;  4KUD B;  5B0Y C;  3V9R A;  3REH B;  1P3K B;  3LEL D;  4NE6 A;  4YS3 B;  4XUJ D;  3C1B D;  5AV6 B;  3UT9 A;  3W98 A;  5B24 A;  2HIO A;  5B31 B;  3X1S C;  1KX4 C;  5B24 D;  1M18 C;  2HIO D;  1AOI C;  2YFV B;  3NQU A;  3AYW C;  5DNN A;  4AWL B;  3B6F C;  5AV8 D;  4JJN A;  5BS7 A;  5DNN D;  5CP6 C;  1P3O B;  5B32 C;  1A7W A;  1TZY A;  4CAY A;  4KGC C;  1M1A B;  4JJN D;  4Z66 A;  1TAF A;  3REI A;  4E45 A;  4LD9 C;  3WKJ C;  1ID3 A;  1TZY D;  1P3G B;  4M6B A;  4E44 A;  3B0B A;  2NQB A;  1U35 A;  3AZM C;  3LZ0 B;  5F99 B;  3REL B;  1P3M C;  1ZLA D;  2CV5 A;  5BO0 A;  4H9R B;  5B31 A;  3X1V A;  1P3K D;  2NQB D;  4X23 C;  3AV1 C;  4H9N A;  3AZI B;  5B40 C;  1P34 A;  2CV5 D;  3LEL C;  3VH5 T;  5B31 D;  3B0D B;  4XUJ C;  3X1V D;  3C1B C;  3W99 A;  4G92 C;  1P3P B;  2ARO A;  4R8P A;  1P34 D;  3TU4 B;  3W99 D;  5B32 G;  4Z5T B;  5B24 C;  2HIO C;  4WU8 A;  3B6G B;  5JRG B;  3MVD A;  3B0C W;  5AV8 C;  3AZK A;  4J8V A;  5KDM A;  4J8W B;  3WA9 B;  5GXQ A;  3REK A;  4EO5 C;  5B2J A;  3W97 A;  4JJN C;  5GXQ D;  2LY8 A;  4XZQ A;  4WU9 A;  4H9S A;  4J8U A;  3W97 D;  3LZ0 D;  5F99 D;  2F8N B;  3AZJ A;  1TZY C;  3AV2 A;  1P3L B;  4WU9 D;  1Q9C A;  1ZLA C;  4J8U D;  4H9O A;  3AZI D;  3AZJ D;  5B0Z A;  1P3K C;  4CSR A;  2NQB C;  3LZ1 B;  1P3P D;  5B2I A;  4WV4 B;  3B6G A;  2CV5 C;  5BNV A;  5B31 C;  5B0Z D;  4Z2M H;  5GSU A;  1P34 C;  5B2I D;  3B6G D;  3W96 B;  3W99 C;  4HGA B;  5JRG D;  3O62 B;  4AWL C;  5GSU D;  4J8W D;  3WA9 D;  3WTP B;  3LJA B;  3AZG B;  1P3B B;  4KGC A;  2YFW B;  1P3A A;  4LD9 A;  3WKJ A;  1P3F B;  5FUG A;  1KX3 A;  5GXQ C;  2CWE A;  5CPI B;  4NE3 A;  3LZ1 A;  3W97 C;  3LZ0 C;  5B31 G;  5F99 C;  1P3A D;  3MGR B;  1KX3 D;  5AY8 B;  4WU9 C;  4H9S C;  3LZ1 D;  5AVB A;  1EQZ A;  4J8U C;  3KWQ B;  3REJ B;  3UTA A;  3AZI C;  3AZJ C;  1HQ3 A;  3MGS B;  4YM6 A;  1R4V A;  4XUJ A;  3X1U B;  2NZD B;  3C1B A;  4NFT A;  5DNM A;  5AVB D;  3A6N B;  3UTB B;  1P3P C;  1EQZ D;  3UTA D;  3X1T B;  5E5A B;  5B0Z C;  1HQ3 D;  4YM6 D;  5B33 B;  3O62 D;  3VH6 W;  5DNM D;  1ULY A;  4QLC B;  5B2I C;  5CPK A;  3B6G C;  5B1L A;  1HTA A;  3NQJ A;  5JRG C;  2BYM A;  5GSU C;  5AV8 A;  5CPK D;  5GT0 A;  3KXB B;  1KX5 A;  4J8W C;  5B1L D;  3AZG D;  3WA9 C;  4J8X A;  1KX5 D;  5GT0 D;  3WAA B;  4J8X D;  5AVC A;  3KWQ A;  2HUE B;  3MGP B;  3MGQ A;  3MGR D;  4ZUX B;  5AVC D;  1M19 A;  1P3A C;  1KU5 A;  3KWQ D;  3X1T A;  1ZLA A;  1H3O B;  3MGQ D;  5GT3 B;  4KUD A;  3MGS D;  1KX3 C;  3REH A;  1P3K A;  5B33 A;  3MNN B;  4YS3 A;  3LZ1 C;  2NZD D;  5AV6 A;  1M19 D;  4QLC A;  3UTB D;  4ZBJ B;  5AV5 B;  3X1T D;  4KUD D;  1P3I B;  3REH D;  5B33 D;  4YS3 D;  5AVB C;  1EQZ C;  3AZH B;  5AV6 D;  4QLC D;  3UTA C;  1HQ3 C;  1F66 B;  4YM6 C;  2YFV A;  3O62 C;  4WNN B;  3AFA B;  5DNM C;  3C1C B;  3KXB D;  4H9P B;  3AZE B;  1S32 B;  5CPK C;  1P3O A;  5B1L C;  1WWS A;  3AZG C;  1M1A A;  4NE5 A;  3MGP D;  5GT0 C;  1P3O D;  1KX5 C;  1N1J B;  1P3G A;  4J8X C;  1M1A D;  1JFI B;  4ZUX D;  2FJ7 B;  1BH9 B;  3LZ0 A;  5F99 A;  3REL A;  3AZL B;  3MGR C;  5B1M B;  5G49 B;  4H9R A;  1P3G D;  3KUY B;  5AVC C;  3AN2 B;  4G91 B;  4UUZ B;  3KWQ C;  3REJ C;  3MGQ C;  5BNX B;  5B0Y B;  3REL D;  3AZI A;  3AZF B;  3MGS C;  1BFM A;  3KSY A;  2NZD C;  1F1E A;  1M19 C;  3UTB C;  3AZH D;  3X1T C;  1P3P A;  4KUD C;  5CPJ B;  1KX4 B;  3REH C;  3TU4 A;  5B33 C;  4YS3 C;  4Z5T A;  3AFA D;  3WTP E;  5AV6 C;  1M18 B;  4QLC C;  2IO5 B;  4WZS B;  3C1C D;  3AYW B;  3TU4 D;  5JRG A;  3B6F B;  4Z5T D;  3KXB C;  1N1J A;  4J8W A;  3WA9 A;  5CP6 B;  5B32 B;  5G49 A;  2JSS A;  3AZF A;  3MGP C;  1P3O C;  2F8N A;  1B67 A;  2BYK B;  3VH5 W;  3AZL D;  5B1M D;  3R45 B;  1M1A C;  4ZUX C;  1P3L A;  3AZM B;  1P3M B;  4KHA B;  3AZN B;  3AZF D;  2F8N D;  1P3G C;  4H9Q B;  4X23 B;  3AV1 B;  1P3L D;  4ZBJ C;  3REL C;  3LEL B;  2PYO B;  5CPJ D;  1P3I C;  4G92 B;  1BH8 B;  3AZH C;  3V9R B;  4DRA A;  3W96 A;  5AV9 B;  3UT9 B;  3W98 B;  3B0D C;  5B24 B;  3AFA C;  3O62 A;  2HIO B;  3C1C C;  3VH6 A;  3W96 D;  3TU4 C;  4Z5T C;  3WTP A;  2BYK A;  3NQU B;  3LJA A;  5DNN B;  4EO5 B;  3AZG A;  1P3B A;  2YFW A;  5BT1 D;  3WTP D;  3LJA D;  5C3I B;  1P3F A;  2L5A A;  1P3B D;  5CPI A;  3AZN D;  4CAY B;  3AZL C;  5B1M C;  3MGR A;  1P3F D;  4Z66 B;  1TAF B;  3REI B;  5CPI D;  5AY8 A;  3B0C T;  1ID3 B;  3REJ A;  3AZF C;  2PYO D;  2NQB B;  3MGS A;  5AV9 A;  1U35 B;  1P3L C;  5AY8 D;  3X1U A;  2NZD A;  3A6N A;  2CV5 B;  3UTB A;  5BO0 B;  3REJ D;  3X1V B;  5CPJ C;  5E5A A;  5AV9 D;  3UT9 D;  3W98 D;  4H9N B;  3X1U D;  1P34 B;  2IO5 C;  3A6N D;  3W99 B;  5E5A D;  2ARO B;  4R8P B;  2RVQ D;  3KXB A;  3W96 C;  4HGA C;  5CHL B;  4WU8 B;  3MVD B;  3WAA A;  2F8N G;  5BT1 C;  3AZK B;  3WTP C;  4J8V B;  5KDM B;  3LJA C; 
#chains in the Genus database with same CATH topology
 5GXQ B;  3MGP A;  3REK B;  1P3B C;  5B2J B;  3WAA D;  4Z66 D;  3W97 B;  3REI D;  4ZUX A;  3AZN C;  1ID3 D;  1WWI A;  1H3O A;  2ZY3 A;  5GT3 A;  4XZQ B;  4WU9 B;  1P3F C;  4DRB A;  5CPI C;  4J8U B;  3MNN A;  1U35 D;  3F6T A;  3AZJ B;  3AV2 B;  2PYO C;  5AV5 A;  5GT3 D;  1P3I A;  5AY8 C;  3MNN D;  4H9O B;  3AZH A;  5B0Z B;  4CSR B;  5AV5 D;  1F66 A;  5AV9 C;  3UT9 C;  3W98 C;  1P3I D;  4WNN A;  3X1U C;  5B2I B;  3AFA A;  3A6N C;  2ARO D;  4R8P D;  3C1C A;  5BNV B;  4H9P A;  5E5A C;  5GSU B;  3X1S B;  1F66 D;  3AZE A;  1S32 A;  4WU8 D;  2RVQ C;  1AOI B;  5DNN C;  3MVD D;  2UWX A;  3AZE D;  1S32 D;  3AZK D;  4J8V D;  5JA4 B;  5BS7 C;  5C3I C;  3REK D;  5B2J D;  1JFI A;  3VH6 T;  2FJ7 A;  1BH9 A;  3AZL A;  4KGC B;  1B6W A;  3WAA C;  5B1M A;  4XZQ D;  4Z66 C;  2VQR A;  3KUY A;  3REI C;  3AN2 A;  1P3A B;  3VH5 A;  4LD9 B;  1ID3 C;  3WKJ B;  2Y2P A;  4UUZ A;  3AV2 D;  2FJ7 D;  5FUG B;  2HUE C;  5BNX A;  5B0Y A;  1KX3 B;  2F8N K;  1U35 C;  3KUY D;  3AN2 D;  3X1V C;  5B0Y D;  5GT3 C;  3X1S A;  5CPJ A;  1KX4 A;  5AVB B;  1EQZ B;  3MNN C;  3UTA B;  1M18 A;  5B40 B;  1HQ3 B;  3EPH A;  1AOI A;  4YM6 B;  5AV5 C;  3AYW A;  4XUJ B;  3X1S D;  1KX4 D;  3C1B B;  5DNM B;  3B6F A;  2ARO C;  4R8P C;  1M18 D;  5JA4 A;  1AOI D;  3AYW D;  1F66 C;  5CP6 A;  4WU8 C;  5CPK B;  3B6F D;  5B32 A;  5B1L B;  3NQJ B;  3MVD C;  2BYM B;  3KFU G;  3AZE C;  1S32 C;  3AZK C;  5CP6 D;  2Y2J A;  5AV8 B;  1KX5 B;  5GT0 B;  5B32 D;  4J8V C;  4J8X B;  3REK C;  4KGC D;  5B2J C;  3R45 A;  3AZM A;  1P3M A;  4LD9 D;  3WKJ D;  4KHA A;  3AZN A;  2F8N H;  4JJN B;  3EPJ A;  4XZQ C;  5AVC B;  4H9Q A;  4X23 A;  3AV1 A;  3MGQ B;  3AZM D;  1P3M D;  3AV2 C;  5B40 A;  2FJ7 C;  1TZY B;  3LEL A;  2PYO A;  3KUY C;  2DF4 C;  1M19 B;  3AN2 C;  1BH8 A;  1ZLA B;  4X23 D;  4Z2M G;  3AV1 D;  4G91 C;  5B40 D;  4KUD B;  4WJ3 C;  5B0Y C;  3V9R A;  3REH B;  1P3K B;  3LEL D;  4NE6 A;  4YS3 B;  4XUJ D;  3C1B D;  5AV6 B;  3UT9 A;  3W98 A;  5B24 A;  2HIO A;  5B31 B;  2Y2H A;  3X1S C;  1KX4 C;  5B24 D;  1M18 C;  2HIO D;  1AOI C;  2YFV B;  3NQU A;  3AYW C;  5DNN A;  4AWL B;  3B6F C;  5AV8 D;  4JJN A;  5BS7 A;  5DNN D;  5CP6 C;  1P3O B;  5B32 C;  1A7W A;  1TZY A;  4CAY A;  2RIQ A;  3EPL A;  1M1A B;  4KGC C;  4JJN D;  2DQN C;  4Z66 A;  1TAF A;  3REI A;  4E45 A;  4LD9 C;  3WKJ C;  1ID3 A;  1TZY D;  1P3G B;  4M6B A;  4E44 A;  3B0B A;  2NQB A;  1U35 A;  3AZM C;  3LZ0 B;  5F99 B;  3REL B;  1P3M C;  1ZLA D;  2CV5 A;  5BO0 A;  4H9R B;  5B31 A;  3X1V A;  1P3K D;  2NQB D;  4X23 C;  3AV1 C;  2Y2N A;  4H9N A;  3AZI B;  5B40 C;  1P34 A;  2CV5 D;  3LEL C;  3VH5 T;  5B31 D;  3B0D B;  4XUJ C;  3X1V D;  3C1B C;  3W99 A;  4G92 C;  1P3P B;  2ARO A;  4R8P A;  1P34 D;  2F2A C;  3TU4 B;  3W99 D;  5B32 G;  4Z5T B;  5B24 C;  2Y2G A;  2HIO C;  4WU8 A;  3B6G B;  5JRG B;  3MVD A;  3B0C W;  5AV8 C;  3AZK A;  4J8V A;  5KDM A;  4J8W B;  3A1I A;  5GXQ A;  3WA9 B;  3REK A;  4EO5 C;  5B2J A;  3W97 A;  4JJN C;  5GXQ D;  2LY8 A;  4XZQ A;  4WU9 A;  4H9S A;  4J8U A;  3W97 D;  3LZ0 D;  5F99 D;  2F8N B;  3AZJ A;  1TZY C;  3AV2 A;  3AL0 C;  1P3L B;  4WU9 D;  1Q9C A;  1ZLA C;  4J8U D;  4H9O A;  2Y2O A;  3AZI D;  3AZJ D;  5B0Z A;  1P3K C;  4CSR A;  2NQB C;  3LZ1 B;  1P3P D;  5B2I A;  4WV4 B;  3B6G A;  2CV5 C;  5BNV A;  5B31 C;  5B0Z D;  4Z2M H;  5GSU A;  1P34 C;  5B2I D;  3B6G D;  3W96 B;  3W99 C;  4HGA B;  5JRG D;  3O62 B;  4AWL C;  5GSU D;  3H0L C;  4J8W D;  3WA9 D;  3WTP B;  3LJA B;  3AZG B;  1P3B B;  4KGC A;  2YFW B;  1P3A A;  3P5J B;  4LD9 A;  3WKJ A;  3H0M C;  1P3F B;  5FUG A;  1KX3 A;  5GXQ C;  2CWE A;  5CPI B;  4NE3 A;  3LZ1 A;  2J8P A;  2ZY5 A;  3W97 C;  3LZ0 C;  5B31 G;  5F99 C;  1P3A D;  3A1K A;  2JE5 A;  3MGR B;  1KX3 D;  2Y2L A;  5AY8 B;  4WU9 C;  4H9S C;  3LZ1 D;  5AVB A;  1EQZ A;  4J8U C;  3KWQ B;  3REJ B;  3UTA A;  3AZI C;  3AZJ C;  1HQ3 A;  2W8S A;  3MGS B;  4YM6 A;  2ZY2 A;  1R4V A;  4XUJ A;  3X1U B;  2NZD B;  3C1B A;  4NFT A;  5DNM A;  5AVB D;  3A6N B;  3UTB B;  1P3P C;  1EQZ D;  3UTA D;  3X1T B;  5E5A B;  1HQ3 D;  5B0Z C;  4YM6 D;  5B33 B;  3O62 D;  3VH6 W;  5DNM D;  1ULY A;  4QLC B;  5B2I C;  5CPK A;  3B6G C;  5B1L A;  1HTA A;  3NQJ A;  5JRG C;  2BYM A;  5GSU C;  5AV8 A;  5CPK D;  5GT0 A;  3KXB B;  1KX5 A;  4J8W C;  5B1L D;  3AZG D;  3WA9 C;  4J8X A;  1KX5 D;  5GT0 D;  3WAA B;  4J8X D;  3H0R C;  5AVC A;  3KWQ A;  2HUE B;  3MGP B;  3MGQ A;  3MGR D;  4ZUX B;  5AVC D;  1M19 A;  1P3A C;  2G5H C;  1KU5 A;  3KWQ D;  3X1T A;  1H3O B;  3MGQ D;  1ZLA A;  5GT3 B;  4KUD A;  3MGS D;  1KX3 C;  3REH A;  1P3K A;  5B33 A;  3MNN B;  4YS3 A;  3LZ1 C;  2NZD D;  5AV6 A;  1M19 D;  4QLC A;  3UTB D;  4ZBJ B;  5AV5 B;  3X1T D;  4KUD D;  1P3I B;  3REH D;  5B33 D;  4YS3 D;  5AVB C;  1EQZ C;  3AZH B;  5AV6 D;  4QLC D;  3UTA C;  1HQ3 C;  1F66 B;  4YM6 C;  2YFV A;  3O62 C;  4WNN B;  3AFA B;  5DNM C;  3C1C B;  3EPK A;  3KXB D;  4H9P B;  3AZE B;  1S32 B;  5CPK C;  1P3O A;  5B1L C;  1WWS A;  3AZG C;  1M1A A;  2Y2K A;  2Y2Q A;  2ZM5 A;  4NE5 A;  3MGP D;  5GT0 C;  1P3O D;  1KX5 C;  1N1J B;  1P3G A;  4J8X C;  1M1A D;  1JFI B;  4ZUX D;  2FJ7 B;  1BH9 B;  3LZ0 A;  5F99 A;  3REL A;  3AZL B;  3MGR C;  5B1M B;  1W2E A;  5G49 B;  4H9R A;  1P3G D;  3KUY B;  5AVC C;  3AN2 B;  4G91 B;  4UUZ B;  3KWQ C;  3REJ C;  3MGQ C;  5BNX B;  5B0Y B;  3REL D;  3AZI A;  3AZF B;  3MGS C;  1BFM A;  3KSY A;  2NZD C;  1F1E A;  1M19 C;  3UTB C;  3AZH D;  3EG5 B;  3X1T C;  1P3P A;  4KUD C;  5CPJ B;  1KX4 B;  3REH C;  3TU4 A;  5B33 C;  4YS3 C;  4Z5T A;  3AFA D;  3WTP E;  5AV6 C;  1M18 B;  4QLC C;  2IO5 B;  4WZS B;  3C1C D;  3AYW B;  3TU4 D;  5JRG A;  3B6F B;  4Z5T D;  3KXB C;  1N1J A;  4J8W A;  3WA9 A;  5CP6 B;  5B32 B;  2XD1 A;  5G49 A;  2ZY4 A;  2JSS A;  3AZF A;  3MGP C;  1P3O C;  2F8N A;  1B67 A;  2BYK B;  3VH5 W;  2XD5 A;  3AZL D;  5B1M D;  3R45 B;  1M1A C;  4ZUX C;  1P3L A;  3AZM B;  1P3M B;  4KHA B;  3AZN B;  3AZF D;  2F8N D;  1T3U A;  1P3G C;  4H9Q B;  4X23 B;  3AV1 B;  1P3L D;  4ZBJ C;  3REL C;  3LEL B;  2PYO B;  5CPJ D;  1P3I C;  2JCH A;  4G92 B;  2Y2I A;  1BH8 B;  3AZH C;  3V9R B;  4DRA A;  3W96 A;  5AV9 B;  3UT9 B;  3W98 B;  3B0D C;  5B24 B;  3AFA C;  3O62 A;  2HIO B;  3C1C C;  3VH6 A;  3W96 D;  3TU4 C;  4UPK A;  4Z5T C;  3WTP A;  1Z2C B;  2BYK A;  2FFF B;  3NQU B;  3LJA A;  5DNN B;  4EO5 B;  3AZG A;  1P3B A;  3IP4 C;  2YFW A;  5BT1 D;  3WTP D;  3LJA D;  5C3I B;  1P3F A;  2L5A A;  1P3B D;  5CPI A;  3AZN D;  4CAY B;  3AZL C;  2G5I C;  5B1M C;  2Y2M A;  3MGR A;  1P3F D;  4Z66 B;  1TAF B;  3REI B;  5CPI D;  5AY8 A;  3B0C T;  1ID3 B;  3FDD A;  3REJ A;  3AZF C;  2BG1 A;  2PYO D;  2NQB B;  3MGS A;  5AV9 A;  1U35 B;  1P3L C;  5AY8 D;  3X1U A;  2NZD A;  3A6N A;  2CV5 B;  3UTB A;  5BO0 B;  3REJ D;  3X1V B;  4DQY B;  5CPJ C;  5E5A A;  5AV9 D;  3UT9 D;  3W98 D;  4H9N B;  3X1U D;  1P34 B;  2IO5 C;  3A6N D;  3W99 B;  5E5A D;  2ARO B;  4R8P B;  2RVQ D;  3KXB A;  3W96 C;  4HGA C;  5CHL B;  4WU8 B;  1PZR A;  3MVD B;  3WAA A;  2F8N G;  5BT1 C;  3AZK B;  3WTP C;  4J8V B;  5KDM B;  3LJA C; 
#chains in the Genus database with same CATH homology
 5GXQ B;  3MGP A;  3REK B;  1P3B C;  5B2J B;  3WAA D;  4Z66 D;  3W97 B;  3REI D;  4ZUX A;  3AZN C;  1ID3 D;  1WWI A;  1H3O A;  2ZY3 A;  5GT3 A;  4XZQ B;  4WU9 B;  1P3F C;  4DRB A;  5CPI C;  4J8U B;  3MNN A;  1U35 D;  3F6T A;  3AZJ B;  3AV2 B;  2PYO C;  5AV5 A;  5GT3 D;  1P3I A;  5AY8 C;  3MNN D;  4H9O B;  3AZH A;  5B0Z B;  4CSR B;  5AV5 D;  1F66 A;  5AV9 C;  3UT9 C;  3W98 C;  1P3I D;  4WNN A;  3X1U C;  5B2I B;  3AFA A;  3A6N C;  2ARO D;  4R8P D;  3C1C A;  5BNV B;  4H9P A;  5E5A C;  5GSU B;  3X1S B;  1F66 D;  3AZE A;  1S32 A;  4WU8 D;  2RVQ C;  1AOI B;  5DNN C;  3MVD D;  2UWX A;  3AZE D;  1S32 D;  3AZK D;  4J8V D;  5JA4 B;  5BS7 C;  5C3I C;  3REK D;  5B2J D;  1JFI A;  3VH6 T;  2FJ7 A;  1BH9 A;  3AZL A;  4KGC B;  1B6W A;  3WAA C;  5B1M A;  4XZQ D;  4Z66 C;  2VQR A;  3KUY A;  3REI C;  3AN2 A;  1P3A B;  3VH5 A;  4LD9 B;  1ID3 C;  3WKJ B;  2Y2P A;  4UUZ A;  3AV2 D;  2FJ7 D;  5FUG B;  2HUE C;  5BNX A;  5B0Y A;  1KX3 B;  2F8N K;  1U35 C;  3KUY D;  3AN2 D;  3X1V C;  5B0Y D;  5GT3 C;  3X1S A;  5CPJ A;  1KX4 A;  5AVB B;  1EQZ B;  3MNN C;  3UTA B;  1M18 A;  5B40 B;  1HQ3 B;  3EPH A;  1AOI A;  4YM6 B;  5AV5 C;  3AYW A;  4XUJ B;  3X1S D;  1KX4 D;  3C1B B;  5DNM B;  3B6F A;  2ARO C;  4R8P C;  1M18 D;  5JA4 A;  1AOI D;  3AYW D;  1F66 C;  5CP6 A;  4WU8 C;  5CPK B;  3B6F D;  5B32 A;  5B1L B;  3NQJ B;  3MVD C;  2BYM B;  3KFU G;  3AZE C;  1S32 C;  3AZK C;  5CP6 D;  2Y2J A;  5AV8 B;  1KX5 B;  5GT0 B;  5B32 D;  4J8V C;  4J8X B;  3REK C;  4KGC D;  5B2J C;  3R45 A;  3AZM A;  1P3M A;  4LD9 D;  3WKJ D;  4KHA A;  3AZN A;  2F8N H;  4JJN B;  3EPJ A;  4XZQ C;  5AVC B;  4H9Q A;  4X23 A;  3AV1 A;  3MGQ B;  3AZM D;  1P3M D;  3AV2 C;  5B40 A;  2FJ7 C;  1TZY B;  3LEL A;  2PYO A;  3KUY C;  2DF4 C;  1M19 B;  3AN2 C;  1BH8 A;  1ZLA B;  4X23 D;  4Z2M G;  3AV1 D;  4G91 C;  5B40 D;  4KUD B;  4WJ3 C;  5B0Y C;  3V9R A;  3REH B;  1P3K B;  3LEL D;  4NE6 A;  4YS3 B;  4XUJ D;  3C1B D;  5AV6 B;  3UT9 A;  3W98 A;  5B24 A;  2HIO A;  5B31 B;  2Y2H A;  3X1S C;  1KX4 C;  5B24 D;  1M18 C;  2HIO D;  1AOI C;  2YFV B;  3NQU A;  3AYW C;  5DNN A;  4AWL B;  3B6F C;  5AV8 D;  4JJN A;  5BS7 A;  5DNN D;  5CP6 C;  1P3O B;  5B32 C;  1A7W A;  1TZY A;  4CAY A;  2RIQ A;  3EPL A;  1M1A B;  4KGC C;  4JJN D;  2DQN C;  4Z66 A;  1TAF A;  3REI A;  4E45 A;  4LD9 C;  3WKJ C;  1ID3 A;  1TZY D;  1P3G B;  4M6B A;  4E44 A;  3B0B A;  2NQB A;  1U35 A;  3AZM C;  3LZ0 B;  5F99 B;  3REL B;  1P3M C;  1ZLA D;  2CV5 A;  5BO0 A;  4H9R B;  5B31 A;  3X1V A;  1P3K D;  2NQB D;  4X23 C;  3AV1 C;  2Y2N A;  4H9N A;  3AZI B;  5B40 C;  1P34 A;  2CV5 D;  3LEL C;  3VH5 T;  5B31 D;  3B0D B;  4XUJ C;  3X1V D;  3C1B C;  3W99 A;  4G92 C;  1P3P B;  2ARO A;  4R8P A;  1P34 D;  2F2A C;  3TU4 B;  3W99 D;  5B32 G;  4Z5T B;  5B24 C;  2Y2G A;  2HIO C;  4WU8 A;  3B6G B;  5JRG B;  3MVD A;  3B0C W;  5AV8 C;  3AZK A;  4J8V A;  5KDM A;  4J8W B;  3A1I A;  5GXQ A;  3WA9 B;  3REK A;  4EO5 C;  5B2J A;  3W97 A;  4JJN C;  5GXQ D;  2LY8 A;  4XZQ A;  4WU9 A;  4H9S A;  4J8U A;  3W97 D;  3LZ0 D;  5F99 D;  2F8N B;  3AZJ A;  1TZY C;  3AV2 A;  3AL0 C;  1P3L B;  4WU9 D;  1Q9C A;  1ZLA C;  4J8U D;  4H9O A;  2Y2O A;  3AZI D;  3AZJ D;  5B0Z A;  1P3K C;  4CSR A;  2NQB C;  3LZ1 B;  1P3P D;  5B2I A;  4WV4 B;  3B6G A;  2CV5 C;  5BNV A;  5B31 C;  5B0Z D;  4Z2M H;  5GSU A;  1P34 C;  5B2I D;  3B6G D;  3W96 B;  3W99 C;  4HGA B;  5JRG D;  3O62 B;  4AWL C;  5GSU D;  3H0L C;  4J8W D;  3WA9 D;  3WTP B;  3LJA B;  3AZG B;  1P3B B;  4KGC A;  2YFW B;  1P3A A;  3P5J B;  4LD9 A;  3WKJ A;  3H0M C;  1P3F B;  5FUG A;  1KX3 A;  5GXQ C;  2CWE A;  5CPI B;  4NE3 A;  3LZ1 A;  2J8P A;  2ZY5 A;  3W97 C;  3LZ0 C;  5B31 G;  5F99 C;  1P3A D;  3A1K A;  2JE5 A;  3MGR B;  1KX3 D;  2Y2L A;  5AY8 B;  4WU9 C;  4H9S C;  3LZ1 D;  5AVB A;  1EQZ A;  4J8U C;  3KWQ B;  3REJ B;  3UTA A;  3AZI C;  3AZJ C;  1HQ3 A;  2W8S A;  3MGS B;  4YM6 A;  2ZY2 A;  1R4V A;  4XUJ A;  3X1U B;  2NZD B;  3C1B A;  4NFT A;  5DNM A;  5AVB D;  3A6N B;  3UTB B;  1P3P C;  1EQZ D;  3UTA D;  3X1T B;  5E5A B;  1HQ3 D;  5B0Z C;  4YM6 D;  5B33 B;  3O62 D;  3VH6 W;  5DNM D;  1ULY A;  4QLC B;  5B2I C;  5CPK A;  3B6G C;  5B1L A;  1HTA A;  3NQJ A;  5JRG C;  2BYM A;  5GSU C;  5AV8 A;  5CPK D;  5GT0 A;  3KXB B;  1KX5 A;  4J8W C;  5B1L D;  3AZG D;  3WA9 C;  4J8X A;  1KX5 D;  5GT0 D;  3WAA B;  4J8X D;  3H0R C;  5AVC A;  3KWQ A;  2HUE B;  3MGP B;  3MGQ A;  3MGR D;  4ZUX B;  5AVC D;  1M19 A;  1P3A C;  2G5H C;  1KU5 A;  3KWQ D;  3X1T A;  1H3O B;  3MGQ D;  1ZLA A;  5GT3 B;  4KUD A;  3MGS D;  1KX3 C;  3REH A;  1P3K A;  5B33 A;  3MNN B;  4YS3 A;  3LZ1 C;  2NZD D;  5AV6 A;  1M19 D;  4QLC A;  3UTB D;  4ZBJ B;  5AV5 B;  3X1T D;  4KUD D;  1P3I B;  3REH D;  5B33 D;  4YS3 D;  5AVB C;  1EQZ C;  3AZH B;  5AV6 D;  4QLC D;  3UTA C;  1HQ3 C;  1F66 B;  4YM6 C;  2YFV A;  3O62 C;  4WNN B;  3AFA B;  5DNM C;  3C1C B;  3EPK A;  3KXB D;  4H9P B;  3AZE B;  1S32 B;  5CPK C;  1P3O A;  5B1L C;  1WWS A;  3AZG C;  1M1A A;  2Y2K A;  2Y2Q A;  2ZM5 A;  4NE5 A;  3MGP D;  5GT0 C;  1P3O D;  1KX5 C;  1N1J B;  1P3G A;  4J8X C;  1M1A D;  1JFI B;  4ZUX D;  2FJ7 B;  1BH9 B;  3LZ0 A;  5F99 A;  3REL A;  3AZL B;  3MGR C;  5B1M B;  1W2E A;  5G49 B;  4H9R A;  1P3G D;  3KUY B;  5AVC C;  3AN2 B;  4G91 B;  4UUZ B;  3KWQ C;  3REJ C;  3MGQ C;  5BNX B;  5B0Y B;  3REL D;  3AZI A;  3AZF B;  3MGS C;  1BFM A;  3KSY A;  2NZD C;  1F1E A;  1M19 C;  3UTB C;  3AZH D;  3EG5 B;  3X1T C;  1P3P A;  4KUD C;  5CPJ B;  1KX4 B;  3REH C;  3TU4 A;  5B33 C;  4YS3 C;  4Z5T A;  3AFA D;  3WTP E;  5AV6 C;  1M18 B;  4QLC C;  2IO5 B;  4WZS B;  3C1C D;  3AYW B;  3TU4 D;  5JRG A;  3B6F B;  4Z5T D;  3KXB C;  1N1J A;  4J8W A;  3WA9 A;  5CP6 B;  5B32 B;  2XD1 A;  5G49 A;  2ZY4 A;  2JSS A;  3AZF A;  3MGP C;  1P3O C;  2F8N A;  1B67 A;  2BYK B;  3VH5 W;  2XD5 A;  3AZL D;  5B1M D;  3R45 B;  1M1A C;  4ZUX C;  1P3L A;  3AZM B;  1P3M B;  4KHA B;  3AZN B;  3AZF D;  2F8N D;  1T3U A;  1P3G C;  4H9Q B;  4X23 B;  3AV1 B;  1P3L D;  4ZBJ C;  3REL C;  3LEL B;  2PYO B;  5CPJ D;  1P3I C;  2JCH A;  4G92 B;  2Y2I A;  1BH8 B;  3AZH C;  3V9R B;  4DRA A;  3W96 A;  5AV9 B;  3UT9 B;  3W98 B;  3B0D C;  5B24 B;  3AFA C;  3O62 A;  2HIO B;  3C1C C;  3VH6 A;  3W96 D;  3TU4 C;  4UPK A;  4Z5T C;  3WTP A;  1Z2C B;  2BYK A;  2FFF B;  3NQU B;  3LJA A;  5DNN B;  4EO5 B;  3AZG A;  1P3B A;  3IP4 C;  2YFW A;  5BT1 D;  3WTP D;  3LJA D;  5C3I B;  1P3F A;  2L5A A;  1P3B D;  5CPI A;  3AZN D;  4CAY B;  3AZL C;  2G5I C;  5B1M C;  2Y2M A;  3MGR A;  1P3F D;  4Z66 B;  1TAF B;  3REI B;  5CPI D;  5AY8 A;  3B0C T;  1ID3 B;  3FDD A;  3REJ A;  3AZF C;  2BG1 A;  2PYO D;  2NQB B;  3MGS A;  5AV9 A;  1U35 B;  1P3L C;  5AY8 D;  3X1U A;  2NZD A;  3A6N A;  2CV5 B;  3UTB A;  5BO0 B;  3REJ D;  3X1V B;  4DQY B;  5CPJ C;  5E5A A;  5AV9 D;  3UT9 D;  3W98 D;  4H9N B;  3X1U D;  1P34 B;  2IO5 C;  3A6N D;  3W99 B;  5E5A D;  2ARO B;  4R8P B;  2RVQ D;  3KXB A;  3W96 C;  4HGA C;  5CHL B;  4WU8 B;  1PZR A;  3MVD B;  3WAA A;  2F8N G;  5BT1 C;  3AZK B;  3WTP C;  4J8V B;  5KDM B;  3LJA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...