3LZ0D

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 1)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
b'KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 35
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz0D00
3LELB 1ULYA 1BH8B 3MGSC 3RELD 5BNXB 3X1UA 3B0CW 3AZJD 4J8VD 1M18C 5DNNA 3AZKC 5AV5D 3REJC 5AV9D 3W98D 1M1AB 3MGQD 1P3OB 1M19A 3B6FC 3X1SC 3LZ1D 3AZIC 4Z5TA 3UTBC 1P34B 5B2ID 5AV6D 1HTAA 4QLCD 2AROA 5B24A 3X1VA 1KX5D 3W99B 2HUEB 3C1CA 3MVDB 1JFIA 3AZLA 4XZQC 3O62A 1N1JB 3WTPE 5B2JB 5B1MB 3X1TB 4AWLB 4XUJB 4E45A 5GT3D 3WKJA 3LJAB 3LELC 1P3BD 1F66B 5FUGA 2HIOB 3KXBD 3AZFB 3NQJA 3AZHA 5B31C 4KGCD 3REHB 3AZED 5GT0D 5BNVB 4LD9A 4JJNB 3REIA 5AVCD 1P3MB 4X23A 3RELB 1P3OC 3R45B 3MGSD 3V9RB 1P34C 3AZJB 3LZ0B 5AV5B 5AV9B 1M18D 5B0ZA 3AZKD 3REJD 3KWQA 3UTAA 4H9SA 3AV1B 1KX4B 2HUEC 3B0CT 2LY8A 2BYKB 3MVDC 1F1EA 4WU9A 5CPJA 5JRGB 2YFWA 2NQBA 1U35B 3B6FD 3X1SD 3AZID 1P3FC 3UTBD 4QLCB 4ZBJC 5B2JC 5B1MC 3X1TC 4H9RB 4G91C 4XUJC 5JA4A 1ZLAB 3AZMA 3AFAA 5GXQA 3AYWB 2HIOC 3B0DB 4CAYB 4KUDA 4XZQD 3REHC 3KSYA 4YM6C 1BH9A 3UT9A 5AV8C 4JJNC 1P3MC 2PYOB 1TZYA 3LELD 4J8UC 4KGCB 1S32B 4CSRB 1P3AB 5B31D 3LZ0C 2F8NK 1P3IB 4ZUXA 1KX4C 3AV1C 5DNMC 3VH6W 5JRGC 1P3OD 1U35C 1P3KA 3LZ1A 5B33A 5E5AB 3AN2C 1P34D 5B2IA 5AV6A 1M18B 3AZKB 1ZLAC 1P3LB 3WTPA 3KUYA 1KX5A 3AYWC 3B0DC 3AV2B 1EQZC 3MVDD 3UTBB 4Z2MH 1P3FD 5B2JD 3A6NC 5B1MD 3X1TD 4XUJD 2PYOC 1P3BA 4WNNB 3KXBA 2HIOD 3B6GC 3VH5W 4J8XB 1S32C 1P3AC 4WV4B 5KDMA 3AZEA 3REHD 5GT0A 4YM6D 4H9NA 1P3IC 3MGPA 5AV8D 4JJND 5AVCA 1P3MD 4J8UD 5B31B 5B24B 3X1VB 5E5AC 4UUZB 3MGSA 3C1CB 3LZ0D 5B40A 1P3LC 5AVBC 3REJA 1KX4D 3AV2C 5DNMD 3AV1D 4KHAB 3AZNA 3WAAB 5JRGD 3B6FA 1U35D 5B31G 3AZIA 3AN2D 3NQJB 4M6BA 5BO0B 3NQUB 1ZLAD 3REKA 5B32B 1P3PB 1HQ3B 3AYWD 1KX3A 1EQZD 4J8XC 1P3FB 4ZBJB 3W97B 3MNNB 4G91B 4Z5TC 3A6ND 5CP6B 2CV5B 1P3GB 2FJ7A 2PYOD 3LELA 2CWEA 5BT1C 5B24C 3X1VC 3KWQB 3B6GD 4H9PB 1S32D 5BNXA 4HGAB 4YM6B 3C1CC 1P3AD 4WU9B 2NZDA 3AZGA 5AV8B 2NQBB 3VH5T 3O62C 1P3ID 3VH5A 4J8UB 1B6WA 1Q9CA 5G49A 5JA4B 3WAAC 1M1AA 1ID3B 4Z66B 1P3OA 5E5AD 1P34A 5GSUB 1AOIA 4YS3B 5DNMB 1P3LD 1WWIA 5B32C 4R8PA 1BH9B 1P3PC 5AVBD 3W99A 1HQ3C 5CPKA 3AV2D 3MVDA 4LD9C 3AN2B 3W97C 1TZYB 3MNNC 5CPIB 5BS7A 5B2JA 5AY8B 5B1MA 5CP6C 1WWSA 5F99B 2CV5C 1P3GC 3LJAA 1EQZB 1F66A 2F8NB 3TU4A 4ZUXB 3AZFA 3KWQC 4H9SC 4J8XD 4HGAC 4WU9C 3A6NB 3REHA 2NQBC 4H9QB 4Z5TD 5BNVA 4JJNA 5B0YB 4H9OB 1P3MA 3B6GB 3RELA 3MGRB 1ID3C 5BT1D 4Z66C 3WTPB 5B24D 3AZMC 3X1VD 1BFMA 3AFAC 2YFVA 3R45A 3V9RA 4G92B 3AZJA 3C1CD 4J8VA 5GSUC 3LZ0A 5AV5A 5AV9A 4YS3C 4NE6A 3W98A 3O62D 3UT9C 3MGQA 3AV1A 3WA9B 3W96B 2BYKA 4WU8B 3WAAD 1H3OA 5JRGA 1TZYC 1R4VA 1U35A 5CPIC 1TAFB 4QLCA 5AY8C 4H9RA 5B1LB 5AVBB 3C1BB 5F99C 1ZLAA 5B32D 1P3PD 2IO5B 1HQ3D 4ZUXC 4CAYA 4J8WB 3AYWA 4J8WA 4LD9D 3W97D 3MNND 3X1UB 5GT3A 1P3KC 5B33C 5CP6D 5DNNB 2CV5D 1P3GD 5B0YC 4NE5A 2PYOA 3MGRC 3WTPC 3KUYC 4DRAA 4KGCA 4NE3A 3KWQD 1M19B 4G92C 4WU9D 4Z5TB 2NQBD 1P3IA 2RVQC 4WZSB 2AROB 3WA9C 3W96C 4WU8C 3REKB 1ID3D 4Z66D 3AZMD 1JFIB 3AFAD 3AZLB 5E5AA 1M18A 3O62B 5GSUD 5B1LC 3AZKA 4EO5B 3C1BC 4YS3D 3WKJB 2IO5C 4J8WC 3MGPC 3UT9D 3AV2A 5FUGB 3X1SA 3UTBA 3VH6T 1TZYD 3AZHB 3VH6A 5CPID 3X1UC 2JSSA 5AY8D 5DNNC 2NZDB 3AZGB 5F99D 5B40C 4WNNA 4LD9B 3REIB 2F8ND 5C3IB 4ZUXD 4X23B 4XZQA 4J8XA 1M19C 3B0BA 5G49B 3AZNC 1P3KD 2BYMA 5B33D 5B32G 2AROC 5B0ZB 5B0YD 1AOIB 3UTAB 1BH8A 3MGRD 3REKC 5B31A 3WTPD 3KUYD 4R8PB 5CPJB 3AZLC 5CPKB 4UUZA 2YFWB 1KX3C 4EO5C 2L5AA 2RVQD 3WKJC 3AZMB 3WA9D 4KHAA 5GXQB 3AFAB 4WU8D 3W96D 3WAAA 2FJ7C 3AZHC 3TU4B 4KUDB 5B1LD 5BO0A 3NQUA 2NZDC 3C1BD 3UT9B 3AZGC 5B32A 3REIC 1P3PA 1HQ3A 5C3IC 3MGPD 4X23C 4J8WD 1N1JA 1P3FA 3W97A 3X1TA 1M1AC 3MNNA 4XUJA 3X1UD 2YFVB 1B67A 5CP6A 4J8VB 5DNND 5B0ZC 2CV5A 2HIOA 1P3GA 1AOIC 3UTAC 5B40D 3W98B 4R8PC 5CPJC 3W99C 5CPKC 4H9PA 3MGQB 1M19D 4YM6A 1P3KB 3LZ1B 5B33B 3AZND 5B2IB 1H3OB 5AV8A 5AV6B 5BS7C 4J8UA 1KU5A 2AROD 3KUYB 4AWLC 2F8NG 1KX5B 5GXQC 3LJAC 3REKD 1ID3A 4Z66A 1F66C 3TU4C 3AZLD 4KUDC 3AZFC 1KX3D 2F8NH 5GSUA 1KX4A 5CHLB 4YS3A 5DNMA 5GT3B 3WKJD 1P3BB 3KXBB 3AN2A 2FJ7D 3RELC 3AZHD 5CPIA 1A7WA 5KDMB 3AZEB 5AY8A 5GT0B 3AZJC 4J8VC 4H9NB 2NZDD 5F99A 3MGPB 3AZGD 5AV5C 5AV9C 1EQZA 3W98C 3REID 2F8NA 5AVCB 4X23D 3MGQC 3LZ1C 3MGSB 3A6NA 1M1AD 5B2IC 5AV6C 4H9QA 5B40B 4QLCC 5B0ZD 5B0YA 3REJB 1KX5C 4H9OA 3UTAD 1AOID 4Z2MG 1S32A 4CSRA 3MGRA 1P3AA 3B6GA 4R8PD 3AZNB 5CPJD 3W99D 5CPKD 3B6FB 3X1SB 3AZIB 4E44A 5GT3C 1P3BC 3WA9A 3W96A 5GXQD 4WU8A 3KXBC 3LJAD 1KX3B 1F66D 4DRBA 3TU4D 1TAFA 4KGCC 4KUDD 3AZFD 4NFTA 4XZQB 3AZEC 1P3LA 5GT0C 5B1LA 5AVBA 3C1BA 2BYMB 2FJ7B 5AVCC
chains in the Genus database with same CATH superfamily
3LELB 2Y2GA 1ULYA 1BH8B 3MGSC 3RELD 5BNXB 3X1UA 1PZRA 3B0CW 3A1IA 3AZJD 2F2AC 4J8VD 5DNNA 1M18C 3AZKC 5AV5D 3REJC 5AV9D 3W98D 2DF4C 4WJ3C 1M1AB 3MGQD 1P3OB 1M19A 3B6FC 3X1SC 3LZ1D 3AZIC 4Z5TA 3UTBC 1P34B 5B2ID 5AV6D 1HTAA 4QLCD 2AROA 5B24A 3X1VA 1KX5D 3W99B 2HUEB 3C1CA 2XD5A 3FDDA 3MVDB 1JFIA 3AZLA 4XZQC 3O62A 1N1JB 3WTPE 5B2JB 5B1MB 3X1TB 4AWLB 2FFFB 4XUJB 4E45A 5GT3D 3WKJA 3LJAB 3LELC 1P3BD 1F66B 5FUGA 2HIOB 3KXBD 3AZFB 3NQJA 3AZHA 5B31C 4KGCD 3REHB 3AZED 5GT0D 5BNVB 4LD9A 4JJNB 3REIA 5AVCD 1P3MB 4X23A 3RELB 1P3OC 3R45B 3MGSD 3V9RB 1P34C 3AZJB 3LZ0B 5AV5B 5AV9B 1M18D 5B0ZA 3AZKD 3REJD 3KWQA 3UTAA 4H9SA 3AV1B 1KX4B 2HUEC 3B0CT 2LY8A 2BYKB 3MVDC 1F1EA 4WU9A 5CPJA 5JRGB 2YFWA 2NQBA 1U35B 3B6FD 3X1SD 3AZID 1P3FC 3UTBD 2Y2KA 4ZBJC 5B2JC 4QLCB 5B1MC 3X1TC 4H9RB 4G91C 4XUJC 5JA4A 1ZLAB 3AZMA 3AFAA 5GXQA 3AYWB 2HIOC 2Y2LA 3B0DB 4CAYB 4KUDA 4XZQD 3REHC 3KSYA 4YM6C 1BH9A 3UT9A 5AV8C 4JJNC 1T3UA 1P3MC 2PYOB 1TZYA 3LELD 4J8UC 4KGCB 1S32B 4CSRB 1P3AB 5B31D 3LZ0C 2F8NK 1P3IB 4ZUXA 1KX4C 4UPKA 3AV1C 5DNMC 3EPKA 3VH6W 5JRGC 1P3OD 1U35C 1P3KA 3LZ1A 5B33A 5E5AB 3AN2C 1P34D 5B2IA 5AV6A 1M18B 3AZKB 1ZLAC 1P3LB 3WTPA 3KUYA 1KX5A 3AYWC 3B0DC 3AV2B 2J8PA 1EQZC 3MVDD 3UTBB 4Z2MH 1P3FD 2Y2IA 5B2JD 3A6NC 5B1MD 3X1TD 4XUJD 3IP4C 2PYOC 1P3BA 4WNNB 2Y2QA 2UWXA 3KXBA 2HIOD 3B6GC 3VH5W 4J8XB 1S32C 1P3AC 4WV4B 5KDMA 3AZEA 3REHD 5GT0A 4YM6D 4H9NA 1P3IC 2DQNC 3MGPA 5AV8D 4JJND 5AVCA 1P3MD 4J8UD 5B31B 5B24B 3X1VB 5E5AC 4UUZB 3MGSA 3C1CB 3LZ0D 3EPLA 5B40A 1P3LC 5AVBC 2VQRA 3REJA 1KX4D 3AV2C 5DNMD 3AV1D 4KHAB 3AZNA 3WAAB 5JRGD 3B6FA 1U35D 5B31G 3AZIA 3AN2D 3NQJB 4M6BA 5BO0B 3NQUB 1ZLAD 3REKA 5B32B 1W2EA 1P3PB 1HQ3B 3AYWD 1KX3A 1EQZD 4J8XC 1P3FB 4ZBJB 3W97B 3MNNB 4G91B 4Z5TC 3A6ND 5CP6B 2CV5B 1P3GB 2FJ7A 2PYOD 3LELA 2CWEA 5BT1C 5B24C 3X1VC 3KWQB 3B6GD 4H9PB 1S32D 5BNXA 4HGAB 4YM6B 3C1CC 1P3AD 4WU9B 2NZDA 3AZGA 5AV8B 2NQBB 3VH5T 3O62C 1P3ID 3VH5A 4J8UB 1B6WA 4DQYB 1Q9CA 5G49A 5JA4B 3WAAC 1M1AA 1ID3B 4Z66B 1P3OA 5E5AD 1P34A 5GSUB 1AOIA 2Y2JA 4YS3B 5DNMB 1P3LD 1WWIA 5B32C 4R8PA 1BH9B 1P3PC 5AVBD 3W99A 1HQ3C 5CPKA 3AV2D 2Y2HA 3MVDA 4LD9C 3AN2B 3W97C 1TZYB 3MNNC 5CPIB 3H0RC 5BS7A 5B2JA 5AY8B 5B1MA 5CP6C 1WWSA 5F99B 2CV5C 1P3GC 3LJAA 1EQZB 1F66A 2F8NB 3TU4A 4ZUXB 3AZFA 3KWQC 4H9SC 4J8XD 4HGAC 4WU9C 3A6NB 3REHA 2NQBC 4H9QB 4Z5TD 3H0LC 5BNVA 3H0MC 4JJNA 5B0YB 4H9OB 1P3MA 2JE5A 3RELA 3B6GB 3MGRB 2ZY5A 5BT1D 4Z66C 3WTPB 5B24D 3AZMC 3X1VD 1ID3C 3AFAC 1BFMA 2YFVA 3R45A 3V9RA 4G92B 3AZJA 3C1CD 2G5IC 4J8VA 5GSUC 3LZ0A 5AV5A 5AV9A 4YS3C 4NE6A 3W98A 3O62D 3UT9C 3MGQA 3AV1A 3WA9B 3W96B 2BYKA 4WU8B 3WAAD 1H3OA 5JRGA 1TZYC 1R4VA 1U35A 5CPIC 1TAFB 4QLCA 5AY8C 4H9RA 5B1LB 5AVBB 3C1BB 5F99C 1ZLAA 5B32D 1P3PD 2IO5B 1HQ3D 4ZUXC 4CAYA 4J8WB 3AYWA 4J8WA 4LD9D 3W97D 3MNND 3X1UB 5GT3A 1P3KC 5B33C 5CP6D 5DNNB 2CV5D 1P3GD 5B0YC 1Z2CB 4NE5A 2PYOA 3MGRC 3WTPC 3KUYC 4DRAA 4KGCA 4NE3A 3KWQD 1M19B 4G92C 4WU9D 4Z5TB 2NQBD 1P3IA 2RVQC 4WZSB 2AROB 3WA9C 3W96C 4WU8C 3REKB 1ID3D 4Z66D 3AZMD 1JFIB 3AFAD 3AZLB 5E5AA 3EPHA 1M18A 2RIQA 3O62B 5GSUD 2ZM5A 5B1LC 3AZKA 4EO5B 3C1BC 3P5JB 4YS3D 3WKJB 2IO5C 4J8WC 3MGPC 3UT9D 3AV2A 5FUGB 3X1SA 3UTBA 2ZY3A 3VH6T 1TZYD 3AZHB 3VH6A 5CPID 3X1UC 2JSSA 5AY8D 5DNNC 2NZDB 3AZGB 5F99D 5B40C 2Y2NA 3EG5B 2G5HC 4WNNA 4LD9B 3REIB 2F8ND 5C3IB 4ZUXD 4X23B 4XZQA 2ZY2A 4J8XA 1M19C 3B0BA 5G49B 3AZNC 1P3KD 2BYMA 5B33D 5B32G 2AROC 5B0ZB 5B0YD 1AOIB 3UTAB 1BH8A 3MGRD 3REKC 5B31A 3WTPD 3KUYD 4R8PB 5CPJB 3AZLC 5CPKB 4UUZA 2YFWB 1KX3C 4EO5C 2JCHA 2L5AA 2Y2MA 2RVQD 3WKJC 2ZY4A 3AZMB 3WA9D 4KHAA 5GXQB 3AFAB 4WU8D 3W96D 3WAAA 2FJ7C 2W8SA 3AZHC 3TU4B 4KUDB 2XD1A 5B1LD 3NQUA 5BO0A 3C1BD 3UT9B 3AZGC 2NZDC 5B32A 3REIC 1P3PA 1HQ3A 5C3IC 3MGPD 4X23C 4J8WD 1N1JA 1P3FA 3W97A 3X1TA 1M1AC 3MNNA 4XUJA 3X1UD 1B67A 2YFVB 5CP6A 4J8VB 5DNND 5B0ZC 2CV5A 2HIOA 1P3GA 1AOIC 3UTAC 5B40D 3W98B 4R8PC 5CPJC 3W99C 5CPKC 4H9PA 3MGQB 1M19D 4YM6A 1P3KB 3LZ1B 5B33B 3AZND 5B2IB 5AV6B 1H3OB 2Y2OA 5AV8A 5BS7C 4J8UA 1KU5A 3EPJA 2AROD 3KUYB 4AWLC 2F8NG 1KX5B 5GXQC 3LJAC 2Y2PA 3REKD 4Z66A 1ID3A 3F6TA 1F66C 3TU4C 3AZLD 4KUDC 3AZFC 1KX3D 2F8NH 5GSUA 3A1KA 1KX4A 5CHLB 4YS3A 5DNMA 5GT3B 3WKJD 1P3BB 3KXBB 3AN2A 3KFUG 2FJ7D 3RELC 3AZHD 5CPIA 1A7WA 5KDMB 3AZEB 5AY8A 5GT0B 3AZJC 4J8VC 4H9NB 2NZDD 5F99A 3MGPB 3AZGD 5AV5C 5AV9C 1EQZA 3W98C 3REID 2F8NA 5AVCB 4X23D 3MGQC 3LZ1C 3MGSB 3A6NA 1M1AD 5B2IC 5AV6C 4H9QA 5B40B 4QLCC 5B0ZD 5B0YA 3REJB 1KX5C 4H9OA 3UTAD 1AOID 4Z2MG 1S32A 4CSRA 3MGRA 1P3AA 3B6GA 4R8PD 3AZNB 5CPJD 3W99D 5CPKD 3B6FB 3X1SB 3AZIB 2BG1A 4E44A 5GT3C 1P3BC 3WA9A 3W96A 5GXQD 4WU8A 3KXBC 3LJAD 1KX3B 1F66D 4DRBA 3AL0C 3TU4D 1TAFA 4KGCC 4KUDD 3AZFD 4NFTA 4XZQB 3AZEC 1P3LA 5GT0C 5B1LA 5AVBA 3C1BA 2BYMB 2FJ7B 5AVCC
chains in the Genus database with same CATH topology
3LELB 2Y2GA 1ULYA 1BH8B 3MGSC 3RELD 5BNXB 3X1UA 1PZRA 3B0CW 3A1IA 3AZJD 2F2AC 4J8VD 5DNNA 1M18C 3AZKC 5AV5D 3REJC 5AV9D 3W98D 2DF4C 4WJ3C 1M1AB 3MGQD 1P3OB 1M19A 3B6FC 3X1SC 3LZ1D 3AZIC 4Z5TA 3UTBC 1P34B 5B2ID 5AV6D 1HTAA 4QLCD 2AROA 5B24A 3X1VA 1KX5D 3W99B 2HUEB 3C1CA 2XD5A 3FDDA 3MVDB 1JFIA 3AZLA 4XZQC 3O62A 1N1JB 3WTPE 5B2JB 5B1MB 3X1TB 4AWLB 2FFFB 4XUJB 4E45A 5GT3D 3WKJA 3LJAB 3LELC 1P3BD 1F66B 5FUGA 2HIOB 3KXBD 3AZFB 3NQJA 3AZHA 5B31C 4KGCD 3REHB 3AZED 5GT0D 5BNVB 4LD9A 4JJNB 3REIA 5AVCD 1P3MB 4X23A 3RELB 1P3OC 3R45B 3MGSD 3V9RB 1P34C 3AZJB 3LZ0B 5AV5B 5AV9B 1M18D 5B0ZA 3AZKD 3REJD 3KWQA 3UTAA 4H9SA 3AV1B 1KX4B 2HUEC 3B0CT 2LY8A 2BYKB 3MVDC 1F1EA 4WU9A 5CPJA 5JRGB 2YFWA 2NQBA 1U35B 3B6FD 3X1SD 3AZID 1P3FC 3UTBD 2Y2KA 4ZBJC 5B2JC 4QLCB 5B1MC 3X1TC 4H9RB 4G91C 4XUJC 5JA4A 1ZLAB 3AZMA 3AFAA 5GXQA 3AYWB 2HIOC 2Y2LA 3B0DB 4CAYB 4KUDA 4XZQD 3REHC 3KSYA 4YM6C 1BH9A 3UT9A 5AV8C 4JJNC 1T3UA 1P3MC 2PYOB 1TZYA 3LELD 4J8UC 4KGCB 1S32B 4CSRB 1P3AB 5B31D 3LZ0C 2F8NK 1P3IB 4ZUXA 1KX4C 4UPKA 3AV1C 5DNMC 3EPKA 3VH6W 5JRGC 1P3OD 1U35C 1P3KA 3LZ1A 5B33A 5E5AB 3AN2C 1P34D 5B2IA 5AV6A 1M18B 3AZKB 1ZLAC 1P3LB 3WTPA 3KUYA 1KX5A 3AYWC 3B0DC 3AV2B 2J8PA 1EQZC 3MVDD 3UTBB 4Z2MH 1P3FD 2Y2IA 5B2JD 3A6NC 5B1MD 3X1TD 4XUJD 3IP4C 2PYOC 1P3BA 4WNNB 2Y2QA 2UWXA 3KXBA 2HIOD 3B6GC 3VH5W 4J8XB 1S32C 1P3AC 4WV4B 5KDMA 3AZEA 3REHD 5GT0A 4YM6D 4H9NA 1P3IC 2DQNC 3MGPA 5AV8D 4JJND 5AVCA 1P3MD 4J8UD 5B31B 5B24B 3X1VB 5E5AC 4UUZB 3MGSA 3C1CB 3LZ0D 3EPLA 5B40A 1P3LC 5AVBC 2VQRA 3REJA 1KX4D 3AV2C 5DNMD 3AV1D 4KHAB 3AZNA 3WAAB 5JRGD 3B6FA 1U35D 5B31G 3AZIA 3AN2D 3NQJB 4M6BA 5BO0B 3NQUB 1ZLAD 3REKA 5B32B 1W2EA 1P3PB 1HQ3B 3AYWD 1KX3A 1EQZD 4J8XC 1P3FB 4ZBJB 3W97B 3MNNB 4G91B 4Z5TC 3A6ND 5CP6B 2CV5B 1P3GB 2FJ7A 2PYOD 3LELA 2CWEA 5BT1C 5B24C 3X1VC 3KWQB 3B6GD 4H9PB 1S32D 5BNXA 4HGAB 4YM6B 3C1CC 1P3AD 4WU9B 2NZDA 3AZGA 5AV8B 2NQBB 3VH5T 3O62C 1P3ID 3VH5A 4J8UB 1B6WA 4DQYB 1Q9CA 5G49A 5JA4B 3WAAC 1M1AA 1ID3B 4Z66B 1P3OA 5E5AD 1P34A 5GSUB 1AOIA 2Y2JA 4YS3B 5DNMB 1P3LD 1WWIA 5B32C 4R8PA 1BH9B 1P3PC 5AVBD 3W99A 1HQ3C 5CPKA 3AV2D 2Y2HA 3MVDA 4LD9C 3AN2B 3W97C 1TZYB 3MNNC 5CPIB 3H0RC 5BS7A 5B2JA 5AY8B 5B1MA 5CP6C 1WWSA 5F99B 2CV5C 1P3GC 3LJAA 1EQZB 1F66A 2F8NB 3TU4A 4ZUXB 3AZFA 3KWQC 4H9SC 4J8XD 4HGAC 4WU9C 3A6NB 3REHA 2NQBC 4H9QB 4Z5TD 3H0LC 5BNVA 3H0MC 4JJNA 5B0YB 4H9OB 1P3MA 2JE5A 3RELA 3B6GB 3MGRB 2ZY5A 5BT1D 4Z66C 3WTPB 5B24D 3AZMC 3X1VD 1ID3C 3AFAC 1BFMA 2YFVA 3R45A 3V9RA 4G92B 3AZJA 3C1CD 2G5IC 4J8VA 5GSUC 3LZ0A 5AV5A 5AV9A 4YS3C 4NE6A 3W98A 3O62D 3UT9C 3MGQA 3AV1A 3WA9B 3W96B 2BYKA 4WU8B 3WAAD 1H3OA 5JRGA 1TZYC 1R4VA 1U35A 5CPIC 1TAFB 4QLCA 5AY8C 4H9RA 5B1LB 5AVBB 3C1BB 5F99C 1ZLAA 5B32D 1P3PD 2IO5B 1HQ3D 4ZUXC 4CAYA 4J8WB 3AYWA 4J8WA 4LD9D 3W97D 3MNND 3X1UB 5GT3A 1P3KC 5B33C 5CP6D 5DNNB 2CV5D 1P3GD 5B0YC 1Z2CB 4NE5A 2PYOA 3MGRC 3WTPC 3KUYC 4DRAA 4KGCA 4NE3A 3KWQD 1M19B 4G92C 4WU9D 4Z5TB 2NQBD 1P3IA 2RVQC 4WZSB 2AROB 3WA9C 3W96C 4WU8C 3REKB 1ID3D 4Z66D 3AZMD 1JFIB 3AFAD 3AZLB 5E5AA 3EPHA 1M18A 2RIQA 3O62B 5GSUD 2ZM5A 5B1LC 3AZKA 4EO5B 3C1BC 3P5JB 4YS3D 3WKJB 2IO5C 4J8WC 3MGPC 3UT9D 3AV2A 5FUGB 3X1SA 3UTBA 2ZY3A 3VH6T 1TZYD 3AZHB 3VH6A 5CPID 3X1UC 2JSSA 5AY8D 5DNNC 2NZDB 3AZGB 5F99D 5B40C 2Y2NA 3EG5B 2G5HC 4WNNA 4LD9B 3REIB 2F8ND 5C3IB 4ZUXD 4X23B 4XZQA 2ZY2A 4J8XA 1M19C 3B0BA 5G49B 3AZNC 1P3KD 2BYMA 5B33D 5B32G 2AROC 5B0ZB 5B0YD 1AOIB 3UTAB 1BH8A 3MGRD 3REKC 5B31A 3WTPD 3KUYD 4R8PB 5CPJB 3AZLC 5CPKB 4UUZA 2YFWB 1KX3C 4EO5C 2JCHA 2L5AA 2Y2MA 2RVQD 3WKJC 2ZY4A 3AZMB 3WA9D 4KHAA 5GXQB 3AFAB 4WU8D 3W96D 3WAAA 2FJ7C 2W8SA 3AZHC 3TU4B 4KUDB 2XD1A 5B1LD 3NQUA 5BO0A 3C1BD 3UT9B 3AZGC 2NZDC 5B32A 3REIC 1P3PA 1HQ3A 5C3IC 3MGPD 4X23C 4J8WD 1N1JA 1P3FA 3W97A 3X1TA 1M1AC 3MNNA 4XUJA 3X1UD 1B67A 2YFVB 5CP6A 4J8VB 5DNND 5B0ZC 2CV5A 2HIOA 1P3GA 1AOIC 3UTAC 5B40D 3W98B 4R8PC 5CPJC 3W99C 5CPKC 4H9PA 3MGQB 1M19D 4YM6A 1P3KB 3LZ1B 5B33B 3AZND 5B2IB 5AV6B 1H3OB 2Y2OA 5AV8A 5BS7C 4J8UA 1KU5A 3EPJA 2AROD 3KUYB 4AWLC 2F8NG 1KX5B 5GXQC 3LJAC 2Y2PA 3REKD 4Z66A 1ID3A 3F6TA 1F66C 3TU4C 3AZLD 4KUDC 3AZFC 1KX3D 2F8NH 5GSUA 3A1KA 1KX4A 5CHLB 4YS3A 5DNMA 5GT3B 3WKJD 1P3BB 3KXBB 3AN2A 3KFUG 2FJ7D 3RELC 3AZHD 5CPIA 1A7WA 5KDMB 3AZEB 5AY8A 5GT0B 3AZJC 4J8VC 4H9NB 2NZDD 5F99A 3MGPB 3AZGD 5AV5C 5AV9C 1EQZA 3W98C 3REID 2F8NA 5AVCB 4X23D 3MGQC 3LZ1C 3MGSB 3A6NA 1M1AD 5B2IC 5AV6C 4H9QA 5B40B 4QLCC 5B0ZD 5B0YA 3REJB 1KX5C 4H9OA 3UTAD 1AOID 4Z2MG 1S32A 4CSRA 3MGRA 1P3AA 3B6GA 4R8PD 3AZNB 5CPJD 3W99D 5CPKD 3B6FB 3X1SB 3AZIB 2BG1A 4E44A 5GT3C 1P3BC 3WA9A 3W96A 5GXQD 4WU8A 3KXBC 3LJAD 1KX3B 1F66D 4DRBA 3AL0C 3TU4D 1TAFA 4KGCC 4KUDD 3AZFD 4NFTA 4XZQB 3AZEC 1P3LA 5GT0C 5B1LA 5AVBA 3C1BA 2BYMB 2FJ7B 5AVCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEL B;  1ULY A;  1BH8 B;  3MGS C;  3REL D;  5BNX B;  3X1U A;  3B0C W;  3AZJ D;  4J8V D;  1M18 C;  5DNN A;  3AZK C;  5AV5 D;  3REJ C;  5AV9 D;  3W98 D;  1M1A B;  3MGQ D;  1P3O B;  1M19 A;  3B6F C;  3X1S C;  3LZ1 D;  3AZI C;  4Z5T A;  3UTB C;  1P34 B;  5B2I D;  5AV6 D;  1HTA A;  4QLC D;  2ARO A;  5B24 A;  3X1V A;  1KX5 D;  3W99 B;  2HUE B;  3C1C A;  3MVD B;  1JFI A;  3AZL A;  4XZQ C;  3O62 A;  1N1J B;  3WTP E;  5B2J B;  5B1M B;  3X1T B;  4AWL B;  4XUJ B;  4E45 A;  5GT3 D;  3WKJ A;  3LJA B;  3LEL C;  1P3B D;  1F66 B;  5FUG A;  2HIO B;  3KXB D;  3AZF B;  3NQJ A;  3AZH A;  5B31 C;  4KGC D;  3REH B;  3AZE D;  5GT0 D;  5BNV B;  4LD9 A;  4JJN B;  3REI A;  5AVC D;  1P3M B;  4X23 A;  3REL B;  1P3O C;  3R45 B;  3MGS D;  3V9R B;  1P34 C;  3AZJ B;  3LZ0 B;  5AV5 B;  5AV9 B;  1M18 D;  5B0Z A;  3AZK D;  3REJ D;  3KWQ A;  3UTA A;  4H9S A;  3AV1 B;  1KX4 B;  2HUE C;  3B0C T;  2LY8 A;  2BYK B;  3MVD C;  1F1E A;  4WU9 A;  5CPJ A;  5JRG B;  2YFW A;  2NQB A;  1U35 B;  3B6F D;  3X1S D;  3AZI D;  1P3F C;  3UTB D;  4QLC B;  4ZBJ C;  5B2J C;  5B1M C;  3X1T C;  4H9R B;  4G91 C;  4XUJ C;  5JA4 A;  1ZLA B;  3AZM A;  3AFA A;  5GXQ A;  3AYW B;  2HIO C;  3B0D B;  4CAY B;  4KUD A;  4XZQ D;  3REH C;  3KSY A;  4YM6 C;  1BH9 A;  3UT9 A;  5AV8 C;  4JJN C;  1P3M C;  2PYO B;  1TZY A;  3LEL D;  4J8U C;  4KGC B;  1S32 B;  4CSR B;  1P3A B;  5B31 D;  3LZ0 C;  2F8N K;  1P3I B;  4ZUX A;  1KX4 C;  3AV1 C;  5DNM C;  3VH6 W;  5JRG C;  1P3O D;  1U35 C;  1P3K A;  3LZ1 A;  5B33 A;  5E5A B;  3AN2 C;  1P34 D;  5B2I A;  5AV6 A;  1M18 B;  3AZK B;  1ZLA C;  1P3L B;  3WTP A;  3KUY A;  1KX5 A;  3AYW C;  3B0D C;  3AV2 B;  1EQZ C;  3MVD D;  3UTB B;  4Z2M H;  1P3F D;  5B2J D;  3A6N C;  5B1M D;  3X1T D;  4XUJ D;  2PYO C;  1P3B A;  4WNN B;  3KXB A;  2HIO D;  3B6G C;  3VH5 W;  4J8X B;  1S32 C;  1P3A C;  4WV4 B;  5KDM A;  3AZE A;  3REH D;  5GT0 A;  4YM6 D;  4H9N A;  1P3I C;  3MGP A;  5AV8 D;  4JJN D;  5AVC A;  1P3M D;  4J8U D;  5B31 B;  5B24 B;  3X1V B;  5E5A C;  4UUZ B;  3MGS A;  3C1C B;  3LZ0 D;  5B40 A;  1P3L C;  5AVB C;  3REJ A;  1KX4 D;  3AV2 C;  5DNM D;  3AV1 D;  4KHA B;  3AZN A;  3WAA B;  5JRG D;  3B6F A;  1U35 D;  5B31 G;  3AZI A;  3AN2 D;  3NQJ B;  4M6B A;  5BO0 B;  3NQU B;  1ZLA D;  3REK A;  5B32 B;  1P3P B;  1HQ3 B;  3AYW D;  1KX3 A;  1EQZ D;  4J8X C;  1P3F B;  4ZBJ B;  3W97 B;  3MNN B;  4G91 B;  4Z5T C;  3A6N D;  5CP6 B;  2CV5 B;  1P3G B;  2FJ7 A;  2PYO D;  3LEL A;  2CWE A;  5BT1 C;  5B24 C;  3X1V C;  3KWQ B;  3B6G D;  4H9P B;  1S32 D;  5BNX A;  4HGA B;  4YM6 B;  3C1C C;  1P3A D;  4WU9 B;  2NZD A;  3AZG A;  5AV8 B;  2NQB B;  3VH5 T;  3O62 C;  1P3I D;  3VH5 A;  4J8U B;  1B6W A;  1Q9C A;  5G49 A;  5JA4 B;  3WAA C;  1M1A A;  1ID3 B;  4Z66 B;  1P3O A;  5E5A D;  1P34 A;  5GSU B;  1AOI A;  4YS3 B;  5DNM B;  1P3L D;  1WWI A;  5B32 C;  4R8P A;  1BH9 B;  1P3P C;  5AVB D;  3W99 A;  1HQ3 C;  5CPK A;  3AV2 D;  3MVD A;  4LD9 C;  3AN2 B;  3W97 C;  1TZY B;  3MNN C;  5CPI B;  5BS7 A;  5B2J A;  5AY8 B;  5B1M A;  5CP6 C;  1WWS A;  5F99 B;  2CV5 C;  1P3G C;  3LJA A;  1EQZ B;  1F66 A;  2F8N B;  3TU4 A;  4ZUX B;  3AZF A;  3KWQ C;  4H9S C;  4J8X D;  4HGA C;  4WU9 C;  3A6N B;  3REH A;  2NQB C;  4H9Q B;  4Z5T D;  5BNV A;  4JJN A;  5B0Y B;  4H9O B;  1P3M A;  3B6G B;  3REL A;  3MGR B;  1ID3 C;  5BT1 D;  4Z66 C;  3WTP B;  5B24 D;  3AZM C;  3X1V D;  1BFM A;  3AFA C;  2YFV A;  3R45 A;  3V9R A;  4G92 B;  3AZJ A;  3C1C D;  4J8V A;  5GSU C;  3LZ0 A;  5AV5 A;  5AV9 A;  4YS3 C;  4NE6 A;  3W98 A;  3O62 D;  3UT9 C;  3MGQ A;  3AV1 A;  3WA9 B;  3W96 B;  2BYK A;  4WU8 B;  3WAA D;  1H3O A;  5JRG A;  1TZY C;  1R4V A;  1U35 A;  5CPI C;  1TAF B;  4QLC A;  5AY8 C;  4H9R A;  5B1L B;  5AVB B;  3C1B B;  5F99 C;  1ZLA A;  5B32 D;  1P3P D;  2IO5 B;  1HQ3 D;  4ZUX C;  4CAY A;  4J8W B;  3AYW A;  4J8W A;  4LD9 D;  3W97 D;  3MNN D;  3X1U B;  5GT3 A;  1P3K C;  5B33 C;  5CP6 D;  5DNN B;  2CV5 D;  1P3G D;  5B0Y C;  4NE5 A;  2PYO A;  3MGR C;  3WTP C;  3KUY C;  4DRA A;  4KGC A;  4NE3 A;  3KWQ D;  1M19 B;  4G92 C;  4WU9 D;  4Z5T B;  2NQB D;  1P3I A;  2RVQ C;  4WZS B;  2ARO B;  3WA9 C;  3W96 C;  4WU8 C;  3REK B;  1ID3 D;  4Z66 D;  3AZM D;  1JFI B;  3AFA D;  3AZL B;  5E5A A;  1M18 A;  3O62 B;  5GSU D;  5B1L C;  3AZK A;  4EO5 B;  3C1B C;  4YS3 D;  3WKJ B;  2IO5 C;  4J8W C;  3MGP C;  3UT9 D;  3AV2 A;  5FUG B;  3X1S A;  3UTB A;  3VH6 T;  1TZY D;  3AZH B;  3VH6 A;  5CPI D;  3X1U C;  2JSS A;  5AY8 D;  5DNN C;  2NZD B;  3AZG B;  5F99 D;  5B40 C;  4WNN A;  4LD9 B;  3REI B;  2F8N D;  5C3I B;  4ZUX D;  4X23 B;  4XZQ A;  4J8X A;  1M19 C;  3B0B A;  5G49 B;  3AZN C;  1P3K D;  2BYM A;  5B33 D;  5B32 G;  2ARO C;  5B0Z B;  5B0Y D;  1AOI B;  3UTA B;  1BH8 A;  3MGR D;  3REK C;  5B31 A;  3WTP D;  3KUY D;  4R8P B;  5CPJ B;  3AZL C;  5CPK B;  4UUZ A;  2YFW B;  1KX3 C;  4EO5 C;  2L5A A;  2RVQ D;  3WKJ C;  3AZM B;  3WA9 D;  4KHA A;  5GXQ B;  3AFA B;  4WU8 D;  3W96 D;  3WAA A;  2FJ7 C;  3AZH C;  3TU4 B;  4KUD B;  5B1L D;  5BO0 A;  3NQU A;  2NZD C;  3C1B D;  3UT9 B;  3AZG C;  5B32 A;  3REI C;  1P3P A;  1HQ3 A;  5C3I C;  3MGP D;  4X23 C;  4J8W D;  1N1J A;  1P3F A;  3W97 A;  3X1T A;  1M1A C;  3MNN A;  4XUJ A;  3X1U D;  2YFV B;  1B67 A;  5CP6 A;  4J8V B;  5DNN D;  5B0Z C;  2CV5 A;  2HIO A;  1P3G A;  1AOI C;  3UTA C;  5B40 D;  3W98 B;  4R8P C;  5CPJ C;  3W99 C;  5CPK C;  4H9P A;  3MGQ B;  1M19 D;  4YM6 A;  1P3K B;  3LZ1 B;  5B33 B;  3AZN D;  5B2I B;  1H3O B;  5AV8 A;  5AV6 B;  5BS7 C;  4J8U A;  1KU5 A;  2ARO D;  3KUY B;  4AWL C;  2F8N G;  1KX5 B;  5GXQ C;  3LJA C;  3REK D;  1ID3 A;  4Z66 A;  1F66 C;  3TU4 C;  3AZL D;  4KUD C;  3AZF C;  1KX3 D;  2F8N H;  5GSU A;  1KX4 A;  5CHL B;  4YS3 A;  5DNM A;  5GT3 B;  3WKJ D;  1P3B B;  3KXB B;  3AN2 A;  2FJ7 D;  3REL C;  3AZH D;  5CPI A;  1A7W A;  5KDM B;  3AZE B;  5AY8 A;  5GT0 B;  3AZJ C;  4J8V C;  4H9N B;  2NZD D;  5F99 A;  3MGP B;  3AZG D;  5AV5 C;  5AV9 C;  1EQZ A;  3W98 C;  3REI D;  2F8N A;  5AVC B;  4X23 D;  3MGQ C;  3LZ1 C;  3MGS B;  3A6N A;  1M1A D;  5B2I C;  5AV6 C;  4H9Q A;  5B40 B;  4QLC C;  5B0Z D;  5B0Y A;  3REJ B;  1KX5 C;  4H9O A;  3UTA D;  1AOI D;  4Z2M G;  1S32 A;  4CSR A;  3MGR A;  1P3A A;  3B6G A;  4R8P D;  3AZN B;  5CPJ D;  3W99 D;  5CPK D;  3B6F B;  3X1S B;  3AZI B;  4E44 A;  5GT3 C;  1P3B C;  3WA9 A;  3W96 A;  5GXQ D;  4WU8 A;  3KXB C;  3LJA D;  1KX3 B;  1F66 D;  4DRB A;  3TU4 D;  1TAF A;  4KGC C;  4KUD D;  3AZF D;  4NFT A;  4XZQ B;  3AZE C;  1P3L A;  5GT0 C;  5B1L A;  5AVB A;  3C1B A;  2BYM B;  2FJ7 B;  5AVC C; 
#chains in the Genus database with same CATH topology
 3LEL B;  2Y2G A;  1ULY A;  1BH8 B;  3MGS C;  3REL D;  5BNX B;  3X1U A;  1PZR A;  3B0C W;  3A1I A;  3AZJ D;  2F2A C;  4J8V D;  5DNN A;  1M18 C;  3AZK C;  5AV5 D;  3REJ C;  5AV9 D;  3W98 D;  2DF4 C;  4WJ3 C;  1M1A B;  3MGQ D;  1P3O B;  1M19 A;  3B6F C;  3X1S C;  3LZ1 D;  3AZI C;  4Z5T A;  3UTB C;  1P34 B;  5B2I D;  5AV6 D;  1HTA A;  4QLC D;  2ARO A;  5B24 A;  3X1V A;  1KX5 D;  3W99 B;  2HUE B;  3C1C A;  2XD5 A;  3FDD A;  3MVD B;  1JFI A;  3AZL A;  4XZQ C;  3O62 A;  1N1J B;  3WTP E;  5B2J B;  5B1M B;  3X1T B;  4AWL B;  2FFF B;  4XUJ B;  4E45 A;  5GT3 D;  3WKJ A;  3LJA B;  3LEL C;  1P3B D;  1F66 B;  5FUG A;  2HIO B;  3KXB D;  3AZF B;  3NQJ A;  3AZH A;  5B31 C;  4KGC D;  3REH B;  3AZE D;  5GT0 D;  5BNV B;  4LD9 A;  4JJN B;  3REI A;  5AVC D;  1P3M B;  4X23 A;  3REL B;  1P3O C;  3R45 B;  3MGS D;  3V9R B;  1P34 C;  3AZJ B;  3LZ0 B;  5AV5 B;  5AV9 B;  1M18 D;  5B0Z A;  3AZK D;  3REJ D;  3KWQ A;  3UTA A;  4H9S A;  3AV1 B;  1KX4 B;  2HUE C;  3B0C T;  2LY8 A;  2BYK B;  3MVD C;  1F1E A;  4WU9 A;  5CPJ A;  5JRG B;  2YFW A;  2NQB A;  1U35 B;  3B6F D;  3X1S D;  3AZI D;  1P3F C;  3UTB D;  2Y2K A;  4ZBJ C;  5B2J C;  4QLC B;  5B1M C;  3X1T C;  4H9R B;  4G91 C;  4XUJ C;  5JA4 A;  1ZLA B;  3AZM A;  3AFA A;  5GXQ A;  3AYW B;  2HIO C;  2Y2L A;  3B0D B;  4CAY B;  4KUD A;  4XZQ D;  3REH C;  3KSY A;  4YM6 C;  1BH9 A;  3UT9 A;  5AV8 C;  4JJN C;  1T3U A;  1P3M C;  2PYO B;  1TZY A;  3LEL D;  4J8U C;  4KGC B;  1S32 B;  4CSR B;  1P3A B;  5B31 D;  3LZ0 C;  2F8N K;  1P3I B;  4ZUX A;  1KX4 C;  4UPK A;  3AV1 C;  5DNM C;  3EPK A;  3VH6 W;  5JRG C;  1P3O D;  1U35 C;  1P3K A;  3LZ1 A;  5B33 A;  5E5A B;  3AN2 C;  1P34 D;  5B2I A;  5AV6 A;  1M18 B;  3AZK B;  1ZLA C;  1P3L B;  3WTP A;  3KUY A;  1KX5 A;  3AYW C;  3B0D C;  3AV2 B;  2J8P A;  1EQZ C;  3MVD D;  3UTB B;  4Z2M H;  1P3F D;  2Y2I A;  5B2J D;  3A6N C;  5B1M D;  3X1T D;  4XUJ D;  3IP4 C;  2PYO C;  1P3B A;  4WNN B;  2Y2Q A;  2UWX A;  3KXB A;  2HIO D;  3B6G C;  3VH5 W;  4J8X B;  1S32 C;  1P3A C;  4WV4 B;  5KDM A;  3AZE A;  3REH D;  5GT0 A;  4YM6 D;  4H9N A;  1P3I C;  2DQN C;  3MGP A;  5AV8 D;  4JJN D;  5AVC A;  1P3M D;  4J8U D;  5B31 B;  5B24 B;  3X1V B;  5E5A C;  4UUZ B;  3MGS A;  3C1C B;  3LZ0 D;  3EPL A;  5B40 A;  1P3L C;  5AVB C;  2VQR A;  3REJ A;  1KX4 D;  3AV2 C;  5DNM D;  3AV1 D;  4KHA B;  3AZN A;  3WAA B;  5JRG D;  3B6F A;  1U35 D;  5B31 G;  3AZI A;  3AN2 D;  3NQJ B;  4M6B A;  5BO0 B;  3NQU B;  1ZLA D;  3REK A;  5B32 B;  1W2E A;  1P3P B;  1HQ3 B;  3AYW D;  1KX3 A;  1EQZ D;  4J8X C;  1P3F B;  4ZBJ B;  3W97 B;  3MNN B;  4G91 B;  4Z5T C;  3A6N D;  5CP6 B;  2CV5 B;  1P3G B;  2FJ7 A;  2PYO D;  3LEL A;  2CWE A;  5BT1 C;  5B24 C;  3X1V C;  3KWQ B;  3B6G D;  4H9P B;  1S32 D;  5BNX A;  4HGA B;  4YM6 B;  3C1C C;  1P3A D;  4WU9 B;  2NZD A;  3AZG A;  5AV8 B;  2NQB B;  3VH5 T;  3O62 C;  1P3I D;  3VH5 A;  4J8U B;  1B6W A;  4DQY B;  1Q9C A;  5G49 A;  5JA4 B;  3WAA C;  1M1A A;  1ID3 B;  4Z66 B;  1P3O A;  5E5A D;  1P34 A;  5GSU B;  1AOI A;  2Y2J A;  4YS3 B;  5DNM B;  1P3L D;  1WWI A;  5B32 C;  4R8P A;  1BH9 B;  1P3P C;  5AVB D;  3W99 A;  1HQ3 C;  5CPK A;  3AV2 D;  2Y2H A;  3MVD A;  4LD9 C;  3AN2 B;  3W97 C;  1TZY B;  3MNN C;  5CPI B;  3H0R C;  5BS7 A;  5B2J A;  5AY8 B;  5B1M A;  5CP6 C;  1WWS A;  5F99 B;  2CV5 C;  1P3G C;  3LJA A;  1EQZ B;  1F66 A;  2F8N B;  3TU4 A;  4ZUX B;  3AZF A;  3KWQ C;  4H9S C;  4J8X D;  4HGA C;  4WU9 C;  3A6N B;  3REH A;  2NQB C;  4H9Q B;  4Z5T D;  3H0L C;  5BNV A;  3H0M C;  4JJN A;  5B0Y B;  4H9O B;  1P3M A;  2JE5 A;  3REL A;  3B6G B;  3MGR B;  2ZY5 A;  5BT1 D;  4Z66 C;  3WTP B;  5B24 D;  3AZM C;  3X1V D;  1ID3 C;  3AFA C;  1BFM A;  2YFV A;  3R45 A;  3V9R A;  4G92 B;  3AZJ A;  3C1C D;  2G5I C;  4J8V A;  5GSU C;  3LZ0 A;  5AV5 A;  5AV9 A;  4YS3 C;  4NE6 A;  3W98 A;  3O62 D;  3UT9 C;  3MGQ A;  3AV1 A;  3WA9 B;  3W96 B;  2BYK A;  4WU8 B;  3WAA D;  1H3O A;  5JRG A;  1TZY C;  1R4V A;  1U35 A;  5CPI C;  1TAF B;  4QLC A;  5AY8 C;  4H9R A;  5B1L B;  5AVB B;  3C1B B;  5F99 C;  1ZLA A;  5B32 D;  1P3P D;  2IO5 B;  1HQ3 D;  4ZUX C;  4CAY A;  4J8W B;  3AYW A;  4J8W A;  4LD9 D;  3W97 D;  3MNN D;  3X1U B;  5GT3 A;  1P3K C;  5B33 C;  5CP6 D;  5DNN B;  2CV5 D;  1P3G D;  5B0Y C;  1Z2C B;  4NE5 A;  2PYO A;  3MGR C;  3WTP C;  3KUY C;  4DRA A;  4KGC A;  4NE3 A;  3KWQ D;  1M19 B;  4G92 C;  4WU9 D;  4Z5T B;  2NQB D;  1P3I A;  2RVQ C;  4WZS B;  2ARO B;  3WA9 C;  3W96 C;  4WU8 C;  3REK B;  1ID3 D;  4Z66 D;  3AZM D;  1JFI B;  3AFA D;  3AZL B;  5E5A A;  3EPH A;  1M18 A;  2RIQ A;  3O62 B;  5GSU D;  2ZM5 A;  5B1L C;  3AZK A;  4EO5 B;  3C1B C;  3P5J B;  4YS3 D;  3WKJ B;  2IO5 C;  4J8W C;  3MGP C;  3UT9 D;  3AV2 A;  5FUG B;  3X1S A;  3UTB A;  2ZY3 A;  3VH6 T;  1TZY D;  3AZH B;  3VH6 A;  5CPI D;  3X1U C;  2JSS A;  5AY8 D;  5DNN C;  2NZD B;  3AZG B;  5F99 D;  5B40 C;  2Y2N A;  3EG5 B;  2G5H C;  4WNN A;  4LD9 B;  3REI B;  2F8N D;  5C3I B;  4ZUX D;  4X23 B;  4XZQ A;  2ZY2 A;  4J8X A;  1M19 C;  3B0B A;  5G49 B;  3AZN C;  1P3K D;  2BYM A;  5B33 D;  5B32 G;  2ARO C;  5B0Z B;  5B0Y D;  1AOI B;  3UTA B;  1BH8 A;  3MGR D;  3REK C;  5B31 A;  3WTP D;  3KUY D;  4R8P B;  5CPJ B;  3AZL C;  5CPK B;  4UUZ A;  2YFW B;  1KX3 C;  4EO5 C;  2JCH A;  2L5A A;  2Y2M A;  2RVQ D;  3WKJ C;  2ZY4 A;  3AZM B;  3WA9 D;  4KHA A;  5GXQ B;  3AFA B;  4WU8 D;  3W96 D;  3WAA A;  2FJ7 C;  2W8S A;  3AZH C;  3TU4 B;  4KUD B;  2XD1 A;  5B1L D;  3NQU A;  5BO0 A;  3C1B D;  3UT9 B;  3AZG C;  2NZD C;  5B32 A;  3REI C;  1P3P A;  1HQ3 A;  5C3I C;  3MGP D;  4X23 C;  4J8W D;  1N1J A;  1P3F A;  3W97 A;  3X1T A;  1M1A C;  3MNN A;  4XUJ A;  3X1U D;  1B67 A;  2YFV B;  5CP6 A;  4J8V B;  5DNN D;  5B0Z C;  2CV5 A;  2HIO A;  1P3G A;  1AOI C;  3UTA C;  5B40 D;  3W98 B;  4R8P C;  5CPJ C;  3W99 C;  5CPK C;  4H9P A;  3MGQ B;  1M19 D;  4YM6 A;  1P3K B;  3LZ1 B;  5B33 B;  3AZN D;  5B2I B;  5AV6 B;  1H3O B;  2Y2O A;  5AV8 A;  5BS7 C;  4J8U A;  1KU5 A;  3EPJ A;  2ARO D;  3KUY B;  4AWL C;  2F8N G;  1KX5 B;  5GXQ C;  3LJA C;  2Y2P A;  3REK D;  4Z66 A;  1ID3 A;  3F6T A;  1F66 C;  3TU4 C;  3AZL D;  4KUD C;  3AZF C;  1KX3 D;  2F8N H;  5GSU A;  3A1K A;  1KX4 A;  5CHL B;  4YS3 A;  5DNM A;  5GT3 B;  3WKJ D;  1P3B B;  3KXB B;  3AN2 A;  3KFU G;  2FJ7 D;  3REL C;  3AZH D;  5CPI A;  1A7W A;  5KDM B;  3AZE B;  5AY8 A;  5GT0 B;  3AZJ C;  4J8V C;  4H9N B;  2NZD D;  5F99 A;  3MGP B;  3AZG D;  5AV5 C;  5AV9 C;  1EQZ A;  3W98 C;  3REI D;  2F8N A;  5AVC B;  4X23 D;  3MGQ C;  3LZ1 C;  3MGS B;  3A6N A;  1M1A D;  5B2I C;  5AV6 C;  4H9Q A;  5B40 B;  4QLC C;  5B0Z D;  5B0Y A;  3REJ B;  1KX5 C;  4H9O A;  3UTA D;  1AOI D;  4Z2M G;  1S32 A;  4CSR A;  3MGR A;  1P3A A;  3B6G A;  4R8P D;  3AZN B;  5CPJ D;  3W99 D;  5CPK D;  3B6F B;  3X1S B;  3AZI B;  2BG1 A;  4E44 A;  5GT3 C;  1P3B C;  3WA9 A;  3W96 A;  5GXQ D;  4WU8 A;  3KXB C;  3LJA D;  1KX3 B;  1F66 D;  4DRB A;  3AL0 C;  3TU4 D;  1TAF A;  4KGC C;  4KUD D;  3AZF D;  4NFT A;  4XZQ B;  3AZE C;  1P3L A;  5GT0 C;  5B1L A;  5AVB A;  3C1B A;  2BYM B;  2FJ7 B;  5AVC C; 
#chains in the Genus database with same CATH homology
 3LEL B;  2Y2G A;  1ULY A;  1BH8 B;  3MGS C;  3REL D;  5BNX B;  3X1U A;  1PZR A;  3B0C W;  3A1I A;  3AZJ D;  2F2A C;  4J8V D;  5DNN A;  1M18 C;  3AZK C;  5AV5 D;  3REJ C;  5AV9 D;  3W98 D;  2DF4 C;  4WJ3 C;  1M1A B;  3MGQ D;  1P3O B;  1M19 A;  3B6F C;  3X1S C;  3LZ1 D;  3AZI C;  4Z5T A;  3UTB C;  1P34 B;  5B2I D;  5AV6 D;  1HTA A;  4QLC D;  2ARO A;  5B24 A;  3X1V A;  1KX5 D;  3W99 B;  2HUE B;  3C1C A;  2XD5 A;  3FDD A;  3MVD B;  1JFI A;  3AZL A;  4XZQ C;  3O62 A;  1N1J B;  3WTP E;  5B2J B;  5B1M B;  3X1T B;  4AWL B;  2FFF B;  4XUJ B;  4E45 A;  5GT3 D;  3WKJ A;  3LJA B;  3LEL C;  1P3B D;  1F66 B;  5FUG A;  2HIO B;  3KXB D;  3AZF B;  3NQJ A;  3AZH A;  5B31 C;  4KGC D;  3REH B;  3AZE D;  5GT0 D;  5BNV B;  4LD9 A;  4JJN B;  3REI A;  5AVC D;  1P3M B;  4X23 A;  3REL B;  1P3O C;  3R45 B;  3MGS D;  3V9R B;  1P34 C;  3AZJ B;  3LZ0 B;  5AV5 B;  5AV9 B;  1M18 D;  5B0Z A;  3AZK D;  3REJ D;  3KWQ A;  3UTA A;  4H9S A;  3AV1 B;  1KX4 B;  2HUE C;  3B0C T;  2LY8 A;  2BYK B;  3MVD C;  1F1E A;  4WU9 A;  5CPJ A;  5JRG B;  2YFW A;  2NQB A;  1U35 B;  3B6F D;  3X1S D;  3AZI D;  1P3F C;  3UTB D;  2Y2K A;  4ZBJ C;  5B2J C;  4QLC B;  5B1M C;  3X1T C;  4H9R B;  4G91 C;  4XUJ C;  5JA4 A;  1ZLA B;  3AZM A;  3AFA A;  5GXQ A;  3AYW B;  2HIO C;  2Y2L A;  3B0D B;  4CAY B;  4KUD A;  4XZQ D;  3REH C;  3KSY A;  4YM6 C;  1BH9 A;  3UT9 A;  5AV8 C;  4JJN C;  1T3U A;  1P3M C;  2PYO B;  1TZY A;  3LEL D;  4J8U C;  4KGC B;  1S32 B;  4CSR B;  1P3A B;  5B31 D;  3LZ0 C;  2F8N K;  1P3I B;  4ZUX A;  1KX4 C;  4UPK A;  3AV1 C;  5DNM C;  3EPK A;  3VH6 W;  5JRG C;  1P3O D;  1U35 C;  1P3K A;  3LZ1 A;  5B33 A;  5E5A B;  3AN2 C;  1P34 D;  5B2I A;  5AV6 A;  1M18 B;  3AZK B;  1ZLA C;  1P3L B;  3WTP A;  3KUY A;  1KX5 A;  3AYW C;  3B0D C;  3AV2 B;  2J8P A;  1EQZ C;  3MVD D;  3UTB B;  4Z2M H;  1P3F D;  2Y2I A;  5B2J D;  3A6N C;  5B1M D;  3X1T D;  4XUJ D;  3IP4 C;  2PYO C;  1P3B A;  4WNN B;  2Y2Q A;  2UWX A;  3KXB A;  2HIO D;  3B6G C;  3VH5 W;  4J8X B;  1S32 C;  1P3A C;  4WV4 B;  5KDM A;  3AZE A;  3REH D;  5GT0 A;  4YM6 D;  4H9N A;  1P3I C;  2DQN C;  3MGP A;  5AV8 D;  4JJN D;  5AVC A;  1P3M D;  4J8U D;  5B31 B;  5B24 B;  3X1V B;  5E5A C;  4UUZ B;  3MGS A;  3C1C B;  3LZ0 D;  3EPL A;  5B40 A;  1P3L C;  5AVB C;  2VQR A;  3REJ A;  1KX4 D;  3AV2 C;  5DNM D;  3AV1 D;  4KHA B;  3AZN A;  3WAA B;  5JRG D;  3B6F A;  1U35 D;  5B31 G;  3AZI A;  3AN2 D;  3NQJ B;  4M6B A;  5BO0 B;  3NQU B;  1ZLA D;  3REK A;  5B32 B;  1W2E A;  1P3P B;  1HQ3 B;  3AYW D;  1KX3 A;  1EQZ D;  4J8X C;  1P3F B;  4ZBJ B;  3W97 B;  3MNN B;  4G91 B;  4Z5T C;  3A6N D;  5CP6 B;  2CV5 B;  1P3G B;  2FJ7 A;  2PYO D;  3LEL A;  2CWE A;  5BT1 C;  5B24 C;  3X1V C;  3KWQ B;  3B6G D;  4H9P B;  1S32 D;  5BNX A;  4HGA B;  4YM6 B;  3C1C C;  1P3A D;  4WU9 B;  2NZD A;  3AZG A;  5AV8 B;  2NQB B;  3VH5 T;  3O62 C;  1P3I D;  3VH5 A;  4J8U B;  1B6W A;  4DQY B;  1Q9C A;  5G49 A;  5JA4 B;  3WAA C;  1M1A A;  1ID3 B;  4Z66 B;  1P3O A;  5E5A D;  1P34 A;  5GSU B;  1AOI A;  2Y2J A;  4YS3 B;  5DNM B;  1P3L D;  1WWI A;  5B32 C;  4R8P A;  1BH9 B;  1P3P C;  5AVB D;  3W99 A;  1HQ3 C;  5CPK A;  3AV2 D;  2Y2H A;  3MVD A;  4LD9 C;  3AN2 B;  3W97 C;  1TZY B;  3MNN C;  5CPI B;  3H0R C;  5BS7 A;  5B2J A;  5AY8 B;  5B1M A;  5CP6 C;  1WWS A;  5F99 B;  2CV5 C;  1P3G C;  3LJA A;  1EQZ B;  1F66 A;  2F8N B;  3TU4 A;  4ZUX B;  3AZF A;  3KWQ C;  4H9S C;  4J8X D;  4HGA C;  4WU9 C;  3A6N B;  3REH A;  2NQB C;  4H9Q B;  4Z5T D;  3H0L C;  5BNV A;  3H0M C;  4JJN A;  5B0Y B;  4H9O B;  1P3M A;  2JE5 A;  3REL A;  3B6G B;  3MGR B;  2ZY5 A;  5BT1 D;  4Z66 C;  3WTP B;  5B24 D;  3AZM C;  3X1V D;  1ID3 C;  3AFA C;  1BFM A;  2YFV A;  3R45 A;  3V9R A;  4G92 B;  3AZJ A;  3C1C D;  2G5I C;  4J8V A;  5GSU C;  3LZ0 A;  5AV5 A;  5AV9 A;  4YS3 C;  4NE6 A;  3W98 A;  3O62 D;  3UT9 C;  3MGQ A;  3AV1 A;  3WA9 B;  3W96 B;  2BYK A;  4WU8 B;  3WAA D;  1H3O A;  5JRG A;  1TZY C;  1R4V A;  1U35 A;  5CPI C;  1TAF B;  4QLC A;  5AY8 C;  4H9R A;  5B1L B;  5AVB B;  3C1B B;  5F99 C;  1ZLA A;  5B32 D;  1P3P D;  2IO5 B;  1HQ3 D;  4ZUX C;  4CAY A;  4J8W B;  3AYW A;  4J8W A;  4LD9 D;  3W97 D;  3MNN D;  3X1U B;  5GT3 A;  1P3K C;  5B33 C;  5CP6 D;  5DNN B;  2CV5 D;  1P3G D;  5B0Y C;  1Z2C B;  4NE5 A;  2PYO A;  3MGR C;  3WTP C;  3KUY C;  4DRA A;  4KGC A;  4NE3 A;  3KWQ D;  1M19 B;  4G92 C;  4WU9 D;  4Z5T B;  2NQB D;  1P3I A;  2RVQ C;  4WZS B;  2ARO B;  3WA9 C;  3W96 C;  4WU8 C;  3REK B;  1ID3 D;  4Z66 D;  3AZM D;  1JFI B;  3AFA D;  3AZL B;  5E5A A;  3EPH A;  1M18 A;  2RIQ A;  3O62 B;  5GSU D;  2ZM5 A;  5B1L C;  3AZK A;  4EO5 B;  3C1B C;  3P5J B;  4YS3 D;  3WKJ B;  2IO5 C;  4J8W C;  3MGP C;  3UT9 D;  3AV2 A;  5FUG B;  3X1S A;  3UTB A;  2ZY3 A;  3VH6 T;  1TZY D;  3AZH B;  3VH6 A;  5CPI D;  3X1U C;  2JSS A;  5AY8 D;  5DNN C;  2NZD B;  3AZG B;  5F99 D;  5B40 C;  2Y2N A;  3EG5 B;  2G5H C;  4WNN A;  4LD9 B;  3REI B;  2F8N D;  5C3I B;  4ZUX D;  4X23 B;  4XZQ A;  2ZY2 A;  4J8X A;  1M19 C;  3B0B A;  5G49 B;  3AZN C;  1P3K D;  2BYM A;  5B33 D;  5B32 G;  2ARO C;  5B0Z B;  5B0Y D;  1AOI B;  3UTA B;  1BH8 A;  3MGR D;  3REK C;  5B31 A;  3WTP D;  3KUY D;  4R8P B;  5CPJ B;  3AZL C;  5CPK B;  4UUZ A;  2YFW B;  1KX3 C;  4EO5 C;  2JCH A;  2L5A A;  2Y2M A;  2RVQ D;  3WKJ C;  2ZY4 A;  3AZM B;  3WA9 D;  4KHA A;  5GXQ B;  3AFA B;  4WU8 D;  3W96 D;  3WAA A;  2FJ7 C;  2W8S A;  3AZH C;  3TU4 B;  4KUD B;  2XD1 A;  5B1L D;  3NQU A;  5BO0 A;  3C1B D;  3UT9 B;  3AZG C;  2NZD C;  5B32 A;  3REI C;  1P3P A;  1HQ3 A;  5C3I C;  3MGP D;  4X23 C;  4J8W D;  1N1J A;  1P3F A;  3W97 A;  3X1T A;  1M1A C;  3MNN A;  4XUJ A;  3X1U D;  1B67 A;  2YFV B;  5CP6 A;  4J8V B;  5DNN D;  5B0Z C;  2CV5 A;  2HIO A;  1P3G A;  1AOI C;  3UTA C;  5B40 D;  3W98 B;  4R8P C;  5CPJ C;  3W99 C;  5CPK C;  4H9P A;  3MGQ B;  1M19 D;  4YM6 A;  1P3K B;  3LZ1 B;  5B33 B;  3AZN D;  5B2I B;  5AV6 B;  1H3O B;  2Y2O A;  5AV8 A;  5BS7 C;  4J8U A;  1KU5 A;  3EPJ A;  2ARO D;  3KUY B;  4AWL C;  2F8N G;  1KX5 B;  5GXQ C;  3LJA C;  2Y2P A;  3REK D;  4Z66 A;  1ID3 A;  3F6T A;  1F66 C;  3TU4 C;  3AZL D;  4KUD C;  3AZF C;  1KX3 D;  2F8N H;  5GSU A;  3A1K A;  1KX4 A;  5CHL B;  4YS3 A;  5DNM A;  5GT3 B;  3WKJ D;  1P3B B;  3KXB B;  3AN2 A;  3KFU G;  2FJ7 D;  3REL C;  3AZH D;  5CPI A;  1A7W A;  5KDM B;  3AZE B;  5AY8 A;  5GT0 B;  3AZJ C;  4J8V C;  4H9N B;  2NZD D;  5F99 A;  3MGP B;  3AZG D;  5AV5 C;  5AV9 C;  1EQZ A;  3W98 C;  3REI D;  2F8N A;  5AVC B;  4X23 D;  3MGQ C;  3LZ1 C;  3MGS B;  3A6N A;  1M1A D;  5B2I C;  5AV6 C;  4H9Q A;  5B40 B;  4QLC C;  5B0Z D;  5B0Y A;  3REJ B;  1KX5 C;  4H9O A;  3UTA D;  1AOI D;  4Z2M G;  1S32 A;  4CSR A;  3MGR A;  1P3A A;  3B6G A;  4R8P D;  3AZN B;  5CPJ D;  3W99 D;  5CPK D;  3B6F B;  3X1S B;  3AZI B;  2BG1 A;  4E44 A;  5GT3 C;  1P3B C;  3WA9 A;  3W96 A;  5GXQ D;  4WU8 A;  3KXB C;  3LJA D;  1KX3 B;  1F66 D;  4DRB A;  3AL0 C;  3TU4 D;  1TAF A;  4KGC C;  4KUD D;  3AZF D;  4NFT A;  4XZQ B;  3AZE C;  1P3L A;  5GT0 C;  5B1L A;  5AVB A;  3C1B A;  2BYM B;  2FJ7 B;  5AVC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...