3LZ0B

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 1)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 27
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz0B00
3KUYD 3KXBD 3UT9A 2CV5D 1M1AB 1S32C 5B0YB 2LY8A 5DNMC 5GSUD 5AV6B 1P3OA 2NZDD 3REKA 3X1SD 4H9SC 3MGQD 3AYWC 4H9SA 1M19C 1P3PB 1HQ3A 2YFVB 1P3FC 1F66C 5G49B 5BT1D 3REJD 3VH5W 1S32D 3WAAD 5GSUC 4AWLC 4YM6C 4ZUXD 3AZEB 4YM6A 3AYWD 3AV2A 3TU4D 1EQZB 3B6FA 4Z66C 4H9QA 3UTAD 2F8NG 3B0CT 1ZLAB 3WAAC 5BT1C 2PYOB 3AYWB 5E5AA 5GT0B 5AV6D 4AWLB 3X1TA 5DNNA 3WAAA 1BFMA 4ZUXC 3X1TC 4HGAB 5AV6A 1P3OB 4Z66D 5AV9B 3AZMC 3WTPD 2BYKA 4CAYB 1P34B 5AVBA 3UT9B 5BNVA 3AZIC 1P3BB 1JFIA 3B6GD 5B2JB 5BS7C 1H3OA 4J8VB 1U35C 1U35B 3LELB 3WKJC 3AZHD 1P3GB 4J8XA 2BYMA 4J8XB 4H9PA 3V9RA 5BNXB 4J8XC 3WTPC 5F99D 4Z2MH 2YFWA 3WTPA 4J8VA 3AZID 4H9RA 4WU9B 1P3KB 3W96B 4HGAC 1P3GD 3A6ND 3AFAA 3X1VA 1BH9A 3AFAC 5AV9A 2JSSA 3X1VC 1AOIA 3UTAB 1P3MD 5B24C 5F99C 3LZ0A 3NQJB 3AZJC 3KUYA 3LZ1A 3RELA 2PYOA 3WA9A 5KDMB 3AZEC 4Z5TC 3AFAD 5JA4B 4XZQD 3LZ1B 3RELB 3W98C 2AROA 3AZJD 4J8UA 4XZQA 2AROC 4J8UC 5GSUB 4Z5TD 2RVQD 3AZJB 1S32B 2NQBC 1P3AA 2FJ7C 3KXBC 3WTPB 4YS3B 5B33A 4E45A 2NQBA 4DRAA 2CV5C 2FJ7A 2AROD 3REIB 4J8UD 4H9PB 1HTAA 3V9RB 5DNMD 2NZDC 5B32A 4EO5B 1TAFA 1KX5D 3C1CC 5CPJD 1N1JA 5B2IB 2NQBD 1M19D 1TAFB 4WV4B 5AVBB 3LELC 1P3FD 1F66D 2BYKB 4CAYA 3B6FD 4WNNB 1M19A 5GT3A 3A6NB 3AV1B 3MGPB 5CPJC 5CPKA 5AVBD 4YS3C 5CPJA 3TU4C 3AZNA 5GT0A 3MVDA 4R8PB 4JJNA 3B6FC 4J8VD 5AV5D 3KWQC 3X1TD 5CPID 3X1UC 1KX4B 3X1UA 4G91C 5DNNC 5B0ZD 1M18C 1TZYB 3AZMD 4NE5A 2HUEC 5F99B 4KUDB 3B6GA 5KDMA 4LD9C 1HQ3B 5AV5A 2IO5B 3B6GC 4E44A 4LD9A 2HIOA 5AV5C 1U35D 4H9OA 2HIOC 3AZIA 3WKJD 3AZHC 5BS7A 1M19B 5DNND 3WA9D 4H9NA 3AFAB 4LD9D 3AZFA 1P3GC 3A6NC 4H9RB 3W99D 3MGSA 2YFWB 1M1AC 3X1VD 5BO0B 5B32B 2BYMB 5BO0A 1P3MC 3W97A 4KGCA 2FJ7B 5B33B 5B40B 3W97C 4KGCC 3MGSB 5AY8A 1EQZD 2F8NA 4CSRB 4EO5C 1P3BA 5BNVB 3R45B 4ZUXB 3AZED 4NE6A 1P34A 3VH6A 5JRGB 3UT9C 4WU8B 1P34C 3REID 1TZYD 5B32G 3AZMB 5B1MD 3MGRB 4H9OB 3X1TB 1B67A 1EQZC 3AYWA 5AV5B 1P3FA 5JRGD 1F66A 2IO5C 4XUJC 1TZYA 2RVQC 3REJA 1R4VA 3AN2A 1HQ3D 3AV2B 1TZYC 3AV2C 2FJ7D 3LZ0B 3MVDD 3AN2D 3MGPD 3UTAA 5JRGC 2YFVA 1P3LD 4ZBJB 4R8PA 4WU8A 3C1CD 1KX5C 5JRGA 2CV5A 4XUJD 5AVCB 3AZLB 4ZUXA 3MGRC 5E5AC 3AV2D 3C1CA 3B0DB 3AZGB 3MGPA 3LELD 3MGPC 4M6BA 1P3LC 3REHA 1P3LB 3NQUA 3LELA 1U35A 3LJAA 5AVBC 4YS3D 1P3IA 3WKJA 5E5AD 3AZFB 3B0DC 3REHB 4QLCB 3MGQB 4H9NB 4DRBA 4J8VC 1AOID 4J8WB 5CPIA 3O62A 1KX5B 3KWQD 4JJNC 3VH5T 3UTBB 5CPIC 3X1UD 1P3AB 3O62C 3KXBB 3AZFD 3AZKA 1ZLAC 5CHLB 5B1LA 5B0ZC 5E5AB 1F1EA 1M18D 4KHAA 4X23A 5B24A 5F99A 3VH5A 1M18A 1AOIC 3W99B 2HIOD 4KUDC 3O62D 2PYOD 2HUEB 5JA4A 3MGSD 1M18B 1Q9CA 3WA9C 5GXQA 3C1BD 4Z5TA 1KU5A 5GXQC 3TU4B 5B2ID 3W99C 3UTBC 1KX3C 5CPJB 5C3IB 5AV8C 5B31B 1M1AD 3UTBA 5AY8D 4KUDD 3REKB 4NE3A 3A6NA 3MGSC 5B0ZB 4QLCC 3MNND 3C1BC 1M1AA 3MGQA 3W97D 5CP6A 3R45A 4QLCA 4KGCD 5GXQD 3VH6T 3C1BA 3AV1C 3W96A 5B2IC 3WKJB 1KX3D 5AV8D 5GT3D 5AY8C 3UT9D 5B2JC 5B33C 4R8PD 2F8NK 3W97B 1P34D 5B1MA 3REIC 4Z2MG 1P3BC 4KGCB 5B1MB 3B0CW 5B1MC 4QLCD 3MNNC 3REIA 5AVCD 3MNNA 3AZLD 1P3OC 3C1CB 3AV1D 3REKC 1JFIB 5GT0D 5AV8B 5C3IC 5GT3C 4UUZA 5B33D 1HQ3C 5GSUA 3AZNC 5B31A 4XUJA 5AVCC 3MVDC 3AZLC 2HIOB 1P3OD 3AN2C 3TU4A 1P3ID 5GT0C 5B31D 3REJB 4H9QB 4Z66A 3B6FB 3MGRD 1P3FB 1F66B 3WA9B 3AZND 3NQJA 3MGRA 3KWQB 1B6WA 1ULYA 4J8WD 3AZMA 1AOIB 4JJNB 4X23B 4UUZB 1P3PA 5DNMB 3AZNB 1BH8A 5B40C 3REHC 2F8NB 5CPKB 3MNNB 5B40A 5AV9D 5CPIB 4J8WA 5FUGB 5B0YA 4WNNA 5BNXA 4J8WC 1P3GA 3X1SB 4WU9C 1P3KC 4JJND 2NZDB 5B0YD 3AZGD 3AZFC 4NFTA 1H3OB 1ZLAD 3B0BA 1ID3B 5B40D 3LJAB 1N1JB 3NQUB 3C1BB 3X1SA 5CP6B 5AV9C 5B1LC 5B0ZA 1P3MA 3W96D 4G92C 1WWSA 3AZGA 3AZIB 5CP6D 3AZGC 2PYOC 1BH8B 3WAAB 2CWEA 1S32A 4LD9B 2L5AA 1ID3D 3LZ0C 5DNMA 3AZJA 2F8NH 3KUYC 3W98B 3AZHB 4KUDA 1KX4C 5B1LD 4ZBJC 1KX3B 3X1UB 1P3AD 1EQZA 3UTBD 4J8UB 1KX4A 2AROB 4YM6B 4WZSB 3AN2B 3W99A 1KX3A 4Z66B 3LZ0D 4WU8D 1A7WA 5B24B 4KHAB 1KX4D 3REJC 1P3AC 4YM6D 3KXBA 5B2JD 4R8PC 1KX5A 3AV1A 1P3BD 3LJAD 3UTAC 1BH9B 3X1VB 4WU8C 5B32C 4CSRA 3REKD 5AV6C 1P3IB 5AY8B 1P3LA 3WTPE 3LJAC 5FUGA 5CPKC 4YS3A 2NQBB 4X23D 5B32D 1P3IC 5B31C 5AVCA 3AZLA 2CV5B 3LZ1D 3RELD 4J8XD 3KWQA 4XZQB 3AZKC 5CPKD 1P3PD 4G91B 5DNNB 4X23C 1WWIA 1ZLAA 3B6GB 5B31G 4Z5TB 5GXQB 3LZ1C 3RELC 5B24D 3REHD 3AZKD 3KUYB 3AZEA 1P3PC 4XUJB 5G49A 3KSYA 3AZHA 4WU9D 1P3KD 3W98A 3MVDB 3VH6W 5AV8A 5B0YC 5B1LB 4XZQC 3AZKB 4WU9A 1P3KA 3W98D 3O62B 1P3MB 5GT3B 4G92B 3W96C 3X1SC 3MGQC 5CP6C 1ID3A 2F8ND 5B2JA 5B2IA 1ID3C 2NZDA
chains in the Genus database with same CATH superfamily
3KUYD 3KXBD 3UT9A 2CV5D 1M1AB 1S32C 5B0YB 2LY8A 5DNMC 5GSUD 5AV6B 1P3OA 2NZDD 3REKA 3X1SD 4H9SC 3MGQD 3AYWC 4H9SA 1M19C 1P3PB 1HQ3A 2Y2KA 2YFVB 1P3FC 1F66C 5G49B 5BT1D 3REJD 3VH5W 1S32D 3WAAD 5GSUC 4AWLC 4YM6C 4ZUXD 2J8PA 3AZEB 4YM6A 3AYWD 3AV2A 3TU4D 1EQZB 3B6FA 4Z66C 4H9QA 3UTAD 2F8NG 3EPHA 3B0CT 2XD5A 1ZLAB 3WAAC 5BT1C 2PYOB 3AYWB 5E5AA 5GT0B 5AV6D 4AWLB 3X1TA 5DNNA 3WAAA 1BFMA 4ZUXC 3X1TC 4HGAB 5AV6A 1P3OB 4Z66D 5AV9B 3AZMC 3WTPD 2BYKA 4CAYB 1P34B 5AVBA 3UT9B 5BNVA 3AZIC 3A1KA 1P3BB 1JFIA 3B6GD 5B2JB 5BS7C 1H3OA 4J8VB 1U35C 1U35B 3LELB 3WKJC 3AZHD 1P3GB 4J8XA 2BYMA 4J8XB 4H9PA 3V9RA 5BNXB 4J8XC 3WTPC 5F99D 4Z2MH 2YFWA 3WTPA 4J8VA 3AZID 4H9RA 4WU9B 1P3KB 3W96B 4HGAC 1P3GD 3A6ND 3AFAA 3X1VA 1BH9A 3H0LC 3AFAC 5AV9A 2JSSA 3X1VC 1AOIA 3UTAB 1P3MD 5B24C 5F99C 2JE5A 3NQJB 3LZ0A 3AZJC 3KUYA 3LZ1A 3RELA 2PYOA 3WA9A 5KDMB 3AZEC 4Z5TC 3AFAD 2Y2QA 5JA4B 4XZQD 3LZ1B 3RELB 3W98C 2AROA 3AZJD 4J8UA 4XZQA 2AROC 4J8UC 5GSUB 4Z5TD 2RVQD 3AZJB 1S32B 2NQBC 1P3AA 2FJ7C 3KXBC 3WTPB 4YS3B 5B33A 4E45A 2NQBA 4DRAA 2CV5C 2FJ7A 2AROD 3REIB 4J8UD 4H9PB 1HTAA 3V9RB 5DNMD 2NZDC 5B32A 4EO5B 1TAFA 1KX5D 3C1CC 2UWXA 5CPJD 1N1JA 2Y2PA 5B2IB 2NQBD 1M19D 1TAFB 4WV4B 5AVBB 3LELC 1P3FD 1F66D 2BYKB 4CAYA 3B6FD 4WNNB 1M19A 1Z2CB 5GT3A 3A6NB 3AV1B 3MGPB 5CPJC 5CPKA 5AVBD 4YS3C 5CPJA 2G5IC 3TU4C 2ZY2A 3AZNA 5GT0A 3MVDA 4R8PB 4JJNA 2DF4C 3B6FC 4J8VD 5AV5D 3KWQC 3X1TD 5CPID 3X1UC 2BG1A 1KX4B 3X1UA 4G91C 5DNNC 2VQRA 5B0ZD 1TZYB 3AZMD 1M18C 4NE5A 2HUEC 5F99B 4KUDB 3B6GA 5KDMA 4LD9C 1HQ3B 5AV5A 2IO5B 3B6GC 4E44A 4LD9A 2HIOA 2Y2MA 5AV5C 1U35D 4H9OA 2HIOC 3AZIA 3WKJD 3AZHC 5BS7A 1M19B 5DNND 3WA9D 4H9NA 3AFAB 4LD9D 3AZFA 1P3GC 3A6NC 4H9RB 3W99D 3MGSA 2YFWB 1M1AC 2ZY5A 3X1VD 5BO0B 5B32B 2BYMB 5BO0A 1P3MC 3W97A 4KGCA 3P5JB 2FJ7B 5B33B 5B40B 3W97C 4KGCC 3MGSB 5AY8A 1EQZD 2F8NA 4CSRB 4EO5C 1P3BA 2Y2GA 5BNVB 3R45B 4ZUXB 3AZED 4NE6A 1P34A 3VH6A 5JRGB 3UT9C 4WU8B 1P34C 3REID 1TZYD 5B32G 3AZMB 5B1MD 3MGRB 4H9OB 3X1TB 1B67A 1EQZC 3AYWA 5AV5B 1P3FA 5JRGD 1F66A 2IO5C 4XUJC 1TZYA 2RVQC 3REJA 1R4VA 3AN2A 1HQ3D 3AV2B 1TZYC 3AV2C 2FJ7D 3LZ0B 3MVDD 3AN2D 3MGPD 3UTAA 5JRGC 2YFVA 1P3LD 4ZBJB 4R8PA 4WU8A 3C1CD 4DQYB 1KX5C 5JRGA 2CV5A 4XUJD 5AVCB 3AZLB 4ZUXA 2Y2JA 3MGRC 5E5AC 3AV2D 3C1CA 3B0DB 3AZGB 3MGPA 3LELD 3MGPC 4M6BA 3F6TA 2FFFB 1P3LC 3REHA 1P3LB 3NQUA 3LELA 1U35A 3LJAA 5AVBC 4YS3D 1P3IA 3WKJA 5E5AD 2W8SA 3B0DC 3AZFB 3REHB 4QLCB 3MGQB 4H9NB 4DRBA 4J8VC 1AOID 4J8WB 5CPIA 3O62A 1KX5B 3KWQD 4JJNC 3VH5T 3UTBB 5CPIC 3X1UD 1P3AB 3O62C 3KXBB 3AZFD 3AZKA 1ZLAC 5CHLB 5B1LA 5B0ZC 5E5AB 1F1EA 1M18D 4KHAA 4X23A 5B24A 5F99A 3VH5A 1M18A 1AOIC 3W99B 2HIOD 4KUDC 3O62D 1PZRA 2PYOD 2HUEB 5JA4A 3MGSD 1M18B 1Q9CA 3WA9C 5GXQA 3C1BD 4Z5TA 4UPKA 1KU5A 5GXQC 3TU4B 5B2ID 2Y2HA 3W99C 3UTBC 1KX3C 5CPJB 5C3IB 5AV8C 5B31B 1M1AD 3UTBA 5AY8D 4KUDD 3REKB 4NE3A 3A6NA 3MGSC 5B0ZB 4QLCC 3MNND 3C1BC 1M1AA 3MGQA 3W97D 5CP6A 3R45A 4QLCA 4KGCD 5GXQD 3VH6T 3C1BA 3AV1C 3W96A 5B2IC 3WKJB 1KX3D 2DQNC 5AV8D 5GT3D 5AY8C 3UT9D 5B2JC 5B33C 4R8PD 2F8NK 3W97B 1P34D 5B1MA 3REIC 4Z2MG 1P3BC 4KGCB 5B1MB 3KFUG 3B0CW 5B1MC 4QLCD 3MNNC 3REIA 5AVCD 3MNNA 3AZLD 1P3OC 3C1CB 3AV1D 3REKC 1JFIB 5GT0D 5AV8B 5C3IC 5GT3C 4UUZA 5B33D 1HQ3C 5GSUA 3AZNC 5B31A 4XUJA 5AVCC 3MVDC 3AZLC 2HIOB 1P3OD 3AN2C 3TU4A 1P3ID 5GT0C 5B31D 3REJB 4H9QB 4Z66A 3B6FB 3MGRD 3EPLA 1P3FB 2ZY3A 1F66B 3WA9B 3AZND 3NQJA 3MGRA 3KWQB 1B6WA 1ULYA 4J8WD 3AZMA 1AOIB 4JJNB 4X23B 4UUZB 1P3PA 5DNMB 3AZNB 1BH8A 2G5HC 5B40C 3EPJA 3REHC 2F8NB 5CPKB 3MNNB 5B40A 5AV9D 5CPIB 4J8WA 5FUGB 5B0YA 4WNNA 5BNXA 4J8WC 1P3GA 3X1SB 4WU9C 1P3KC 4JJND 2NZDB 2F2AC 5B0YD 3AZGD 3AZFC 4NFTA 1H3OB 1ZLAD 3B0BA 1ID3B 5B40D 3LJAB 1N1JB 2Y2IA 3NQUB 3C1BB 3X1SA 5CP6B 5AV9C 1T3UA 5B1LC 5B0ZA 1P3MA 2ZM5A 3W96D 4G92C 1WWSA 3AZGA 3AZIB 3AL0C 5CP6D 3AZGC 2PYOC 1BH8B 3WAAB 2CWEA 1S32A 4LD9B 2L5AA 1ID3D 3LZ0C 5DNMA 3AZJA 2F8NH 3KUYC 3W98B 3AZHB 4KUDA 3EPKA 5B1LD 4ZBJC 1KX4C 1KX3B 3X1UB 1P3AD 1EQZA 3UTBD 4J8UB 1KX4A 2AROB 4YM6B 4WZSB 3AN2B 3W99A 1KX3A 4Z66B 3LZ0D 4WU8D 1A7WA 5B24B 4KHAB 1KX4D 3REJC 1P3AC 3H0RC 4YM6D 3KXBA 5B2JD 4R8PC 1KX5A 3AV1A 1P3BD 3LJAD 3UTAC 1BH9B 3X1VB 4WU8C 5B32C 4CSRA 3REKD 5AV6C 1P3IB 5AY8B 3IP4C 1P3LA 2XD1A 3WTPE 2RIQA 1W2EA 3LJAC 2Y2LA 5FUGA 5CPKC 4YS3A 2NQBB 4X23D 5B32D 2JCHA 1P3IC 3H0MC 5B31C 5AVCA 3AZLA 3FDDA 2CV5B 3LZ1D 3RELD 4J8XD 3KWQA 4XZQB 3AZKC 5CPKD 1P3PD 4G91B 5DNNB 4X23C 1WWIA 1ZLAA 3B6GB 5B31G 4Z5TB 2Y2OA 5GXQB 3LZ1C 3RELC 5B24D 3REHD 3AZKD 2ZY4A 3KUYB 3AZEA 1P3PC 4WJ3C 4XUJB 3EG5B 5G49A 3KSYA 3AZHA 4WU9D 1P3KD 3W98A 3A1IA 3MVDB 3VH6W 5AV8A 5B0YC 5B1LB 4XZQC 3AZKB 4WU9A 1P3KA 3W98D 3O62B 1P3MB 5GT3B 4G92B 3W96C 3X1SC 2Y2NA 3MGQC 5CP6C 1ID3A 2F8ND 5B2JA 5B2IA 1ID3C 2NZDA
chains in the Genus database with same CATH topology
3KUYD 3KXBD 3UT9A 2CV5D 1M1AB 1S32C 5B0YB 2LY8A 5DNMC 5GSUD 5AV6B 1P3OA 2NZDD 3REKA 3X1SD 4H9SC 3MGQD 3AYWC 4H9SA 1M19C 1P3PB 1HQ3A 2Y2KA 2YFVB 1P3FC 1F66C 5G49B 5BT1D 3REJD 3VH5W 1S32D 3WAAD 5GSUC 4AWLC 4YM6C 4ZUXD 2J8PA 3AZEB 4YM6A 3AYWD 3AV2A 3TU4D 1EQZB 3B6FA 4Z66C 4H9QA 3UTAD 2F8NG 3EPHA 3B0CT 2XD5A 1ZLAB 3WAAC 5BT1C 2PYOB 3AYWB 5E5AA 5GT0B 5AV6D 4AWLB 3X1TA 5DNNA 3WAAA 1BFMA 4ZUXC 3X1TC 4HGAB 5AV6A 1P3OB 4Z66D 5AV9B 3AZMC 3WTPD 2BYKA 4CAYB 1P34B 5AVBA 3UT9B 5BNVA 3AZIC 3A1KA 1P3BB 1JFIA 3B6GD 5B2JB 5BS7C 1H3OA 4J8VB 1U35C 1U35B 3LELB 3WKJC 3AZHD 1P3GB 4J8XA 2BYMA 4J8XB 4H9PA 3V9RA 5BNXB 4J8XC 3WTPC 5F99D 4Z2MH 2YFWA 3WTPA 4J8VA 3AZID 4H9RA 4WU9B 1P3KB 3W96B 4HGAC 1P3GD 3A6ND 3AFAA 3X1VA 1BH9A 3H0LC 3AFAC 5AV9A 2JSSA 3X1VC 1AOIA 3UTAB 1P3MD 5B24C 5F99C 2JE5A 3NQJB 3LZ0A 3AZJC 3KUYA 3LZ1A 3RELA 2PYOA 3WA9A 5KDMB 3AZEC 4Z5TC 3AFAD 2Y2QA 5JA4B 4XZQD 3LZ1B 3RELB 3W98C 2AROA 3AZJD 4J8UA 4XZQA 2AROC 4J8UC 5GSUB 4Z5TD 2RVQD 3AZJB 1S32B 2NQBC 1P3AA 2FJ7C 3KXBC 3WTPB 4YS3B 5B33A 4E45A 2NQBA 4DRAA 2CV5C 2FJ7A 2AROD 3REIB 4J8UD 4H9PB 1HTAA 3V9RB 5DNMD 2NZDC 5B32A 4EO5B 1TAFA 1KX5D 3C1CC 2UWXA 5CPJD 1N1JA 2Y2PA 5B2IB 2NQBD 1M19D 1TAFB 4WV4B 5AVBB 3LELC 1P3FD 1F66D 2BYKB 4CAYA 3B6FD 4WNNB 1M19A 1Z2CB 5GT3A 3A6NB 3AV1B 3MGPB 5CPJC 5CPKA 5AVBD 4YS3C 5CPJA 2G5IC 3TU4C 2ZY2A 3AZNA 5GT0A 3MVDA 4R8PB 4JJNA 2DF4C 3B6FC 4J8VD 5AV5D 3KWQC 3X1TD 5CPID 3X1UC 2BG1A 1KX4B 3X1UA 4G91C 5DNNC 2VQRA 5B0ZD 1TZYB 3AZMD 1M18C 4NE5A 2HUEC 5F99B 4KUDB 3B6GA 5KDMA 4LD9C 1HQ3B 5AV5A 2IO5B 3B6GC 4E44A 4LD9A 2HIOA 2Y2MA 5AV5C 1U35D 4H9OA 2HIOC 3AZIA 3WKJD 3AZHC 5BS7A 1M19B 5DNND 3WA9D 4H9NA 3AFAB 4LD9D 3AZFA 1P3GC 3A6NC 4H9RB 3W99D 3MGSA 2YFWB 1M1AC 2ZY5A 3X1VD 5BO0B 5B32B 2BYMB 5BO0A 1P3MC 3W97A 4KGCA 3P5JB 2FJ7B 5B33B 5B40B 3W97C 4KGCC 3MGSB 5AY8A 1EQZD 2F8NA 4CSRB 4EO5C 1P3BA 2Y2GA 5BNVB 3R45B 4ZUXB 3AZED 4NE6A 1P34A 3VH6A 5JRGB 3UT9C 4WU8B 1P34C 3REID 1TZYD 5B32G 3AZMB 5B1MD 3MGRB 4H9OB 3X1TB 1B67A 1EQZC 3AYWA 5AV5B 1P3FA 5JRGD 1F66A 2IO5C 4XUJC 1TZYA 2RVQC 3REJA 1R4VA 3AN2A 1HQ3D 3AV2B 1TZYC 3AV2C 2FJ7D 3LZ0B 3MVDD 3AN2D 3MGPD 3UTAA 5JRGC 2YFVA 1P3LD 4ZBJB 4R8PA 4WU8A 3C1CD 4DQYB 1KX5C 5JRGA 2CV5A 4XUJD 5AVCB 3AZLB 4ZUXA 2Y2JA 3MGRC 5E5AC 3AV2D 3C1CA 3B0DB 3AZGB 3MGPA 3LELD 3MGPC 4M6BA 3F6TA 2FFFB 1P3LC 3REHA 1P3LB 3NQUA 3LELA 1U35A 3LJAA 5AVBC 4YS3D 1P3IA 3WKJA 5E5AD 2W8SA 3B0DC 3AZFB 3REHB 4QLCB 3MGQB 4H9NB 4DRBA 4J8VC 1AOID 4J8WB 5CPIA 3O62A 1KX5B 3KWQD 4JJNC 3VH5T 3UTBB 5CPIC 3X1UD 1P3AB 3O62C 3KXBB 3AZFD 3AZKA 1ZLAC 5CHLB 5B1LA 5B0ZC 5E5AB 1F1EA 1M18D 4KHAA 4X23A 5B24A 5F99A 3VH5A 1M18A 1AOIC 3W99B 2HIOD 4KUDC 3O62D 1PZRA 2PYOD 2HUEB 5JA4A 3MGSD 1M18B 1Q9CA 3WA9C 5GXQA 3C1BD 4Z5TA 4UPKA 1KU5A 5GXQC 3TU4B 5B2ID 2Y2HA 3W99C 3UTBC 1KX3C 5CPJB 5C3IB 5AV8C 5B31B 1M1AD 3UTBA 5AY8D 4KUDD 3REKB 4NE3A 3A6NA 3MGSC 5B0ZB 4QLCC 3MNND 3C1BC 1M1AA 3MGQA 3W97D 5CP6A 3R45A 4QLCA 4KGCD 5GXQD 3VH6T 3C1BA 3AV1C 3W96A 5B2IC 3WKJB 1KX3D 2DQNC 5AV8D 5GT3D 5AY8C 3UT9D 5B2JC 5B33C 4R8PD 2F8NK 3W97B 1P34D 5B1MA 3REIC 4Z2MG 1P3BC 4KGCB 5B1MB 3KFUG 3B0CW 5B1MC 4QLCD 3MNNC 3REIA 5AVCD 3MNNA 3AZLD 1P3OC 3C1CB 3AV1D 3REKC 1JFIB 5GT0D 5AV8B 5C3IC 5GT3C 4UUZA 5B33D 1HQ3C 5GSUA 3AZNC 5B31A 4XUJA 5AVCC 3MVDC 3AZLC 2HIOB 1P3OD 3AN2C 3TU4A 1P3ID 5GT0C 5B31D 3REJB 4H9QB 4Z66A 3B6FB 3MGRD 3EPLA 1P3FB 2ZY3A 1F66B 3WA9B 3AZND 3NQJA 3MGRA 3KWQB 1B6WA 1ULYA 4J8WD 3AZMA 1AOIB 4JJNB 4X23B 4UUZB 1P3PA 5DNMB 3AZNB 1BH8A 2G5HC 5B40C 3EPJA 3REHC 2F8NB 5CPKB 3MNNB 5B40A 5AV9D 5CPIB 4J8WA 5FUGB 5B0YA 4WNNA 5BNXA 4J8WC 1P3GA 3X1SB 4WU9C 1P3KC 4JJND 2NZDB 2F2AC 5B0YD 3AZGD 3AZFC 4NFTA 1H3OB 1ZLAD 3B0BA 1ID3B 5B40D 3LJAB 1N1JB 2Y2IA 3NQUB 3C1BB 3X1SA 5CP6B 5AV9C 1T3UA 5B1LC 5B0ZA 1P3MA 2ZM5A 3W96D 4G92C 1WWSA 3AZGA 3AZIB 3AL0C 5CP6D 3AZGC 2PYOC 1BH8B 3WAAB 2CWEA 1S32A 4LD9B 2L5AA 1ID3D 3LZ0C 5DNMA 3AZJA 2F8NH 3KUYC 3W98B 3AZHB 4KUDA 3EPKA 5B1LD 4ZBJC 1KX4C 1KX3B 3X1UB 1P3AD 1EQZA 3UTBD 4J8UB 1KX4A 2AROB 4YM6B 4WZSB 3AN2B 3W99A 1KX3A 4Z66B 3LZ0D 4WU8D 1A7WA 5B24B 4KHAB 1KX4D 3REJC 1P3AC 3H0RC 4YM6D 3KXBA 5B2JD 4R8PC 1KX5A 3AV1A 1P3BD 3LJAD 3UTAC 1BH9B 3X1VB 4WU8C 5B32C 4CSRA 3REKD 5AV6C 1P3IB 5AY8B 3IP4C 1P3LA 2XD1A 3WTPE 2RIQA 1W2EA 3LJAC 2Y2LA 5FUGA 5CPKC 4YS3A 2NQBB 4X23D 5B32D 2JCHA 1P3IC 3H0MC 5B31C 5AVCA 3AZLA 3FDDA 2CV5B 3LZ1D 3RELD 4J8XD 3KWQA 4XZQB 3AZKC 5CPKD 1P3PD 4G91B 5DNNB 4X23C 1WWIA 1ZLAA 3B6GB 5B31G 4Z5TB 2Y2OA 5GXQB 3LZ1C 3RELC 5B24D 3REHD 3AZKD 2ZY4A 3KUYB 3AZEA 1P3PC 4WJ3C 4XUJB 3EG5B 5G49A 3KSYA 3AZHA 4WU9D 1P3KD 3W98A 3A1IA 3MVDB 3VH6W 5AV8A 5B0YC 5B1LB 4XZQC 3AZKB 4WU9A 1P3KA 3W98D 3O62B 1P3MB 5GT3B 4G92B 3W96C 3X1SC 2Y2NA 3MGQC 5CP6C 1ID3A 2F8ND 5B2JA 5B2IA 1ID3C 2NZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY D;  3KXB D;  3UT9 A;  2CV5 D;  1M1A B;  1S32 C;  5B0Y B;  2LY8 A;  5DNM C;  5GSU D;  5AV6 B;  1P3O A;  2NZD D;  3REK A;  3X1S D;  4H9S C;  3MGQ D;  3AYW C;  4H9S A;  1M19 C;  1P3P B;  1HQ3 A;  2YFV B;  1P3F C;  1F66 C;  5G49 B;  5BT1 D;  3REJ D;  3VH5 W;  1S32 D;  3WAA D;  5GSU C;  4AWL C;  4YM6 C;  4ZUX D;  3AZE B;  4YM6 A;  3AYW D;  3AV2 A;  3TU4 D;  1EQZ B;  3B6F A;  4Z66 C;  4H9Q A;  3UTA D;  2F8N G;  3B0C T;  1ZLA B;  3WAA C;  5BT1 C;  2PYO B;  3AYW B;  5E5A A;  5GT0 B;  5AV6 D;  4AWL B;  3X1T A;  5DNN A;  3WAA A;  1BFM A;  4ZUX C;  3X1T C;  4HGA B;  5AV6 A;  1P3O B;  4Z66 D;  5AV9 B;  3AZM C;  3WTP D;  2BYK A;  4CAY B;  1P34 B;  5AVB A;  3UT9 B;  5BNV A;  3AZI C;  1P3B B;  1JFI A;  3B6G D;  5B2J B;  5BS7 C;  1H3O A;  4J8V B;  1U35 C;  1U35 B;  3LEL B;  3WKJ C;  3AZH D;  1P3G B;  4J8X A;  2BYM A;  4J8X B;  4H9P A;  3V9R A;  5BNX B;  4J8X C;  3WTP C;  5F99 D;  4Z2M H;  2YFW A;  3WTP A;  4J8V A;  3AZI D;  4H9R A;  4WU9 B;  1P3K B;  3W96 B;  4HGA C;  1P3G D;  3A6N D;  3AFA A;  3X1V A;  1BH9 A;  3AFA C;  5AV9 A;  2JSS A;  3X1V C;  1AOI A;  3UTA B;  1P3M D;  5B24 C;  5F99 C;  3LZ0 A;  3NQJ B;  3AZJ C;  3KUY A;  3LZ1 A;  3REL A;  2PYO A;  3WA9 A;  5KDM B;  3AZE C;  4Z5T C;  3AFA D;  5JA4 B;  4XZQ D;  3LZ1 B;  3REL B;  3W98 C;  2ARO A;  3AZJ D;  4J8U A;  4XZQ A;  2ARO C;  4J8U C;  5GSU B;  4Z5T D;  2RVQ D;  3AZJ B;  1S32 B;  2NQB C;  1P3A A;  2FJ7 C;  3KXB C;  3WTP B;  4YS3 B;  5B33 A;  4E45 A;  2NQB A;  4DRA A;  2CV5 C;  2FJ7 A;  2ARO D;  3REI B;  4J8U D;  4H9P B;  1HTA A;  3V9R B;  5DNM D;  2NZD C;  5B32 A;  4EO5 B;  1TAF A;  1KX5 D;  3C1C C;  5CPJ D;  1N1J A;  5B2I B;  2NQB D;  1M19 D;  1TAF B;  4WV4 B;  5AVB B;  3LEL C;  1P3F D;  1F66 D;  2BYK B;  4CAY A;  3B6F D;  4WNN B;  1M19 A;  5GT3 A;  3A6N B;  3AV1 B;  3MGP B;  5CPJ C;  5CPK A;  5AVB D;  4YS3 C;  5CPJ A;  3TU4 C;  3AZN A;  5GT0 A;  3MVD A;  4R8P B;  4JJN A;  3B6F C;  4J8V D;  5AV5 D;  3KWQ C;  3X1T D;  5CPI D;  3X1U C;  1KX4 B;  3X1U A;  4G91 C;  5DNN C;  5B0Z D;  1M18 C;  1TZY B;  3AZM D;  4NE5 A;  2HUE C;  5F99 B;  4KUD B;  3B6G A;  5KDM A;  4LD9 C;  1HQ3 B;  5AV5 A;  2IO5 B;  3B6G C;  4E44 A;  4LD9 A;  2HIO A;  5AV5 C;  1U35 D;  4H9O A;  2HIO C;  3AZI A;  3WKJ D;  3AZH C;  5BS7 A;  1M19 B;  5DNN D;  3WA9 D;  4H9N A;  3AFA B;  4LD9 D;  3AZF A;  1P3G C;  3A6N C;  4H9R B;  3W99 D;  3MGS A;  2YFW B;  1M1A C;  3X1V D;  5BO0 B;  5B32 B;  2BYM B;  5BO0 A;  1P3M C;  3W97 A;  4KGC A;  2FJ7 B;  5B33 B;  5B40 B;  3W97 C;  4KGC C;  3MGS B;  5AY8 A;  1EQZ D;  2F8N A;  4CSR B;  4EO5 C;  1P3B A;  5BNV B;  3R45 B;  4ZUX B;  3AZE D;  4NE6 A;  1P34 A;  3VH6 A;  5JRG B;  3UT9 C;  4WU8 B;  1P34 C;  3REI D;  1TZY D;  5B32 G;  3AZM B;  5B1M D;  3MGR B;  4H9O B;  3X1T B;  1B67 A;  1EQZ C;  3AYW A;  5AV5 B;  1P3F A;  5JRG D;  1F66 A;  2IO5 C;  4XUJ C;  1TZY A;  2RVQ C;  3REJ A;  1R4V A;  3AN2 A;  1HQ3 D;  3AV2 B;  1TZY C;  3AV2 C;  2FJ7 D;  3LZ0 B;  3MVD D;  3AN2 D;  3MGP D;  3UTA A;  5JRG C;  2YFV A;  1P3L D;  4ZBJ B;  4R8P A;  4WU8 A;  3C1C D;  1KX5 C;  5JRG A;  2CV5 A;  4XUJ D;  5AVC B;  3AZL B;  4ZUX A;  3MGR C;  5E5A C;  3AV2 D;  3C1C A;  3B0D B;  3AZG B;  3MGP A;  3LEL D;  3MGP C;  4M6B A;  1P3L C;  3REH A;  1P3L B;  3NQU A;  3LEL A;  1U35 A;  3LJA A;  5AVB C;  4YS3 D;  1P3I A;  3WKJ A;  5E5A D;  3AZF B;  3B0D C;  3REH B;  4QLC B;  3MGQ B;  4H9N B;  4DRB A;  4J8V C;  1AOI D;  4J8W B;  5CPI A;  3O62 A;  1KX5 B;  3KWQ D;  4JJN C;  3VH5 T;  3UTB B;  5CPI C;  3X1U D;  1P3A B;  3O62 C;  3KXB B;  3AZF D;  3AZK A;  1ZLA C;  5CHL B;  5B1L A;  5B0Z C;  5E5A B;  1F1E A;  1M18 D;  4KHA A;  4X23 A;  5B24 A;  5F99 A;  3VH5 A;  1M18 A;  1AOI C;  3W99 B;  2HIO D;  4KUD C;  3O62 D;  2PYO D;  2HUE B;  5JA4 A;  3MGS D;  1M18 B;  1Q9C A;  3WA9 C;  5GXQ A;  3C1B D;  4Z5T A;  1KU5 A;  5GXQ C;  3TU4 B;  5B2I D;  3W99 C;  3UTB C;  1KX3 C;  5CPJ B;  5C3I B;  5AV8 C;  5B31 B;  1M1A D;  3UTB A;  5AY8 D;  4KUD D;  3REK B;  4NE3 A;  3A6N A;  3MGS C;  5B0Z B;  4QLC C;  3MNN D;  3C1B C;  1M1A A;  3MGQ A;  3W97 D;  5CP6 A;  3R45 A;  4QLC A;  4KGC D;  5GXQ D;  3VH6 T;  3C1B A;  3AV1 C;  3W96 A;  5B2I C;  3WKJ B;  1KX3 D;  5AV8 D;  5GT3 D;  5AY8 C;  3UT9 D;  5B2J C;  5B33 C;  4R8P D;  2F8N K;  3W97 B;  1P34 D;  5B1M A;  3REI C;  4Z2M G;  1P3B C;  4KGC B;  5B1M B;  3B0C W;  5B1M C;  4QLC D;  3MNN C;  3REI A;  5AVC D;  3MNN A;  3AZL D;  1P3O C;  3C1C B;  3AV1 D;  3REK C;  1JFI B;  5GT0 D;  5AV8 B;  5C3I C;  5GT3 C;  4UUZ A;  5B33 D;  1HQ3 C;  5GSU A;  3AZN C;  5B31 A;  4XUJ A;  5AVC C;  3MVD C;  3AZL C;  2HIO B;  1P3O D;  3AN2 C;  3TU4 A;  1P3I D;  5GT0 C;  5B31 D;  3REJ B;  4H9Q B;  4Z66 A;  3B6F B;  3MGR D;  1P3F B;  1F66 B;  3WA9 B;  3AZN D;  3NQJ A;  3MGR A;  3KWQ B;  1B6W A;  1ULY A;  4J8W D;  3AZM A;  1AOI B;  4JJN B;  4X23 B;  4UUZ B;  1P3P A;  5DNM B;  3AZN B;  1BH8 A;  5B40 C;  3REH C;  2F8N B;  5CPK B;  3MNN B;  5B40 A;  5AV9 D;  5CPI B;  4J8W A;  5FUG B;  5B0Y A;  4WNN A;  5BNX A;  4J8W C;  1P3G A;  3X1S B;  4WU9 C;  1P3K C;  4JJN D;  2NZD B;  5B0Y D;  3AZG D;  3AZF C;  4NFT A;  1H3O B;  1ZLA D;  3B0B A;  1ID3 B;  5B40 D;  3LJA B;  1N1J B;  3NQU B;  3C1B B;  3X1S A;  5CP6 B;  5AV9 C;  5B1L C;  5B0Z A;  1P3M A;  3W96 D;  4G92 C;  1WWS A;  3AZG A;  3AZI B;  5CP6 D;  3AZG C;  2PYO C;  1BH8 B;  3WAA B;  2CWE A;  1S32 A;  4LD9 B;  2L5A A;  1ID3 D;  3LZ0 C;  5DNM A;  3AZJ A;  2F8N H;  3KUY C;  3W98 B;  3AZH B;  4KUD A;  1KX4 C;  5B1L D;  4ZBJ C;  1KX3 B;  3X1U B;  1P3A D;  1EQZ A;  3UTB D;  4J8U B;  1KX4 A;  2ARO B;  4YM6 B;  4WZS B;  3AN2 B;  3W99 A;  1KX3 A;  4Z66 B;  3LZ0 D;  4WU8 D;  1A7W A;  5B24 B;  4KHA B;  1KX4 D;  3REJ C;  1P3A C;  4YM6 D;  3KXB A;  5B2J D;  4R8P C;  1KX5 A;  3AV1 A;  1P3B D;  3LJA D;  3UTA C;  1BH9 B;  3X1V B;  4WU8 C;  5B32 C;  4CSR A;  3REK D;  5AV6 C;  1P3I B;  5AY8 B;  1P3L A;  3WTP E;  3LJA C;  5FUG A;  5CPK C;  4YS3 A;  2NQB B;  4X23 D;  5B32 D;  1P3I C;  5B31 C;  5AVC A;  3AZL A;  2CV5 B;  3LZ1 D;  3REL D;  4J8X D;  3KWQ A;  4XZQ B;  3AZK C;  5CPK D;  1P3P D;  4G91 B;  5DNN B;  4X23 C;  1WWI A;  1ZLA A;  3B6G B;  5B31 G;  4Z5T B;  5GXQ B;  3LZ1 C;  3REL C;  5B24 D;  3REH D;  3AZK D;  3KUY B;  3AZE A;  1P3P C;  4XUJ B;  5G49 A;  3KSY A;  3AZH A;  4WU9 D;  1P3K D;  3W98 A;  3MVD B;  3VH6 W;  5AV8 A;  5B0Y C;  5B1L B;  4XZQ C;  3AZK B;  4WU9 A;  1P3K A;  3W98 D;  3O62 B;  1P3M B;  5GT3 B;  4G92 B;  3W96 C;  3X1S C;  3MGQ C;  5CP6 C;  1ID3 A;  2F8N D;  5B2J A;  5B2I A;  1ID3 C;  2NZD A; 
#chains in the Genus database with same CATH topology
 3KUY D;  3KXB D;  3UT9 A;  2CV5 D;  1M1A B;  1S32 C;  5B0Y B;  2LY8 A;  5DNM C;  5GSU D;  5AV6 B;  1P3O A;  2NZD D;  3REK A;  3X1S D;  4H9S C;  3MGQ D;  3AYW C;  4H9S A;  1M19 C;  1P3P B;  1HQ3 A;  2Y2K A;  2YFV B;  1P3F C;  1F66 C;  5G49 B;  5BT1 D;  3REJ D;  3VH5 W;  1S32 D;  3WAA D;  5GSU C;  4AWL C;  4YM6 C;  4ZUX D;  2J8P A;  3AZE B;  4YM6 A;  3AYW D;  3AV2 A;  3TU4 D;  1EQZ B;  3B6F A;  4Z66 C;  4H9Q A;  3UTA D;  2F8N G;  3EPH A;  3B0C T;  2XD5 A;  1ZLA B;  3WAA C;  5BT1 C;  2PYO B;  3AYW B;  5E5A A;  5GT0 B;  5AV6 D;  4AWL B;  3X1T A;  5DNN A;  3WAA A;  1BFM A;  4ZUX C;  3X1T C;  4HGA B;  5AV6 A;  1P3O B;  4Z66 D;  5AV9 B;  3AZM C;  3WTP D;  2BYK A;  4CAY B;  1P34 B;  5AVB A;  3UT9 B;  5BNV A;  3AZI C;  3A1K A;  1P3B B;  1JFI A;  3B6G D;  5B2J B;  5BS7 C;  1H3O A;  4J8V B;  1U35 C;  1U35 B;  3LEL B;  3WKJ C;  3AZH D;  1P3G B;  4J8X A;  2BYM A;  4J8X B;  4H9P A;  3V9R A;  5BNX B;  4J8X C;  3WTP C;  5F99 D;  4Z2M H;  2YFW A;  3WTP A;  4J8V A;  3AZI D;  4H9R A;  4WU9 B;  1P3K B;  3W96 B;  4HGA C;  1P3G D;  3A6N D;  3AFA A;  3X1V A;  1BH9 A;  3H0L C;  3AFA C;  5AV9 A;  2JSS A;  3X1V C;  1AOI A;  3UTA B;  1P3M D;  5B24 C;  5F99 C;  2JE5 A;  3NQJ B;  3LZ0 A;  3AZJ C;  3KUY A;  3LZ1 A;  3REL A;  2PYO A;  3WA9 A;  5KDM B;  3AZE C;  4Z5T C;  3AFA D;  2Y2Q A;  5JA4 B;  4XZQ D;  3LZ1 B;  3REL B;  3W98 C;  2ARO A;  3AZJ D;  4J8U A;  4XZQ A;  2ARO C;  4J8U C;  5GSU B;  4Z5T D;  2RVQ D;  3AZJ B;  1S32 B;  2NQB C;  1P3A A;  2FJ7 C;  3KXB C;  3WTP B;  4YS3 B;  5B33 A;  4E45 A;  2NQB A;  4DRA A;  2CV5 C;  2FJ7 A;  2ARO D;  3REI B;  4J8U D;  4H9P B;  1HTA A;  3V9R B;  5DNM D;  2NZD C;  5B32 A;  4EO5 B;  1TAF A;  1KX5 D;  3C1C C;  2UWX A;  5CPJ D;  1N1J A;  2Y2P A;  5B2I B;  2NQB D;  1M19 D;  1TAF B;  4WV4 B;  5AVB B;  3LEL C;  1P3F D;  1F66 D;  2BYK B;  4CAY A;  3B6F D;  4WNN B;  1M19 A;  1Z2C B;  5GT3 A;  3A6N B;  3AV1 B;  3MGP B;  5CPJ C;  5CPK A;  5AVB D;  4YS3 C;  5CPJ A;  2G5I C;  3TU4 C;  2ZY2 A;  3AZN A;  5GT0 A;  3MVD A;  4R8P B;  4JJN A;  2DF4 C;  3B6F C;  4J8V D;  5AV5 D;  3KWQ C;  3X1T D;  5CPI D;  3X1U C;  2BG1 A;  1KX4 B;  3X1U A;  4G91 C;  5DNN C;  2VQR A;  5B0Z D;  1TZY B;  3AZM D;  1M18 C;  4NE5 A;  2HUE C;  5F99 B;  4KUD B;  3B6G A;  5KDM A;  4LD9 C;  1HQ3 B;  5AV5 A;  2IO5 B;  3B6G C;  4E44 A;  4LD9 A;  2HIO A;  2Y2M A;  5AV5 C;  1U35 D;  4H9O A;  2HIO C;  3AZI A;  3WKJ D;  3AZH C;  5BS7 A;  1M19 B;  5DNN D;  3WA9 D;  4H9N A;  3AFA B;  4LD9 D;  3AZF A;  1P3G C;  3A6N C;  4H9R B;  3W99 D;  3MGS A;  2YFW B;  1M1A C;  2ZY5 A;  3X1V D;  5BO0 B;  5B32 B;  2BYM B;  5BO0 A;  1P3M C;  3W97 A;  4KGC A;  3P5J B;  2FJ7 B;  5B33 B;  5B40 B;  3W97 C;  4KGC C;  3MGS B;  5AY8 A;  1EQZ D;  2F8N A;  4CSR B;  4EO5 C;  1P3B A;  2Y2G A;  5BNV B;  3R45 B;  4ZUX B;  3AZE D;  4NE6 A;  1P34 A;  3VH6 A;  5JRG B;  3UT9 C;  4WU8 B;  1P34 C;  3REI D;  1TZY D;  5B32 G;  3AZM B;  5B1M D;  3MGR B;  4H9O B;  3X1T B;  1B67 A;  1EQZ C;  3AYW A;  5AV5 B;  1P3F A;  5JRG D;  1F66 A;  2IO5 C;  4XUJ C;  1TZY A;  2RVQ C;  3REJ A;  1R4V A;  3AN2 A;  1HQ3 D;  3AV2 B;  1TZY C;  3AV2 C;  2FJ7 D;  3LZ0 B;  3MVD D;  3AN2 D;  3MGP D;  3UTA A;  5JRG C;  2YFV A;  1P3L D;  4ZBJ B;  4R8P A;  4WU8 A;  3C1C D;  4DQY B;  1KX5 C;  5JRG A;  2CV5 A;  4XUJ D;  5AVC B;  3AZL B;  4ZUX A;  2Y2J A;  3MGR C;  5E5A C;  3AV2 D;  3C1C A;  3B0D B;  3AZG B;  3MGP A;  3LEL D;  3MGP C;  4M6B A;  3F6T A;  2FFF B;  1P3L C;  3REH A;  1P3L B;  3NQU A;  3LEL A;  1U35 A;  3LJA A;  5AVB C;  4YS3 D;  1P3I A;  3WKJ A;  5E5A D;  2W8S A;  3B0D C;  3AZF B;  3REH B;  4QLC B;  3MGQ B;  4H9N B;  4DRB A;  4J8V C;  1AOI D;  4J8W B;  5CPI A;  3O62 A;  1KX5 B;  3KWQ D;  4JJN C;  3VH5 T;  3UTB B;  5CPI C;  3X1U D;  1P3A B;  3O62 C;  3KXB B;  3AZF D;  3AZK A;  1ZLA C;  5CHL B;  5B1L A;  5B0Z C;  5E5A B;  1F1E A;  1M18 D;  4KHA A;  4X23 A;  5B24 A;  5F99 A;  3VH5 A;  1M18 A;  1AOI C;  3W99 B;  2HIO D;  4KUD C;  3O62 D;  1PZR A;  2PYO D;  2HUE B;  5JA4 A;  3MGS D;  1M18 B;  1Q9C A;  3WA9 C;  5GXQ A;  3C1B D;  4Z5T A;  4UPK A;  1KU5 A;  5GXQ C;  3TU4 B;  5B2I D;  2Y2H A;  3W99 C;  3UTB C;  1KX3 C;  5CPJ B;  5C3I B;  5AV8 C;  5B31 B;  1M1A D;  3UTB A;  5AY8 D;  4KUD D;  3REK B;  4NE3 A;  3A6N A;  3MGS C;  5B0Z B;  4QLC C;  3MNN D;  3C1B C;  1M1A A;  3MGQ A;  3W97 D;  5CP6 A;  3R45 A;  4QLC A;  4KGC D;  5GXQ D;  3VH6 T;  3C1B A;  3AV1 C;  3W96 A;  5B2I C;  3WKJ B;  1KX3 D;  2DQN C;  5AV8 D;  5GT3 D;  5AY8 C;  3UT9 D;  5B2J C;  5B33 C;  4R8P D;  2F8N K;  3W97 B;  1P34 D;  5B1M A;  3REI C;  4Z2M G;  1P3B C;  4KGC B;  5B1M B;  3KFU G;  3B0C W;  5B1M C;  4QLC D;  3MNN C;  3REI A;  5AVC D;  3MNN A;  3AZL D;  1P3O C;  3C1C B;  3AV1 D;  3REK C;  1JFI B;  5GT0 D;  5AV8 B;  5C3I C;  5GT3 C;  4UUZ A;  5B33 D;  1HQ3 C;  5GSU A;  3AZN C;  5B31 A;  4XUJ A;  5AVC C;  3MVD C;  3AZL C;  2HIO B;  1P3O D;  3AN2 C;  3TU4 A;  1P3I D;  5GT0 C;  5B31 D;  3REJ B;  4H9Q B;  4Z66 A;  3B6F B;  3MGR D;  3EPL A;  1P3F B;  2ZY3 A;  1F66 B;  3WA9 B;  3AZN D;  3NQJ A;  3MGR A;  3KWQ B;  1B6W A;  1ULY A;  4J8W D;  3AZM A;  1AOI B;  4JJN B;  4X23 B;  4UUZ B;  1P3P A;  5DNM B;  3AZN B;  1BH8 A;  2G5H C;  5B40 C;  3EPJ A;  3REH C;  2F8N B;  5CPK B;  3MNN B;  5B40 A;  5AV9 D;  5CPI B;  4J8W A;  5FUG B;  5B0Y A;  4WNN A;  5BNX A;  4J8W C;  1P3G A;  3X1S B;  4WU9 C;  1P3K C;  4JJN D;  2NZD B;  2F2A C;  5B0Y D;  3AZG D;  3AZF C;  4NFT A;  1H3O B;  1ZLA D;  3B0B A;  1ID3 B;  5B40 D;  3LJA B;  1N1J B;  2Y2I A;  3NQU B;  3C1B B;  3X1S A;  5CP6 B;  5AV9 C;  1T3U A;  5B1L C;  5B0Z A;  1P3M A;  2ZM5 A;  3W96 D;  4G92 C;  1WWS A;  3AZG A;  3AZI B;  3AL0 C;  5CP6 D;  3AZG C;  2PYO C;  1BH8 B;  3WAA B;  2CWE A;  1S32 A;  4LD9 B;  2L5A A;  1ID3 D;  3LZ0 C;  5DNM A;  3AZJ A;  2F8N H;  3KUY C;  3W98 B;  3AZH B;  4KUD A;  3EPK A;  5B1L D;  4ZBJ C;  1KX4 C;  1KX3 B;  3X1U B;  1P3A D;  1EQZ A;  3UTB D;  4J8U B;  1KX4 A;  2ARO B;  4YM6 B;  4WZS B;  3AN2 B;  3W99 A;  1KX3 A;  4Z66 B;  3LZ0 D;  4WU8 D;  1A7W A;  5B24 B;  4KHA B;  1KX4 D;  3REJ C;  1P3A C;  3H0R C;  4YM6 D;  3KXB A;  5B2J D;  4R8P C;  1KX5 A;  3AV1 A;  1P3B D;  3LJA D;  3UTA C;  1BH9 B;  3X1V B;  4WU8 C;  5B32 C;  4CSR A;  3REK D;  5AV6 C;  1P3I B;  5AY8 B;  3IP4 C;  1P3L A;  2XD1 A;  3WTP E;  2RIQ A;  1W2E A;  3LJA C;  2Y2L A;  5FUG A;  5CPK C;  4YS3 A;  2NQB B;  4X23 D;  5B32 D;  2JCH A;  1P3I C;  3H0M C;  5B31 C;  5AVC A;  3AZL A;  3FDD A;  2CV5 B;  3LZ1 D;  3REL D;  4J8X D;  3KWQ A;  4XZQ B;  3AZK C;  5CPK D;  1P3P D;  4G91 B;  5DNN B;  4X23 C;  1WWI A;  1ZLA A;  3B6G B;  5B31 G;  4Z5T B;  2Y2O A;  5GXQ B;  3LZ1 C;  3REL C;  5B24 D;  3REH D;  3AZK D;  2ZY4 A;  3KUY B;  3AZE A;  1P3P C;  4WJ3 C;  4XUJ B;  3EG5 B;  5G49 A;  3KSY A;  3AZH A;  4WU9 D;  1P3K D;  3W98 A;  3A1I A;  3MVD B;  3VH6 W;  5AV8 A;  5B0Y C;  5B1L B;  4XZQ C;  3AZK B;  4WU9 A;  1P3K A;  3W98 D;  3O62 B;  1P3M B;  5GT3 B;  4G92 B;  3W96 C;  3X1S C;  2Y2N A;  3MGQ C;  5CP6 C;  1ID3 A;  2F8N D;  5B2J A;  5B2I A;  1ID3 C;  2NZD A; 
#chains in the Genus database with same CATH homology
 3KUY D;  3KXB D;  3UT9 A;  2CV5 D;  1M1A B;  1S32 C;  5B0Y B;  2LY8 A;  5DNM C;  5GSU D;  5AV6 B;  1P3O A;  2NZD D;  3REK A;  3X1S D;  4H9S C;  3MGQ D;  3AYW C;  4H9S A;  1M19 C;  1P3P B;  1HQ3 A;  2Y2K A;  2YFV B;  1P3F C;  1F66 C;  5G49 B;  5BT1 D;  3REJ D;  3VH5 W;  1S32 D;  3WAA D;  5GSU C;  4AWL C;  4YM6 C;  4ZUX D;  2J8P A;  3AZE B;  4YM6 A;  3AYW D;  3AV2 A;  3TU4 D;  1EQZ B;  3B6F A;  4Z66 C;  4H9Q A;  3UTA D;  2F8N G;  3EPH A;  3B0C T;  2XD5 A;  1ZLA B;  3WAA C;  5BT1 C;  2PYO B;  3AYW B;  5E5A A;  5GT0 B;  5AV6 D;  4AWL B;  3X1T A;  5DNN A;  3WAA A;  1BFM A;  4ZUX C;  3X1T C;  4HGA B;  5AV6 A;  1P3O B;  4Z66 D;  5AV9 B;  3AZM C;  3WTP D;  2BYK A;  4CAY B;  1P34 B;  5AVB A;  3UT9 B;  5BNV A;  3AZI C;  3A1K A;  1P3B B;  1JFI A;  3B6G D;  5B2J B;  5BS7 C;  1H3O A;  4J8V B;  1U35 C;  1U35 B;  3LEL B;  3WKJ C;  3AZH D;  1P3G B;  4J8X A;  2BYM A;  4J8X B;  4H9P A;  3V9R A;  5BNX B;  4J8X C;  3WTP C;  5F99 D;  4Z2M H;  2YFW A;  3WTP A;  4J8V A;  3AZI D;  4H9R A;  4WU9 B;  1P3K B;  3W96 B;  4HGA C;  1P3G D;  3A6N D;  3AFA A;  3X1V A;  1BH9 A;  3H0L C;  3AFA C;  5AV9 A;  2JSS A;  3X1V C;  1AOI A;  3UTA B;  1P3M D;  5B24 C;  5F99 C;  2JE5 A;  3NQJ B;  3LZ0 A;  3AZJ C;  3KUY A;  3LZ1 A;  3REL A;  2PYO A;  3WA9 A;  5KDM B;  3AZE C;  4Z5T C;  3AFA D;  2Y2Q A;  5JA4 B;  4XZQ D;  3LZ1 B;  3REL B;  3W98 C;  2ARO A;  3AZJ D;  4J8U A;  4XZQ A;  2ARO C;  4J8U C;  5GSU B;  4Z5T D;  2RVQ D;  3AZJ B;  1S32 B;  2NQB C;  1P3A A;  2FJ7 C;  3KXB C;  3WTP B;  4YS3 B;  5B33 A;  4E45 A;  2NQB A;  4DRA A;  2CV5 C;  2FJ7 A;  2ARO D;  3REI B;  4J8U D;  4H9P B;  1HTA A;  3V9R B;  5DNM D;  2NZD C;  5B32 A;  4EO5 B;  1TAF A;  1KX5 D;  3C1C C;  2UWX A;  5CPJ D;  1N1J A;  2Y2P A;  5B2I B;  2NQB D;  1M19 D;  1TAF B;  4WV4 B;  5AVB B;  3LEL C;  1P3F D;  1F66 D;  2BYK B;  4CAY A;  3B6F D;  4WNN B;  1M19 A;  1Z2C B;  5GT3 A;  3A6N B;  3AV1 B;  3MGP B;  5CPJ C;  5CPK A;  5AVB D;  4YS3 C;  5CPJ A;  2G5I C;  3TU4 C;  2ZY2 A;  3AZN A;  5GT0 A;  3MVD A;  4R8P B;  4JJN A;  2DF4 C;  3B6F C;  4J8V D;  5AV5 D;  3KWQ C;  3X1T D;  5CPI D;  3X1U C;  2BG1 A;  1KX4 B;  3X1U A;  4G91 C;  5DNN C;  2VQR A;  5B0Z D;  1TZY B;  3AZM D;  1M18 C;  4NE5 A;  2HUE C;  5F99 B;  4KUD B;  3B6G A;  5KDM A;  4LD9 C;  1HQ3 B;  5AV5 A;  2IO5 B;  3B6G C;  4E44 A;  4LD9 A;  2HIO A;  2Y2M A;  5AV5 C;  1U35 D;  4H9O A;  2HIO C;  3AZI A;  3WKJ D;  3AZH C;  5BS7 A;  1M19 B;  5DNN D;  3WA9 D;  4H9N A;  3AFA B;  4LD9 D;  3AZF A;  1P3G C;  3A6N C;  4H9R B;  3W99 D;  3MGS A;  2YFW B;  1M1A C;  2ZY5 A;  3X1V D;  5BO0 B;  5B32 B;  2BYM B;  5BO0 A;  1P3M C;  3W97 A;  4KGC A;  3P5J B;  2FJ7 B;  5B33 B;  5B40 B;  3W97 C;  4KGC C;  3MGS B;  5AY8 A;  1EQZ D;  2F8N A;  4CSR B;  4EO5 C;  1P3B A;  2Y2G A;  5BNV B;  3R45 B;  4ZUX B;  3AZE D;  4NE6 A;  1P34 A;  3VH6 A;  5JRG B;  3UT9 C;  4WU8 B;  1P34 C;  3REI D;  1TZY D;  5B32 G;  3AZM B;  5B1M D;  3MGR B;  4H9O B;  3X1T B;  1B67 A;  1EQZ C;  3AYW A;  5AV5 B;  1P3F A;  5JRG D;  1F66 A;  2IO5 C;  4XUJ C;  1TZY A;  2RVQ C;  3REJ A;  1R4V A;  3AN2 A;  1HQ3 D;  3AV2 B;  1TZY C;  3AV2 C;  2FJ7 D;  3LZ0 B;  3MVD D;  3AN2 D;  3MGP D;  3UTA A;  5JRG C;  2YFV A;  1P3L D;  4ZBJ B;  4R8P A;  4WU8 A;  3C1C D;  4DQY B;  1KX5 C;  5JRG A;  2CV5 A;  4XUJ D;  5AVC B;  3AZL B;  4ZUX A;  2Y2J A;  3MGR C;  5E5A C;  3AV2 D;  3C1C A;  3B0D B;  3AZG B;  3MGP A;  3LEL D;  3MGP C;  4M6B A;  3F6T A;  2FFF B;  1P3L C;  3REH A;  1P3L B;  3NQU A;  3LEL A;  1U35 A;  3LJA A;  5AVB C;  4YS3 D;  1P3I A;  3WKJ A;  5E5A D;  2W8S A;  3B0D C;  3AZF B;  3REH B;  4QLC B;  3MGQ B;  4H9N B;  4DRB A;  4J8V C;  1AOI D;  4J8W B;  5CPI A;  3O62 A;  1KX5 B;  3KWQ D;  4JJN C;  3VH5 T;  3UTB B;  5CPI C;  3X1U D;  1P3A B;  3O62 C;  3KXB B;  3AZF D;  3AZK A;  1ZLA C;  5CHL B;  5B1L A;  5B0Z C;  5E5A B;  1F1E A;  1M18 D;  4KHA A;  4X23 A;  5B24 A;  5F99 A;  3VH5 A;  1M18 A;  1AOI C;  3W99 B;  2HIO D;  4KUD C;  3O62 D;  1PZR A;  2PYO D;  2HUE B;  5JA4 A;  3MGS D;  1M18 B;  1Q9C A;  3WA9 C;  5GXQ A;  3C1B D;  4Z5T A;  4UPK A;  1KU5 A;  5GXQ C;  3TU4 B;  5B2I D;  2Y2H A;  3W99 C;  3UTB C;  1KX3 C;  5CPJ B;  5C3I B;  5AV8 C;  5B31 B;  1M1A D;  3UTB A;  5AY8 D;  4KUD D;  3REK B;  4NE3 A;  3A6N A;  3MGS C;  5B0Z B;  4QLC C;  3MNN D;  3C1B C;  1M1A A;  3MGQ A;  3W97 D;  5CP6 A;  3R45 A;  4QLC A;  4KGC D;  5GXQ D;  3VH6 T;  3C1B A;  3AV1 C;  3W96 A;  5B2I C;  3WKJ B;  1KX3 D;  2DQN C;  5AV8 D;  5GT3 D;  5AY8 C;  3UT9 D;  5B2J C;  5B33 C;  4R8P D;  2F8N K;  3W97 B;  1P34 D;  5B1M A;  3REI C;  4Z2M G;  1P3B C;  4KGC B;  5B1M B;  3KFU G;  3B0C W;  5B1M C;  4QLC D;  3MNN C;  3REI A;  5AVC D;  3MNN A;  3AZL D;  1P3O C;  3C1C B;  3AV1 D;  3REK C;  1JFI B;  5GT0 D;  5AV8 B;  5C3I C;  5GT3 C;  4UUZ A;  5B33 D;  1HQ3 C;  5GSU A;  3AZN C;  5B31 A;  4XUJ A;  5AVC C;  3MVD C;  3AZL C;  2HIO B;  1P3O D;  3AN2 C;  3TU4 A;  1P3I D;  5GT0 C;  5B31 D;  3REJ B;  4H9Q B;  4Z66 A;  3B6F B;  3MGR D;  3EPL A;  1P3F B;  2ZY3 A;  1F66 B;  3WA9 B;  3AZN D;  3NQJ A;  3MGR A;  3KWQ B;  1B6W A;  1ULY A;  4J8W D;  3AZM A;  1AOI B;  4JJN B;  4X23 B;  4UUZ B;  1P3P A;  5DNM B;  3AZN B;  1BH8 A;  2G5H C;  5B40 C;  3EPJ A;  3REH C;  2F8N B;  5CPK B;  3MNN B;  5B40 A;  5AV9 D;  5CPI B;  4J8W A;  5FUG B;  5B0Y A;  4WNN A;  5BNX A;  4J8W C;  1P3G A;  3X1S B;  4WU9 C;  1P3K C;  4JJN D;  2NZD B;  2F2A C;  5B0Y D;  3AZG D;  3AZF C;  4NFT A;  1H3O B;  1ZLA D;  3B0B A;  1ID3 B;  5B40 D;  3LJA B;  1N1J B;  2Y2I A;  3NQU B;  3C1B B;  3X1S A;  5CP6 B;  5AV9 C;  1T3U A;  5B1L C;  5B0Z A;  1P3M A;  2ZM5 A;  3W96 D;  4G92 C;  1WWS A;  3AZG A;  3AZI B;  3AL0 C;  5CP6 D;  3AZG C;  2PYO C;  1BH8 B;  3WAA B;  2CWE A;  1S32 A;  4LD9 B;  2L5A A;  1ID3 D;  3LZ0 C;  5DNM A;  3AZJ A;  2F8N H;  3KUY C;  3W98 B;  3AZH B;  4KUD A;  3EPK A;  5B1L D;  4ZBJ C;  1KX4 C;  1KX3 B;  3X1U B;  1P3A D;  1EQZ A;  3UTB D;  4J8U B;  1KX4 A;  2ARO B;  4YM6 B;  4WZS B;  3AN2 B;  3W99 A;  1KX3 A;  4Z66 B;  3LZ0 D;  4WU8 D;  1A7W A;  5B24 B;  4KHA B;  1KX4 D;  3REJ C;  1P3A C;  3H0R C;  4YM6 D;  3KXB A;  5B2J D;  4R8P C;  1KX5 A;  3AV1 A;  1P3B D;  3LJA D;  3UTA C;  1BH9 B;  3X1V B;  4WU8 C;  5B32 C;  4CSR A;  3REK D;  5AV6 C;  1P3I B;  5AY8 B;  3IP4 C;  1P3L A;  2XD1 A;  3WTP E;  2RIQ A;  1W2E A;  3LJA C;  2Y2L A;  5FUG A;  5CPK C;  4YS3 A;  2NQB B;  4X23 D;  5B32 D;  2JCH A;  1P3I C;  3H0M C;  5B31 C;  5AVC A;  3AZL A;  3FDD A;  2CV5 B;  3LZ1 D;  3REL D;  4J8X D;  3KWQ A;  4XZQ B;  3AZK C;  5CPK D;  1P3P D;  4G91 B;  5DNN B;  4X23 C;  1WWI A;  1ZLA A;  3B6G B;  5B31 G;  4Z5T B;  2Y2O A;  5GXQ B;  3LZ1 C;  3REL C;  5B24 D;  3REH D;  3AZK D;  2ZY4 A;  3KUY B;  3AZE A;  1P3P C;  4WJ3 C;  4XUJ B;  3EG5 B;  5G49 A;  3KSY A;  3AZH A;  4WU9 D;  1P3K D;  3W98 A;  3A1I A;  3MVD B;  3VH6 W;  5AV8 A;  5B0Y C;  5B1L B;  4XZQ C;  3AZK B;  4WU9 A;  1P3K A;  3W98 D;  3O62 B;  1P3M B;  5GT3 B;  4G92 B;  3W96 C;  3X1S C;  2Y2N A;  3MGQ C;  5CP6 C;  1ID3 A;  2F8N D;  5B2J A;  5B2I A;  1ID3 C;  2NZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...