3LZ0D

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 1)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 35
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz0D00
3X1TC 3KWQD 4XZQC 3LZ0B 1P3KA 3R45A 1M18D 2CWEA 1P3BB 5BT1C 5AV9D 4J8XD 3B0DC 3REHB 4CSRA 1U35D 5JRGB 4ZUXB 3MGQC 5E5AD 5B31D 2CV5B 5DNND 4LD9B 4WU9D 4WU8B 1ZLAA 3UTBB 4NE6A 3AZLA 5F99A 5CPKA 3AZHB 3W97B 1Q9CA 2HUEC 3VH5W 1KX5C 4X23D 1M18B 1N1JB 5CHLB 5AV9B 4J8XB 5CPIB 3WA9D 1B67A 2NZDD 2HIOC 4EO5C 4G92B 3B6FC 1U35B 3REJC 3AZMA 5E5AB 5B31B 3WTPA 5DNNB 2BYKA 4H9OB 4WU9B 5DNMD 5AV5D 3UT9B 3AN2D 1M19A 4KGCC 2AROA 5AVBD 3RELA 3AFAC 1HQ3C 5B1LA 1P3ID 5GSUB 5CP6B 3V9RB 4YM6A 4J8VA 4KUDC 2F8NA 5AV8C 4UUZA 3X1VC 4X23B 3X1SC 2NQBC 1F66D 5GXQD 3W98A 3AZGA 3A6NB 4JJNC 1BH8B 5B0YC 2F8NG 3WA9C 5DNMB 3X1UD 4J8UD 3AN2B 1M1AC 3MGSB 3LELB 3MGPC 4H9NA 3AZIA 3WKJD 5B1MD 4H9SC 1HTAA 3REIC 4E44A 3MNNB 5B24A 5GT3B 1ZLAC 1KX3A 5F99C 5CPKC 4XUJC 1P3FB 3VH5T 3AZKD 3KXBD 2FJ7D 3UTAA 1F66B 3W96A 1P3OA 4R8PA 5BNVA 3AZJA 3X1UB 3B0CW 4J8WD 5B40B 3C1BD 5B1MB 1ID3C 3WAAA 3AZMC 3WTPC 3WTPE 4H9RA 5G49A 2AROC 3AZKB 5AY8A 3TU4C 3KXBB 1P3PD 5B0ZB 3AV2D 5AV6A 4J8VC 3W99C 5B2JD 5B32B 5BO0B 3KUYD 2IO5C 5KDMB 3X1TD 3C1BB 5B33D 5C3IC 3W98C 4XZQD 3LZ1A 4G91C 5BT1D 3C1CB 3VH5A 3LZ0A 3MVDB 3AZIC 1P3BA 3MGQD 5AVCA 1P3PB 4Z66B 3REKC 4ZUXA 5JRGA 5B24C 2CV5A 1TZYB 4LD9A 4QLCA 4WU8A 2L5AA 3UTBA 3AV2C 3AZHA 3W97A 3X1TB 1KX5D 3W96C 4XZQB 1S32B 4YS3C 4R8PC 3MGRA 4KHAB 3AZJC 3B0DB 5B33C 2HIOD 4H9PB 4NE3A 1M18A 3B6FD 1N1JA 3MGQB 4J8XA 3REJD 5CPIA 1R4VA 3AZFB 1U35A 1KU5A 5E5AA 4KGCD 5DNNA 4WU9A 4H9OA 3LJAA 3UT9A 4H9QA 2HUEB 3AFAD 3AZND 5CPJC 1HQ3D 4E45A 3AV1B 1EQZC 5B2IC 4KUDD 3AYWC 4AWLC 5AV8D 5GSUA 5CP6A 3V9RA 3X1VD 1H3OB 3X1SD 2NQBD 4X23A 2RVQC 2HIOB 4EO5B 4WNNB 3KWQB 3B6FB 3REJB 4JJND 5B0YD 3LZ1C 1M1AD 3A6NA 1AOIC 4KGCB 1BH8A 5FUGB 3MGPD 5DNMA 3AFAB 3MGSA 3REID 1JFIB 4NFTA 5AVCC 3LELA 1P3MC 1KX4C 1P3LC 3O62C 3B6GA 4ZUXC 1ZLAD 4KUDB 3MNNA 5AV8B 5F99D 5CPKD 4XUJD 3AZNC 1P3GC 4QLCC 5GT3A 4WU8C 2NQBB 1P3FA 3VH6W 3W97C 4DRBA 4Z5TC 4JJNB 5B0YB 1F66A 3WA9B 2NZDB 3AZEC 3MGRC 1M1AB 1A7WA 3MGPB 1P34A 3REIB 1ID3D 5CPIC 5AV5B 3AZMD 4NE5A 3WTPD 1P3KC 5B40A 4WV4B 5B1MA 5AVBB 1ZLAB 5GT0A 4XUJB 2AROD 3LJAC 3TU4D 3UT9C 1P3IB 3AZLC 3KXBA 4CAYB 2LY8A 1P3AA 5B0ZA 4WZSB 4J8VD 5JA4B 3W99D 2F8ND 5GSUC 5CP6C 2YFVB 1WWSA 5B32A 5GXQB 5BO0A 1ID3B 3W98D 3WTPB 4J8UB 5KDMA 3C1BA 3NQUB 2PYOA 3A6NC 3WKJB 4DRAA 3AZID 3TU4B 3C1CA 3MVDA 2YFWB 3MGSC 3REKD 3LELC 1M19C 5B24D 3B6GC 4Z66A 1BH9B 3RELC 3MNNC 2F8NB 3W99B 5B1LC 5GT3C 2FJ7B 5BS7A 1TZYA 2IO5B 1P3FC 4YM6C 3W96D 5C3IB 3W98B 2BYMB 4YS3D 4R8PD 3X1TA 4Z2MG 4G91B 3AZJD 4J8WB 4XZQA 1S32A 1P34C 4KHAA 3AZGC 4H9PA 3REKB 4M6BA 3MGQA 5B40C 3AZFA 5GT0C 2F8NK 3REHA 3AV2B 5CPJD 4HGAC 1EQZD 5B2ID 1KX3C 3AV1A 5B2JB 3AYWD 1ULYA 5AV6D 1P3AC 5B0ZC 4YS3B 3KUYB 1B6WA 3UTAC 2RVQD 5B33B 5B32C 1P3OC 3B0CT 1H3OA 2HIOA 4WNNA 3LZ1D 3KWQA 3B6FA 3B0BA 3REJA 2PYOC 1AOID 5AV9A 3WAAC 5CPJB 4KGCA 3C1CC 5AVCD 5FUGA 1EQZB 4ZBJC 5B31A 1P3MD 1P3LD 1KX4D 3O62D 1JFIA 5B2IB 4ZUXD 3AYWB 4Z66C 1P3GD 5AY8C 4QLCD 4WU8D 4KUDA 1TAFB 5AV8A 5BS7C 1TZYC 1KX5B 3W97D 5AV6C 1F1EA 5B31G 4Z5TD 3AZED 3MGRD 1AOIB 4JJNA 5B0YA 1S32C 3WA9A 2NZDA 1M1AA 5AVCB 3MGPA 5CPID 1P3KD 1P3MB 1KX4B 1P3LB 3O62B 4H9SA 3LZ0C 3REIA 5AV5A 3AZNB 3AZFC 3AN2A 1P3GB 1P3BC 1HQ3B 4QLCB 3LJAD 5AVBA 3UT9D 3REHC 4XUJA 2JSSA 5JRGC 3AZLD 2CV5C 1P3IA 5BNXB 4LD9C 3X1VB 3AV1C 4Z5TB 3UTBC 5GSUD 4CAYA 3X1SB 5CP6D 3NQJB 3AZEB 3MGRB 3AZHC 5JA4A 2YFVA 1P3KB 5GXQA 3R45B 3KWQC 1ID3A 3X1UA 3A6ND 4CSRB 4J8UA 1M18C 3NQUA 5AV9C 3LJAB 4J8XC 4H9QB 4G92C 3WKJA 3MGSD 1U35C 3LELD 5E5AC 5B31C 5F99B 3TU4A 3AZLB 5CPKB 5DNNC 1M19D 2YFWA 4WU9C 3B6GD 3KSYA 3RELD 3MNND 5B1LD 5GT3D 1BH9A 3AZKA 3W99A 1P3FD 4YM6D 2FJ7A 2BYMA 4X23C 2F8NH 1P34D 3AZMB 3AZGD 2NZDC 4J8WA 2BYKB 5B40D 1M19B 3B6GB 2AROB 5GT0D 5DNMC 5B32G 5AV5C 3REKA 3RELB 3AN2C 5B1LB 5AVBC 1P3PA 4YM6B 4J8VB 3AV2A 1KX3D 1P3IC 3VH6T 1P3AD 4UUZB 5B0ZD 5B2JA 1BFMA 4YS3A 3UTAD 3KUYA 5B32D 1P34B 3AZGB 1P3OD 1F66C 5B33A 5GXQC 3AZIB 2PYOD 4H9NB 5GT0B 3X1UC 4J8UC 3WAAD 3C1CD 4HGAB 3MVDD 3WKJC 5B24B 5B1MC 5CPJA 1KX3B 1EQZA 1P3AB 4Z66D 5AY8D 5B2IA 3AYWA 1TZYD 3AZKC 3UTAB 3KXBC 3W96B 1P3OB 1TAFA 2FJ7C 4R8PB 4Z2MH 1KX5A 5BNVB 3AZJB 2PYOB 1S32D 3WAAB 1AOIA 4J8WC 3C1BC 4ZBJB 4H9RB 3VH6A 3LZ0D 5G49B 1P3MA 1KX4A 3AZFD 1P3LA 1P3BD 5AY8B 3O62A 3MVDC 3REHD 3AZNA 1P3GA 3AFAA 1HQ3A 5JRGD 4AWLB 5AV6B 1P3PC 2CV5D 4LD9D 3AV1D 3UTBD 5BNXA 3X1VA 5B2JC 1WWIA 3AZHD 4Z5TA 3NQJA 3X1SA 2NQBA 3KUYC 3AZEA 3LZ1B
chains in the Genus database with same CATH superfamily
3X1TC 3KWQD 4XZQC 2Y2JA 3LZ0B 1P3KA 3R45A 1M18D 3EPLA 2CWEA 1P3BB 5BT1C 5AV9D 4J8XD 3B0DC 3REHB 4CSRA 1U35D 5JRGB 4ZUXB 3P5JB 3MGQC 2ZY2A 5E5AD 5B31D 2CV5B 5DNND 4LD9B 4WU9D 4WU8B 1ZLAA 3UTBB 4NE6A 3AZLA 5F99A 5CPKA 3AZHB 3W97B 1Q9CA 2HUEC 3VH5W 1KX5C 4X23D 1M18B 1N1JB 5CHLB 5AV9B 4J8XB 5CPIB 3WA9D 1B67A 2NZDD 2HIOC 4EO5C 4G92B 3B6FC 1U35B 3REJC 3AZMA 5E5AB 5B31B 3WTPA 5DNNB 2BYKA 4H9OB 4WU9B 5DNMD 5AV5D 3UT9B 3AN2D 1M19A 4KGCC 2AROA 2RIQA 5AVBD 2Y2HA 3RELA 3AFAC 1HQ3C 5B1LA 1P3ID 5GSUB 5CP6B 3V9RB 4YM6A 4J8VA 4KUDC 2F8NA 5AV8C 4UUZA 3X1VC 4X23B 3X1SC 2NQBC 1F66D 5GXQD 3W98A 3EPKA 2F2AC 3AZGA 3A6NB 4JJNC 1BH8B 5B0YC 2F8NG 3WA9C 5DNMB 3X1UD 4J8UD 3AN2B 1M1AC 3MGSB 3LELB 3MGPC 4H9NA 3AZIA 3WKJD 5B1MD 4H9SC 1HTAA 3REIC 4E44A 2FFFB 3MNNB 5B24A 5GT3B 1ZLAC 2Y2NA 1KX3A 5F99C 5CPKC 4XUJC 2ZY4A 1P3FB 3VH5T 2JCHA 3AZKD 3KXBD 2FJ7D 3UTAA 1F66B 3W96A 1P3OA 4R8PA 5BNVA 2Y2GA 3AZJA 3X1UB 3B0CW 4J8WD 5B40B 3C1BD 5B1MB 1ID3C 3WAAA 3AZMC 3WTPC 1PZRA 3WTPE 4H9RA 5G49A 2AROC 3AZKB 5AY8A 3TU4C 3KXBB 1P3PD 5B0ZB 3AV2D 3H0RC 5AV6A 4J8VC 3W99C 5B2JD 5B32B 5BO0B 3KUYD 2IO5C 5KDMB 3X1TD 3C1BB 2UWXA 5B33D 2Y2OA 5C3IC 3W98C 4XZQD 3LZ1A 4G91C 5BT1D 3C1CB 3VH5A 3LZ0A 3MVDB 3AZIC 1P3BA 3MGQD 5AVCA 1P3PB 4Z66B 3REKC 4ZUXA 5JRGA 5B24C 2CV5A 1TZYB 4LD9A 4QLCA 4WU8A 2L5AA 3UTBA 3AV2C 1T3UA 3AZHA 3W97A 3X1TB 1KX5D 3W96C 4XZQB 1S32B 4YS3C 4R8PC 3MGRA 4KHAB 3AZJC 3B0DB 4UPKA 5B33C 2HIOD 4H9PB 4NE3A 1M18A 3B6FD 1N1JA 3MGQB 4J8XA 3REJD 5CPIA 1R4VA 3AZFB 1U35A 1KU5A 5E5AA 4KGCD 5DNNA 4WU9A 4H9OA 3LJAA 3UT9A 4H9QA 2HUEB 3AFAD 3AZND 5CPJC 1HQ3D 4E45A 3AV1B 1EQZC 5B2IC 4KUDD 3AYWC 4AWLC 5AV8D 3EPJA 5GSUA 5CP6A 3V9RA 3X1VD 2DQNC 1H3OB 3IP4C 3X1SD 2NQBD 4X23A 2RVQC 2HIOB 4EO5B 4WNNB 3KWQB 3B6FB 3REJB 3H0MC 5B0YD 3LZ1C 2ZM5A 4JJND 1M1AD 3A6NA 1AOIC 4KGCB 3EPHA 1BH8A 5FUGB 3MGPD 5DNMA 3F6TA 3AFAB 3MGSA 3REID 1JFIB 4NFTA 5AVCC 3LELA 1P3MC 1KX4C 1P3LC 2W8SA 3O62C 3B6GA 4ZUXC 1ZLAD 4KUDB 3MNNA 2Y2LA 5AV8B 5F99D 4XUJD 3AZNC 5CPKD 1P3GC 4QLCC 5GT3A 4WU8C 2NQBB 1P3FA 3VH6W 3W97C 4DRBA 4Z5TC 4JJNB 5B0YB 1F66A 3WA9B 2NZDB 3AZEC 3MGRC 2Y2QA 1M1AB 1A7WA 3MGPB 1P34A 3REIB 1ID3D 5CPIC 5AV5B 3AZMD 4NE5A 3WTPD 1P3KC 5B40A 4WV4B 5B1MA 5AVBB 1ZLAB 5GT0A 4XUJB 2AROD 3LJAC 3TU4D 3UT9C 1P3IB 3AZLC 3KXBA 4CAYB 2LY8A 1P3AA 5B0ZA 4WZSB 4J8VD 5JA4B 3W99D 2F8ND 5GSUC 5CP6C 4WJ3C 2YFVB 1WWSA 1Z2CB 5B32A 5GXQB 2JE5A 3AL0C 5BO0A 1ID3B 3FDDA 3W98D 3WTPB 4J8UB 5KDMA 3C1BA 3NQUB 2PYOA 3A6NC 3WKJB 4DRAA 3AZID 3TU4B 3C1CA 3MVDA 2YFWB 3A1KA 3MGSC 3REKD 3LELC 1M19C 5B24D 3B6GC 4Z66A 1BH9B 3RELC 3MNNC 2F8NB 3W99B 5B1LC 5GT3C 2FJ7B 5BS7A 1TZYA 2IO5B 1P3FC 4YM6C 3W96D 2Y2MA 5C3IB 2BYMB 3W98B 4YS3D 4R8PD 3X1TA 4Z2MG 4G91B 3AZJD 4J8WB 4XZQA 1S32A 1P34C 4KHAA 3AZGC 4H9PA 3REKB 4M6BA 2Y2IA 3MGQA 5B40C 3AZFA 2Y2KA 5GT0C 2F8NK 3REHA 3AV2B 5CPJD 4HGAC 1EQZD 5B2ID 1KX3C 3AV1A 5B2JB 3AYWD 1ULYA 5AV6D 1P3AC 5B0ZC 4YS3B 3KUYB 1B6WA 3UTAC 2RVQD 5B33B 5B32C 1P3OC 1H3OA 3B0CT 2HIOA 4WNNA 3LZ1D 3KWQA 3B6FA 3B0BA 3REJA 2PYOC 1AOID 2DF4C 5AV9A 3WAAC 5CPJB 4KGCA 3C1CC 5AVCD 5FUGA 1EQZB 4ZBJC 5B31A 1P3MD 1P3LD 1KX4D 3O62D 1JFIA 5B2IB 4ZUXD 3AYWB 4Z66C 1P3GD 5AY8C 4QLCD 4WU8D 4KUDA 1TAFB 5AV8A 5BS7C 1TZYC 1KX5B 3W97D 5AV6C 1F1EA 5B31G 4Z5TD 2VQRA 3AZED 3MGRD 1AOIB 4JJNA 5B0YA 1S32C 3WA9A 2NZDA 1M1AA 5AVCB 3MGPA 5CPID 1P3KD 1P3MB 1KX4B 1P3LB 2XD1A 3O62B 4H9SA 3LZ0C 3REIA 5AV5A 3AZNB 3AZFC 3AN2A 1P3GB 1P3BC 1HQ3B 4QLCB 3LJAD 5AVBA 3UT9D 3REHC 4XUJA 2JSSA 5JRGC 3AZLD 2CV5C 1P3IA 5BNXB 4LD9C 3X1VB 3AV1C 4Z5TB 3UTBC 5GSUD 4CAYA 3NQJB 5CP6D 3X1SB 3AZEB 3MGRB 3AZHC 5JA4A 4DQYB 2YFVA 1P3KB 5GXQA 3R45B 3KWQC 1ID3A 3X1UA 3A6ND 4CSRB 4J8UA 1M18C 3NQUA 3EG5B 5AV9C 3LJAB 4J8XC 3A1IA 4H9QB 4G92C 3WKJA 3MGSD 1U35C 3LELD 5E5AC 5B31C 5F99B 3TU4A 3AZLB 5CPKB 5DNNC 1M19D 2YFWA 4WU9C 3B6GD 3KSYA 3RELD 3MNND 5B1LD 5GT3D 1BH9A 3AZKA 3W99A 1P3FD 4YM6D 2FJ7A 2XD5A 2BYMA 4X23C 2G5IC 1W2EA 2F8NH 1P34D 3AZMB 3AZGD 2NZDC 4J8WA 2BYKB 5B40D 1M19B 3B6GB 2AROB 5GT0D 5DNMC 5B32G 5AV5C 3REKA 3RELB 3AN2C 5B1LB 5AVBC 3H0LC 1P3PA 4YM6B 4J8VB 3AV2A 1KX3D 1P3IC 3VH6T 1P3AD 4UUZB 5B0ZD 5B2JA 1BFMA 4YS3A 3UTAD 3KUYA 5B32D 1P34B 3AZGB 1P3OD 1F66C 5B33A 5GXQC 3AZIB 2PYOD 4H9NB 5GT0B 3KFUG 3X1UC 4J8UC 3WAAD 3C1CD 4HGAB 3MVDD 3WKJC 5B24B 5B1MC 2ZY5A 5CPJA 1KX3B 1EQZA 1P3AB 4Z66D 5AY8D 5B2IA 3AYWA 1TZYD 3AZKC 3UTAB 3KXBC 3W96B 1P3OB 1TAFA 2FJ7C 4R8PB 4Z2MH 1KX5A 5BNVB 3AZJB 2G5HC 2PYOB 1S32D 3WAAB 1AOIA 4J8WC 3C1BC 4ZBJB 2ZY3A 2Y2PA 4H9RB 3VH6A 3LZ0D 5G49B 1P3MA 1KX4A 3AZFD 1P3LA 1P3BD 5AY8B 3O62A 3MVDC 3REHD 3AZNA 1P3GA 3AFAA 1HQ3A 5JRGD 2BG1A 4AWLB 5AV6B 1P3PC 2CV5D 4LD9D 3AV1D 2J8PA 3UTBD 5BNXA 3X1VA 5B2JC 1WWIA 3AZHD 4Z5TA 3NQJA 3X1SA 2NQBA 3KUYC 3AZEA 3LZ1B
chains in the Genus database with same CATH topology
3X1TC 3KWQD 4XZQC 2Y2JA 3LZ0B 1P3KA 3R45A 1M18D 3EPLA 2CWEA 1P3BB 5BT1C 5AV9D 4J8XD 3B0DC 3REHB 4CSRA 1U35D 5JRGB 4ZUXB 3P5JB 3MGQC 2ZY2A 5E5AD 5B31D 2CV5B 5DNND 4LD9B 4WU9D 4WU8B 1ZLAA 3UTBB 4NE6A 3AZLA 5F99A 5CPKA 3AZHB 3W97B 1Q9CA 2HUEC 3VH5W 1KX5C 4X23D 1M18B 1N1JB 5CHLB 5AV9B 4J8XB 5CPIB 3WA9D 1B67A 2NZDD 2HIOC 4EO5C 4G92B 3B6FC 1U35B 3REJC 3AZMA 5E5AB 5B31B 3WTPA 5DNNB 2BYKA 4H9OB 4WU9B 5DNMD 5AV5D 3UT9B 3AN2D 1M19A 4KGCC 2AROA 2RIQA 5AVBD 2Y2HA 3RELA 3AFAC 1HQ3C 5B1LA 1P3ID 5GSUB 5CP6B 3V9RB 4YM6A 4J8VA 4KUDC 2F8NA 5AV8C 4UUZA 3X1VC 4X23B 3X1SC 2NQBC 1F66D 5GXQD 3W98A 3EPKA 2F2AC 3AZGA 3A6NB 4JJNC 1BH8B 5B0YC 2F8NG 3WA9C 5DNMB 3X1UD 4J8UD 3AN2B 1M1AC 3MGSB 3LELB 3MGPC 4H9NA 3AZIA 3WKJD 5B1MD 4H9SC 1HTAA 3REIC 4E44A 2FFFB 3MNNB 5B24A 5GT3B 1ZLAC 2Y2NA 1KX3A 5F99C 5CPKC 4XUJC 2ZY4A 1P3FB 3VH5T 2JCHA 3AZKD 3KXBD 2FJ7D 3UTAA 1F66B 3W96A 1P3OA 4R8PA 5BNVA 2Y2GA 3AZJA 3X1UB 3B0CW 4J8WD 5B40B 3C1BD 5B1MB 1ID3C 3WAAA 3AZMC 3WTPC 1PZRA 3WTPE 4H9RA 5G49A 2AROC 3AZKB 5AY8A 3TU4C 3KXBB 1P3PD 5B0ZB 3AV2D 3H0RC 5AV6A 4J8VC 3W99C 5B2JD 5B32B 5BO0B 3KUYD 2IO5C 5KDMB 3X1TD 3C1BB 2UWXA 5B33D 2Y2OA 5C3IC 3W98C 4XZQD 3LZ1A 4G91C 5BT1D 3C1CB 3VH5A 3LZ0A 3MVDB 3AZIC 1P3BA 3MGQD 5AVCA 1P3PB 4Z66B 3REKC 4ZUXA 5JRGA 5B24C 2CV5A 1TZYB 4LD9A 4QLCA 4WU8A 2L5AA 3UTBA 3AV2C 1T3UA 3AZHA 3W97A 3X1TB 1KX5D 3W96C 4XZQB 1S32B 4YS3C 4R8PC 3MGRA 4KHAB 3AZJC 3B0DB 4UPKA 5B33C 2HIOD 4H9PB 4NE3A 1M18A 3B6FD 1N1JA 3MGQB 4J8XA 3REJD 5CPIA 1R4VA 3AZFB 1U35A 1KU5A 5E5AA 4KGCD 5DNNA 4WU9A 4H9OA 3LJAA 3UT9A 4H9QA 2HUEB 3AFAD 3AZND 5CPJC 1HQ3D 4E45A 3AV1B 1EQZC 5B2IC 4KUDD 3AYWC 4AWLC 5AV8D 3EPJA 5GSUA 5CP6A 3V9RA 3X1VD 2DQNC 1H3OB 3IP4C 3X1SD 2NQBD 4X23A 2RVQC 2HIOB 4EO5B 4WNNB 3KWQB 3B6FB 3REJB 3H0MC 5B0YD 3LZ1C 2ZM5A 4JJND 1M1AD 3A6NA 1AOIC 4KGCB 3EPHA 1BH8A 5FUGB 3MGPD 5DNMA 3F6TA 3AFAB 3MGSA 3REID 1JFIB 4NFTA 5AVCC 3LELA 1P3MC 1KX4C 1P3LC 2W8SA 3O62C 3B6GA 4ZUXC 1ZLAD 4KUDB 3MNNA 2Y2LA 5AV8B 5F99D 4XUJD 3AZNC 5CPKD 1P3GC 4QLCC 5GT3A 4WU8C 2NQBB 1P3FA 3VH6W 3W97C 4DRBA 4Z5TC 4JJNB 5B0YB 1F66A 3WA9B 2NZDB 3AZEC 3MGRC 2Y2QA 1M1AB 1A7WA 3MGPB 1P34A 3REIB 1ID3D 5CPIC 5AV5B 3AZMD 4NE5A 3WTPD 1P3KC 5B40A 4WV4B 5B1MA 5AVBB 1ZLAB 5GT0A 4XUJB 2AROD 3LJAC 3TU4D 3UT9C 1P3IB 3AZLC 3KXBA 4CAYB 2LY8A 1P3AA 5B0ZA 4WZSB 4J8VD 5JA4B 3W99D 2F8ND 5GSUC 5CP6C 4WJ3C 2YFVB 1WWSA 1Z2CB 5B32A 5GXQB 2JE5A 3AL0C 5BO0A 1ID3B 3FDDA 3W98D 3WTPB 4J8UB 5KDMA 3C1BA 3NQUB 2PYOA 3A6NC 3WKJB 4DRAA 3AZID 3TU4B 3C1CA 3MVDA 2YFWB 3A1KA 3MGSC 3REKD 3LELC 1M19C 5B24D 3B6GC 4Z66A 1BH9B 3RELC 3MNNC 2F8NB 3W99B 5B1LC 5GT3C 2FJ7B 5BS7A 1TZYA 2IO5B 1P3FC 4YM6C 3W96D 2Y2MA 5C3IB 2BYMB 3W98B 4YS3D 4R8PD 3X1TA 4Z2MG 4G91B 3AZJD 4J8WB 4XZQA 1S32A 1P34C 4KHAA 3AZGC 4H9PA 3REKB 4M6BA 2Y2IA 3MGQA 5B40C 3AZFA 2Y2KA 5GT0C 2F8NK 3REHA 3AV2B 5CPJD 4HGAC 1EQZD 5B2ID 1KX3C 3AV1A 5B2JB 3AYWD 1ULYA 5AV6D 1P3AC 5B0ZC 4YS3B 3KUYB 1B6WA 3UTAC 2RVQD 5B33B 5B32C 1P3OC 1H3OA 3B0CT 2HIOA 4WNNA 3LZ1D 3KWQA 3B6FA 3B0BA 3REJA 2PYOC 1AOID 2DF4C 5AV9A 3WAAC 5CPJB 4KGCA 3C1CC 5AVCD 5FUGA 1EQZB 4ZBJC 5B31A 1P3MD 1P3LD 1KX4D 3O62D 1JFIA 5B2IB 4ZUXD 3AYWB 4Z66C 1P3GD 5AY8C 4QLCD 4WU8D 4KUDA 1TAFB 5AV8A 5BS7C 1TZYC 1KX5B 3W97D 5AV6C 1F1EA 5B31G 4Z5TD 2VQRA 3AZED 3MGRD 1AOIB 4JJNA 5B0YA 1S32C 3WA9A 2NZDA 1M1AA 5AVCB 3MGPA 5CPID 1P3KD 1P3MB 1KX4B 1P3LB 2XD1A 3O62B 4H9SA 3LZ0C 3REIA 5AV5A 3AZNB 3AZFC 3AN2A 1P3GB 1P3BC 1HQ3B 4QLCB 3LJAD 5AVBA 3UT9D 3REHC 4XUJA 2JSSA 5JRGC 3AZLD 2CV5C 1P3IA 5BNXB 4LD9C 3X1VB 3AV1C 4Z5TB 3UTBC 5GSUD 4CAYA 3NQJB 5CP6D 3X1SB 3AZEB 3MGRB 3AZHC 5JA4A 4DQYB 2YFVA 1P3KB 5GXQA 3R45B 3KWQC 1ID3A 3X1UA 3A6ND 4CSRB 4J8UA 1M18C 3NQUA 3EG5B 5AV9C 3LJAB 4J8XC 3A1IA 4H9QB 4G92C 3WKJA 3MGSD 1U35C 3LELD 5E5AC 5B31C 5F99B 3TU4A 3AZLB 5CPKB 5DNNC 1M19D 2YFWA 4WU9C 3B6GD 3KSYA 3RELD 3MNND 5B1LD 5GT3D 1BH9A 3AZKA 3W99A 1P3FD 4YM6D 2FJ7A 2XD5A 2BYMA 4X23C 2G5IC 1W2EA 2F8NH 1P34D 3AZMB 3AZGD 2NZDC 4J8WA 2BYKB 5B40D 1M19B 3B6GB 2AROB 5GT0D 5DNMC 5B32G 5AV5C 3REKA 3RELB 3AN2C 5B1LB 5AVBC 3H0LC 1P3PA 4YM6B 4J8VB 3AV2A 1KX3D 1P3IC 3VH6T 1P3AD 4UUZB 5B0ZD 5B2JA 1BFMA 4YS3A 3UTAD 3KUYA 5B32D 1P34B 3AZGB 1P3OD 1F66C 5B33A 5GXQC 3AZIB 2PYOD 4H9NB 5GT0B 3KFUG 3X1UC 4J8UC 3WAAD 3C1CD 4HGAB 3MVDD 3WKJC 5B24B 5B1MC 2ZY5A 5CPJA 1KX3B 1EQZA 1P3AB 4Z66D 5AY8D 5B2IA 3AYWA 1TZYD 3AZKC 3UTAB 3KXBC 3W96B 1P3OB 1TAFA 2FJ7C 4R8PB 4Z2MH 1KX5A 5BNVB 3AZJB 2G5HC 2PYOB 1S32D 3WAAB 1AOIA 4J8WC 3C1BC 4ZBJB 2ZY3A 2Y2PA 4H9RB 3VH6A 3LZ0D 5G49B 1P3MA 1KX4A 3AZFD 1P3LA 1P3BD 5AY8B 3O62A 3MVDC 3REHD 3AZNA 1P3GA 3AFAA 1HQ3A 5JRGD 2BG1A 4AWLB 5AV6B 1P3PC 2CV5D 4LD9D 3AV1D 2J8PA 3UTBD 5BNXA 3X1VA 5B2JC 1WWIA 3AZHD 4Z5TA 3NQJA 3X1SA 2NQBA 3KUYC 3AZEA 3LZ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T C;  3KWQ D;  4XZQ C;  3LZ0 B;  1P3K A;  3R45 A;  1M18 D;  2CWE A;  1P3B B;  5BT1 C;  5AV9 D;  4J8X D;  3B0D C;  3REH B;  4CSR A;  1U35 D;  5JRG B;  4ZUX B;  3MGQ C;  5E5A D;  5B31 D;  2CV5 B;  5DNN D;  4LD9 B;  4WU9 D;  4WU8 B;  1ZLA A;  3UTB B;  4NE6 A;  3AZL A;  5F99 A;  5CPK A;  3AZH B;  3W97 B;  1Q9C A;  2HUE C;  3VH5 W;  1KX5 C;  4X23 D;  1M18 B;  1N1J B;  5CHL B;  5AV9 B;  4J8X B;  5CPI B;  3WA9 D;  1B67 A;  2NZD D;  2HIO C;  4EO5 C;  4G92 B;  3B6F C;  1U35 B;  3REJ C;  3AZM A;  5E5A B;  5B31 B;  3WTP A;  5DNN B;  2BYK A;  4H9O B;  4WU9 B;  5DNM D;  5AV5 D;  3UT9 B;  3AN2 D;  1M19 A;  4KGC C;  2ARO A;  5AVB D;  3REL A;  3AFA C;  1HQ3 C;  5B1L A;  1P3I D;  5GSU B;  5CP6 B;  3V9R B;  4YM6 A;  4J8V A;  4KUD C;  2F8N A;  5AV8 C;  4UUZ A;  3X1V C;  4X23 B;  3X1S C;  2NQB C;  1F66 D;  5GXQ D;  3W98 A;  3AZG A;  3A6N B;  4JJN C;  1BH8 B;  5B0Y C;  2F8N G;  3WA9 C;  5DNM B;  3X1U D;  4J8U D;  3AN2 B;  1M1A C;  3MGS B;  3LEL B;  3MGP C;  4H9N A;  3AZI A;  3WKJ D;  5B1M D;  4H9S C;  1HTA A;  3REI C;  4E44 A;  3MNN B;  5B24 A;  5GT3 B;  1ZLA C;  1KX3 A;  5F99 C;  5CPK C;  4XUJ C;  1P3F B;  3VH5 T;  3AZK D;  3KXB D;  2FJ7 D;  3UTA A;  1F66 B;  3W96 A;  1P3O A;  4R8P A;  5BNV A;  3AZJ A;  3X1U B;  3B0C W;  4J8W D;  5B40 B;  3C1B D;  5B1M B;  1ID3 C;  3WAA A;  3AZM C;  3WTP C;  3WTP E;  4H9R A;  5G49 A;  2ARO C;  3AZK B;  5AY8 A;  3TU4 C;  3KXB B;  1P3P D;  5B0Z B;  3AV2 D;  5AV6 A;  4J8V C;  3W99 C;  5B2J D;  5B32 B;  5BO0 B;  3KUY D;  2IO5 C;  5KDM B;  3X1T D;  3C1B B;  5B33 D;  5C3I C;  3W98 C;  4XZQ D;  3LZ1 A;  4G91 C;  5BT1 D;  3C1C B;  3VH5 A;  3LZ0 A;  3MVD B;  3AZI C;  1P3B A;  3MGQ D;  5AVC A;  1P3P B;  4Z66 B;  3REK C;  4ZUX A;  5JRG A;  5B24 C;  2CV5 A;  1TZY B;  4LD9 A;  4QLC A;  4WU8 A;  2L5A A;  3UTB A;  3AV2 C;  3AZH A;  3W97 A;  3X1T B;  1KX5 D;  3W96 C;  4XZQ B;  1S32 B;  4YS3 C;  4R8P C;  3MGR A;  4KHA B;  3AZJ C;  3B0D B;  5B33 C;  2HIO D;  4H9P B;  4NE3 A;  1M18 A;  3B6F D;  1N1J A;  3MGQ B;  4J8X A;  3REJ D;  5CPI A;  1R4V A;  3AZF B;  1U35 A;  1KU5 A;  5E5A A;  4KGC D;  5DNN A;  4WU9 A;  4H9O A;  3LJA A;  3UT9 A;  4H9Q A;  2HUE B;  3AFA D;  3AZN D;  5CPJ C;  1HQ3 D;  4E45 A;  3AV1 B;  1EQZ C;  5B2I C;  4KUD D;  3AYW C;  4AWL C;  5AV8 D;  5GSU A;  5CP6 A;  3V9R A;  3X1V D;  1H3O B;  3X1S D;  2NQB D;  4X23 A;  2RVQ C;  2HIO B;  4EO5 B;  4WNN B;  3KWQ B;  3B6F B;  3REJ B;  4JJN D;  5B0Y D;  3LZ1 C;  1M1A D;  3A6N A;  1AOI C;  4KGC B;  1BH8 A;  5FUG B;  3MGP D;  5DNM A;  3AFA B;  3MGS A;  3REI D;  1JFI B;  4NFT A;  5AVC C;  3LEL A;  1P3M C;  1KX4 C;  1P3L C;  3O62 C;  3B6G A;  4ZUX C;  1ZLA D;  4KUD B;  3MNN A;  5AV8 B;  5F99 D;  5CPK D;  4XUJ D;  3AZN C;  1P3G C;  4QLC C;  5GT3 A;  4WU8 C;  2NQB B;  1P3F A;  3VH6 W;  3W97 C;  4DRB A;  4Z5T C;  4JJN B;  5B0Y B;  1F66 A;  3WA9 B;  2NZD B;  3AZE C;  3MGR C;  1M1A B;  1A7W A;  3MGP B;  1P34 A;  3REI B;  1ID3 D;  5CPI C;  5AV5 B;  3AZM D;  4NE5 A;  3WTP D;  1P3K C;  5B40 A;  4WV4 B;  5B1M A;  5AVB B;  1ZLA B;  5GT0 A;  4XUJ B;  2ARO D;  3LJA C;  3TU4 D;  3UT9 C;  1P3I B;  3AZL C;  3KXB A;  4CAY B;  2LY8 A;  1P3A A;  5B0Z A;  4WZS B;  4J8V D;  5JA4 B;  3W99 D;  2F8N D;  5GSU C;  5CP6 C;  2YFV B;  1WWS A;  5B32 A;  5GXQ B;  5BO0 A;  1ID3 B;  3W98 D;  3WTP B;  4J8U B;  5KDM A;  3C1B A;  3NQU B;  2PYO A;  3A6N C;  3WKJ B;  4DRA A;  3AZI D;  3TU4 B;  3C1C A;  3MVD A;  2YFW B;  3MGS C;  3REK D;  3LEL C;  1M19 C;  5B24 D;  3B6G C;  4Z66 A;  1BH9 B;  3REL C;  3MNN C;  2F8N B;  3W99 B;  5B1L C;  5GT3 C;  2FJ7 B;  5BS7 A;  1TZY A;  2IO5 B;  1P3F C;  4YM6 C;  3W96 D;  5C3I B;  3W98 B;  2BYM B;  4YS3 D;  4R8P D;  3X1T A;  4Z2M G;  4G91 B;  3AZJ D;  4J8W B;  4XZQ A;  1S32 A;  1P34 C;  4KHA A;  3AZG C;  4H9P A;  3REK B;  4M6B A;  3MGQ A;  5B40 C;  3AZF A;  5GT0 C;  2F8N K;  3REH A;  3AV2 B;  5CPJ D;  4HGA C;  1EQZ D;  5B2I D;  1KX3 C;  3AV1 A;  5B2J B;  3AYW D;  1ULY A;  5AV6 D;  1P3A C;  5B0Z C;  4YS3 B;  3KUY B;  1B6W A;  3UTA C;  2RVQ D;  5B33 B;  5B32 C;  1P3O C;  3B0C T;  1H3O A;  2HIO A;  4WNN A;  3LZ1 D;  3KWQ A;  3B6F A;  3B0B A;  3REJ A;  2PYO C;  1AOI D;  5AV9 A;  3WAA C;  5CPJ B;  4KGC A;  3C1C C;  5AVC D;  5FUG A;  1EQZ B;  4ZBJ C;  5B31 A;  1P3M D;  1P3L D;  1KX4 D;  3O62 D;  1JFI A;  5B2I B;  4ZUX D;  3AYW B;  4Z66 C;  1P3G D;  5AY8 C;  4QLC D;  4WU8 D;  4KUD A;  1TAF B;  5AV8 A;  5BS7 C;  1TZY C;  1KX5 B;  3W97 D;  5AV6 C;  1F1E A;  5B31 G;  4Z5T D;  3AZE D;  3MGR D;  1AOI B;  4JJN A;  5B0Y A;  1S32 C;  3WA9 A;  2NZD A;  1M1A A;  5AVC B;  3MGP A;  5CPI D;  1P3K D;  1P3M B;  1KX4 B;  1P3L B;  3O62 B;  4H9S A;  3LZ0 C;  3REI A;  5AV5 A;  3AZN B;  3AZF C;  3AN2 A;  1P3G B;  1P3B C;  1HQ3 B;  4QLC B;  3LJA D;  5AVB A;  3UT9 D;  3REH C;  4XUJ A;  2JSS A;  5JRG C;  3AZL D;  2CV5 C;  1P3I A;  5BNX B;  4LD9 C;  3X1V B;  3AV1 C;  4Z5T B;  3UTB C;  5GSU D;  4CAY A;  3X1S B;  5CP6 D;  3NQJ B;  3AZE B;  3MGR B;  3AZH C;  5JA4 A;  2YFV A;  1P3K B;  5GXQ A;  3R45 B;  3KWQ C;  1ID3 A;  3X1U A;  3A6N D;  4CSR B;  4J8U A;  1M18 C;  3NQU A;  5AV9 C;  3LJA B;  4J8X C;  4H9Q B;  4G92 C;  3WKJ A;  3MGS D;  1U35 C;  3LEL D;  5E5A C;  5B31 C;  5F99 B;  3TU4 A;  3AZL B;  5CPK B;  5DNN C;  1M19 D;  2YFW A;  4WU9 C;  3B6G D;  3KSY A;  3REL D;  3MNN D;  5B1L D;  5GT3 D;  1BH9 A;  3AZK A;  3W99 A;  1P3F D;  4YM6 D;  2FJ7 A;  2BYM A;  4X23 C;  2F8N H;  1P34 D;  3AZM B;  3AZG D;  2NZD C;  4J8W A;  2BYK B;  5B40 D;  1M19 B;  3B6G B;  2ARO B;  5GT0 D;  5DNM C;  5B32 G;  5AV5 C;  3REK A;  3REL B;  3AN2 C;  5B1L B;  5AVB C;  1P3P A;  4YM6 B;  4J8V B;  3AV2 A;  1KX3 D;  1P3I C;  3VH6 T;  1P3A D;  4UUZ B;  5B0Z D;  5B2J A;  1BFM A;  4YS3 A;  3UTA D;  3KUY A;  5B32 D;  1P34 B;  3AZG B;  1P3O D;  1F66 C;  5B33 A;  5GXQ C;  3AZI B;  2PYO D;  4H9N B;  5GT0 B;  3X1U C;  4J8U C;  3WAA D;  3C1C D;  4HGA B;  3MVD D;  3WKJ C;  5B24 B;  5B1M C;  5CPJ A;  1KX3 B;  1EQZ A;  1P3A B;  4Z66 D;  5AY8 D;  5B2I A;  3AYW A;  1TZY D;  3AZK C;  3UTA B;  3KXB C;  3W96 B;  1P3O B;  1TAF A;  2FJ7 C;  4R8P B;  4Z2M H;  1KX5 A;  5BNV B;  3AZJ B;  2PYO B;  1S32 D;  3WAA B;  1AOI A;  4J8W C;  3C1B C;  4ZBJ B;  4H9R B;  3VH6 A;  3LZ0 D;  5G49 B;  1P3M A;  1KX4 A;  3AZF D;  1P3L A;  1P3B D;  5AY8 B;  3O62 A;  3MVD C;  3REH D;  3AZN A;  1P3G A;  3AFA A;  1HQ3 A;  5JRG D;  4AWL B;  5AV6 B;  1P3P C;  2CV5 D;  4LD9 D;  3AV1 D;  3UTB D;  5BNX A;  3X1V A;  5B2J C;  1WWI A;  3AZH D;  4Z5T A;  3NQJ A;  3X1S A;  2NQB A;  3KUY C;  3AZE A;  3LZ1 B; 
#chains in the Genus database with same CATH topology
 3X1T C;  3KWQ D;  4XZQ C;  2Y2J A;  3LZ0 B;  1P3K A;  3R45 A;  1M18 D;  3EPL A;  2CWE A;  1P3B B;  5BT1 C;  5AV9 D;  4J8X D;  3B0D C;  3REH B;  4CSR A;  1U35 D;  5JRG B;  4ZUX B;  3P5J B;  3MGQ C;  2ZY2 A;  5E5A D;  5B31 D;  2CV5 B;  5DNN D;  4LD9 B;  4WU9 D;  4WU8 B;  1ZLA A;  3UTB B;  4NE6 A;  3AZL A;  5F99 A;  5CPK A;  3AZH B;  3W97 B;  1Q9C A;  2HUE C;  3VH5 W;  1KX5 C;  4X23 D;  1M18 B;  1N1J B;  5CHL B;  5AV9 B;  4J8X B;  5CPI B;  3WA9 D;  1B67 A;  2NZD D;  2HIO C;  4EO5 C;  4G92 B;  3B6F C;  1U35 B;  3REJ C;  3AZM A;  5E5A B;  5B31 B;  3WTP A;  5DNN B;  2BYK A;  4H9O B;  4WU9 B;  5DNM D;  5AV5 D;  3UT9 B;  3AN2 D;  1M19 A;  4KGC C;  2ARO A;  2RIQ A;  5AVB D;  2Y2H A;  3REL A;  3AFA C;  1HQ3 C;  5B1L A;  1P3I D;  5GSU B;  5CP6 B;  3V9R B;  4YM6 A;  4J8V A;  4KUD C;  2F8N A;  5AV8 C;  4UUZ A;  3X1V C;  4X23 B;  3X1S C;  2NQB C;  1F66 D;  5GXQ D;  3W98 A;  3EPK A;  2F2A C;  3AZG A;  3A6N B;  4JJN C;  1BH8 B;  5B0Y C;  2F8N G;  3WA9 C;  5DNM B;  3X1U D;  4J8U D;  3AN2 B;  1M1A C;  3MGS B;  3LEL B;  3MGP C;  4H9N A;  3AZI A;  3WKJ D;  5B1M D;  4H9S C;  1HTA A;  3REI C;  4E44 A;  2FFF B;  3MNN B;  5B24 A;  5GT3 B;  1ZLA C;  2Y2N A;  1KX3 A;  5F99 C;  5CPK C;  4XUJ C;  2ZY4 A;  1P3F B;  3VH5 T;  2JCH A;  3AZK D;  3KXB D;  2FJ7 D;  3UTA A;  1F66 B;  3W96 A;  1P3O A;  4R8P A;  5BNV A;  2Y2G A;  3AZJ A;  3X1U B;  3B0C W;  4J8W D;  5B40 B;  3C1B D;  5B1M B;  1ID3 C;  3WAA A;  3AZM C;  3WTP C;  1PZR A;  3WTP E;  4H9R A;  5G49 A;  2ARO C;  3AZK B;  5AY8 A;  3TU4 C;  3KXB B;  1P3P D;  5B0Z B;  3AV2 D;  3H0R C;  5AV6 A;  4J8V C;  3W99 C;  5B2J D;  5B32 B;  5BO0 B;  3KUY D;  2IO5 C;  5KDM B;  3X1T D;  3C1B B;  2UWX A;  5B33 D;  2Y2O A;  5C3I C;  3W98 C;  4XZQ D;  3LZ1 A;  4G91 C;  5BT1 D;  3C1C B;  3VH5 A;  3LZ0 A;  3MVD B;  3AZI C;  1P3B A;  3MGQ D;  5AVC A;  1P3P B;  4Z66 B;  3REK C;  4ZUX A;  5JRG A;  5B24 C;  2CV5 A;  1TZY B;  4LD9 A;  4QLC A;  4WU8 A;  2L5A A;  3UTB A;  3AV2 C;  1T3U A;  3AZH A;  3W97 A;  3X1T B;  1KX5 D;  3W96 C;  4XZQ B;  1S32 B;  4YS3 C;  4R8P C;  3MGR A;  4KHA B;  3AZJ C;  3B0D B;  4UPK A;  5B33 C;  2HIO D;  4H9P B;  4NE3 A;  1M18 A;  3B6F D;  1N1J A;  3MGQ B;  4J8X A;  3REJ D;  5CPI A;  1R4V A;  3AZF B;  1U35 A;  1KU5 A;  5E5A A;  4KGC D;  5DNN A;  4WU9 A;  4H9O A;  3LJA A;  3UT9 A;  4H9Q A;  2HUE B;  3AFA D;  3AZN D;  5CPJ C;  1HQ3 D;  4E45 A;  3AV1 B;  1EQZ C;  5B2I C;  4KUD D;  3AYW C;  4AWL C;  5AV8 D;  3EPJ A;  5GSU A;  5CP6 A;  3V9R A;  3X1V D;  2DQN C;  1H3O B;  3IP4 C;  3X1S D;  2NQB D;  4X23 A;  2RVQ C;  2HIO B;  4EO5 B;  4WNN B;  3KWQ B;  3B6F B;  3REJ B;  3H0M C;  5B0Y D;  3LZ1 C;  2ZM5 A;  4JJN D;  1M1A D;  3A6N A;  1AOI C;  4KGC B;  3EPH A;  1BH8 A;  5FUG B;  3MGP D;  5DNM A;  3F6T A;  3AFA B;  3MGS A;  3REI D;  1JFI B;  4NFT A;  5AVC C;  3LEL A;  1P3M C;  1KX4 C;  1P3L C;  2W8S A;  3O62 C;  3B6G A;  4ZUX C;  1ZLA D;  4KUD B;  3MNN A;  2Y2L A;  5AV8 B;  5F99 D;  4XUJ D;  3AZN C;  5CPK D;  1P3G C;  4QLC C;  5GT3 A;  4WU8 C;  2NQB B;  1P3F A;  3VH6 W;  3W97 C;  4DRB A;  4Z5T C;  4JJN B;  5B0Y B;  1F66 A;  3WA9 B;  2NZD B;  3AZE C;  3MGR C;  2Y2Q A;  1M1A B;  1A7W A;  3MGP B;  1P34 A;  3REI B;  1ID3 D;  5CPI C;  5AV5 B;  3AZM D;  4NE5 A;  3WTP D;  1P3K C;  5B40 A;  4WV4 B;  5B1M A;  5AVB B;  1ZLA B;  5GT0 A;  4XUJ B;  2ARO D;  3LJA C;  3TU4 D;  3UT9 C;  1P3I B;  3AZL C;  3KXB A;  4CAY B;  2LY8 A;  1P3A A;  5B0Z A;  4WZS B;  4J8V D;  5JA4 B;  3W99 D;  2F8N D;  5GSU C;  5CP6 C;  4WJ3 C;  2YFV B;  1WWS A;  1Z2C B;  5B32 A;  5GXQ B;  2JE5 A;  3AL0 C;  5BO0 A;  1ID3 B;  3FDD A;  3W98 D;  3WTP B;  4J8U B;  5KDM A;  3C1B A;  3NQU B;  2PYO A;  3A6N C;  3WKJ B;  4DRA A;  3AZI D;  3TU4 B;  3C1C A;  3MVD A;  2YFW B;  3A1K A;  3MGS C;  3REK D;  3LEL C;  1M19 C;  5B24 D;  3B6G C;  4Z66 A;  1BH9 B;  3REL C;  3MNN C;  2F8N B;  3W99 B;  5B1L C;  5GT3 C;  2FJ7 B;  5BS7 A;  1TZY A;  2IO5 B;  1P3F C;  4YM6 C;  3W96 D;  2Y2M A;  5C3I B;  2BYM B;  3W98 B;  4YS3 D;  4R8P D;  3X1T A;  4Z2M G;  4G91 B;  3AZJ D;  4J8W B;  4XZQ A;  1S32 A;  1P34 C;  4KHA A;  3AZG C;  4H9P A;  3REK B;  4M6B A;  2Y2I A;  3MGQ A;  5B40 C;  3AZF A;  2Y2K A;  5GT0 C;  2F8N K;  3REH A;  3AV2 B;  5CPJ D;  4HGA C;  1EQZ D;  5B2I D;  1KX3 C;  3AV1 A;  5B2J B;  3AYW D;  1ULY A;  5AV6 D;  1P3A C;  5B0Z C;  4YS3 B;  3KUY B;  1B6W A;  3UTA C;  2RVQ D;  5B33 B;  5B32 C;  1P3O C;  1H3O A;  3B0C T;  2HIO A;  4WNN A;  3LZ1 D;  3KWQ A;  3B6F A;  3B0B A;  3REJ A;  2PYO C;  1AOI D;  2DF4 C;  5AV9 A;  3WAA C;  5CPJ B;  4KGC A;  3C1C C;  5AVC D;  5FUG A;  1EQZ B;  4ZBJ C;  5B31 A;  1P3M D;  1P3L D;  1KX4 D;  3O62 D;  1JFI A;  5B2I B;  4ZUX D;  3AYW B;  4Z66 C;  1P3G D;  5AY8 C;  4QLC D;  4WU8 D;  4KUD A;  1TAF B;  5AV8 A;  5BS7 C;  1TZY C;  1KX5 B;  3W97 D;  5AV6 C;  1F1E A;  5B31 G;  4Z5T D;  2VQR A;  3AZE D;  3MGR D;  1AOI B;  4JJN A;  5B0Y A;  1S32 C;  3WA9 A;  2NZD A;  1M1A A;  5AVC B;  3MGP A;  5CPI D;  1P3K D;  1P3M B;  1KX4 B;  1P3L B;  2XD1 A;  3O62 B;  4H9S A;  3LZ0 C;  3REI A;  5AV5 A;  3AZN B;  3AZF C;  3AN2 A;  1P3G B;  1P3B C;  1HQ3 B;  4QLC B;  3LJA D;  5AVB A;  3UT9 D;  3REH C;  4XUJ A;  2JSS A;  5JRG C;  3AZL D;  2CV5 C;  1P3I A;  5BNX B;  4LD9 C;  3X1V B;  3AV1 C;  4Z5T B;  3UTB C;  5GSU D;  4CAY A;  3NQJ B;  5CP6 D;  3X1S B;  3AZE B;  3MGR B;  3AZH C;  5JA4 A;  4DQY B;  2YFV A;  1P3K B;  5GXQ A;  3R45 B;  3KWQ C;  1ID3 A;  3X1U A;  3A6N D;  4CSR B;  4J8U A;  1M18 C;  3NQU A;  3EG5 B;  5AV9 C;  3LJA B;  4J8X C;  3A1I A;  4H9Q B;  4G92 C;  3WKJ A;  3MGS D;  1U35 C;  3LEL D;  5E5A C;  5B31 C;  5F99 B;  3TU4 A;  3AZL B;  5CPK B;  5DNN C;  1M19 D;  2YFW A;  4WU9 C;  3B6G D;  3KSY A;  3REL D;  3MNN D;  5B1L D;  5GT3 D;  1BH9 A;  3AZK A;  3W99 A;  1P3F D;  4YM6 D;  2FJ7 A;  2XD5 A;  2BYM A;  4X23 C;  2G5I C;  1W2E A;  2F8N H;  1P34 D;  3AZM B;  3AZG D;  2NZD C;  4J8W A;  2BYK B;  5B40 D;  1M19 B;  3B6G B;  2ARO B;  5GT0 D;  5DNM C;  5B32 G;  5AV5 C;  3REK A;  3REL B;  3AN2 C;  5B1L B;  5AVB C;  3H0L C;  1P3P A;  4YM6 B;  4J8V B;  3AV2 A;  1KX3 D;  1P3I C;  3VH6 T;  1P3A D;  4UUZ B;  5B0Z D;  5B2J A;  1BFM A;  4YS3 A;  3UTA D;  3KUY A;  5B32 D;  1P34 B;  3AZG B;  1P3O D;  1F66 C;  5B33 A;  5GXQ C;  3AZI B;  2PYO D;  4H9N B;  5GT0 B;  3KFU G;  3X1U C;  4J8U C;  3WAA D;  3C1C D;  4HGA B;  3MVD D;  3WKJ C;  5B24 B;  5B1M C;  2ZY5 A;  5CPJ A;  1KX3 B;  1EQZ A;  1P3A B;  4Z66 D;  5AY8 D;  5B2I A;  3AYW A;  1TZY D;  3AZK C;  3UTA B;  3KXB C;  3W96 B;  1P3O B;  1TAF A;  2FJ7 C;  4R8P B;  4Z2M H;  1KX5 A;  5BNV B;  3AZJ B;  2G5H C;  2PYO B;  1S32 D;  3WAA B;  1AOI A;  4J8W C;  3C1B C;  4ZBJ B;  2ZY3 A;  2Y2P A;  4H9R B;  3VH6 A;  3LZ0 D;  5G49 B;  1P3M A;  1KX4 A;  3AZF D;  1P3L A;  1P3B D;  5AY8 B;  3O62 A;  3MVD C;  3REH D;  3AZN A;  1P3G A;  3AFA A;  1HQ3 A;  5JRG D;  2BG1 A;  4AWL B;  5AV6 B;  1P3P C;  2CV5 D;  4LD9 D;  3AV1 D;  2J8P A;  3UTB D;  5BNX A;  3X1V A;  5B2J C;  1WWI A;  3AZH D;  4Z5T A;  3NQJ A;  3X1S A;  2NQB A;  3KUY C;  3AZE A;  3LZ1 B; 
#chains in the Genus database with same CATH homology
 3X1T C;  3KWQ D;  4XZQ C;  2Y2J A;  3LZ0 B;  1P3K A;  3R45 A;  1M18 D;  3EPL A;  2CWE A;  1P3B B;  5BT1 C;  5AV9 D;  4J8X D;  3B0D C;  3REH B;  4CSR A;  1U35 D;  5JRG B;  4ZUX B;  3P5J B;  3MGQ C;  2ZY2 A;  5E5A D;  5B31 D;  2CV5 B;  5DNN D;  4LD9 B;  4WU9 D;  4WU8 B;  1ZLA A;  3UTB B;  4NE6 A;  3AZL A;  5F99 A;  5CPK A;  3AZH B;  3W97 B;  1Q9C A;  2HUE C;  3VH5 W;  1KX5 C;  4X23 D;  1M18 B;  1N1J B;  5CHL B;  5AV9 B;  4J8X B;  5CPI B;  3WA9 D;  1B67 A;  2NZD D;  2HIO C;  4EO5 C;  4G92 B;  3B6F C;  1U35 B;  3REJ C;  3AZM A;  5E5A B;  5B31 B;  3WTP A;  5DNN B;  2BYK A;  4H9O B;  4WU9 B;  5DNM D;  5AV5 D;  3UT9 B;  3AN2 D;  1M19 A;  4KGC C;  2ARO A;  2RIQ A;  5AVB D;  2Y2H A;  3REL A;  3AFA C;  1HQ3 C;  5B1L A;  1P3I D;  5GSU B;  5CP6 B;  3V9R B;  4YM6 A;  4J8V A;  4KUD C;  2F8N A;  5AV8 C;  4UUZ A;  3X1V C;  4X23 B;  3X1S C;  2NQB C;  1F66 D;  5GXQ D;  3W98 A;  3EPK A;  2F2A C;  3AZG A;  3A6N B;  4JJN C;  1BH8 B;  5B0Y C;  2F8N G;  3WA9 C;  5DNM B;  3X1U D;  4J8U D;  3AN2 B;  1M1A C;  3MGS B;  3LEL B;  3MGP C;  4H9N A;  3AZI A;  3WKJ D;  5B1M D;  4H9S C;  1HTA A;  3REI C;  4E44 A;  2FFF B;  3MNN B;  5B24 A;  5GT3 B;  1ZLA C;  2Y2N A;  1KX3 A;  5F99 C;  5CPK C;  4XUJ C;  2ZY4 A;  1P3F B;  3VH5 T;  2JCH A;  3AZK D;  3KXB D;  2FJ7 D;  3UTA A;  1F66 B;  3W96 A;  1P3O A;  4R8P A;  5BNV A;  2Y2G A;  3AZJ A;  3X1U B;  3B0C W;  4J8W D;  5B40 B;  3C1B D;  5B1M B;  1ID3 C;  3WAA A;  3AZM C;  3WTP C;  1PZR A;  3WTP E;  4H9R A;  5G49 A;  2ARO C;  3AZK B;  5AY8 A;  3TU4 C;  3KXB B;  1P3P D;  5B0Z B;  3AV2 D;  3H0R C;  5AV6 A;  4J8V C;  3W99 C;  5B2J D;  5B32 B;  5BO0 B;  3KUY D;  2IO5 C;  5KDM B;  3X1T D;  3C1B B;  2UWX A;  5B33 D;  2Y2O A;  5C3I C;  3W98 C;  4XZQ D;  3LZ1 A;  4G91 C;  5BT1 D;  3C1C B;  3VH5 A;  3LZ0 A;  3MVD B;  3AZI C;  1P3B A;  3MGQ D;  5AVC A;  1P3P B;  4Z66 B;  3REK C;  4ZUX A;  5JRG A;  5B24 C;  2CV5 A;  1TZY B;  4LD9 A;  4QLC A;  4WU8 A;  2L5A A;  3UTB A;  3AV2 C;  1T3U A;  3AZH A;  3W97 A;  3X1T B;  1KX5 D;  3W96 C;  4XZQ B;  1S32 B;  4YS3 C;  4R8P C;  3MGR A;  4KHA B;  3AZJ C;  3B0D B;  4UPK A;  5B33 C;  2HIO D;  4H9P B;  4NE3 A;  1M18 A;  3B6F D;  1N1J A;  3MGQ B;  4J8X A;  3REJ D;  5CPI A;  1R4V A;  3AZF B;  1U35 A;  1KU5 A;  5E5A A;  4KGC D;  5DNN A;  4WU9 A;  4H9O A;  3LJA A;  3UT9 A;  4H9Q A;  2HUE B;  3AFA D;  3AZN D;  5CPJ C;  1HQ3 D;  4E45 A;  3AV1 B;  1EQZ C;  5B2I C;  4KUD D;  3AYW C;  4AWL C;  5AV8 D;  3EPJ A;  5GSU A;  5CP6 A;  3V9R A;  3X1V D;  2DQN C;  1H3O B;  3IP4 C;  3X1S D;  2NQB D;  4X23 A;  2RVQ C;  2HIO B;  4EO5 B;  4WNN B;  3KWQ B;  3B6F B;  3REJ B;  3H0M C;  5B0Y D;  3LZ1 C;  2ZM5 A;  4JJN D;  1M1A D;  3A6N A;  1AOI C;  4KGC B;  3EPH A;  1BH8 A;  5FUG B;  3MGP D;  5DNM A;  3F6T A;  3AFA B;  3MGS A;  3REI D;  1JFI B;  4NFT A;  5AVC C;  3LEL A;  1P3M C;  1KX4 C;  1P3L C;  2W8S A;  3O62 C;  3B6G A;  4ZUX C;  1ZLA D;  4KUD B;  3MNN A;  2Y2L A;  5AV8 B;  5F99 D;  4XUJ D;  3AZN C;  5CPK D;  1P3G C;  4QLC C;  5GT3 A;  4WU8 C;  2NQB B;  1P3F A;  3VH6 W;  3W97 C;  4DRB A;  4Z5T C;  4JJN B;  5B0Y B;  1F66 A;  3WA9 B;  2NZD B;  3AZE C;  3MGR C;  2Y2Q A;  1M1A B;  1A7W A;  3MGP B;  1P34 A;  3REI B;  1ID3 D;  5CPI C;  5AV5 B;  3AZM D;  4NE5 A;  3WTP D;  1P3K C;  5B40 A;  4WV4 B;  5B1M A;  5AVB B;  1ZLA B;  5GT0 A;  4XUJ B;  2ARO D;  3LJA C;  3TU4 D;  3UT9 C;  1P3I B;  3AZL C;  3KXB A;  4CAY B;  2LY8 A;  1P3A A;  5B0Z A;  4WZS B;  4J8V D;  5JA4 B;  3W99 D;  2F8N D;  5GSU C;  5CP6 C;  4WJ3 C;  2YFV B;  1WWS A;  1Z2C B;  5B32 A;  5GXQ B;  2JE5 A;  3AL0 C;  5BO0 A;  1ID3 B;  3FDD A;  3W98 D;  3WTP B;  4J8U B;  5KDM A;  3C1B A;  3NQU B;  2PYO A;  3A6N C;  3WKJ B;  4DRA A;  3AZI D;  3TU4 B;  3C1C A;  3MVD A;  2YFW B;  3A1K A;  3MGS C;  3REK D;  3LEL C;  1M19 C;  5B24 D;  3B6G C;  4Z66 A;  1BH9 B;  3REL C;  3MNN C;  2F8N B;  3W99 B;  5B1L C;  5GT3 C;  2FJ7 B;  5BS7 A;  1TZY A;  2IO5 B;  1P3F C;  4YM6 C;  3W96 D;  2Y2M A;  5C3I B;  2BYM B;  3W98 B;  4YS3 D;  4R8P D;  3X1T A;  4Z2M G;  4G91 B;  3AZJ D;  4J8W B;  4XZQ A;  1S32 A;  1P34 C;  4KHA A;  3AZG C;  4H9P A;  3REK B;  4M6B A;  2Y2I A;  3MGQ A;  5B40 C;  3AZF A;  2Y2K A;  5GT0 C;  2F8N K;  3REH A;  3AV2 B;  5CPJ D;  4HGA C;  1EQZ D;  5B2I D;  1KX3 C;  3AV1 A;  5B2J B;  3AYW D;  1ULY A;  5AV6 D;  1P3A C;  5B0Z C;  4YS3 B;  3KUY B;  1B6W A;  3UTA C;  2RVQ D;  5B33 B;  5B32 C;  1P3O C;  1H3O A;  3B0C T;  2HIO A;  4WNN A;  3LZ1 D;  3KWQ A;  3B6F A;  3B0B A;  3REJ A;  2PYO C;  1AOI D;  2DF4 C;  5AV9 A;  3WAA C;  5CPJ B;  4KGC A;  3C1C C;  5AVC D;  5FUG A;  1EQZ B;  4ZBJ C;  5B31 A;  1P3M D;  1P3L D;  1KX4 D;  3O62 D;  1JFI A;  5B2I B;  4ZUX D;  3AYW B;  4Z66 C;  1P3G D;  5AY8 C;  4QLC D;  4WU8 D;  4KUD A;  1TAF B;  5AV8 A;  5BS7 C;  1TZY C;  1KX5 B;  3W97 D;  5AV6 C;  1F1E A;  5B31 G;  4Z5T D;  2VQR A;  3AZE D;  3MGR D;  1AOI B;  4JJN A;  5B0Y A;  1S32 C;  3WA9 A;  2NZD A;  1M1A A;  5AVC B;  3MGP A;  5CPI D;  1P3K D;  1P3M B;  1KX4 B;  1P3L B;  2XD1 A;  3O62 B;  4H9S A;  3LZ0 C;  3REI A;  5AV5 A;  3AZN B;  3AZF C;  3AN2 A;  1P3G B;  1P3B C;  1HQ3 B;  4QLC B;  3LJA D;  5AVB A;  3UT9 D;  3REH C;  4XUJ A;  2JSS A;  5JRG C;  3AZL D;  2CV5 C;  1P3I A;  5BNX B;  4LD9 C;  3X1V B;  3AV1 C;  4Z5T B;  3UTB C;  5GSU D;  4CAY A;  3NQJ B;  5CP6 D;  3X1S B;  3AZE B;  3MGR B;  3AZH C;  5JA4 A;  4DQY B;  2YFV A;  1P3K B;  5GXQ A;  3R45 B;  3KWQ C;  1ID3 A;  3X1U A;  3A6N D;  4CSR B;  4J8U A;  1M18 C;  3NQU A;  3EG5 B;  5AV9 C;  3LJA B;  4J8X C;  3A1I A;  4H9Q B;  4G92 C;  3WKJ A;  3MGS D;  1U35 C;  3LEL D;  5E5A C;  5B31 C;  5F99 B;  3TU4 A;  3AZL B;  5CPK B;  5DNN C;  1M19 D;  2YFW A;  4WU9 C;  3B6G D;  3KSY A;  3REL D;  3MNN D;  5B1L D;  5GT3 D;  1BH9 A;  3AZK A;  3W99 A;  1P3F D;  4YM6 D;  2FJ7 A;  2XD5 A;  2BYM A;  4X23 C;  2G5I C;  1W2E A;  2F8N H;  1P34 D;  3AZM B;  3AZG D;  2NZD C;  4J8W A;  2BYK B;  5B40 D;  1M19 B;  3B6G B;  2ARO B;  5GT0 D;  5DNM C;  5B32 G;  5AV5 C;  3REK A;  3REL B;  3AN2 C;  5B1L B;  5AVB C;  3H0L C;  1P3P A;  4YM6 B;  4J8V B;  3AV2 A;  1KX3 D;  1P3I C;  3VH6 T;  1P3A D;  4UUZ B;  5B0Z D;  5B2J A;  1BFM A;  4YS3 A;  3UTA D;  3KUY A;  5B32 D;  1P34 B;  3AZG B;  1P3O D;  1F66 C;  5B33 A;  5GXQ C;  3AZI B;  2PYO D;  4H9N B;  5GT0 B;  3KFU G;  3X1U C;  4J8U C;  3WAA D;  3C1C D;  4HGA B;  3MVD D;  3WKJ C;  5B24 B;  5B1M C;  2ZY5 A;  5CPJ A;  1KX3 B;  1EQZ A;  1P3A B;  4Z66 D;  5AY8 D;  5B2I A;  3AYW A;  1TZY D;  3AZK C;  3UTA B;  3KXB C;  3W96 B;  1P3O B;  1TAF A;  2FJ7 C;  4R8P B;  4Z2M H;  1KX5 A;  5BNV B;  3AZJ B;  2G5H C;  2PYO B;  1S32 D;  3WAA B;  1AOI A;  4J8W C;  3C1B C;  4ZBJ B;  2ZY3 A;  2Y2P A;  4H9R B;  3VH6 A;  3LZ0 D;  5G49 B;  1P3M A;  1KX4 A;  3AZF D;  1P3L A;  1P3B D;  5AY8 B;  3O62 A;  3MVD C;  3REH D;  3AZN A;  1P3G A;  3AFA A;  1HQ3 A;  5JRG D;  2BG1 A;  4AWL B;  5AV6 B;  1P3P C;  2CV5 D;  4LD9 D;  3AV1 D;  2J8P A;  3UTB D;  5BNX A;  3X1V A;  5B2J C;  1WWI A;  3AZH D;  4Z5T A;  3NQJ A;  3X1S A;  2NQB A;  3KUY C;  3AZE A;  3LZ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...