3LZ0D

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 1)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 35
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz0D00
4NE5A 4G91B 5AV5C 2F8ND 5AY8C 5B0YA 1TAFA 3X1UD 3WA9A 3AV1C 5AY8B 2AROC 2F8NK 5GXQB 3W99C 1KX5A 5B1MD 4Z5TB 5JRGA 1P3ID 5GT0A 3AZEC 4UUZA 4J8VA 4WU8D 5B2IC 2JSSA 4R8PC 3X1UB 3REJC 5B1LC 3W98D 3C1BD 1P3BD 5AVBA 2HUEC 5B0ZC 5CPJD 4KUDD 4NE3A 1AOIA 5B24C 3MNNC 3WKJB 3AZNA 1M19A 1F66C 3W96D 5B33A 1ZLAB 5AV8D 3W98A 3REHD 5GT0B 5B2JD 4XZQD 3AZLB 5B0YB 1AOIC 5B40A 5GT3D 5B0ZA 3AZID 3LZ0A 3A6NC 1S32A 1HQ3A 5KDMB 3UTBC 1P3OB 2NQBB 1ID3A 4J8VC 4NFTA 2YFWB 3AV1B 5CPKD 2FJ7D 5GT3C 3C1BA 1ULYA 5DNNC 4H9PA 3X1SD 2LY8A 3WKJA 5B33C 3AZHD 2BYKB 4XZQB 3AZLD 3WAAD 5GT0D 4J8XA 2PYOD 5CP6A 3NQJA 1BFMA 3X1TB 5AVBC 4X23A 5AV6B 1P3OC 5B1MA 4LD9D 1Q9CA 5B32C 1P34D 5KDMA 1P3LC 5B2JC 3AN2A 2HIOD 3AYWB 1KX3B 5GT0C 5B1MC 1P3KC 2FJ7B 3TU4D 4J8UB 3W97B 3W99A 4DRBA 1P3IB 1P3GA 3A6NB 2BYMB 1EQZD 1TZYD 3NQJB 3AZEB 3REKA 3V9RB 4YS3A 3TU4C 3AYWD 2HIOB 5B1LB 1HTAA 3MGSA 3AZGD 4Z66A 3AYWA 4LD9B 2IO5C 3UTAC 1U35A 5AV6A 4YM6C 3MVDD 3LELB 3W97A 5B31C 3W96B 5GXQC 3MGPA 3AZLC 1JFIB 3REKB 4WU9C 3VH5T 5FUGB 1S32C 1P3AB 4M6BA 3UT9D 3MGPD 5B2IB 4AWLC 5JA4B 4J8WD 1WWIA 4WU8B 3MVDA 3REID 4KHAB 4G91C 5GSUA 2YFVA 1P3BC 1U35B 3AV2A 1KX3D 4X23D 2AROB 3MGPB 3MGSB 3LELC 3REIC 4Z66B 4J8UC 3O62A 3C1CD 3LZ0D 4R8PA 3AZIC 5B40D 5E5AB 3B0DB 1H3OB 1F1EA 3REHA 5AV6C 4YM6A 2PYOB 1P3FB 4ZUXC 5AV9D 5F99A 3LZ1B 3AZMD 2NQBA 3WTPA 1P3MD 1P34C 4XUJB 2AROA 5AVBD 2YFWA 3AV1A 2CV5C 3WA9C 3LJAC 5C3IC 4ZUXD 2CV5A 5GSUB 3REJD 3AZKC 1P3GC 3WTPC 4X23B 5B1MB 1KX4C 3AZHA 3O62D 1H3OA 3AFAA 5AVCC 4J8XB 5AVBB 2PYOC 3B6GD 4ZUXB 5DNMC 4H9NA 3WTPE 3R45A 3O62C 5B0YD 3X1UA 4J8UA 3AZND 4Z2MH 3AFAC 1M19D 2F8NA 3REIA 3B6FD 4NE6A 5CPIC 3WTPD 1P3MA 2BYMA 3AN2B 3VH6T 5C3IB 4QLCA 3AZFC 3LZ0B 3C1CB 4XUJA 5G49A 4J8VD 4DRAA 3MVDC 4WU9D 5JRGD 1P3IA 3W98B 2NQBC 5B0ZB 3R45B 5B31G 5DNND 1TZYB 4AWLB 1ID3C 2RVQC 2HUEB 5CPJA 3X1VD 4KUDA 2NQBD 3UTAB 3KUYC 1P3PD 5GSUD 1U35C 4YM6D 3LELA 3AZKD 3B0CW 5B2ID 3MGSC 3UTBD 1P3MB 1KU5A 4KHAA 3VH6A 1JFIA 3TU4A 3LELD 3W98C 5B32D 5AV8B 1F66A 3AZNC 1M19C 5E5AD 5B24A 3MNNA 5AV5B 3KUYD 4WU8C 5DNMD 2HIOC 3AZGB 1A7WA 4KGCB 4ZBJC 4G92B 3B6FB 3KWQD 1P3KA 4UUZB 4Z66D 2L5AA 4CAYB 3X1SB 3AZJD 1M18C 3AN2C 1KX3C 5E5AA 5GXQA 1P3LA 5BT1D 3W97C 1M1AA 5B32A 1P3GD 5AVCA 3AZEA 5JRGC 2NZDC 3AZHC 3AZKA 3KXBC 4LD9A 1N1JA 5DNMB 1P34A 5GT3B 5DNNA 3KUYB 5AV9B 5B24D 3MNND 3AFAB 1HQ3B 5B32G 1P3KB 3REHC 1P3AA 1B67A 4E45A 2FJ7C 3NQUB 3WKJD 3MGRD 3AZIA 4CAYA 3X1SA 5E5AC 3WAAB 3AZHB 4CSRA 3C1BB 4QLCD 5AVCB 5CPKB 1P3OA 2F8NG 4HGAB 1N1JB 3A6ND 3AZJC 1M18D 5B40C 1ID3D 4H9SA 5AV9A 1P3OD 1P3BA 3REIB 3WKJC 5GSUC 5AV9C 1S32D 3VH5A 1ZLAC 1WWSA 3X1TA 4QLCB 3AV2B 3AZIB 3UT9B 5GT3A 5B0ZD 3WAAA 4XZQA 4XUJD 1P3FC 3REJA 4J8VB 5CHLB 5B31A 3AZGC 2FJ7A 3AZNB 1M19B 1P3BB 1BH9B 4CSRB 5BNVA 2IO5B 3A6NA 2CV5B 4Z66C 3B0CT 4JJNB 3UT9A 5B0YC 1AOIB 1B6WA 5AV5A 3UTAD 3REKC 1S32B 3REJB 5GXQD 4H9QB 3TU4B 3W97D 5CPIA 4H9NB 4Z5TD 3AZFD 2NZDD 3W96A 5B1LA 1BH9A 2CWEA 5BNVB 3AZJB 1AOID 1TZYC 5B2JB 3W96C 5B31B 1F66D 3LJAD 4WNNA 3LZ1D 3AZMB 3C1CC 3MGQD 4E44A 5JA4A 4WU8A 3MVDB 4J8XC 1P3LD 4H9PB 5AY8A 3LJAA 3B6GB 2BYKA 1KX5B 1P3PC 3AV2D 3C1BC 3MGSD 3O62B 3WA9D 2NZDA 4HGAC 1EQZB 3AZFB 5CPIB 5CPID 3RELD 5DNNB 3KUYA 1M1AC 1P3GB 5AY8D 3UTBA 1P3FA 3REKD 3W99D 4XZQC 5F99B 3LZ1A 3KWQC 4YS3B 5AVCD 3WAAC 3RELC 1M1AD 3VH5W 5BO0A 2HIOA 3X1TC 3B6GC 4EO5C 1ZLAA 4H9RB 3KXBB 3B6FA 5CPKA 5CPKC 4XUJC 3B6FC 5B40B 3V9RA 3AZFA 3X1VA 3LJAB 3B6GA 5B31D 1F66B 5B1LD 5B24B 3MNNB 1M1AB 4WU9A 4J8WC 3AZMC 3AZLA 2NZDB 4J8XD 1EQZA 5B2IA 5CPJC 3MGQA 4KUDC 4ZBJB 5AV8C 4G92C 4WV4B 1KX4A 4WZSB 1KX5C 4J8UD 2RVQD 4Z2MG 1ID3B 1M18B 4KGCC 3MGRC 4LD9C 2F8NB 4Z5TC 3MGRB 4Z5TA 3KXBA 4QLCC 3B0BA 4R8PD 1BH8A 4KGCD 5BT1C 4R8PB 1HQ3D 3C1CA 1P3MC 3AFAD 3X1TD 3X1UC 5CPJB 4KUDB 3KXBD 5BS7C 5CP6B 3MGQC 4H9QA 5B2JA 3NQUA 5BS7A 1KX3A 1M18A 5B33D 3AV1D 5F99D 3AZMA 4H9OA 3W99B 2AROD 4YM6B 2F8NH 3AV2C 1BH8B 4J8WB 4JJNC 3UT9C 5B33B 3MGRA 4KGCA 1KX5D 1P3AD 5F99C 3KWQB 3RELA 4ZUXA 5BNXA 5AV6D 2CV5D 5AV8A 4H9OB 1P3KD 1P3LB 3AZGA 5B32B 1ZLAD 1EQZC 1KX4D 1HQ3C 4J8WA 3AYWC 4YS3D 3VH6W 5BO0B 3AZKB 3LZ0C 3UTBB 1P3IC 2YFVB 3X1VC 3AZED 3RELB 5FUGA 3X1VB 5BNXB 4YS3C 4JJNA 1U35D 4H9SC 5G49B 1P3PB 3B0DC 3AZJA 4H9RA 4EO5B 1TAFB 3LZ1C 3KWQA 3WA9B 4JJND 5DNMA 1P34B 4WNNB 3MGPC 5CP6D 3X1SC 1TZYA 3REHB 2PYOA 5JRGB 4WU9B 1P3AC 1KX4B 5AV5D 3UTAA 3KSYA 1P3FD 3WTPB 4X23C 1R4VA 5CP6C 3MGQB 1P3PA 3AN2D
chains in the Genus database with same CATH superfamily
4NE5A 4G91B 5AV5C 2F8ND 5AY8C 5B0YA 1TAFA 3X1UD 3WA9A 3AV1C 5AY8B 2AROC 2F8NK 5GXQB 3W99C 2ZY3A 1KX5A 5B1MD 4Z5TB 5JRGA 1P3ID 5GT0A 3AZEC 4UUZA 4J8VA 4WU8D 5B2IC 2JSSA 4R8PC 3X1UB 3REJC 5B1LC 3W98D 3C1BD 1P3BD 2Y2HA 5AVBA 2HUEC 5B0ZC 5CPJD 3A1IA 4KUDD 4NE3A 1AOIA 5B24C 3MNNC 3WKJB 3AZNA 1M19A 1F66C 3W96D 5B33A 1ZLAB 5AV8D 3W98A 3REHD 5GT0B 1T3UA 5B2JD 4XZQD 3AZLB 5B0YB 1AOIC 5B40A 5GT3D 5B0ZA 3AZID 3LZ0A 3A6NC 1S32A 1HQ3A 5KDMB 3UTBC 1P3OB 2NQBB 1ID3A 4J8VC 4NFTA 2YFWB 3AV1B 5CPKD 2FJ7D 5GT3C 3C1BA 2W8SA 1ULYA 5DNNC 4H9PA 3X1SD 2LY8A 3WKJA 5B33C 3AZHD 2BYKB 4XZQB 3AZLD 3WAAD 5GT0D 4J8XA 2PYOD 2ZY4A 5CP6A 3NQJA 1BFMA 3EPHA 3X1TB 5AVBC 4X23A 5AV6B 2UWXA 1P3OC 5B1MA 4LD9D 1Q9CA 5B32C 1P34D 5KDMA 1P3LC 5B2JC 3AN2A 2HIOD 3AYWB 1KX3B 5GT0C 5B1MC 1P3KC 2FJ7B 3TU4D 4J8UB 3W97B 3W99A 4DRBA 1P3IB 1P3GA 3A6NB 2BYMB 1EQZD 1TZYD 3NQJB 3AZEB 3REKA 3V9RB 4YS3A 3TU4C 3AYWD 2HIOB 5B1LB 1HTAA 3MGSA 3AZGD 3AL0C 4Z66A 2Y2OA 2BG1A 3P5JB 3AYWA 2J8PA 2IO5C 3UTAC 1U35A 5AV6A 4YM6C 3MVDD 4LD9B 3LELB 3W97A 5B31C 3W96B 5GXQC 3MGPA 3AZLC 1JFIB 3REKB 4WU9C 3VH5T 5FUGB 1S32C 1P3AB 4M6BA 3UT9D 3MGPD 5B2IB 1W2EA 2ZY2A 4AWLC 5JA4B 4J8WD 1WWIA 4WU8B 3MVDA 3REID 4KHAB 4G91C 5GSUA 2YFVA 1P3BC 1U35B 3AV2A 1KX3D 4X23D 2AROB 3MGPB 3MGSB 3LELC 3REIC 3EPKA 4Z66B 2Y2PA 4J8UC 3O62A 3C1CD 3LZ0D 4R8PA 3AZIC 5B40D 2Y2GA 5E5AB 3B0DB 1H3OB 1F1EA 3EG5B 3REHA 5AV6C 4YM6A 3F6TA 2PYOB 1P3FB 4ZUXC 5AV9D 2Y2KA 5F99A 3LZ1B 3AZMD 2NQBA 3WTPA 1P3MD 1P34C 4XUJB 2AROA 5AVBD 2YFWA 3AV1A 2CV5C 3WA9C 3LJAC 5C3IC 4ZUXD 2CV5A 5GSUB 3REJD 3AZKC 1P3GC 3WTPC 4X23B 5B1MB 1KX4C 3AZHA 3O62D 1H3OA 3AFAA 5AVCC 4J8XB 5AVBB 2PYOC 3B6GD 4ZUXB 5DNMC 4H9NA 3WTPE 3R45A 3O62C 5B0YD 3X1UA 4J8UA 3AZND 4Z2MH 3AFAC 1M19D 2F8NA 3REIA 3B6FD 4NE6A 5CPIC 3WTPD 1P3MA 2BYMA 3H0MC 3AN2B 3VH6T 5C3IB 4QLCA 2RIQA 3AZFC 3H0RC 3LZ0B 3C1CB 4XUJA 5G49A 4J8VD 4DRAA 3MVDC 4WU9D 5JRGD 1P3IA 3W98B 2VQRA 2NQBC 5B0ZB 3R45B 5B31G 3EPJA 5DNND 1TZYB 4AWLB 1ID3C 2RVQC 2HUEB 5CPJA 3X1VD 1PZRA 4KUDA 2NQBD 3UTAB 3KUYC 1P3PD 5GSUD 1U35C 4YM6D 3LELA 3AZKD 3B0CW 5B2ID 3MGSC 3UTBD 1P3MB 1KU5A 4KHAA 3VH6A 1JFIA 3TU4A 3LELD 3W98C 5B32D 5AV8B 1F66A 3AZNC 1M19C 5E5AD 5B24A 3MNNA 5AV5B 3KUYD 4WU8C 5DNMD 2HIOC 3AZGB 1A7WA 4KGCB 4ZBJC 4G92B 3B6FB 3KWQD 1P3KA 4UUZB 4Z66D 2L5AA 4CAYB 3X1SB 3AZJD 1M18C 3AN2C 1KX3C 5E5AA 5GXQA 1P3LA 5BT1D 3W97C 1M1AA 5B32A 1P3GD 5AVCA 2Y2IA 3AZEA 2ZM5A 5JRGC 2NZDC 3AZHC 3AZKA 3KXBC 4LD9A 1N1JA 3EPLA 5DNMB 1P34A 2G5HC 5GT3B 5DNNA 3KUYB 5AV9B 5B24D 3MNND 3AFAB 1HQ3B 5B32G 1P3KB 3REHC 1P3AA 1B67A 4E45A 2FJ7C 3NQUB 3WKJD 3MGRD 3AZIA 4CAYA 3X1SA 5E5AC 3WAAB 3AZHB 4CSRA 3C1BB 4QLCD 5AVCB 5CPKB 1P3OA 2F8NG 4HGAB 1N1JB 3A6ND 3AZJC 1M18D 5B40C 1ID3D 4H9SA 5AV9A 2JCHA 1P3OD 1P3BA 3REIB 3WKJC 5GSUC 5AV9C 1S32D 3VH5A 1ZLAC 1WWSA 3X1TA 4QLCB 3AV2B 3AZIB 3UT9B 5GT3A 5B0ZD 3WAAA 4XZQA 4XUJD 1P3FC 3REJA 4J8VB 5CHLB 5B31A 3AZGC 2FJ7A 3AZNB 1M19B 1P3BB 3AN2D 1BH9B 2DQNC 4CSRB 5BNVA 2IO5B 2ZY5A 3A6NA 4Z66C 2CV5B 3B0CT 4JJNB 3UT9A 5B0YC 1AOIB 1B6WA 5AV5A 3UTAD 3REKC 1S32B 3REJB 5GXQD 4H9QB 3TU4B 3W97D 5CPIA 4H9NB 4Z5TD 3AZFD 2NZDD 3W96A 5B1LA 1BH9A 2CWEA 5BNVB 3AZJB 1AOID 1TZYC 5B2JB 3W96C 5B31B 1F66D 3LJAD 2Y2LA 4WNNA 3LZ1D 3AZMB 3C1CC 3MGQD 4E44A 5JA4A 3KFUG 4WU8A 3MVDB 4J8XC 1P3LD 2Y2JA 4H9PB 5AY8A 3LJAA 3B6GB 2BYKA 1KX5B 1P3PC 3AV2D 3C1BC 3MGSD 3O62B 3WA9D 2NZDA 4HGAC 1EQZB 3AZFB 5CPIB 5CPID 2G5IC 3RELD 5DNNB 3KUYA 1M1AC 1P3GB 5AY8D 3UTBA 1P3FA 3REKD 3W99D 4XZQC 5F99B 3LZ1A 3KWQC 4YS3B 2Y2NA 5AVCD 3WAAC 3RELC 1M1AD 3VH5W 5BO0A 2HIOA 3X1TC 2JE5A 3B6GC 4EO5C 1ZLAA 4H9RB 3KXBB 3B6FA 5CPKA 5CPKC 4XUJC 3B6FC 5B40B 1P3PA 3V9RA 3AZFA 3X1VA 3LJAB 3B6GA 5B31D 1F66B 5B1LD 5B24B 3MNNB 1M1AB 2FFFB 4WU9A 4J8WC 3AZMC 3AZLA 2NZDB 4J8XD 1EQZA 5B2IA 5CPJC 3MGQA 4KUDC 4ZBJB 5AV8C 4G92C 4WV4B 1KX4A 4WZSB 1KX5C 4J8UD 2RVQD 3IP4C 4Z2MG 1ID3B 1M18B 4KGCC 3MGRC 4LD9C 2F8NB 4Z5TC 3MGRB 4Z5TA 3KXBA 4QLCC 3B0BA 4R8PD 1BH8A 4KGCD 5BT1C 4R8PB 1HQ3D 3C1CA 1P3MC 3AFAD 3X1TD 3X1UC 2Y2MA 5CPJB 4KUDB 3KXBD 5BS7C 5CP6B 3MGQC 4H9QA 5B2JA 3NQUA 5BS7A 1KX3A 2Y2QA 1M18A 5B33D 3AV1D 5F99D 3AZMA 4H9OA 3W99B 4WJ3C 2AROD 4YM6B 3FDDA 2F8NH 3AV2C 1BH8B 4J8WB 3H0LC 4JJNC 3UT9C 5B33B 3MGRA 4KGCA 1KX5D 1P3AD 5F99C 3KWQB 3RELA 4ZUXA 5BNXA 3A1KA 5AV6D 5AV8A 2CV5D 4H9OB 1P3KD 2DF4C 1P3LB 3AZGA 5B32B 1ZLAD 1EQZC 1KX4D 1HQ3C 4J8WA 2XD1A 3AYWC 4YS3D 3VH6W 5BO0B 3AZKB 3LZ0C 3UTBB 1P3IC 2YFVB 3X1VC 3AZED 3RELB 5FUGA 2XD5A 4UPKA 5BNXB 4YS3C 4JJNA 3X1VB 1U35D 4H9SC 5G49B 1P3PB 3B0DC 3AZJA 4H9RA 4EO5B 1TAFB 3LZ1C 3KWQA 3WA9B 4JJND 5DNMA 1P34B 4WNNB 3MGPC 5CP6D 3X1SC 1TZYA 3REHB 2PYOA 5JRGB 4WU9B 1P3AC 1KX4B 5AV5D 3UTAA 3KSYA 1P3FD 3WTPB 4X23C 1R4VA 5CP6C 3MGQB 2F2AC 1Z2CB 4DQYB
chains in the Genus database with same CATH topology
4NE5A 4G91B 5AV5C 2F8ND 5AY8C 5B0YA 1TAFA 3X1UD 3WA9A 3AV1C 5AY8B 2AROC 2F8NK 5GXQB 3W99C 2ZY3A 1KX5A 5B1MD 4Z5TB 5JRGA 1P3ID 5GT0A 3AZEC 4UUZA 4J8VA 4WU8D 5B2IC 2JSSA 4R8PC 3X1UB 3REJC 5B1LC 3W98D 3C1BD 1P3BD 2Y2HA 5AVBA 2HUEC 5B0ZC 5CPJD 3A1IA 4KUDD 4NE3A 1AOIA 5B24C 3MNNC 3WKJB 3AZNA 1M19A 1F66C 3W96D 5B33A 1ZLAB 5AV8D 3W98A 3REHD 5GT0B 1T3UA 5B2JD 4XZQD 3AZLB 5B0YB 1AOIC 5B40A 5GT3D 5B0ZA 3AZID 3LZ0A 3A6NC 1S32A 1HQ3A 5KDMB 3UTBC 1P3OB 2NQBB 1ID3A 4J8VC 4NFTA 2YFWB 3AV1B 5CPKD 2FJ7D 5GT3C 3C1BA 2W8SA 1ULYA 5DNNC 4H9PA 3X1SD 2LY8A 3WKJA 5B33C 3AZHD 2BYKB 4XZQB 3AZLD 3WAAD 5GT0D 4J8XA 2PYOD 2ZY4A 5CP6A 3NQJA 1BFMA 3EPHA 3X1TB 5AVBC 4X23A 5AV6B 2UWXA 1P3OC 5B1MA 4LD9D 1Q9CA 5B32C 1P34D 5KDMA 1P3LC 5B2JC 3AN2A 2HIOD 3AYWB 1KX3B 5GT0C 5B1MC 1P3KC 2FJ7B 3TU4D 4J8UB 3W97B 3W99A 4DRBA 1P3IB 1P3GA 3A6NB 2BYMB 1EQZD 1TZYD 3NQJB 3AZEB 3REKA 3V9RB 4YS3A 3TU4C 3AYWD 2HIOB 5B1LB 1HTAA 3MGSA 3AZGD 3AL0C 4Z66A 2Y2OA 2BG1A 3P5JB 3AYWA 2J8PA 2IO5C 3UTAC 1U35A 5AV6A 4YM6C 3MVDD 4LD9B 3LELB 3W97A 5B31C 3W96B 5GXQC 3MGPA 3AZLC 1JFIB 3REKB 4WU9C 3VH5T 5FUGB 1S32C 1P3AB 4M6BA 3UT9D 3MGPD 5B2IB 1W2EA 2ZY2A 4AWLC 5JA4B 4J8WD 1WWIA 4WU8B 3MVDA 3REID 4KHAB 4G91C 5GSUA 2YFVA 1P3BC 1U35B 3AV2A 1KX3D 4X23D 2AROB 3MGPB 3MGSB 3LELC 3REIC 3EPKA 4Z66B 2Y2PA 4J8UC 3O62A 3C1CD 3LZ0D 4R8PA 3AZIC 5B40D 2Y2GA 5E5AB 3B0DB 1H3OB 1F1EA 3EG5B 3REHA 5AV6C 4YM6A 3F6TA 2PYOB 1P3FB 4ZUXC 5AV9D 2Y2KA 5F99A 3LZ1B 3AZMD 2NQBA 3WTPA 1P3MD 1P34C 4XUJB 2AROA 5AVBD 2YFWA 3AV1A 2CV5C 3WA9C 3LJAC 5C3IC 4ZUXD 2CV5A 5GSUB 3REJD 3AZKC 1P3GC 3WTPC 4X23B 5B1MB 1KX4C 3AZHA 3O62D 1H3OA 3AFAA 5AVCC 4J8XB 5AVBB 2PYOC 3B6GD 4ZUXB 5DNMC 4H9NA 3WTPE 3R45A 3O62C 5B0YD 3X1UA 4J8UA 3AZND 4Z2MH 3AFAC 1M19D 2F8NA 3REIA 3B6FD 4NE6A 5CPIC 3WTPD 1P3MA 2BYMA 3H0MC 3AN2B 3VH6T 5C3IB 4QLCA 2RIQA 3AZFC 3H0RC 3LZ0B 3C1CB 4XUJA 5G49A 4J8VD 4DRAA 3MVDC 4WU9D 5JRGD 1P3IA 3W98B 2VQRA 2NQBC 5B0ZB 3R45B 5B31G 3EPJA 5DNND 1TZYB 4AWLB 1ID3C 2RVQC 2HUEB 5CPJA 3X1VD 1PZRA 4KUDA 2NQBD 3UTAB 3KUYC 1P3PD 5GSUD 1U35C 4YM6D 3LELA 3AZKD 3B0CW 5B2ID 3MGSC 3UTBD 1P3MB 1KU5A 4KHAA 3VH6A 1JFIA 3TU4A 3LELD 3W98C 5B32D 5AV8B 1F66A 3AZNC 1M19C 5E5AD 5B24A 3MNNA 5AV5B 3KUYD 4WU8C 5DNMD 2HIOC 3AZGB 1A7WA 4KGCB 4ZBJC 4G92B 3B6FB 3KWQD 1P3KA 4UUZB 4Z66D 2L5AA 4CAYB 3X1SB 3AZJD 1M18C 3AN2C 1KX3C 5E5AA 5GXQA 1P3LA 5BT1D 3W97C 1M1AA 5B32A 1P3GD 5AVCA 2Y2IA 3AZEA 2ZM5A 5JRGC 2NZDC 3AZHC 3AZKA 3KXBC 4LD9A 1N1JA 3EPLA 5DNMB 1P34A 2G5HC 5GT3B 5DNNA 3KUYB 5AV9B 5B24D 3MNND 3AFAB 1HQ3B 5B32G 1P3KB 3REHC 1P3AA 1B67A 4E45A 2FJ7C 3NQUB 3WKJD 3MGRD 3AZIA 4CAYA 3X1SA 5E5AC 3WAAB 3AZHB 4CSRA 3C1BB 4QLCD 5AVCB 5CPKB 1P3OA 2F8NG 4HGAB 1N1JB 3A6ND 3AZJC 1M18D 5B40C 1ID3D 4H9SA 5AV9A 2JCHA 1P3OD 1P3BA 3REIB 3WKJC 5GSUC 5AV9C 1S32D 3VH5A 1ZLAC 1WWSA 3X1TA 4QLCB 3AV2B 3AZIB 3UT9B 5GT3A 5B0ZD 3WAAA 4XZQA 4XUJD 1P3FC 3REJA 4J8VB 5CHLB 5B31A 3AZGC 2FJ7A 3AZNB 1M19B 1P3BB 3AN2D 1BH9B 2DQNC 4CSRB 5BNVA 2IO5B 2ZY5A 3A6NA 4Z66C 2CV5B 3B0CT 4JJNB 3UT9A 5B0YC 1AOIB 1B6WA 5AV5A 3UTAD 3REKC 1S32B 3REJB 5GXQD 4H9QB 3TU4B 3W97D 5CPIA 4H9NB 4Z5TD 3AZFD 2NZDD 3W96A 5B1LA 1BH9A 2CWEA 5BNVB 3AZJB 1AOID 1TZYC 5B2JB 3W96C 5B31B 1F66D 3LJAD 2Y2LA 4WNNA 3LZ1D 3AZMB 3C1CC 3MGQD 4E44A 5JA4A 3KFUG 4WU8A 3MVDB 4J8XC 1P3LD 2Y2JA 4H9PB 5AY8A 3LJAA 3B6GB 2BYKA 1KX5B 1P3PC 3AV2D 3C1BC 3MGSD 3O62B 3WA9D 2NZDA 4HGAC 1EQZB 3AZFB 5CPIB 5CPID 2G5IC 3RELD 5DNNB 3KUYA 1M1AC 1P3GB 5AY8D 3UTBA 1P3FA 3REKD 3W99D 4XZQC 5F99B 3LZ1A 3KWQC 4YS3B 2Y2NA 5AVCD 3WAAC 3RELC 1M1AD 3VH5W 5BO0A 2HIOA 3X1TC 2JE5A 3B6GC 4EO5C 1ZLAA 4H9RB 3KXBB 3B6FA 5CPKA 5CPKC 4XUJC 3B6FC 5B40B 1P3PA 3V9RA 3AZFA 3X1VA 3LJAB 3B6GA 5B31D 1F66B 5B1LD 5B24B 3MNNB 1M1AB 2FFFB 4WU9A 4J8WC 3AZMC 3AZLA 2NZDB 4J8XD 1EQZA 5B2IA 5CPJC 3MGQA 4KUDC 4ZBJB 5AV8C 4G92C 4WV4B 1KX4A 4WZSB 1KX5C 4J8UD 2RVQD 3IP4C 4Z2MG 1ID3B 1M18B 4KGCC 3MGRC 4LD9C 2F8NB 4Z5TC 3MGRB 4Z5TA 3KXBA 4QLCC 3B0BA 4R8PD 1BH8A 4KGCD 5BT1C 4R8PB 1HQ3D 3C1CA 1P3MC 3AFAD 3X1TD 3X1UC 2Y2MA 5CPJB 4KUDB 3KXBD 5BS7C 5CP6B 3MGQC 4H9QA 5B2JA 3NQUA 5BS7A 1KX3A 2Y2QA 1M18A 5B33D 3AV1D 5F99D 3AZMA 4H9OA 3W99B 4WJ3C 2AROD 4YM6B 3FDDA 2F8NH 3AV2C 1BH8B 4J8WB 3H0LC 4JJNC 3UT9C 5B33B 3MGRA 4KGCA 1KX5D 1P3AD 5F99C 3KWQB 3RELA 4ZUXA 5BNXA 3A1KA 5AV6D 5AV8A 2CV5D 4H9OB 1P3KD 2DF4C 1P3LB 3AZGA 5B32B 1ZLAD 1EQZC 1KX4D 1HQ3C 4J8WA 2XD1A 3AYWC 4YS3D 3VH6W 5BO0B 3AZKB 3LZ0C 3UTBB 1P3IC 2YFVB 3X1VC 3AZED 3RELB 5FUGA 2XD5A 4UPKA 5BNXB 4YS3C 4JJNA 3X1VB 1U35D 4H9SC 5G49B 1P3PB 3B0DC 3AZJA 4H9RA 4EO5B 1TAFB 3LZ1C 3KWQA 3WA9B 4JJND 5DNMA 1P34B 4WNNB 3MGPC 5CP6D 3X1SC 1TZYA 3REHB 2PYOA 5JRGB 4WU9B 1P3AC 1KX4B 5AV5D 3UTAA 3KSYA 1P3FD 3WTPB 4X23C 1R4VA 5CP6C 3MGQB 2F2AC 1Z2CB 4DQYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE5 A;  4G91 B;  5AV5 C;  2F8N D;  5AY8 C;  5B0Y A;  1TAF A;  3X1U D;  3WA9 A;  3AV1 C;  5AY8 B;  2ARO C;  2F8N K;  5GXQ B;  3W99 C;  1KX5 A;  5B1M D;  4Z5T B;  5JRG A;  1P3I D;  5GT0 A;  3AZE C;  4UUZ A;  4J8V A;  4WU8 D;  5B2I C;  2JSS A;  4R8P C;  3X1U B;  3REJ C;  5B1L C;  3W98 D;  3C1B D;  1P3B D;  5AVB A;  2HUE C;  5B0Z C;  5CPJ D;  4KUD D;  4NE3 A;  1AOI A;  5B24 C;  3MNN C;  3WKJ B;  3AZN A;  1M19 A;  1F66 C;  3W96 D;  5B33 A;  1ZLA B;  5AV8 D;  3W98 A;  3REH D;  5GT0 B;  5B2J D;  4XZQ D;  3AZL B;  5B0Y B;  1AOI C;  5B40 A;  5GT3 D;  5B0Z A;  3AZI D;  3LZ0 A;  3A6N C;  1S32 A;  1HQ3 A;  5KDM B;  3UTB C;  1P3O B;  2NQB B;  1ID3 A;  4J8V C;  4NFT A;  2YFW B;  3AV1 B;  5CPK D;  2FJ7 D;  5GT3 C;  3C1B A;  1ULY A;  5DNN C;  4H9P A;  3X1S D;  2LY8 A;  3WKJ A;  5B33 C;  3AZH D;  2BYK B;  4XZQ B;  3AZL D;  3WAA D;  5GT0 D;  4J8X A;  2PYO D;  5CP6 A;  3NQJ A;  1BFM A;  3X1T B;  5AVB C;  4X23 A;  5AV6 B;  1P3O C;  5B1M A;  4LD9 D;  1Q9C A;  5B32 C;  1P34 D;  5KDM A;  1P3L C;  5B2J C;  3AN2 A;  2HIO D;  3AYW B;  1KX3 B;  5GT0 C;  5B1M C;  1P3K C;  2FJ7 B;  3TU4 D;  4J8U B;  3W97 B;  3W99 A;  4DRB A;  1P3I B;  1P3G A;  3A6N B;  2BYM B;  1EQZ D;  1TZY D;  3NQJ B;  3AZE B;  3REK A;  3V9R B;  4YS3 A;  3TU4 C;  3AYW D;  2HIO B;  5B1L B;  1HTA A;  3MGS A;  3AZG D;  4Z66 A;  3AYW A;  4LD9 B;  2IO5 C;  3UTA C;  1U35 A;  5AV6 A;  4YM6 C;  3MVD D;  3LEL B;  3W97 A;  5B31 C;  3W96 B;  5GXQ C;  3MGP A;  3AZL C;  1JFI B;  3REK B;  4WU9 C;  3VH5 T;  5FUG B;  1S32 C;  1P3A B;  4M6B A;  3UT9 D;  3MGP D;  5B2I B;  4AWL C;  5JA4 B;  4J8W D;  1WWI A;  4WU8 B;  3MVD A;  3REI D;  4KHA B;  4G91 C;  5GSU A;  2YFV A;  1P3B C;  1U35 B;  3AV2 A;  1KX3 D;  4X23 D;  2ARO B;  3MGP B;  3MGS B;  3LEL C;  3REI C;  4Z66 B;  4J8U C;  3O62 A;  3C1C D;  3LZ0 D;  4R8P A;  3AZI C;  5B40 D;  5E5A B;  3B0D B;  1H3O B;  1F1E A;  3REH A;  5AV6 C;  4YM6 A;  2PYO B;  1P3F B;  4ZUX C;  5AV9 D;  5F99 A;  3LZ1 B;  3AZM D;  2NQB A;  3WTP A;  1P3M D;  1P34 C;  4XUJ B;  2ARO A;  5AVB D;  2YFW A;  3AV1 A;  2CV5 C;  3WA9 C;  3LJA C;  5C3I C;  4ZUX D;  2CV5 A;  5GSU B;  3REJ D;  3AZK C;  1P3G C;  3WTP C;  4X23 B;  5B1M B;  1KX4 C;  3AZH A;  3O62 D;  1H3O A;  3AFA A;  5AVC C;  4J8X B;  5AVB B;  2PYO C;  3B6G D;  4ZUX B;  5DNM C;  4H9N A;  3WTP E;  3R45 A;  3O62 C;  5B0Y D;  3X1U A;  4J8U A;  3AZN D;  4Z2M H;  3AFA C;  1M19 D;  2F8N A;  3REI A;  3B6F D;  4NE6 A;  5CPI C;  3WTP D;  1P3M A;  2BYM A;  3AN2 B;  3VH6 T;  5C3I B;  4QLC A;  3AZF C;  3LZ0 B;  3C1C B;  4XUJ A;  5G49 A;  4J8V D;  4DRA A;  3MVD C;  4WU9 D;  5JRG D;  1P3I A;  3W98 B;  2NQB C;  5B0Z B;  3R45 B;  5B31 G;  5DNN D;  1TZY B;  4AWL B;  1ID3 C;  2RVQ C;  2HUE B;  5CPJ A;  3X1V D;  4KUD A;  2NQB D;  3UTA B;  3KUY C;  1P3P D;  5GSU D;  1U35 C;  4YM6 D;  3LEL A;  3AZK D;  3B0C W;  5B2I D;  3MGS C;  3UTB D;  1P3M B;  1KU5 A;  4KHA A;  3VH6 A;  1JFI A;  3TU4 A;  3LEL D;  3W98 C;  5B32 D;  5AV8 B;  1F66 A;  3AZN C;  1M19 C;  5E5A D;  5B24 A;  3MNN A;  5AV5 B;  3KUY D;  4WU8 C;  5DNM D;  2HIO C;  3AZG B;  1A7W A;  4KGC B;  4ZBJ C;  4G92 B;  3B6F B;  3KWQ D;  1P3K A;  4UUZ B;  4Z66 D;  2L5A A;  4CAY B;  3X1S B;  3AZJ D;  1M18 C;  3AN2 C;  1KX3 C;  5E5A A;  5GXQ A;  1P3L A;  5BT1 D;  3W97 C;  1M1A A;  5B32 A;  1P3G D;  5AVC A;  3AZE A;  5JRG C;  2NZD C;  3AZH C;  3AZK A;  3KXB C;  4LD9 A;  1N1J A;  5DNM B;  1P34 A;  5GT3 B;  5DNN A;  3KUY B;  5AV9 B;  5B24 D;  3MNN D;  3AFA B;  1HQ3 B;  5B32 G;  1P3K B;  3REH C;  1P3A A;  1B67 A;  4E45 A;  2FJ7 C;  3NQU B;  3WKJ D;  3MGR D;  3AZI A;  4CAY A;  3X1S A;  5E5A C;  3WAA B;  3AZH B;  4CSR A;  3C1B B;  4QLC D;  5AVC B;  5CPK B;  1P3O A;  2F8N G;  4HGA B;  1N1J B;  3A6N D;  3AZJ C;  1M18 D;  5B40 C;  1ID3 D;  4H9S A;  5AV9 A;  1P3O D;  1P3B A;  3REI B;  3WKJ C;  5GSU C;  5AV9 C;  1S32 D;  3VH5 A;  1ZLA C;  1WWS A;  3X1T A;  4QLC B;  3AV2 B;  3AZI B;  3UT9 B;  5GT3 A;  5B0Z D;  3WAA A;  4XZQ A;  4XUJ D;  1P3F C;  3REJ A;  4J8V B;  5CHL B;  5B31 A;  3AZG C;  2FJ7 A;  3AZN B;  1M19 B;  1P3B B;  1BH9 B;  4CSR B;  5BNV A;  2IO5 B;  3A6N A;  2CV5 B;  4Z66 C;  3B0C T;  4JJN B;  3UT9 A;  5B0Y C;  1AOI B;  1B6W A;  5AV5 A;  3UTA D;  3REK C;  1S32 B;  3REJ B;  5GXQ D;  4H9Q B;  3TU4 B;  3W97 D;  5CPI A;  4H9N B;  4Z5T D;  3AZF D;  2NZD D;  3W96 A;  5B1L A;  1BH9 A;  2CWE A;  5BNV B;  3AZJ B;  1AOI D;  1TZY C;  5B2J B;  3W96 C;  5B31 B;  1F66 D;  3LJA D;  4WNN A;  3LZ1 D;  3AZM B;  3C1C C;  3MGQ D;  4E44 A;  5JA4 A;  4WU8 A;  3MVD B;  4J8X C;  1P3L D;  4H9P B;  5AY8 A;  3LJA A;  3B6G B;  2BYK A;  1KX5 B;  1P3P C;  3AV2 D;  3C1B C;  3MGS D;  3O62 B;  3WA9 D;  2NZD A;  4HGA C;  1EQZ B;  3AZF B;  5CPI B;  5CPI D;  3REL D;  5DNN B;  3KUY A;  1M1A C;  1P3G B;  5AY8 D;  3UTB A;  1P3F A;  3REK D;  3W99 D;  4XZQ C;  5F99 B;  3LZ1 A;  3KWQ C;  4YS3 B;  5AVC D;  3WAA C;  3REL C;  1M1A D;  3VH5 W;  5BO0 A;  2HIO A;  3X1T C;  3B6G C;  4EO5 C;  1ZLA A;  4H9R B;  3KXB B;  3B6F A;  5CPK A;  5CPK C;  4XUJ C;  3B6F C;  5B40 B;  3V9R A;  3AZF A;  3X1V A;  3LJA B;  3B6G A;  5B31 D;  1F66 B;  5B1L D;  5B24 B;  3MNN B;  1M1A B;  4WU9 A;  4J8W C;  3AZM C;  3AZL A;  2NZD B;  4J8X D;  1EQZ A;  5B2I A;  5CPJ C;  3MGQ A;  4KUD C;  4ZBJ B;  5AV8 C;  4G92 C;  4WV4 B;  1KX4 A;  4WZS B;  1KX5 C;  4J8U D;  2RVQ D;  4Z2M G;  1ID3 B;  1M18 B;  4KGC C;  3MGR C;  4LD9 C;  2F8N B;  4Z5T C;  3MGR B;  4Z5T A;  3KXB A;  4QLC C;  3B0B A;  4R8P D;  1BH8 A;  4KGC D;  5BT1 C;  4R8P B;  1HQ3 D;  3C1C A;  1P3M C;  3AFA D;  3X1T D;  3X1U C;  5CPJ B;  4KUD B;  3KXB D;  5BS7 C;  5CP6 B;  3MGQ C;  4H9Q A;  5B2J A;  3NQU A;  5BS7 A;  1KX3 A;  1M18 A;  5B33 D;  3AV1 D;  5F99 D;  3AZM A;  4H9O A;  3W99 B;  2ARO D;  4YM6 B;  2F8N H;  3AV2 C;  1BH8 B;  4J8W B;  4JJN C;  3UT9 C;  5B33 B;  3MGR A;  4KGC A;  1KX5 D;  1P3A D;  5F99 C;  3KWQ B;  3REL A;  4ZUX A;  5BNX A;  5AV6 D;  2CV5 D;  5AV8 A;  4H9O B;  1P3K D;  1P3L B;  3AZG A;  5B32 B;  1ZLA D;  1EQZ C;  1KX4 D;  1HQ3 C;  4J8W A;  3AYW C;  4YS3 D;  3VH6 W;  5BO0 B;  3AZK B;  3LZ0 C;  3UTB B;  1P3I C;  2YFV B;  3X1V C;  3AZE D;  3REL B;  5FUG A;  3X1V B;  5BNX B;  4YS3 C;  4JJN A;  1U35 D;  4H9S C;  5G49 B;  1P3P B;  3B0D C;  3AZJ A;  4H9R A;  4EO5 B;  1TAF B;  3LZ1 C;  3KWQ A;  3WA9 B;  4JJN D;  5DNM A;  1P34 B;  4WNN B;  3MGP C;  5CP6 D;  3X1S C;  1TZY A;  3REH B;  2PYO A;  5JRG B;  4WU9 B;  1P3A C;  1KX4 B;  5AV5 D;  3UTA A;  3KSY A;  1P3F D;  3WTP B;  4X23 C;  1R4V A;  5CP6 C;  3MGQ B;  1P3P A;  3AN2 D; 
#chains in the Genus database with same CATH topology
 4NE5 A;  4G91 B;  5AV5 C;  2F8N D;  5AY8 C;  5B0Y A;  1TAF A;  3X1U D;  3WA9 A;  3AV1 C;  5AY8 B;  2ARO C;  2F8N K;  5GXQ B;  3W99 C;  2ZY3 A;  1KX5 A;  5B1M D;  4Z5T B;  5JRG A;  1P3I D;  5GT0 A;  3AZE C;  4UUZ A;  4J8V A;  4WU8 D;  5B2I C;  2JSS A;  4R8P C;  3X1U B;  3REJ C;  5B1L C;  3W98 D;  3C1B D;  1P3B D;  2Y2H A;  5AVB A;  2HUE C;  5B0Z C;  5CPJ D;  3A1I A;  4KUD D;  4NE3 A;  1AOI A;  5B24 C;  3MNN C;  3WKJ B;  3AZN A;  1M19 A;  1F66 C;  3W96 D;  5B33 A;  1ZLA B;  5AV8 D;  3W98 A;  3REH D;  5GT0 B;  1T3U A;  5B2J D;  4XZQ D;  3AZL B;  5B0Y B;  1AOI C;  5B40 A;  5GT3 D;  5B0Z A;  3AZI D;  3LZ0 A;  3A6N C;  1S32 A;  1HQ3 A;  5KDM B;  3UTB C;  1P3O B;  2NQB B;  1ID3 A;  4J8V C;  4NFT A;  2YFW B;  3AV1 B;  5CPK D;  2FJ7 D;  5GT3 C;  3C1B A;  2W8S A;  1ULY A;  5DNN C;  4H9P A;  3X1S D;  2LY8 A;  3WKJ A;  5B33 C;  3AZH D;  2BYK B;  4XZQ B;  3AZL D;  3WAA D;  5GT0 D;  4J8X A;  2PYO D;  2ZY4 A;  5CP6 A;  3NQJ A;  1BFM A;  3EPH A;  3X1T B;  5AVB C;  4X23 A;  5AV6 B;  2UWX A;  1P3O C;  5B1M A;  4LD9 D;  1Q9C A;  5B32 C;  1P34 D;  5KDM A;  1P3L C;  5B2J C;  3AN2 A;  2HIO D;  3AYW B;  1KX3 B;  5GT0 C;  5B1M C;  1P3K C;  2FJ7 B;  3TU4 D;  4J8U B;  3W97 B;  3W99 A;  4DRB A;  1P3I B;  1P3G A;  3A6N B;  2BYM B;  1EQZ D;  1TZY D;  3NQJ B;  3AZE B;  3REK A;  3V9R B;  4YS3 A;  3TU4 C;  3AYW D;  2HIO B;  5B1L B;  1HTA A;  3MGS A;  3AZG D;  3AL0 C;  4Z66 A;  2Y2O A;  2BG1 A;  3P5J B;  3AYW A;  2J8P A;  2IO5 C;  3UTA C;  1U35 A;  5AV6 A;  4YM6 C;  3MVD D;  4LD9 B;  3LEL B;  3W97 A;  5B31 C;  3W96 B;  5GXQ C;  3MGP A;  3AZL C;  1JFI B;  3REK B;  4WU9 C;  3VH5 T;  5FUG B;  1S32 C;  1P3A B;  4M6B A;  3UT9 D;  3MGP D;  5B2I B;  1W2E A;  2ZY2 A;  4AWL C;  5JA4 B;  4J8W D;  1WWI A;  4WU8 B;  3MVD A;  3REI D;  4KHA B;  4G91 C;  5GSU A;  2YFV A;  1P3B C;  1U35 B;  3AV2 A;  1KX3 D;  4X23 D;  2ARO B;  3MGP B;  3MGS B;  3LEL C;  3REI C;  3EPK A;  4Z66 B;  2Y2P A;  4J8U C;  3O62 A;  3C1C D;  3LZ0 D;  4R8P A;  3AZI C;  5B40 D;  2Y2G A;  5E5A B;  3B0D B;  1H3O B;  1F1E A;  3EG5 B;  3REH A;  5AV6 C;  4YM6 A;  3F6T A;  2PYO B;  1P3F B;  4ZUX C;  5AV9 D;  2Y2K A;  5F99 A;  3LZ1 B;  3AZM D;  2NQB A;  3WTP A;  1P3M D;  1P34 C;  4XUJ B;  2ARO A;  5AVB D;  2YFW A;  3AV1 A;  2CV5 C;  3WA9 C;  3LJA C;  5C3I C;  4ZUX D;  2CV5 A;  5GSU B;  3REJ D;  3AZK C;  1P3G C;  3WTP C;  4X23 B;  5B1M B;  1KX4 C;  3AZH A;  3O62 D;  1H3O A;  3AFA A;  5AVC C;  4J8X B;  5AVB B;  2PYO C;  3B6G D;  4ZUX B;  5DNM C;  4H9N A;  3WTP E;  3R45 A;  3O62 C;  5B0Y D;  3X1U A;  4J8U A;  3AZN D;  4Z2M H;  3AFA C;  1M19 D;  2F8N A;  3REI A;  3B6F D;  4NE6 A;  5CPI C;  3WTP D;  1P3M A;  2BYM A;  3H0M C;  3AN2 B;  3VH6 T;  5C3I B;  4QLC A;  2RIQ A;  3AZF C;  3H0R C;  3LZ0 B;  3C1C B;  4XUJ A;  5G49 A;  4J8V D;  4DRA A;  3MVD C;  4WU9 D;  5JRG D;  1P3I A;  3W98 B;  2VQR A;  2NQB C;  5B0Z B;  3R45 B;  5B31 G;  3EPJ A;  5DNN D;  1TZY B;  4AWL B;  1ID3 C;  2RVQ C;  2HUE B;  5CPJ A;  3X1V D;  1PZR A;  4KUD A;  2NQB D;  3UTA B;  3KUY C;  1P3P D;  5GSU D;  1U35 C;  4YM6 D;  3LEL A;  3AZK D;  3B0C W;  5B2I D;  3MGS C;  3UTB D;  1P3M B;  1KU5 A;  4KHA A;  3VH6 A;  1JFI A;  3TU4 A;  3LEL D;  3W98 C;  5B32 D;  5AV8 B;  1F66 A;  3AZN C;  1M19 C;  5E5A D;  5B24 A;  3MNN A;  5AV5 B;  3KUY D;  4WU8 C;  5DNM D;  2HIO C;  3AZG B;  1A7W A;  4KGC B;  4ZBJ C;  4G92 B;  3B6F B;  3KWQ D;  1P3K A;  4UUZ B;  4Z66 D;  2L5A A;  4CAY B;  3X1S B;  3AZJ D;  1M18 C;  3AN2 C;  1KX3 C;  5E5A A;  5GXQ A;  1P3L A;  5BT1 D;  3W97 C;  1M1A A;  5B32 A;  1P3G D;  5AVC A;  2Y2I A;  3AZE A;  2ZM5 A;  5JRG C;  2NZD C;  3AZH C;  3AZK A;  3KXB C;  4LD9 A;  1N1J A;  3EPL A;  5DNM B;  1P34 A;  2G5H C;  5GT3 B;  5DNN A;  3KUY B;  5AV9 B;  5B24 D;  3MNN D;  3AFA B;  1HQ3 B;  5B32 G;  1P3K B;  3REH C;  1P3A A;  1B67 A;  4E45 A;  2FJ7 C;  3NQU B;  3WKJ D;  3MGR D;  3AZI A;  4CAY A;  3X1S A;  5E5A C;  3WAA B;  3AZH B;  4CSR A;  3C1B B;  4QLC D;  5AVC B;  5CPK B;  1P3O A;  2F8N G;  4HGA B;  1N1J B;  3A6N D;  3AZJ C;  1M18 D;  5B40 C;  1ID3 D;  4H9S A;  5AV9 A;  2JCH A;  1P3O D;  1P3B A;  3REI B;  3WKJ C;  5GSU C;  5AV9 C;  1S32 D;  3VH5 A;  1ZLA C;  1WWS A;  3X1T A;  4QLC B;  3AV2 B;  3AZI B;  3UT9 B;  5GT3 A;  5B0Z D;  3WAA A;  4XZQ A;  4XUJ D;  1P3F C;  3REJ A;  4J8V B;  5CHL B;  5B31 A;  3AZG C;  2FJ7 A;  3AZN B;  1M19 B;  1P3B B;  3AN2 D;  1BH9 B;  2DQN C;  4CSR B;  5BNV A;  2IO5 B;  2ZY5 A;  3A6N A;  4Z66 C;  2CV5 B;  3B0C T;  4JJN B;  3UT9 A;  5B0Y C;  1AOI B;  1B6W A;  5AV5 A;  3UTA D;  3REK C;  1S32 B;  3REJ B;  5GXQ D;  4H9Q B;  3TU4 B;  3W97 D;  5CPI A;  4H9N B;  4Z5T D;  3AZF D;  2NZD D;  3W96 A;  5B1L A;  1BH9 A;  2CWE A;  5BNV B;  3AZJ B;  1AOI D;  1TZY C;  5B2J B;  3W96 C;  5B31 B;  1F66 D;  3LJA D;  2Y2L A;  4WNN A;  3LZ1 D;  3AZM B;  3C1C C;  3MGQ D;  4E44 A;  5JA4 A;  3KFU G;  4WU8 A;  3MVD B;  4J8X C;  1P3L D;  2Y2J A;  4H9P B;  5AY8 A;  3LJA A;  3B6G B;  2BYK A;  1KX5 B;  1P3P C;  3AV2 D;  3C1B C;  3MGS D;  3O62 B;  3WA9 D;  2NZD A;  4HGA C;  1EQZ B;  3AZF B;  5CPI B;  5CPI D;  2G5I C;  3REL D;  5DNN B;  3KUY A;  1M1A C;  1P3G B;  5AY8 D;  3UTB A;  1P3F A;  3REK D;  3W99 D;  4XZQ C;  5F99 B;  3LZ1 A;  3KWQ C;  4YS3 B;  2Y2N A;  5AVC D;  3WAA C;  3REL C;  1M1A D;  3VH5 W;  5BO0 A;  2HIO A;  3X1T C;  2JE5 A;  3B6G C;  4EO5 C;  1ZLA A;  4H9R B;  3KXB B;  3B6F A;  5CPK A;  5CPK C;  4XUJ C;  3B6F C;  5B40 B;  1P3P A;  3V9R A;  3AZF A;  3X1V A;  3LJA B;  3B6G A;  5B31 D;  1F66 B;  5B1L D;  5B24 B;  3MNN B;  1M1A B;  2FFF B;  4WU9 A;  4J8W C;  3AZM C;  3AZL A;  2NZD B;  4J8X D;  1EQZ A;  5B2I A;  5CPJ C;  3MGQ A;  4KUD C;  4ZBJ B;  5AV8 C;  4G92 C;  4WV4 B;  1KX4 A;  4WZS B;  1KX5 C;  4J8U D;  2RVQ D;  3IP4 C;  4Z2M G;  1ID3 B;  1M18 B;  4KGC C;  3MGR C;  4LD9 C;  2F8N B;  4Z5T C;  3MGR B;  4Z5T A;  3KXB A;  4QLC C;  3B0B A;  4R8P D;  1BH8 A;  4KGC D;  5BT1 C;  4R8P B;  1HQ3 D;  3C1C A;  1P3M C;  3AFA D;  3X1T D;  3X1U C;  2Y2M A;  5CPJ B;  4KUD B;  3KXB D;  5BS7 C;  5CP6 B;  3MGQ C;  4H9Q A;  5B2J A;  3NQU A;  5BS7 A;  1KX3 A;  2Y2Q A;  1M18 A;  5B33 D;  3AV1 D;  5F99 D;  3AZM A;  4H9O A;  3W99 B;  4WJ3 C;  2ARO D;  4YM6 B;  3FDD A;  2F8N H;  3AV2 C;  1BH8 B;  4J8W B;  3H0L C;  4JJN C;  3UT9 C;  5B33 B;  3MGR A;  4KGC A;  1KX5 D;  1P3A D;  5F99 C;  3KWQ B;  3REL A;  4ZUX A;  5BNX A;  3A1K A;  5AV6 D;  5AV8 A;  2CV5 D;  4H9O B;  1P3K D;  2DF4 C;  1P3L B;  3AZG A;  5B32 B;  1ZLA D;  1EQZ C;  1KX4 D;  1HQ3 C;  4J8W A;  2XD1 A;  3AYW C;  4YS3 D;  3VH6 W;  5BO0 B;  3AZK B;  3LZ0 C;  3UTB B;  1P3I C;  2YFV B;  3X1V C;  3AZE D;  3REL B;  5FUG A;  2XD5 A;  4UPK A;  5BNX B;  4YS3 C;  4JJN A;  3X1V B;  1U35 D;  4H9S C;  5G49 B;  1P3P B;  3B0D C;  3AZJ A;  4H9R A;  4EO5 B;  1TAF B;  3LZ1 C;  3KWQ A;  3WA9 B;  4JJN D;  5DNM A;  1P34 B;  4WNN B;  3MGP C;  5CP6 D;  3X1S C;  1TZY A;  3REH B;  2PYO A;  5JRG B;  4WU9 B;  1P3A C;  1KX4 B;  5AV5 D;  3UTA A;  3KSY A;  1P3F D;  3WTP B;  4X23 C;  1R4V A;  5CP6 C;  3MGQ B;  2F2A C;  1Z2C B;  4DQY B; 
#chains in the Genus database with same CATH homology
 4NE5 A;  4G91 B;  5AV5 C;  2F8N D;  5AY8 C;  5B0Y A;  1TAF A;  3X1U D;  3WA9 A;  3AV1 C;  5AY8 B;  2ARO C;  2F8N K;  5GXQ B;  3W99 C;  2ZY3 A;  1KX5 A;  5B1M D;  4Z5T B;  5JRG A;  1P3I D;  5GT0 A;  3AZE C;  4UUZ A;  4J8V A;  4WU8 D;  5B2I C;  2JSS A;  4R8P C;  3X1U B;  3REJ C;  5B1L C;  3W98 D;  3C1B D;  1P3B D;  2Y2H A;  5AVB A;  2HUE C;  5B0Z C;  5CPJ D;  3A1I A;  4KUD D;  4NE3 A;  1AOI A;  5B24 C;  3MNN C;  3WKJ B;  3AZN A;  1M19 A;  1F66 C;  3W96 D;  5B33 A;  1ZLA B;  5AV8 D;  3W98 A;  3REH D;  5GT0 B;  1T3U A;  5B2J D;  4XZQ D;  3AZL B;  5B0Y B;  1AOI C;  5B40 A;  5GT3 D;  5B0Z A;  3AZI D;  3LZ0 A;  3A6N C;  1S32 A;  1HQ3 A;  5KDM B;  3UTB C;  1P3O B;  2NQB B;  1ID3 A;  4J8V C;  4NFT A;  2YFW B;  3AV1 B;  5CPK D;  2FJ7 D;  5GT3 C;  3C1B A;  2W8S A;  1ULY A;  5DNN C;  4H9P A;  3X1S D;  2LY8 A;  3WKJ A;  5B33 C;  3AZH D;  2BYK B;  4XZQ B;  3AZL D;  3WAA D;  5GT0 D;  4J8X A;  2PYO D;  2ZY4 A;  5CP6 A;  3NQJ A;  1BFM A;  3EPH A;  3X1T B;  5AVB C;  4X23 A;  5AV6 B;  2UWX A;  1P3O C;  5B1M A;  4LD9 D;  1Q9C A;  5B32 C;  1P34 D;  5KDM A;  1P3L C;  5B2J C;  3AN2 A;  2HIO D;  3AYW B;  1KX3 B;  5GT0 C;  5B1M C;  1P3K C;  2FJ7 B;  3TU4 D;  4J8U B;  3W97 B;  3W99 A;  4DRB A;  1P3I B;  1P3G A;  3A6N B;  2BYM B;  1EQZ D;  1TZY D;  3NQJ B;  3AZE B;  3REK A;  3V9R B;  4YS3 A;  3TU4 C;  3AYW D;  2HIO B;  5B1L B;  1HTA A;  3MGS A;  3AZG D;  3AL0 C;  4Z66 A;  2Y2O A;  2BG1 A;  3P5J B;  3AYW A;  2J8P A;  2IO5 C;  3UTA C;  1U35 A;  5AV6 A;  4YM6 C;  3MVD D;  4LD9 B;  3LEL B;  3W97 A;  5B31 C;  3W96 B;  5GXQ C;  3MGP A;  3AZL C;  1JFI B;  3REK B;  4WU9 C;  3VH5 T;  5FUG B;  1S32 C;  1P3A B;  4M6B A;  3UT9 D;  3MGP D;  5B2I B;  1W2E A;  2ZY2 A;  4AWL C;  5JA4 B;  4J8W D;  1WWI A;  4WU8 B;  3MVD A;  3REI D;  4KHA B;  4G91 C;  5GSU A;  2YFV A;  1P3B C;  1U35 B;  3AV2 A;  1KX3 D;  4X23 D;  2ARO B;  3MGP B;  3MGS B;  3LEL C;  3REI C;  3EPK A;  4Z66 B;  2Y2P A;  4J8U C;  3O62 A;  3C1C D;  3LZ0 D;  4R8P A;  3AZI C;  5B40 D;  2Y2G A;  5E5A B;  3B0D B;  1H3O B;  1F1E A;  3EG5 B;  3REH A;  5AV6 C;  4YM6 A;  3F6T A;  2PYO B;  1P3F B;  4ZUX C;  5AV9 D;  2Y2K A;  5F99 A;  3LZ1 B;  3AZM D;  2NQB A;  3WTP A;  1P3M D;  1P34 C;  4XUJ B;  2ARO A;  5AVB D;  2YFW A;  3AV1 A;  2CV5 C;  3WA9 C;  3LJA C;  5C3I C;  4ZUX D;  2CV5 A;  5GSU B;  3REJ D;  3AZK C;  1P3G C;  3WTP C;  4X23 B;  5B1M B;  1KX4 C;  3AZH A;  3O62 D;  1H3O A;  3AFA A;  5AVC C;  4J8X B;  5AVB B;  2PYO C;  3B6G D;  4ZUX B;  5DNM C;  4H9N A;  3WTP E;  3R45 A;  3O62 C;  5B0Y D;  3X1U A;  4J8U A;  3AZN D;  4Z2M H;  3AFA C;  1M19 D;  2F8N A;  3REI A;  3B6F D;  4NE6 A;  5CPI C;  3WTP D;  1P3M A;  2BYM A;  3H0M C;  3AN2 B;  3VH6 T;  5C3I B;  4QLC A;  2RIQ A;  3AZF C;  3H0R C;  3LZ0 B;  3C1C B;  4XUJ A;  5G49 A;  4J8V D;  4DRA A;  3MVD C;  4WU9 D;  5JRG D;  1P3I A;  3W98 B;  2VQR A;  2NQB C;  5B0Z B;  3R45 B;  5B31 G;  3EPJ A;  5DNN D;  1TZY B;  4AWL B;  1ID3 C;  2RVQ C;  2HUE B;  5CPJ A;  3X1V D;  1PZR A;  4KUD A;  2NQB D;  3UTA B;  3KUY C;  1P3P D;  5GSU D;  1U35 C;  4YM6 D;  3LEL A;  3AZK D;  3B0C W;  5B2I D;  3MGS C;  3UTB D;  1P3M B;  1KU5 A;  4KHA A;  3VH6 A;  1JFI A;  3TU4 A;  3LEL D;  3W98 C;  5B32 D;  5AV8 B;  1F66 A;  3AZN C;  1M19 C;  5E5A D;  5B24 A;  3MNN A;  5AV5 B;  3KUY D;  4WU8 C;  5DNM D;  2HIO C;  3AZG B;  1A7W A;  4KGC B;  4ZBJ C;  4G92 B;  3B6F B;  3KWQ D;  1P3K A;  4UUZ B;  4Z66 D;  2L5A A;  4CAY B;  3X1S B;  3AZJ D;  1M18 C;  3AN2 C;  1KX3 C;  5E5A A;  5GXQ A;  1P3L A;  5BT1 D;  3W97 C;  1M1A A;  5B32 A;  1P3G D;  5AVC A;  2Y2I A;  3AZE A;  2ZM5 A;  5JRG C;  2NZD C;  3AZH C;  3AZK A;  3KXB C;  4LD9 A;  1N1J A;  3EPL A;  5DNM B;  1P34 A;  2G5H C;  5GT3 B;  5DNN A;  3KUY B;  5AV9 B;  5B24 D;  3MNN D;  3AFA B;  1HQ3 B;  5B32 G;  1P3K B;  3REH C;  1P3A A;  1B67 A;  4E45 A;  2FJ7 C;  3NQU B;  3WKJ D;  3MGR D;  3AZI A;  4CAY A;  3X1S A;  5E5A C;  3WAA B;  3AZH B;  4CSR A;  3C1B B;  4QLC D;  5AVC B;  5CPK B;  1P3O A;  2F8N G;  4HGA B;  1N1J B;  3A6N D;  3AZJ C;  1M18 D;  5B40 C;  1ID3 D;  4H9S A;  5AV9 A;  2JCH A;  1P3O D;  1P3B A;  3REI B;  3WKJ C;  5GSU C;  5AV9 C;  1S32 D;  3VH5 A;  1ZLA C;  1WWS A;  3X1T A;  4QLC B;  3AV2 B;  3AZI B;  3UT9 B;  5GT3 A;  5B0Z D;  3WAA A;  4XZQ A;  4XUJ D;  1P3F C;  3REJ A;  4J8V B;  5CHL B;  5B31 A;  3AZG C;  2FJ7 A;  3AZN B;  1M19 B;  1P3B B;  3AN2 D;  1BH9 B;  2DQN C;  4CSR B;  5BNV A;  2IO5 B;  2ZY5 A;  3A6N A;  4Z66 C;  2CV5 B;  3B0C T;  4JJN B;  3UT9 A;  5B0Y C;  1AOI B;  1B6W A;  5AV5 A;  3UTA D;  3REK C;  1S32 B;  3REJ B;  5GXQ D;  4H9Q B;  3TU4 B;  3W97 D;  5CPI A;  4H9N B;  4Z5T D;  3AZF D;  2NZD D;  3W96 A;  5B1L A;  1BH9 A;  2CWE A;  5BNV B;  3AZJ B;  1AOI D;  1TZY C;  5B2J B;  3W96 C;  5B31 B;  1F66 D;  3LJA D;  2Y2L A;  4WNN A;  3LZ1 D;  3AZM B;  3C1C C;  3MGQ D;  4E44 A;  5JA4 A;  3KFU G;  4WU8 A;  3MVD B;  4J8X C;  1P3L D;  2Y2J A;  4H9P B;  5AY8 A;  3LJA A;  3B6G B;  2BYK A;  1KX5 B;  1P3P C;  3AV2 D;  3C1B C;  3MGS D;  3O62 B;  3WA9 D;  2NZD A;  4HGA C;  1EQZ B;  3AZF B;  5CPI B;  5CPI D;  2G5I C;  3REL D;  5DNN B;  3KUY A;  1M1A C;  1P3G B;  5AY8 D;  3UTB A;  1P3F A;  3REK D;  3W99 D;  4XZQ C;  5F99 B;  3LZ1 A;  3KWQ C;  4YS3 B;  2Y2N A;  5AVC D;  3WAA C;  3REL C;  1M1A D;  3VH5 W;  5BO0 A;  2HIO A;  3X1T C;  2JE5 A;  3B6G C;  4EO5 C;  1ZLA A;  4H9R B;  3KXB B;  3B6F A;  5CPK A;  5CPK C;  4XUJ C;  3B6F C;  5B40 B;  1P3P A;  3V9R A;  3AZF A;  3X1V A;  3LJA B;  3B6G A;  5B31 D;  1F66 B;  5B1L D;  5B24 B;  3MNN B;  1M1A B;  2FFF B;  4WU9 A;  4J8W C;  3AZM C;  3AZL A;  2NZD B;  4J8X D;  1EQZ A;  5B2I A;  5CPJ C;  3MGQ A;  4KUD C;  4ZBJ B;  5AV8 C;  4G92 C;  4WV4 B;  1KX4 A;  4WZS B;  1KX5 C;  4J8U D;  2RVQ D;  3IP4 C;  4Z2M G;  1ID3 B;  1M18 B;  4KGC C;  3MGR C;  4LD9 C;  2F8N B;  4Z5T C;  3MGR B;  4Z5T A;  3KXB A;  4QLC C;  3B0B A;  4R8P D;  1BH8 A;  4KGC D;  5BT1 C;  4R8P B;  1HQ3 D;  3C1C A;  1P3M C;  3AFA D;  3X1T D;  3X1U C;  2Y2M A;  5CPJ B;  4KUD B;  3KXB D;  5BS7 C;  5CP6 B;  3MGQ C;  4H9Q A;  5B2J A;  3NQU A;  5BS7 A;  1KX3 A;  2Y2Q A;  1M18 A;  5B33 D;  3AV1 D;  5F99 D;  3AZM A;  4H9O A;  3W99 B;  4WJ3 C;  2ARO D;  4YM6 B;  3FDD A;  2F8N H;  3AV2 C;  1BH8 B;  4J8W B;  3H0L C;  4JJN C;  3UT9 C;  5B33 B;  3MGR A;  4KGC A;  1KX5 D;  1P3A D;  5F99 C;  3KWQ B;  3REL A;  4ZUX A;  5BNX A;  3A1K A;  5AV6 D;  5AV8 A;  2CV5 D;  4H9O B;  1P3K D;  2DF4 C;  1P3L B;  3AZG A;  5B32 B;  1ZLA D;  1EQZ C;  1KX4 D;  1HQ3 C;  4J8W A;  2XD1 A;  3AYW C;  4YS3 D;  3VH6 W;  5BO0 B;  3AZK B;  3LZ0 C;  3UTB B;  1P3I C;  2YFV B;  3X1V C;  3AZE D;  3REL B;  5FUG A;  2XD5 A;  4UPK A;  5BNX B;  4YS3 C;  4JJN A;  3X1V B;  1U35 D;  4H9S C;  5G49 B;  1P3P B;  3B0D C;  3AZJ A;  4H9R A;  4EO5 B;  1TAF B;  3LZ1 C;  3KWQ A;  3WA9 B;  4JJN D;  5DNM A;  1P34 B;  4WNN B;  3MGP C;  5CP6 D;  3X1S C;  1TZY A;  3REH B;  2PYO A;  5JRG B;  4WU9 B;  1P3A C;  1KX4 B;  5AV5 D;  3UTA A;  3KSY A;  1P3F D;  3WTP B;  4X23 C;  1R4V A;  5CP6 C;  3MGQ B;  2F2A C;  1Z2C B;  4DQY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...