3LZ1D

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 2)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 35
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz1D00
1U35A 4JJND 3MGSA 3WA9D 4XUJC 4G91C 4H9NB 4YS3D 2AROB 1M19B 5AY8C 2FJ7D 2YFWA 3KWQD 5DNNA 5AVCA 3MNNA 4ZUXA 3C1CD 2NQBC 5CP6B 3KXBB 2BYKB 5G49B 5B33C 3AV1D 4R8PA 1KX3B 4DRBA 3REKC 3B6FD 4WU9A 1KX5B 5BO0B 3B0BA 4J8VA 5CPIB 5B0YC 3UTAC 3R45B 3AFAB 5BNXB 4G92B 1B67A 1ZLAB 2AROD 3MGPB 5B32B 4Z2MG 1KX4C 3X1SB 3LZ0C 1WWIA 2PYOD 3W99A 3VH5T 3KUYD 1TZYB 3AZFC 4XUJA 1M1AD 1KX3D 3B0CW 3MGRC 3REHB 1P3KC 3X1UD 1KX5D 3MGQB 5DNMB 1HQ3C 3AV2B 3B6GB 1P3MB 3AZKD 3AFAD 2NQBA 3B0DB 1ZLAD 3O62B 3MVDC 5B32D 2NZDB 3REJB 3AN2B 3REKA 4J8UC 3AZHB 5AVBC 3UT9B 5FUGB 3A6NC 5B0YA 4J8XC 3WTPC 4H9OB 1TZYD 3X1VC 1P3GB 1KX4A 3MGQD 4X23B 3AV2D 3B6GD 1P3MD 5CPJD 5B1LC 3W97C 5B1MC 3AYWB 3C1BC 3AZFA 2NZDD 3MGRA 3AN2D 5CPKC 1P3KA 5GT3C 1P3PB 5JA4A 4WU8C 1S32B 1HQ3A 3AZGA 4HGAB 3LELB 2LY8A 3NQUA 5B2IC 3MVDA 4H9RB 3V9RA 5B40C 4J8UA 4X23D 2CV5D 3A6NA 1EQZA 1P3IB 3WTPA 3VH6W 5AV9B 3X1VA 1P3PD 1S32D 3AZNA 5BT1D 5GXQB 4XZQC 3UTBC 3LELD 3WAAB 5E5AB 3LJAB 5B31D 4UUZB 3W97A 4CAYA 5B1MA 1P3BB 3NQJB 3AZIB 4KGCD 3TU4C 5CPKA 5GT3A 4WU8A 5BS7C 1ID3B 1BH8B 5AV5C 5B2IA 1BH9B 4Z5TB 5B40A 4QLCC 4J8WC 3RELC 2IO5C 2YFVA 5GXQD 5GT0D 3AZMB 2RVQC 5F99B 4JJNB 1P3BD 5BNVB 3AZID 4AWLC 2HIOC 3WKJC 3MGSB 2FJ7B 4Z2MH 1ID3D 3UTBA 2HUEB 4YS3C 3AV1B 3MNNB 3X1TC 3LZ1A 3TU4A 3KWQC 5B0ZD 4KHAA 3B6FB 3AZMD 3W98A 3C1CC 5JRGD 1P3FD 5AV5A 5B2JB 3AZEA 5F99D 4WU9B 3W96C 1JFIA 4J8WA 4QLCA 4WNNA 3MGSD 3REIA 4CSRA 1AOIB 3AZLC 2PYOB 1F66A 3KUYB 2AROC 5AVCD 3MNND 1M19C 4ZUXD 1M1AB 4YM6A 3W99B 1P3LB 3WKJA 4WV4B 3X1UB 4R8PD 5CP6C 3KXBC 5B2JD 4WU9D 5C3IB 3AZKB 2F8NA 1KX3C 4J8VD 1P3AA 3X1TA 1KX5C 1P3OB 5CPIC 1H3OB 3AFAC 1AOID 4G92C 1ZLAC 3W96A 3MGPC 5B32C 3W99D 1P3LD 5AY8A 3X1SC 4XUJD 4NE3A 2F8NG 3AZLA 5CPJB 4H9PB 1TZYC 5B33A 3REHC 1M19A 2NQBD 1P3OD 5DNMC 3AV2C 3B6GC 1P3MC 5CP6A 3B0DC 3KXBA 5G49A 3REKD 1M18B 3UTAA 4KUDB 5JA4B 4LD9C 3O62C 2NZDC 3REJC 3AN2C 5B0YD 3AZHC 3AZGB 3UT9C 5BO0A 5CPIA 3B0CT 3R45A 3MVDB 3AFAA 2CV5B 5BNXA 3LZ0A 1KX4D 3VH6A 1ZLAA 3MGPA 3A6NB 1P3GC 1EQZB 5KDMB 3X1SA 4X23C 3AZFD 3WTPE 5AV6B 4EO5B 1P3KD 1M18D 4KUDD 1TZYA 3AYWC 3AZNB 5B31B 3REHA 3AZGD 1HTAA 1P3PC 4KGCB 5DNMA 1S32C 5BT1C 5AVBA 4HGAC 5B24C 3MVDD 3LELC 5CPKB 4J8XA 3AZJC 4LD9A 3O62A 3A6ND 3REJA 3AZHA 1EQZD 3UT9A 3WTPD 5AV6D 1P3IC 5GT0B 5B40B 3X1VD 5GSUC 5B1LA 5AV9C 3AZND 3C1BA 1P3GA 5CHLB 4Z66C 5GXQC 3W97D 5B1MD 3WAAC 5E5AC 3LJAC 5CPKD 3AYWA 1P3BC 3AZIC 3VH6T 5AV8C 4ZBJB 5B0ZB 5B2ID 5B24A 5B40D 1P34C 3LZ1B 5JRGB 4KHAB 3AZJA 1P3FB 4Z5TC 3W98B 1U35B 3AZEB 3AZMC 1P3IA 1JFIB 4XZQA 5GSUA 5F99C 4JJNC 4WNNB 5AV9A 3REIB 2YFWB 3WA9C 3UTBD 5DNNB 5AVCB 4ZUXB 4Z66A 2FJ7C 4H9QA 1F66B 3WAAA 5BS7A 5E5AA 4YM6B 4R8PB 3LZ1D 3LJAA 3TU4D 3AV1C 3NQJA 3MNNC 3AZIA 3W98D 4E44A 2F8NH 1U35D 4J8VB 5AV8A 5AV5D 3RELA 3AZED 2F8NB 3B6FC 1P3AB 1BH8A 1P34A 4J8WD 4QLCD 3X1TB 5B2JC 4WU9C 3REID 4Z5TA 5DNND 3AZMA 2HIOA 1F66D 1Q9CA 4NE6A 1N1JA 4G91B 4XUJB 4YM6D 1AOIC 2PYOC 5F99A 5AY8B 4JJNA 3KUYC 5BNVA 3WA9A 1M1AC 3W99C 4YS3A 1P3LC 3AZLB 2F8ND 2FJ7A 3X1UC 3KWQA 4H9SC 5B33B 2NQBB 1P3AD 3X1TD 2F8NK 3C1CA 5C3IC 3AZKC 3VH5W 3REKB 1KU5A 3AV1A 1TAFA 2CWEA 1P3OC 5B0YB 3B6FA 3UTAB 1BFMA 2BYMA 4E45A 3W96D 5B2JA 5AY8D 1KX4B 4H9NA 3KSYA 2AROA 3LZ0B 3AZLD 5B33D 3MGQC 1M19D 3AZFB 1AOIA 5CPJC 2PYOA 3MGRB 2BYKA 3KUYA 1P3KB 4NE5A 1M1AA 1KX3A 1HQ3B 5CP6D 3KXBD 1P3LA 3UTAD 1F1EA 3X1UA 1KX5A 4H9SA 1WWSA 3NQUB 1M18C 3AZKA 4KUDC 3V9RB 4J8UB 5AVBB 5CPID 3AZGC 5B32A 3LZ0D 1P3OA 1ULYA 4J8XB 3WTPB 4LD9B 3MGPD 1H3OA 2CV5C 3MGRD 3X1SD 3X1VB 1HQ3D 1EQZC 5B1LB 3MGQA 5AV6C 3REHD 3AV2A 4DRAA 3B6GA 4CAYB 5B1MB 4EO5C 3C1BB 5CPJA 1P3MA 4H9PA 3W97B 5DNMD 4J8UD 3AZNC 5B31C 5AVBD 5GT3B 4WU8B 4KGCC 5B32G 2NZDA 3AN2A 4J8XD 4LD9D 3O62D 3REJD 4NFTA 5FUGA 3AZHD 3UT9D 1M18A 5B2IB 4KUDA 4H9OA 1B6WA 2YFVB 5B24B 5B1LD 4M6BA 3AZJB 4X23A 2CV5A 5GT0C 3WKJD 3C1BD 1P3GD 4WZSB 5GT3D 4WU8D 5KDMA 4XZQB 3UTBB 5GSUB 1P3PA 3AYWD 5AV6A 1S32A 1ID3C 3LELA 4Z66B 3TU4B 5B31A 4H9QB 4KGCA 5B24D 4H9RA 3AZJD 4ZBJC 5B0ZC 5AV5B 2JSSA 1R4VA 3LZ1C 2L5AA 5JRGC 4J8WB 5AV8B 4QLCB 3RELB 2IO5B 1P3FC 3W98C 1U35C 1P3ID 1P34B 4CSRB 4XZQD 5GSUD 3AZEC 5AV9D 3MGSC 5GT0A 5GXQA 4Z66D 5B31G 3REIC 4AWLB 2HUEC 4UUZA 2HIOB 3WKJB 5DNNC 1P3BA 5AVCC 3WAAD 1N1JB 5E5AD 4ZUXC 3LJAD 1F66C 3WA9B 1ID3A 4R8PC 4YM6C 4YS3B 3VH5A 5AV8D 3RELD 3KWQB 4J8VC 1P34D 1BH9A 2RVQD 3C1CB 1A7WA 5B0ZA 1P3AC 4Z5TD 1TAFB 3W96B 5JRGA 1P3FA 2HIOD 2BYMB
chains in the Genus database with same CATH superfamily
1U35A 4JJND 3MGSA 3WA9D 4XUJC 4G91C 4H9NB 4YS3D 2AROB 1M19B 5AY8C 2FJ7D 2YFWA 3KWQD 5DNNA 5AVCA 3MNNA 4ZUXA 3C1CD 2NQBC 5CP6B 3KXBB 2BYKB 5G49B 5B33C 2Y2MA 3AV1D 4R8PA 1KX3B 4DRBA 3REKC 3B6FD 4WU9A 1KX5B 3H0LC 5BO0B 3B0BA 4J8VA 5CPIB 5B0YC 3UTAC 3R45B 3AFAB 5BNXB 4G92B 1B67A 1ZLAB 3EPHA 2AROD 3MGPB 1Z2CB 2Y2NA 4Z2MG 5B32B 1KX4C 2Y2JA 3X1SB 3LZ0C 1WWIA 2PYOD 3W99A 3VH5T 3KUYD 1TZYB 3AZFC 4XUJA 2ZY5A 1M1AD 1KX3D 3B0CW 3MGRC 3REHB 2ZY4A 2W8SA 1P3KC 3X1UD 1KX5D 3MGQB 5DNMB 1HQ3C 3AV2B 3B6GB 1P3MB 3AZKD 3AFAD 2NQBA 3B0DB 1ZLAD 3O62B 3MVDC 5B32D 2NZDB 3REJB 3AN2B 3REKA 4J8UC 3AZHB 5AVBC 3UT9B 1PZRA 2Y2LA 5FUGB 3A6NC 5B0YA 4J8XC 3WTPC 2ZY2A 4H9OB 1TZYD 3X1VC 1P3GB 1KX4A 3MGQD 4X23B 3AV2D 3B6GD 1P3MD 1T3UA 5CPJD 5B1LC 3W97C 5B1MC 3AYWB 3C1BC 3AZFA 2NZDD 3MGRA 3AN2D 5CPKC 1P3KA 5GT3C 1P3PB 5JA4A 4WU8C 1S32B 1HQ3A 4WJ3C 3AZGA 4HGAB 3LELB 2XD1A 2LY8A 3NQUA 5B2IC 3MVDA 4H9RB 3V9RA 5B40C 4J8UA 4X23D 2CV5D 3A6NA 1EQZA 1P3IB 3WTPA 3VH6W 5AV9B 3X1VA 1P3PD 1S32D 3AZNA 5BT1D 5GXQB 4XZQC 3UTBC 3LELD 3WAAB 5E5AB 3LJAB 5B31D 4UUZB 3W97A 4CAYA 5B1MA 1P3BB 3NQJB 3AZIB 4KGCD 3EPLA 3TU4C 5CPKA 2J8PA 5GT3A 4WU8A 2ZM5A 5BS7C 1ID3B 1BH8B 5AV5C 5B2IA 1BH9B 4Z5TB 5B40A 4QLCC 4J8WC 3RELC 2IO5C 2YFVA 2Y2KA 5GXQD 5GT0D 3AZMB 2RVQC 5F99B 4JJNB 1P3BD 5BNVB 3AZID 4AWLC 2HIOC 3WKJC 3IP4C 3MGSB 2FJ7B 4Z2MH 1ID3D 3UTBA 2HUEB 4YS3C 3AV1B 3MNNB 3X1TC 3LZ1A 3TU4A 3KWQC 5B0ZD 4KHAA 3B6FB 3AZMD 3W98A 3C1CC 5JRGD 1P3FD 5AV5A 5B2JB 3AZEA 5F99D 4WU9B 3W96C 3A1KA 1JFIA 4J8WA 4QLCA 4WNNA 3MGSD 3REIA 4CSRA 1AOIB 3AZLC 2PYOB 1F66A 3KUYB 2AROC 1W2EA 5AVCD 3MNND 4ZUXD 1M19C 1M1AB 4YM6A 3W99B 1P3LB 3WKJA 4WV4B 3X1UB 4R8PD 5CP6C 3KXBC 5B2JD 4WU9D 5C3IB 3AZKB 2F8NA 1KX3C 4J8VD 1P3AA 3X1TA 1KX5C 1P3OB 5CPIC 1H3OB 3AFAC 1AOID 4G92C 1ZLAC 3W96A 3MGPC 5B32C 3W99D 2ZY3A 1P3LD 5AY8A 3X1SC 4XUJD 4NE3A 2Y2IA 3KFUG 2F8NG 3AZLA 5CPJB 4H9PB 1TZYC 5B33A 3REHC 1M19A 2NQBD 1P3OD 5DNMC 3AV2C 3B6GC 1P3MC 5CP6A 3B0DC 3KXBA 5G49A 3REKD 1M18B 3UTAA 4KUDB 5JA4B 4LD9C 3O62C 2NZDC 3REJC 3AN2C 3AL0C 5B0YD 3AZHC 3AZGB 3UT9C 2XD5A 5BO0A 4DQYB 5CPIA 3B0CT 3R45A 3MVDB 3AFAA 2CV5B 5BNXA 3LZ0A 1KX4D 3VH6A 1ZLAA 2BG1A 2F2AC 3MGPA 3A6NB 2Y2HA 1P3GC 1EQZB 5KDMB 3X1SA 4X23C 3AZFD 3WTPE 5AV6B 4EO5B 1P3KD 1M18D 4KUDD 1TZYA 3AYWC 3AZNB 5B31B 3REHA 3AZGD 1HTAA 1P3PC 4KGCB 5DNMA 2UWXA 1S32C 5BT1C 5AVBA 4HGAC 5B24C 3MVDD 3LELC 5CPKB 4J8XA 3AZJC 4LD9A 3O62A 3A6ND 3REJA 2Y2OA 3AZHA 3UT9A 1EQZD 3WTPD 5AV6D 1P3IC 5GT0B 5B40B 3X1VD 5GSUC 5B1LA 5AV9C 3AZND 3C1BA 1P3GA 5CHLB 4Z66C 5GXQC 3W97D 5B1MD 3WAAC 3A1IA 5E5AC 3LJAC 5CPKD 3AYWA 1P3BC 3AZIC 3EPKA 3VH6T 5AV8C 4ZBJB 5B0ZB 5B2ID 5B24A 5B40D 1P34C 3LZ1B 5JRGB 4KHAB 3AZJA 1P3FB 4Z5TC 3W98B 1U35B 3AZEB 3AZMC 2G5IC 2JCHA 1P3IA 1JFIB 2DF4C 4XZQA 5GSUA 5F99C 4JJNC 4WNNB 5AV9A 3REIB 2YFWB 3WA9C 3UTBD 5DNNB 5AVCB 4ZUXB 4Z66A 2FJ7C 4H9QA 2Y2PA 1F66B 3WAAA 5BS7A 5E5AA 4YM6B 4R8PB 3LZ1D 3LJAA 3TU4D 3AV1C 3NQJA 3MNNC 3AZIA 3W98D 4E44A 2F8NH 1U35D 4J8VB 5AV8A 5AV5D 3RELA 3AZED 2F8NB 3B6FC 1P3AB 1BH8A 1P34A 4J8WD 4QLCD 3X1TB 5B2JC 4WU9C 2Y2QA 3REID 4Z5TA 5DNND 3AZMA 2HIOA 1F66D 1Q9CA 4NE6A 1N1JA 4G91B 4XUJB 4YM6D 1AOIC 2PYOC 5F99A 5AY8B 4JJNA 3KUYC 5BNVA 3WA9A 1M1AC 3W99C 4YS3A 1P3LC 3AZLB 2F8ND 2FJ7A 3X1UC 3KWQA 4H9SC 5B33B 2NQBB 1P3AD 3X1TD 2F8NK 3C1CA 5C3IC 3AZKC 3VH5W 3REKB 1KU5A 3AV1A 1TAFA 2CWEA 1P3OC 5B0YB 3B6FA 3UTAB 1BFMA 2BYMA 4E45A 3W96D 5B2JA 5AY8D 1KX4B 4H9NA 3KSYA 2AROA 3LZ0B 3AZLD 5B33D 3MGQC 1M19D 3AZFB 1AOIA 5CPJC 2PYOA 3MGRB 2BYKA 3KUYA 1P3KB 4NE5A 1M1AA 1KX3A 1HQ3B 5CP6D 3KXBD 1P3LA 3UTAD 1F1EA 2Y2GA 3X1UA 4H9SA 1KX5A 1WWSA 4UPKA 3NQUB 1M18C 3AZKA 4KUDC 3V9RB 3EPJA 4J8UB 5AVBB 5CPID 3AZGC 5B32A 2VQRA 3LZ0D 1P3OA 1ULYA 4J8XB 3WTPB 4LD9B 3MGPD 1H3OA 2CV5C 3MGRD 2G5HC 3X1SD 3X1VB 1HQ3D 1EQZC 2JE5A 5B1LB 3FDDA 3MGQA 5AV6C 3REHD 3AV2A 4DRAA 3B6GA 4CAYB 5B1MB 4EO5C 3C1BB 5CPJA 1P3MA 4H9PA 3W97B 5DNMD 4J8UD 3AZNC 5B31C 5AVBD 5GT3B 4WU8B 4KGCC 5B32G 2NZDA 3AN2A 4J8XD 4LD9D 3O62D 3REJD 4NFTA 5FUGA 3AZHD 3UT9D 1M18A 5B2IB 4KUDA 4H9OA 1B6WA 2YFVB 5B24B 5B1LD 4M6BA 3AZJB 4X23A 2CV5A 5GT0C 3F6TA 3WKJD 3C1BD 1P3GD 2FFFB 4WZSB 5GT3D 4WU8D 5KDMA 4XZQB 3UTBB 5GSUB 1P3PA 3AYWD 5AV6A 1S32A 1ID3C 3LELA 4Z66B 3TU4B 5B31A 4H9QB 4KGCA 5B24D 4H9RA 3AZJD 4ZBJC 5B0ZC 5AV5B 2JSSA 1R4VA 3LZ1C 2L5AA 5JRGC 4J8WB 5AV8B 4QLCB 3RELB 2IO5B 1P3FC 3W98C 1U35C 1P3ID 1P34B 4CSRB 4XZQD 5GSUD 3AZEC 5AV9D 3MGSC 5GT0A 5GXQA 2RIQA 4Z66D 5B31G 3REIC 4AWLB 2HUEC 4UUZA 2HIOB 3WKJB 5DNNC 3H0RC 5AVCC 1P3BA 3WAAD 1N1JB 5E5AD 4ZUXC 3LJAD 1F66C 3WA9B 1ID3A 4R8PC 4YM6C 4YS3B 3VH5A 5AV8D 3RELD 3KWQB 2DQNC 4J8VC 1P34D 1BH9A 2RVQD 3H0MC 3C1CB 1A7WA 5B0ZA 3P5JB 1P3AC 4Z5TD 1TAFB 3W96B 5JRGA 3EG5B 1P3FA 2HIOD 2BYMB
chains in the Genus database with same CATH topology
1U35A 4JJND 3MGSA 3WA9D 4XUJC 4G91C 4H9NB 4YS3D 2AROB 1M19B 5AY8C 2FJ7D 2YFWA 3KWQD 5DNNA 5AVCA 3MNNA 4ZUXA 3C1CD 2NQBC 5CP6B 3KXBB 2BYKB 5G49B 5B33C 2Y2MA 3AV1D 4R8PA 1KX3B 4DRBA 3REKC 3B6FD 4WU9A 1KX5B 3H0LC 5BO0B 3B0BA 4J8VA 5CPIB 5B0YC 3UTAC 3R45B 3AFAB 5BNXB 4G92B 1B67A 1ZLAB 3EPHA 2AROD 3MGPB 1Z2CB 2Y2NA 4Z2MG 5B32B 1KX4C 2Y2JA 3X1SB 3LZ0C 1WWIA 2PYOD 3W99A 3VH5T 3KUYD 1TZYB 3AZFC 4XUJA 2ZY5A 1M1AD 1KX3D 3B0CW 3MGRC 3REHB 2ZY4A 2W8SA 1P3KC 3X1UD 1KX5D 3MGQB 5DNMB 1HQ3C 3AV2B 3B6GB 1P3MB 3AZKD 3AFAD 2NQBA 3B0DB 1ZLAD 3O62B 3MVDC 5B32D 2NZDB 3REJB 3AN2B 3REKA 4J8UC 3AZHB 5AVBC 3UT9B 1PZRA 2Y2LA 5FUGB 3A6NC 5B0YA 4J8XC 3WTPC 2ZY2A 4H9OB 1TZYD 3X1VC 1P3GB 1KX4A 3MGQD 4X23B 3AV2D 3B6GD 1P3MD 1T3UA 5CPJD 5B1LC 3W97C 5B1MC 3AYWB 3C1BC 3AZFA 2NZDD 3MGRA 3AN2D 5CPKC 1P3KA 5GT3C 1P3PB 5JA4A 4WU8C 1S32B 1HQ3A 4WJ3C 3AZGA 4HGAB 3LELB 2XD1A 2LY8A 3NQUA 5B2IC 3MVDA 4H9RB 3V9RA 5B40C 4J8UA 4X23D 2CV5D 3A6NA 1EQZA 1P3IB 3WTPA 3VH6W 5AV9B 3X1VA 1P3PD 1S32D 3AZNA 5BT1D 5GXQB 4XZQC 3UTBC 3LELD 3WAAB 5E5AB 3LJAB 5B31D 4UUZB 3W97A 4CAYA 5B1MA 1P3BB 3NQJB 3AZIB 4KGCD 3EPLA 3TU4C 5CPKA 2J8PA 5GT3A 4WU8A 2ZM5A 5BS7C 1ID3B 1BH8B 5AV5C 5B2IA 1BH9B 4Z5TB 5B40A 4QLCC 4J8WC 3RELC 2IO5C 2YFVA 2Y2KA 5GXQD 5GT0D 3AZMB 2RVQC 5F99B 4JJNB 1P3BD 5BNVB 3AZID 4AWLC 2HIOC 3WKJC 3IP4C 3MGSB 2FJ7B 4Z2MH 1ID3D 3UTBA 2HUEB 4YS3C 3AV1B 3MNNB 3X1TC 3LZ1A 3TU4A 3KWQC 5B0ZD 4KHAA 3B6FB 3AZMD 3W98A 3C1CC 5JRGD 1P3FD 5AV5A 5B2JB 3AZEA 5F99D 4WU9B 3W96C 3A1KA 1JFIA 4J8WA 4QLCA 4WNNA 3MGSD 3REIA 4CSRA 1AOIB 3AZLC 2PYOB 1F66A 3KUYB 2AROC 1W2EA 5AVCD 3MNND 4ZUXD 1M19C 1M1AB 4YM6A 3W99B 1P3LB 3WKJA 4WV4B 3X1UB 4R8PD 5CP6C 3KXBC 5B2JD 4WU9D 5C3IB 3AZKB 2F8NA 1KX3C 4J8VD 1P3AA 3X1TA 1KX5C 1P3OB 5CPIC 1H3OB 3AFAC 1AOID 4G92C 1ZLAC 3W96A 3MGPC 5B32C 3W99D 2ZY3A 1P3LD 5AY8A 3X1SC 4XUJD 4NE3A 2Y2IA 3KFUG 2F8NG 3AZLA 5CPJB 4H9PB 1TZYC 5B33A 3REHC 1M19A 2NQBD 1P3OD 5DNMC 3AV2C 3B6GC 1P3MC 5CP6A 3B0DC 3KXBA 5G49A 3REKD 1M18B 3UTAA 4KUDB 5JA4B 4LD9C 3O62C 2NZDC 3REJC 3AN2C 3AL0C 5B0YD 3AZHC 3AZGB 3UT9C 2XD5A 5BO0A 4DQYB 5CPIA 3B0CT 3R45A 3MVDB 3AFAA 2CV5B 5BNXA 3LZ0A 1KX4D 3VH6A 1ZLAA 2BG1A 2F2AC 3MGPA 3A6NB 2Y2HA 1P3GC 1EQZB 5KDMB 3X1SA 4X23C 3AZFD 3WTPE 5AV6B 4EO5B 1P3KD 1M18D 4KUDD 1TZYA 3AYWC 3AZNB 5B31B 3REHA 3AZGD 1HTAA 1P3PC 4KGCB 5DNMA 2UWXA 1S32C 5BT1C 5AVBA 4HGAC 5B24C 3MVDD 3LELC 5CPKB 4J8XA 3AZJC 4LD9A 3O62A 3A6ND 3REJA 2Y2OA 3AZHA 3UT9A 1EQZD 3WTPD 5AV6D 1P3IC 5GT0B 5B40B 3X1VD 5GSUC 5B1LA 5AV9C 3AZND 3C1BA 1P3GA 5CHLB 4Z66C 5GXQC 3W97D 5B1MD 3WAAC 3A1IA 5E5AC 3LJAC 5CPKD 3AYWA 1P3BC 3AZIC 3EPKA 3VH6T 5AV8C 4ZBJB 5B0ZB 5B2ID 5B24A 5B40D 1P34C 3LZ1B 5JRGB 4KHAB 3AZJA 1P3FB 4Z5TC 3W98B 1U35B 3AZEB 3AZMC 2G5IC 2JCHA 1P3IA 1JFIB 2DF4C 4XZQA 5GSUA 5F99C 4JJNC 4WNNB 5AV9A 3REIB 2YFWB 3WA9C 3UTBD 5DNNB 5AVCB 4ZUXB 4Z66A 2FJ7C 4H9QA 2Y2PA 1F66B 3WAAA 5BS7A 5E5AA 4YM6B 4R8PB 3LZ1D 3LJAA 3TU4D 3AV1C 3NQJA 3MNNC 3AZIA 3W98D 4E44A 2F8NH 1U35D 4J8VB 5AV8A 5AV5D 3RELA 3AZED 2F8NB 3B6FC 1P3AB 1BH8A 1P34A 4J8WD 4QLCD 3X1TB 5B2JC 4WU9C 2Y2QA 3REID 4Z5TA 5DNND 3AZMA 2HIOA 1F66D 1Q9CA 4NE6A 1N1JA 4G91B 4XUJB 4YM6D 1AOIC 2PYOC 5F99A 5AY8B 4JJNA 3KUYC 5BNVA 3WA9A 1M1AC 3W99C 4YS3A 1P3LC 3AZLB 2F8ND 2FJ7A 3X1UC 3KWQA 4H9SC 5B33B 2NQBB 1P3AD 3X1TD 2F8NK 3C1CA 5C3IC 3AZKC 3VH5W 3REKB 1KU5A 3AV1A 1TAFA 2CWEA 1P3OC 5B0YB 3B6FA 3UTAB 1BFMA 2BYMA 4E45A 3W96D 5B2JA 5AY8D 1KX4B 4H9NA 3KSYA 2AROA 3LZ0B 3AZLD 5B33D 3MGQC 1M19D 3AZFB 1AOIA 5CPJC 2PYOA 3MGRB 2BYKA 3KUYA 1P3KB 4NE5A 1M1AA 1KX3A 1HQ3B 5CP6D 3KXBD 1P3LA 3UTAD 1F1EA 2Y2GA 3X1UA 4H9SA 1KX5A 1WWSA 4UPKA 3NQUB 1M18C 3AZKA 4KUDC 3V9RB 3EPJA 4J8UB 5AVBB 5CPID 3AZGC 5B32A 2VQRA 3LZ0D 1P3OA 1ULYA 4J8XB 3WTPB 4LD9B 3MGPD 1H3OA 2CV5C 3MGRD 2G5HC 3X1SD 3X1VB 1HQ3D 1EQZC 2JE5A 5B1LB 3FDDA 3MGQA 5AV6C 3REHD 3AV2A 4DRAA 3B6GA 4CAYB 5B1MB 4EO5C 3C1BB 5CPJA 1P3MA 4H9PA 3W97B 5DNMD 4J8UD 3AZNC 5B31C 5AVBD 5GT3B 4WU8B 4KGCC 5B32G 2NZDA 3AN2A 4J8XD 4LD9D 3O62D 3REJD 4NFTA 5FUGA 3AZHD 3UT9D 1M18A 5B2IB 4KUDA 4H9OA 1B6WA 2YFVB 5B24B 5B1LD 4M6BA 3AZJB 4X23A 2CV5A 5GT0C 3F6TA 3WKJD 3C1BD 1P3GD 2FFFB 4WZSB 5GT3D 4WU8D 5KDMA 4XZQB 3UTBB 5GSUB 1P3PA 3AYWD 5AV6A 1S32A 1ID3C 3LELA 4Z66B 3TU4B 5B31A 4H9QB 4KGCA 5B24D 4H9RA 3AZJD 4ZBJC 5B0ZC 5AV5B 2JSSA 1R4VA 3LZ1C 2L5AA 5JRGC 4J8WB 5AV8B 4QLCB 3RELB 2IO5B 1P3FC 3W98C 1U35C 1P3ID 1P34B 4CSRB 4XZQD 5GSUD 3AZEC 5AV9D 3MGSC 5GT0A 5GXQA 2RIQA 4Z66D 5B31G 3REIC 4AWLB 2HUEC 4UUZA 2HIOB 3WKJB 5DNNC 3H0RC 5AVCC 1P3BA 3WAAD 1N1JB 5E5AD 4ZUXC 3LJAD 1F66C 3WA9B 1ID3A 4R8PC 4YM6C 4YS3B 3VH5A 5AV8D 3RELD 3KWQB 2DQNC 4J8VC 1P34D 1BH9A 2RVQD 3H0MC 3C1CB 1A7WA 5B0ZA 3P5JB 1P3AC 4Z5TD 1TAFB 3W96B 5JRGA 3EG5B 1P3FA 2HIOD 2BYMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U35 A;  4JJN D;  3MGS A;  3WA9 D;  4XUJ C;  4G91 C;  4H9N B;  4YS3 D;  2ARO B;  1M19 B;  5AY8 C;  2FJ7 D;  2YFW A;  3KWQ D;  5DNN A;  5AVC A;  3MNN A;  4ZUX A;  3C1C D;  2NQB C;  5CP6 B;  3KXB B;  2BYK B;  5G49 B;  5B33 C;  3AV1 D;  4R8P A;  1KX3 B;  4DRB A;  3REK C;  3B6F D;  4WU9 A;  1KX5 B;  5BO0 B;  3B0B A;  4J8V A;  5CPI B;  5B0Y C;  3UTA C;  3R45 B;  3AFA B;  5BNX B;  4G92 B;  1B67 A;  1ZLA B;  2ARO D;  3MGP B;  5B32 B;  4Z2M G;  1KX4 C;  3X1S B;  3LZ0 C;  1WWI A;  2PYO D;  3W99 A;  3VH5 T;  3KUY D;  1TZY B;  3AZF C;  4XUJ A;  1M1A D;  1KX3 D;  3B0C W;  3MGR C;  3REH B;  1P3K C;  3X1U D;  1KX5 D;  3MGQ B;  5DNM B;  1HQ3 C;  3AV2 B;  3B6G B;  1P3M B;  3AZK D;  3AFA D;  2NQB A;  3B0D B;  1ZLA D;  3O62 B;  3MVD C;  5B32 D;  2NZD B;  3REJ B;  3AN2 B;  3REK A;  4J8U C;  3AZH B;  5AVB C;  3UT9 B;  5FUG B;  3A6N C;  5B0Y A;  4J8X C;  3WTP C;  4H9O B;  1TZY D;  3X1V C;  1P3G B;  1KX4 A;  3MGQ D;  4X23 B;  3AV2 D;  3B6G D;  1P3M D;  5CPJ D;  5B1L C;  3W97 C;  5B1M C;  3AYW B;  3C1B C;  3AZF A;  2NZD D;  3MGR A;  3AN2 D;  5CPK C;  1P3K A;  5GT3 C;  1P3P B;  5JA4 A;  4WU8 C;  1S32 B;  1HQ3 A;  3AZG A;  4HGA B;  3LEL B;  2LY8 A;  3NQU A;  5B2I C;  3MVD A;  4H9R B;  3V9R A;  5B40 C;  4J8U A;  4X23 D;  2CV5 D;  3A6N A;  1EQZ A;  1P3I B;  3WTP A;  3VH6 W;  5AV9 B;  3X1V A;  1P3P D;  1S32 D;  3AZN A;  5BT1 D;  5GXQ B;  4XZQ C;  3UTB C;  3LEL D;  3WAA B;  5E5A B;  3LJA B;  5B31 D;  4UUZ B;  3W97 A;  4CAY A;  5B1M A;  1P3B B;  3NQJ B;  3AZI B;  4KGC D;  3TU4 C;  5CPK A;  5GT3 A;  4WU8 A;  5BS7 C;  1ID3 B;  1BH8 B;  5AV5 C;  5B2I A;  1BH9 B;  4Z5T B;  5B40 A;  4QLC C;  4J8W C;  3REL C;  2IO5 C;  2YFV A;  5GXQ D;  5GT0 D;  3AZM B;  2RVQ C;  5F99 B;  4JJN B;  1P3B D;  5BNV B;  3AZI D;  4AWL C;  2HIO C;  3WKJ C;  3MGS B;  2FJ7 B;  4Z2M H;  1ID3 D;  3UTB A;  2HUE B;  4YS3 C;  3AV1 B;  3MNN B;  3X1T C;  3LZ1 A;  3TU4 A;  3KWQ C;  5B0Z D;  4KHA A;  3B6F B;  3AZM D;  3W98 A;  3C1C C;  5JRG D;  1P3F D;  5AV5 A;  5B2J B;  3AZE A;  5F99 D;  4WU9 B;  3W96 C;  1JFI A;  4J8W A;  4QLC A;  4WNN A;  3MGS D;  3REI A;  4CSR A;  1AOI B;  3AZL C;  2PYO B;  1F66 A;  3KUY B;  2ARO C;  5AVC D;  3MNN D;  1M19 C;  4ZUX D;  1M1A B;  4YM6 A;  3W99 B;  1P3L B;  3WKJ A;  4WV4 B;  3X1U B;  4R8P D;  5CP6 C;  3KXB C;  5B2J D;  4WU9 D;  5C3I B;  3AZK B;  2F8N A;  1KX3 C;  4J8V D;  1P3A A;  3X1T A;  1KX5 C;  1P3O B;  5CPI C;  1H3O B;  3AFA C;  1AOI D;  4G92 C;  1ZLA C;  3W96 A;  3MGP C;  5B32 C;  3W99 D;  1P3L D;  5AY8 A;  3X1S C;  4XUJ D;  4NE3 A;  2F8N G;  3AZL A;  5CPJ B;  4H9P B;  1TZY C;  5B33 A;  3REH C;  1M19 A;  2NQB D;  1P3O D;  5DNM C;  3AV2 C;  3B6G C;  1P3M C;  5CP6 A;  3B0D C;  3KXB A;  5G49 A;  3REK D;  1M18 B;  3UTA A;  4KUD B;  5JA4 B;  4LD9 C;  3O62 C;  2NZD C;  3REJ C;  3AN2 C;  5B0Y D;  3AZH C;  3AZG B;  3UT9 C;  5BO0 A;  5CPI A;  3B0C T;  3R45 A;  3MVD B;  3AFA A;  2CV5 B;  5BNX A;  3LZ0 A;  1KX4 D;  3VH6 A;  1ZLA A;  3MGP A;  3A6N B;  1P3G C;  1EQZ B;  5KDM B;  3X1S A;  4X23 C;  3AZF D;  3WTP E;  5AV6 B;  4EO5 B;  1P3K D;  1M18 D;  4KUD D;  1TZY A;  3AYW C;  3AZN B;  5B31 B;  3REH A;  3AZG D;  1HTA A;  1P3P C;  4KGC B;  5DNM A;  1S32 C;  5BT1 C;  5AVB A;  4HGA C;  5B24 C;  3MVD D;  3LEL C;  5CPK B;  4J8X A;  3AZJ C;  4LD9 A;  3O62 A;  3A6N D;  3REJ A;  3AZH A;  1EQZ D;  3UT9 A;  3WTP D;  5AV6 D;  1P3I C;  5GT0 B;  5B40 B;  3X1V D;  5GSU C;  5B1L A;  5AV9 C;  3AZN D;  3C1B A;  1P3G A;  5CHL B;  4Z66 C;  5GXQ C;  3W97 D;  5B1M D;  3WAA C;  5E5A C;  3LJA C;  5CPK D;  3AYW A;  1P3B C;  3AZI C;  3VH6 T;  5AV8 C;  4ZBJ B;  5B0Z B;  5B2I D;  5B24 A;  5B40 D;  1P34 C;  3LZ1 B;  5JRG B;  4KHA B;  3AZJ A;  1P3F B;  4Z5T C;  3W98 B;  1U35 B;  3AZE B;  3AZM C;  1P3I A;  1JFI B;  4XZQ A;  5GSU A;  5F99 C;  4JJN C;  4WNN B;  5AV9 A;  3REI B;  2YFW B;  3WA9 C;  3UTB D;  5DNN B;  5AVC B;  4ZUX B;  4Z66 A;  2FJ7 C;  4H9Q A;  1F66 B;  3WAA A;  5BS7 A;  5E5A A;  4YM6 B;  4R8P B;  3LZ1 D;  3LJA A;  3TU4 D;  3AV1 C;  3NQJ A;  3MNN C;  3AZI A;  3W98 D;  4E44 A;  2F8N H;  1U35 D;  4J8V B;  5AV8 A;  5AV5 D;  3REL A;  3AZE D;  2F8N B;  3B6F C;  1P3A B;  1BH8 A;  1P34 A;  4J8W D;  4QLC D;  3X1T B;  5B2J C;  4WU9 C;  3REI D;  4Z5T A;  5DNN D;  3AZM A;  2HIO A;  1F66 D;  1Q9C A;  4NE6 A;  1N1J A;  4G91 B;  4XUJ B;  4YM6 D;  1AOI C;  2PYO C;  5F99 A;  5AY8 B;  4JJN A;  3KUY C;  5BNV A;  3WA9 A;  1M1A C;  3W99 C;  4YS3 A;  1P3L C;  3AZL B;  2F8N D;  2FJ7 A;  3X1U C;  3KWQ A;  4H9S C;  5B33 B;  2NQB B;  1P3A D;  3X1T D;  2F8N K;  3C1C A;  5C3I C;  3AZK C;  3VH5 W;  3REK B;  1KU5 A;  3AV1 A;  1TAF A;  2CWE A;  1P3O C;  5B0Y B;  3B6F A;  3UTA B;  1BFM A;  2BYM A;  4E45 A;  3W96 D;  5B2J A;  5AY8 D;  1KX4 B;  4H9N A;  3KSY A;  2ARO A;  3LZ0 B;  3AZL D;  5B33 D;  3MGQ C;  1M19 D;  3AZF B;  1AOI A;  5CPJ C;  2PYO A;  3MGR B;  2BYK A;  3KUY A;  1P3K B;  4NE5 A;  1M1A A;  1KX3 A;  1HQ3 B;  5CP6 D;  3KXB D;  1P3L A;  3UTA D;  1F1E A;  3X1U A;  1KX5 A;  4H9S A;  1WWS A;  3NQU B;  1M18 C;  3AZK A;  4KUD C;  3V9R B;  4J8U B;  5AVB B;  5CPI D;  3AZG C;  5B32 A;  3LZ0 D;  1P3O A;  1ULY A;  4J8X B;  3WTP B;  4LD9 B;  3MGP D;  1H3O A;  2CV5 C;  3MGR D;  3X1S D;  3X1V B;  1HQ3 D;  1EQZ C;  5B1L B;  3MGQ A;  5AV6 C;  3REH D;  3AV2 A;  4DRA A;  3B6G A;  4CAY B;  5B1M B;  4EO5 C;  3C1B B;  5CPJ A;  1P3M A;  4H9P A;  3W97 B;  5DNM D;  4J8U D;  3AZN C;  5B31 C;  5AVB D;  5GT3 B;  4WU8 B;  4KGC C;  5B32 G;  2NZD A;  3AN2 A;  4J8X D;  4LD9 D;  3O62 D;  3REJ D;  4NFT A;  5FUG A;  3AZH D;  3UT9 D;  1M18 A;  5B2I B;  4KUD A;  4H9O A;  1B6W A;  2YFV B;  5B24 B;  5B1L D;  4M6B A;  3AZJ B;  4X23 A;  2CV5 A;  5GT0 C;  3WKJ D;  3C1B D;  1P3G D;  4WZS B;  5GT3 D;  4WU8 D;  5KDM A;  4XZQ B;  3UTB B;  5GSU B;  1P3P A;  3AYW D;  5AV6 A;  1S32 A;  1ID3 C;  3LEL A;  4Z66 B;  3TU4 B;  5B31 A;  4H9Q B;  4KGC A;  5B24 D;  4H9R A;  3AZJ D;  4ZBJ C;  5B0Z C;  5AV5 B;  2JSS A;  1R4V A;  3LZ1 C;  2L5A A;  5JRG C;  4J8W B;  5AV8 B;  4QLC B;  3REL B;  2IO5 B;  1P3F C;  3W98 C;  1U35 C;  1P3I D;  1P34 B;  4CSR B;  4XZQ D;  5GSU D;  3AZE C;  5AV9 D;  3MGS C;  5GT0 A;  5GXQ A;  4Z66 D;  5B31 G;  3REI C;  4AWL B;  2HUE C;  4UUZ A;  2HIO B;  3WKJ B;  5DNN C;  1P3B A;  5AVC C;  3WAA D;  1N1J B;  5E5A D;  4ZUX C;  3LJA D;  1F66 C;  3WA9 B;  1ID3 A;  4R8P C;  4YM6 C;  4YS3 B;  3VH5 A;  5AV8 D;  3REL D;  3KWQ B;  4J8V C;  1P34 D;  1BH9 A;  2RVQ D;  3C1C B;  1A7W A;  5B0Z A;  1P3A C;  4Z5T D;  1TAF B;  3W96 B;  5JRG A;  1P3F A;  2HIO D;  2BYM B; 
#chains in the Genus database with same CATH topology
 1U35 A;  4JJN D;  3MGS A;  3WA9 D;  4XUJ C;  4G91 C;  4H9N B;  4YS3 D;  2ARO B;  1M19 B;  5AY8 C;  2FJ7 D;  2YFW A;  3KWQ D;  5DNN A;  5AVC A;  3MNN A;  4ZUX A;  3C1C D;  2NQB C;  5CP6 B;  3KXB B;  2BYK B;  5G49 B;  5B33 C;  2Y2M A;  3AV1 D;  4R8P A;  1KX3 B;  4DRB A;  3REK C;  3B6F D;  4WU9 A;  1KX5 B;  3H0L C;  5BO0 B;  3B0B A;  4J8V A;  5CPI B;  5B0Y C;  3UTA C;  3R45 B;  3AFA B;  5BNX B;  4G92 B;  1B67 A;  1ZLA B;  3EPH A;  2ARO D;  3MGP B;  1Z2C B;  2Y2N A;  4Z2M G;  5B32 B;  1KX4 C;  2Y2J A;  3X1S B;  3LZ0 C;  1WWI A;  2PYO D;  3W99 A;  3VH5 T;  3KUY D;  1TZY B;  3AZF C;  4XUJ A;  2ZY5 A;  1M1A D;  1KX3 D;  3B0C W;  3MGR C;  3REH B;  2ZY4 A;  2W8S A;  1P3K C;  3X1U D;  1KX5 D;  3MGQ B;  5DNM B;  1HQ3 C;  3AV2 B;  3B6G B;  1P3M B;  3AZK D;  3AFA D;  2NQB A;  3B0D B;  1ZLA D;  3O62 B;  3MVD C;  5B32 D;  2NZD B;  3REJ B;  3AN2 B;  3REK A;  4J8U C;  3AZH B;  5AVB C;  3UT9 B;  1PZR A;  2Y2L A;  5FUG B;  3A6N C;  5B0Y A;  4J8X C;  3WTP C;  2ZY2 A;  4H9O B;  1TZY D;  3X1V C;  1P3G B;  1KX4 A;  3MGQ D;  4X23 B;  3AV2 D;  3B6G D;  1P3M D;  1T3U A;  5CPJ D;  5B1L C;  3W97 C;  5B1M C;  3AYW B;  3C1B C;  3AZF A;  2NZD D;  3MGR A;  3AN2 D;  5CPK C;  1P3K A;  5GT3 C;  1P3P B;  5JA4 A;  4WU8 C;  1S32 B;  1HQ3 A;  4WJ3 C;  3AZG A;  4HGA B;  3LEL B;  2XD1 A;  2LY8 A;  3NQU A;  5B2I C;  3MVD A;  4H9R B;  3V9R A;  5B40 C;  4J8U A;  4X23 D;  2CV5 D;  3A6N A;  1EQZ A;  1P3I B;  3WTP A;  3VH6 W;  5AV9 B;  3X1V A;  1P3P D;  1S32 D;  3AZN A;  5BT1 D;  5GXQ B;  4XZQ C;  3UTB C;  3LEL D;  3WAA B;  5E5A B;  3LJA B;  5B31 D;  4UUZ B;  3W97 A;  4CAY A;  5B1M A;  1P3B B;  3NQJ B;  3AZI B;  4KGC D;  3EPL A;  3TU4 C;  5CPK A;  2J8P A;  5GT3 A;  4WU8 A;  2ZM5 A;  5BS7 C;  1ID3 B;  1BH8 B;  5AV5 C;  5B2I A;  1BH9 B;  4Z5T B;  5B40 A;  4QLC C;  4J8W C;  3REL C;  2IO5 C;  2YFV A;  2Y2K A;  5GXQ D;  5GT0 D;  3AZM B;  2RVQ C;  5F99 B;  4JJN B;  1P3B D;  5BNV B;  3AZI D;  4AWL C;  2HIO C;  3WKJ C;  3IP4 C;  3MGS B;  2FJ7 B;  4Z2M H;  1ID3 D;  3UTB A;  2HUE B;  4YS3 C;  3AV1 B;  3MNN B;  3X1T C;  3LZ1 A;  3TU4 A;  3KWQ C;  5B0Z D;  4KHA A;  3B6F B;  3AZM D;  3W98 A;  3C1C C;  5JRG D;  1P3F D;  5AV5 A;  5B2J B;  3AZE A;  5F99 D;  4WU9 B;  3W96 C;  3A1K A;  1JFI A;  4J8W A;  4QLC A;  4WNN A;  3MGS D;  3REI A;  4CSR A;  1AOI B;  3AZL C;  2PYO B;  1F66 A;  3KUY B;  2ARO C;  1W2E A;  5AVC D;  3MNN D;  4ZUX D;  1M19 C;  1M1A B;  4YM6 A;  3W99 B;  1P3L B;  3WKJ A;  4WV4 B;  3X1U B;  4R8P D;  5CP6 C;  3KXB C;  5B2J D;  4WU9 D;  5C3I B;  3AZK B;  2F8N A;  1KX3 C;  4J8V D;  1P3A A;  3X1T A;  1KX5 C;  1P3O B;  5CPI C;  1H3O B;  3AFA C;  1AOI D;  4G92 C;  1ZLA C;  3W96 A;  3MGP C;  5B32 C;  3W99 D;  2ZY3 A;  1P3L D;  5AY8 A;  3X1S C;  4XUJ D;  4NE3 A;  2Y2I A;  3KFU G;  2F8N G;  3AZL A;  5CPJ B;  4H9P B;  1TZY C;  5B33 A;  3REH C;  1M19 A;  2NQB D;  1P3O D;  5DNM C;  3AV2 C;  3B6G C;  1P3M C;  5CP6 A;  3B0D C;  3KXB A;  5G49 A;  3REK D;  1M18 B;  3UTA A;  4KUD B;  5JA4 B;  4LD9 C;  3O62 C;  2NZD C;  3REJ C;  3AN2 C;  3AL0 C;  5B0Y D;  3AZH C;  3AZG B;  3UT9 C;  2XD5 A;  5BO0 A;  4DQY B;  5CPI A;  3B0C T;  3R45 A;  3MVD B;  3AFA A;  2CV5 B;  5BNX A;  3LZ0 A;  1KX4 D;  3VH6 A;  1ZLA A;  2BG1 A;  2F2A C;  3MGP A;  3A6N B;  2Y2H A;  1P3G C;  1EQZ B;  5KDM B;  3X1S A;  4X23 C;  3AZF D;  3WTP E;  5AV6 B;  4EO5 B;  1P3K D;  1M18 D;  4KUD D;  1TZY A;  3AYW C;  3AZN B;  5B31 B;  3REH A;  3AZG D;  1HTA A;  1P3P C;  4KGC B;  5DNM A;  2UWX A;  1S32 C;  5BT1 C;  5AVB A;  4HGA C;  5B24 C;  3MVD D;  3LEL C;  5CPK B;  4J8X A;  3AZJ C;  4LD9 A;  3O62 A;  3A6N D;  3REJ A;  2Y2O A;  3AZH A;  3UT9 A;  1EQZ D;  3WTP D;  5AV6 D;  1P3I C;  5GT0 B;  5B40 B;  3X1V D;  5GSU C;  5B1L A;  5AV9 C;  3AZN D;  3C1B A;  1P3G A;  5CHL B;  4Z66 C;  5GXQ C;  3W97 D;  5B1M D;  3WAA C;  3A1I A;  5E5A C;  3LJA C;  5CPK D;  3AYW A;  1P3B C;  3AZI C;  3EPK A;  3VH6 T;  5AV8 C;  4ZBJ B;  5B0Z B;  5B2I D;  5B24 A;  5B40 D;  1P34 C;  3LZ1 B;  5JRG B;  4KHA B;  3AZJ A;  1P3F B;  4Z5T C;  3W98 B;  1U35 B;  3AZE B;  3AZM C;  2G5I C;  2JCH A;  1P3I A;  1JFI B;  2DF4 C;  4XZQ A;  5GSU A;  5F99 C;  4JJN C;  4WNN B;  5AV9 A;  3REI B;  2YFW B;  3WA9 C;  3UTB D;  5DNN B;  5AVC B;  4ZUX B;  4Z66 A;  2FJ7 C;  4H9Q A;  2Y2P A;  1F66 B;  3WAA A;  5BS7 A;  5E5A A;  4YM6 B;  4R8P B;  3LZ1 D;  3LJA A;  3TU4 D;  3AV1 C;  3NQJ A;  3MNN C;  3AZI A;  3W98 D;  4E44 A;  2F8N H;  1U35 D;  4J8V B;  5AV8 A;  5AV5 D;  3REL A;  3AZE D;  2F8N B;  3B6F C;  1P3A B;  1BH8 A;  1P34 A;  4J8W D;  4QLC D;  3X1T B;  5B2J C;  4WU9 C;  2Y2Q A;  3REI D;  4Z5T A;  5DNN D;  3AZM A;  2HIO A;  1F66 D;  1Q9C A;  4NE6 A;  1N1J A;  4G91 B;  4XUJ B;  4YM6 D;  1AOI C;  2PYO C;  5F99 A;  5AY8 B;  4JJN A;  3KUY C;  5BNV A;  3WA9 A;  1M1A C;  3W99 C;  4YS3 A;  1P3L C;  3AZL B;  2F8N D;  2FJ7 A;  3X1U C;  3KWQ A;  4H9S C;  5B33 B;  2NQB B;  1P3A D;  3X1T D;  2F8N K;  3C1C A;  5C3I C;  3AZK C;  3VH5 W;  3REK B;  1KU5 A;  3AV1 A;  1TAF A;  2CWE A;  1P3O C;  5B0Y B;  3B6F A;  3UTA B;  1BFM A;  2BYM A;  4E45 A;  3W96 D;  5B2J A;  5AY8 D;  1KX4 B;  4H9N A;  3KSY A;  2ARO A;  3LZ0 B;  3AZL D;  5B33 D;  3MGQ C;  1M19 D;  3AZF B;  1AOI A;  5CPJ C;  2PYO A;  3MGR B;  2BYK A;  3KUY A;  1P3K B;  4NE5 A;  1M1A A;  1KX3 A;  1HQ3 B;  5CP6 D;  3KXB D;  1P3L A;  3UTA D;  1F1E A;  2Y2G A;  3X1U A;  4H9S A;  1KX5 A;  1WWS A;  4UPK A;  3NQU B;  1M18 C;  3AZK A;  4KUD C;  3V9R B;  3EPJ A;  4J8U B;  5AVB B;  5CPI D;  3AZG C;  5B32 A;  2VQR A;  3LZ0 D;  1P3O A;  1ULY A;  4J8X B;  3WTP B;  4LD9 B;  3MGP D;  1H3O A;  2CV5 C;  3MGR D;  2G5H C;  3X1S D;  3X1V B;  1HQ3 D;  1EQZ C;  2JE5 A;  5B1L B;  3FDD A;  3MGQ A;  5AV6 C;  3REH D;  3AV2 A;  4DRA A;  3B6G A;  4CAY B;  5B1M B;  4EO5 C;  3C1B B;  5CPJ A;  1P3M A;  4H9P A;  3W97 B;  5DNM D;  4J8U D;  3AZN C;  5B31 C;  5AVB D;  5GT3 B;  4WU8 B;  4KGC C;  5B32 G;  2NZD A;  3AN2 A;  4J8X D;  4LD9 D;  3O62 D;  3REJ D;  4NFT A;  5FUG A;  3AZH D;  3UT9 D;  1M18 A;  5B2I B;  4KUD A;  4H9O A;  1B6W A;  2YFV B;  5B24 B;  5B1L D;  4M6B A;  3AZJ B;  4X23 A;  2CV5 A;  5GT0 C;  3F6T A;  3WKJ D;  3C1B D;  1P3G D;  2FFF B;  4WZS B;  5GT3 D;  4WU8 D;  5KDM A;  4XZQ B;  3UTB B;  5GSU B;  1P3P A;  3AYW D;  5AV6 A;  1S32 A;  1ID3 C;  3LEL A;  4Z66 B;  3TU4 B;  5B31 A;  4H9Q B;  4KGC A;  5B24 D;  4H9R A;  3AZJ D;  4ZBJ C;  5B0Z C;  5AV5 B;  2JSS A;  1R4V A;  3LZ1 C;  2L5A A;  5JRG C;  4J8W B;  5AV8 B;  4QLC B;  3REL B;  2IO5 B;  1P3F C;  3W98 C;  1U35 C;  1P3I D;  1P34 B;  4CSR B;  4XZQ D;  5GSU D;  3AZE C;  5AV9 D;  3MGS C;  5GT0 A;  5GXQ A;  2RIQ A;  4Z66 D;  5B31 G;  3REI C;  4AWL B;  2HUE C;  4UUZ A;  2HIO B;  3WKJ B;  5DNN C;  3H0R C;  5AVC C;  1P3B A;  3WAA D;  1N1J B;  5E5A D;  4ZUX C;  3LJA D;  1F66 C;  3WA9 B;  1ID3 A;  4R8P C;  4YM6 C;  4YS3 B;  3VH5 A;  5AV8 D;  3REL D;  3KWQ B;  2DQN C;  4J8V C;  1P34 D;  1BH9 A;  2RVQ D;  3H0M C;  3C1C B;  1A7W A;  5B0Z A;  3P5J B;  1P3A C;  4Z5T D;  1TAF B;  3W96 B;  5JRG A;  3EG5 B;  1P3F A;  2HIO D;  2BYM B; 
#chains in the Genus database with same CATH homology
 1U35 A;  4JJN D;  3MGS A;  3WA9 D;  4XUJ C;  4G91 C;  4H9N B;  4YS3 D;  2ARO B;  1M19 B;  5AY8 C;  2FJ7 D;  2YFW A;  3KWQ D;  5DNN A;  5AVC A;  3MNN A;  4ZUX A;  3C1C D;  2NQB C;  5CP6 B;  3KXB B;  2BYK B;  5G49 B;  5B33 C;  2Y2M A;  3AV1 D;  4R8P A;  1KX3 B;  4DRB A;  3REK C;  3B6F D;  4WU9 A;  1KX5 B;  3H0L C;  5BO0 B;  3B0B A;  4J8V A;  5CPI B;  5B0Y C;  3UTA C;  3R45 B;  3AFA B;  5BNX B;  4G92 B;  1B67 A;  1ZLA B;  3EPH A;  2ARO D;  3MGP B;  1Z2C B;  2Y2N A;  4Z2M G;  5B32 B;  1KX4 C;  2Y2J A;  3X1S B;  3LZ0 C;  1WWI A;  2PYO D;  3W99 A;  3VH5 T;  3KUY D;  1TZY B;  3AZF C;  4XUJ A;  2ZY5 A;  1M1A D;  1KX3 D;  3B0C W;  3MGR C;  3REH B;  2ZY4 A;  2W8S A;  1P3K C;  3X1U D;  1KX5 D;  3MGQ B;  5DNM B;  1HQ3 C;  3AV2 B;  3B6G B;  1P3M B;  3AZK D;  3AFA D;  2NQB A;  3B0D B;  1ZLA D;  3O62 B;  3MVD C;  5B32 D;  2NZD B;  3REJ B;  3AN2 B;  3REK A;  4J8U C;  3AZH B;  5AVB C;  3UT9 B;  1PZR A;  2Y2L A;  5FUG B;  3A6N C;  5B0Y A;  4J8X C;  3WTP C;  2ZY2 A;  4H9O B;  1TZY D;  3X1V C;  1P3G B;  1KX4 A;  3MGQ D;  4X23 B;  3AV2 D;  3B6G D;  1P3M D;  1T3U A;  5CPJ D;  5B1L C;  3W97 C;  5B1M C;  3AYW B;  3C1B C;  3AZF A;  2NZD D;  3MGR A;  3AN2 D;  5CPK C;  1P3K A;  5GT3 C;  1P3P B;  5JA4 A;  4WU8 C;  1S32 B;  1HQ3 A;  4WJ3 C;  3AZG A;  4HGA B;  3LEL B;  2XD1 A;  2LY8 A;  3NQU A;  5B2I C;  3MVD A;  4H9R B;  3V9R A;  5B40 C;  4J8U A;  4X23 D;  2CV5 D;  3A6N A;  1EQZ A;  1P3I B;  3WTP A;  3VH6 W;  5AV9 B;  3X1V A;  1P3P D;  1S32 D;  3AZN A;  5BT1 D;  5GXQ B;  4XZQ C;  3UTB C;  3LEL D;  3WAA B;  5E5A B;  3LJA B;  5B31 D;  4UUZ B;  3W97 A;  4CAY A;  5B1M A;  1P3B B;  3NQJ B;  3AZI B;  4KGC D;  3EPL A;  3TU4 C;  5CPK A;  2J8P A;  5GT3 A;  4WU8 A;  2ZM5 A;  5BS7 C;  1ID3 B;  1BH8 B;  5AV5 C;  5B2I A;  1BH9 B;  4Z5T B;  5B40 A;  4QLC C;  4J8W C;  3REL C;  2IO5 C;  2YFV A;  2Y2K A;  5GXQ D;  5GT0 D;  3AZM B;  2RVQ C;  5F99 B;  4JJN B;  1P3B D;  5BNV B;  3AZI D;  4AWL C;  2HIO C;  3WKJ C;  3IP4 C;  3MGS B;  2FJ7 B;  4Z2M H;  1ID3 D;  3UTB A;  2HUE B;  4YS3 C;  3AV1 B;  3MNN B;  3X1T C;  3LZ1 A;  3TU4 A;  3KWQ C;  5B0Z D;  4KHA A;  3B6F B;  3AZM D;  3W98 A;  3C1C C;  5JRG D;  1P3F D;  5AV5 A;  5B2J B;  3AZE A;  5F99 D;  4WU9 B;  3W96 C;  3A1K A;  1JFI A;  4J8W A;  4QLC A;  4WNN A;  3MGS D;  3REI A;  4CSR A;  1AOI B;  3AZL C;  2PYO B;  1F66 A;  3KUY B;  2ARO C;  1W2E A;  5AVC D;  3MNN D;  4ZUX D;  1M19 C;  1M1A B;  4YM6 A;  3W99 B;  1P3L B;  3WKJ A;  4WV4 B;  3X1U B;  4R8P D;  5CP6 C;  3KXB C;  5B2J D;  4WU9 D;  5C3I B;  3AZK B;  2F8N A;  1KX3 C;  4J8V D;  1P3A A;  3X1T A;  1KX5 C;  1P3O B;  5CPI C;  1H3O B;  3AFA C;  1AOI D;  4G92 C;  1ZLA C;  3W96 A;  3MGP C;  5B32 C;  3W99 D;  2ZY3 A;  1P3L D;  5AY8 A;  3X1S C;  4XUJ D;  4NE3 A;  2Y2I A;  3KFU G;  2F8N G;  3AZL A;  5CPJ B;  4H9P B;  1TZY C;  5B33 A;  3REH C;  1M19 A;  2NQB D;  1P3O D;  5DNM C;  3AV2 C;  3B6G C;  1P3M C;  5CP6 A;  3B0D C;  3KXB A;  5G49 A;  3REK D;  1M18 B;  3UTA A;  4KUD B;  5JA4 B;  4LD9 C;  3O62 C;  2NZD C;  3REJ C;  3AN2 C;  3AL0 C;  5B0Y D;  3AZH C;  3AZG B;  3UT9 C;  2XD5 A;  5BO0 A;  4DQY B;  5CPI A;  3B0C T;  3R45 A;  3MVD B;  3AFA A;  2CV5 B;  5BNX A;  3LZ0 A;  1KX4 D;  3VH6 A;  1ZLA A;  2BG1 A;  2F2A C;  3MGP A;  3A6N B;  2Y2H A;  1P3G C;  1EQZ B;  5KDM B;  3X1S A;  4X23 C;  3AZF D;  3WTP E;  5AV6 B;  4EO5 B;  1P3K D;  1M18 D;  4KUD D;  1TZY A;  3AYW C;  3AZN B;  5B31 B;  3REH A;  3AZG D;  1HTA A;  1P3P C;  4KGC B;  5DNM A;  2UWX A;  1S32 C;  5BT1 C;  5AVB A;  4HGA C;  5B24 C;  3MVD D;  3LEL C;  5CPK B;  4J8X A;  3AZJ C;  4LD9 A;  3O62 A;  3A6N D;  3REJ A;  2Y2O A;  3AZH A;  3UT9 A;  1EQZ D;  3WTP D;  5AV6 D;  1P3I C;  5GT0 B;  5B40 B;  3X1V D;  5GSU C;  5B1L A;  5AV9 C;  3AZN D;  3C1B A;  1P3G A;  5CHL B;  4Z66 C;  5GXQ C;  3W97 D;  5B1M D;  3WAA C;  3A1I A;  5E5A C;  3LJA C;  5CPK D;  3AYW A;  1P3B C;  3AZI C;  3EPK A;  3VH6 T;  5AV8 C;  4ZBJ B;  5B0Z B;  5B2I D;  5B24 A;  5B40 D;  1P34 C;  3LZ1 B;  5JRG B;  4KHA B;  3AZJ A;  1P3F B;  4Z5T C;  3W98 B;  1U35 B;  3AZE B;  3AZM C;  2G5I C;  2JCH A;  1P3I A;  1JFI B;  2DF4 C;  4XZQ A;  5GSU A;  5F99 C;  4JJN C;  4WNN B;  5AV9 A;  3REI B;  2YFW B;  3WA9 C;  3UTB D;  5DNN B;  5AVC B;  4ZUX B;  4Z66 A;  2FJ7 C;  4H9Q A;  2Y2P A;  1F66 B;  3WAA A;  5BS7 A;  5E5A A;  4YM6 B;  4R8P B;  3LZ1 D;  3LJA A;  3TU4 D;  3AV1 C;  3NQJ A;  3MNN C;  3AZI A;  3W98 D;  4E44 A;  2F8N H;  1U35 D;  4J8V B;  5AV8 A;  5AV5 D;  3REL A;  3AZE D;  2F8N B;  3B6F C;  1P3A B;  1BH8 A;  1P34 A;  4J8W D;  4QLC D;  3X1T B;  5B2J C;  4WU9 C;  2Y2Q A;  3REI D;  4Z5T A;  5DNN D;  3AZM A;  2HIO A;  1F66 D;  1Q9C A;  4NE6 A;  1N1J A;  4G91 B;  4XUJ B;  4YM6 D;  1AOI C;  2PYO C;  5F99 A;  5AY8 B;  4JJN A;  3KUY C;  5BNV A;  3WA9 A;  1M1A C;  3W99 C;  4YS3 A;  1P3L C;  3AZL B;  2F8N D;  2FJ7 A;  3X1U C;  3KWQ A;  4H9S C;  5B33 B;  2NQB B;  1P3A D;  3X1T D;  2F8N K;  3C1C A;  5C3I C;  3AZK C;  3VH5 W;  3REK B;  1KU5 A;  3AV1 A;  1TAF A;  2CWE A;  1P3O C;  5B0Y B;  3B6F A;  3UTA B;  1BFM A;  2BYM A;  4E45 A;  3W96 D;  5B2J A;  5AY8 D;  1KX4 B;  4H9N A;  3KSY A;  2ARO A;  3LZ0 B;  3AZL D;  5B33 D;  3MGQ C;  1M19 D;  3AZF B;  1AOI A;  5CPJ C;  2PYO A;  3MGR B;  2BYK A;  3KUY A;  1P3K B;  4NE5 A;  1M1A A;  1KX3 A;  1HQ3 B;  5CP6 D;  3KXB D;  1P3L A;  3UTA D;  1F1E A;  2Y2G A;  3X1U A;  4H9S A;  1KX5 A;  1WWS A;  4UPK A;  3NQU B;  1M18 C;  3AZK A;  4KUD C;  3V9R B;  3EPJ A;  4J8U B;  5AVB B;  5CPI D;  3AZG C;  5B32 A;  2VQR A;  3LZ0 D;  1P3O A;  1ULY A;  4J8X B;  3WTP B;  4LD9 B;  3MGP D;  1H3O A;  2CV5 C;  3MGR D;  2G5H C;  3X1S D;  3X1V B;  1HQ3 D;  1EQZ C;  2JE5 A;  5B1L B;  3FDD A;  3MGQ A;  5AV6 C;  3REH D;  3AV2 A;  4DRA A;  3B6G A;  4CAY B;  5B1M B;  4EO5 C;  3C1B B;  5CPJ A;  1P3M A;  4H9P A;  3W97 B;  5DNM D;  4J8U D;  3AZN C;  5B31 C;  5AVB D;  5GT3 B;  4WU8 B;  4KGC C;  5B32 G;  2NZD A;  3AN2 A;  4J8X D;  4LD9 D;  3O62 D;  3REJ D;  4NFT A;  5FUG A;  3AZH D;  3UT9 D;  1M18 A;  5B2I B;  4KUD A;  4H9O A;  1B6W A;  2YFV B;  5B24 B;  5B1L D;  4M6B A;  3AZJ B;  4X23 A;  2CV5 A;  5GT0 C;  3F6T A;  3WKJ D;  3C1B D;  1P3G D;  2FFF B;  4WZS B;  5GT3 D;  4WU8 D;  5KDM A;  4XZQ B;  3UTB B;  5GSU B;  1P3P A;  3AYW D;  5AV6 A;  1S32 A;  1ID3 C;  3LEL A;  4Z66 B;  3TU4 B;  5B31 A;  4H9Q B;  4KGC A;  5B24 D;  4H9R A;  3AZJ D;  4ZBJ C;  5B0Z C;  5AV5 B;  2JSS A;  1R4V A;  3LZ1 C;  2L5A A;  5JRG C;  4J8W B;  5AV8 B;  4QLC B;  3REL B;  2IO5 B;  1P3F C;  3W98 C;  1U35 C;  1P3I D;  1P34 B;  4CSR B;  4XZQ D;  5GSU D;  3AZE C;  5AV9 D;  3MGS C;  5GT0 A;  5GXQ A;  2RIQ A;  4Z66 D;  5B31 G;  3REI C;  4AWL B;  2HUE C;  4UUZ A;  2HIO B;  3WKJ B;  5DNN C;  3H0R C;  5AVC C;  1P3B A;  3WAA D;  1N1J B;  5E5A D;  4ZUX C;  3LJA D;  1F66 C;  3WA9 B;  1ID3 A;  4R8P C;  4YM6 C;  4YS3 B;  3VH5 A;  5AV8 D;  3REL D;  3KWQ B;  2DQN C;  4J8V C;  1P34 D;  1BH9 A;  2RVQ D;  3H0M C;  3C1C B;  1A7W A;  5B0Z A;  3P5J B;  1P3A C;  4Z5T D;  1TAF B;  3W96 B;  5JRG A;  3EG5 B;  1P3F A;  2HIO D;  2BYM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...