3LZFL

Crystal structure of fab 2d1 in complex with the 1918 influenza virus hemagglutinin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
212
Chain Sequence
PVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVSWYQQVPGTAPKLLIYGNNERPSGVPDRFSGSKSATSASLAISGLQSEDEADYYCAAWDDSLNGFWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of preexisting immunity to the 2009 H1N1 pandemic influenza virus.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin, HA1 Subunit
total genus 41
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfL01
2Z4QA 4KMTH 4PRBB 4Y2OA 4PRNB 5FYKL 4M43H 9CGTA 1MIEH 3WUWG 5IWLC 3ZDXE 1JZ5A 4UTBH 1HHIB 1T03L 4IDLA 3VFOA 1HKLH 2XT1B 1JMXA 4M93B 2BNQA 3EOYG 3K4ZA 5C6TL 5EUOF 1U95A 3IDXL 3U9PH 5CEZH 4JEGB 5E9DA 5GQBA 4ZPTB 4UT6H 3STLA 3DETC 1B0GB 1OAYL 1N3NA 1I8KB 1R5IA 4HW6A 3RI5K 3LS4H 1A64A 3BH9B 4WO4B 3HE7D 3HKFA 1RJZA 2HJLB 1DLFL 4YZFE 1Y18B 5L2KB 4MQ7A 5TE7H 4X6BA 5GRVK 2DBLL 3JTTA 1JPGA 2BCKA 3NFSL 3MLWH 5HI3C 5I0DA 3AY4A 5AD0B 2AK4B 4YPGB 4JO2L 1OLLA 5I15H 4KMQA 1CK0H 4NO5B 5I1IH 1TETL 3MRKB 4JFOB 3TCLA 4MQXC 1A14L 5KN5A 4LHUG 1UENA 1D5IL 2E7LA 4GLRI 4NNXA 1Q0XL 1T20A 5FO7B 2QSVA 4HPYH 5HHQB 4DVBA 2XICA 3QDHA 2C3GA 5BJTB 1JPSL 3HI1A 1LNUA 3F7VA 3C60C 4IRZH 4F7EA 2EDRA 2W91A 4L8CB 3MGTB 3BZDA 4OM1H 4PRAB 5M7QA 1OAQL 5TF1L 3ULVE 4ERSL 2V2TA 2NTSP 3G6AA 2DQUH 5ACZB 3CZJA 1ZSDA 3T4AB 1NSNL 4YHZH 5D7IB 1QKZL 1NANH 4YHOL 1JZ8A 3VI3E 4O4YH 3NVQA 4D3CL 5SX5K 1KPUA 3NA9L 3O4LD 1SYVB 5CGMA 4HH9A 5B39B 4GMSL 3EIFA 1NANI 5EORH 5IEKA 1Y0LB 4MXWH 4PJ5A 4JQXC 5KVEH 1DBBH 1MNUL 1G7QA 5C0BD 3MJ9L 4DZBB 4H5SB 3UYRH 4KK5D 1C12A 2CD0A 5A16A 1R3HB 4MSWA 4IIQB 3U0PA 4R4BB 1CYGA 3O8XA 4JB9L 3D69A 3U0WH 1OP9A 4RGMB 1Z0MA 2WP3T 4NPYA 3HNTH 4RFNB 3TPUB 1O7VA 1JTOA 5BV7H 4R7DB 2PYED 1PEWA 3RHWK 1UH4A 3SGJC 5CD3A 3L1OH 4JY4B 4H1LG 4BJLA 2Z8VC 4UAOC 2X6MA 3BOVA 3P0VL 4ELME 5DJYA 1QKZH 3S35H 4TPRH 3BWUC 1UJ3C 5CIPH 3BN3B 1JHTB 1W8OA 1JN6B 5MI0B 2ZCLL 2NLJA 4WV1A 4ERSH 2WINA 4YJZL 3GMMA 5FYJU 3OB0K 4OM1L 1MRCH 1EXUA 1FORL 1EHXA 2VXVH 4MA3A 4KJPD 4WDIA 4PP1C 5D7JD 1G9NH 3RWDA 3UAJC 1UQSB 4HUVB 3RAJL 1UB5A 1J1OL 4OM0H 3B6SB 2LAAA 4XVUD 1KNOB 3BKCL 3NACL 1KLFA 2R15A 1IC1A 3GMPB 1CIUA 4Z95H 4JANB 3VFGL 1FNLA 1KC5L 3H9YA 5IB2B 3I3DA 3ARVA 4NQEB 2HFFB 3NPSC 4J2XA 3VG0L 1N5AA 3FT3A 2YPLA 2HN7A 4FHBD 3V6FB 1I3RB 2D0FA 4MHHI 4V2BA 2H45A 5D1QA 3MACH 4PB0H 4QRQA 5CINL 3MV9E 4H5SA 3KYNB 4N0CC 2VH5L 5F9WB 3MROA 3VXPB 1T5WA 1V3KA 2ZNWA 3D87B 3C8KA 3GI9L 4A2MA 3H7BB 4ODXB 1DLHB 3H3BC 4L9LB 1V3JA 3BP4A 2B2XL 3PQYD 1K2DA 5J1SC 1FGNH 2ESVD 5C0RL 1E27B 2NYYD 5F89A 5FFLA 1EFXA 1A22B 4QXGH 4MJ4A 1KV3A 4OFVA 4KRPB 4JVPA 2X05A 4XMPL 2K9UA 3RGVA 4IMLB 1BAFL 1RIVH 4JPWL 3CVHL 5KS9E 3MYZA 1GL4B 1OCWH 3G6DL 3U36B 5C08B 3O6MH 2FSEB 3VFSB 4J1UA 5KZCD 1E6JH 1G6RA 5LGHH 3ECBA 2P8LA 1EJOL 3BIBX 1WIUA 2WP3O 2DM4A 3TC9A 4QWWD 2ZUVA 4M8VA 1KXVC 4NRXB 2HMID 2OL3L 2OL3H 1AD9B 5I8EB 4JRYE 5GSRB 1NC4D 3VA6A 5C07D 1UWXK 4ZS6C 4PGDB 4KKBD 1EHLL 4WGWB 3BGMA 2IPKB 1NC2A 3SGKC 3A6CL 1G7PA 4G3YH 1JRHL 5TFSH 1NGXA 2FX7L 2IBZX 4DGIL 1G7JB 4M5YH 4UQ2A 1YNLH 1MVUB 3VCLA 3VXSA 1GC1L 1OPGL 3H0TA 3VWKD 1FSKC 1B2WL 1KTLB 4JQIH 1HXMB 1NUGA 4OLXL 4LSSH 4KUZH 4OQTL 4OV5B 4PJBB 1MWAL 2YBRB 3DBXA 4P2YA 2X4NB 4W81A 5BS0E 2IBGA 3LHPL 1HK6A 5JHDB 2XTJD 3H7BA 1RZGB 4XC1H 1XIWD 3FFCB 2QHLA 1KACB 4ODTL 4N0FB 4WO4D 4EIZC 5BRZE 2XPGA 4C4KO 4I2XB 1EGJA 5ETUB 4YDVA 3I6LE 4WI8A 4M9PA 4LCWE 3DETD 4QOKA 5FGBC 3U9UA 2QADD 1F02I 4ZTPL 2FSEA 4GQ9H 1JHLL 2BVTA 1NUDA 1QO3A 4OZFB 5GSVB 3KJ4B 2BSED 4C56A 1KLUA 1F3JA 3OXRA 1HYRC 1UXWA 4K9EH 3BESR 4OD1L 1NDGA 2YK1H 4BQCA 2NZ9D 4IRJB 1FZJB 4WFFE 4OCRH 1P4LB 2BDNL 4JRWA 2I9LA 4JQVC 4EOWL 1YQVL 1R3IH 1SJVA 1XCTA 3DGCR 1QA9B 1G7HA 1XF3B 3HZYA 4W6YB 1DZBA 3MLSL 2AJUH 2LU7A 3JWNC 2V7HB 3MR9B 2ICEA 5DMGD 2HFEB 1TQCB 3RVVC 4JO4H 4MNGA 3AMKA 3TBTB 4L4VA 1FFNB 4NQEE 4PRPD 1QOKA 5B21A 4BH7B 4PJAE 2FX8H 1AE6L 1DBML 3ZKXC 1XR8B 4KTEH 1YYLH 5AUMA 3FB8A 2EC9T 3MCKB 4K94C 2J4WL 2Z92B 2AW2A 1WK0A 4LCUA 1C5CH 4X0KA 5LWYH 3IDIA 5DD1L 4Z7UB 3MUGA 5T5NG 5SX4H 3H9SE 1ORQA 2PO6D 3OKOB 1MFEH 5J11C 1HHHB 2OSLB 4K3JH 6CGTA 1KGCD 2B1AL 3CDGA 5GISH 4O4YL 1ZA3B 3CDCA 1GZPB 4EIGB 2HN7B 4L3ED 2VZ3A 1L4IA 4XNZC 5E8NB 3O45B 4KHXL 4I3RH 4FXKA 2GI7A 4XNMB 3BHBB 3GKWH 2GCYA 1T83A 3QUZC 1A7QH 5KSBE 3QXWA 4OUOA 1U95B 2Y9RT 4U2YA 4OCXH 4PRNA 1QBMH 2VDMH 4P5KA 1KIQA 1AO7D 3BQUC 3OKDA 5IT2H 1WFNA 3I84A 1LE9B 5IROC 3LN4A 2VISA 5D93B 5K59E 2YS4A 4KHTH 1T7WA 4TUOB 1F13A 3EYSH 3OX8B 1NDMA 2P24B 1FYTB 4H25B 1DDHB 1NBQA 4P2CG 3WHE0 4ZNCD 1CK0L 3FOLA 5I1IL 3QEQB 2MKWA 2W59A 3P4OA 3CK0H 5DFVD 2D9CA 2D0HA 5F7KC 4XVUC 4AMKH 4ORZC 2ADJA 5M95B 5DRZB 1TQBB 3ABZA 4U1JA 1UM5L 4JFED 5ESQB 4X0KB 4XNXL 3WL9A 3UTOA 5I71C 2ZKHL 2R69L 4KI5D 5C2BH 2DIBA 3GMLA 2C1PB 3V52L 3F62A 3SJVB 5DSCA 4OTXH 1EEYB 4WVRA 3KPSB 1Z9SA 1WEJH 2UZIL 3IJHB 5LXGL 1XR8A 1AGEB 1CXIA 1RHHA 4MJID 3FFCE 3F7YB 3ZL4L 1I75A 5FM8A 1HHKA 1OD7A 3L5WA 1Q1JL 2ZSVB 4K55A 4V1DB 4UMGA 5HTSA 2R39A 4UTBL 3HCVA 1T03H 1J88A 2M26A 3G04A 3IDIB 5EO9B 4RGNC 5ERWB 1O5DT 4TSBL 4PUBL 1A6AB 4XAWH 4PV8A 3KGRA 4DCQA 1BAFH 3VD5A 4WJ5B 4LRIA 3TZVA 1R5VA 2V17H 4JDZA 4JM2F 1MWAB 5DJXB 3GKWL 1C08A 4RCAA 1RUKH 4I3RL 1KJ2B 1FGNL 4PJ5B 4ALAL 3G5XA 1D5ZB 1DDHA 2ZKHH 2LVEA 3HG1B 2Z31A 1FPTL 1BVKA 1OGAD 4D94A 1FCGA 3TFKD 3UYPA 5DQJB 2P24A 2B39A 4WGVB 3OKKB 4YBQC 3NIDF 3C6SB 5A2LH 3SDDB 2YPVL 5I1JL 2H2PD 4I77L 5K93A 1DTUA 4DUWA 4F37K 4MNHA 5LWYL 5EWIL 3OG6B 1YMMB 4H88L 4LFHG 4NBXB 3RZCC 4AM0A 4Y1AA 2NX5E 3E2HC 2UWEB 2LU3A 2DLHA 2NTFA 1J8HB 1YYLL 4U1NB 4F7CA 1CBVL 1U8HA 5E1AB 2BX5A 1IILE 2F53E 1Z9LA 2EDYA 3KDMB 3B2VH 5I1GH 1HSAA 4QXWA 5KS9F 1G9NL 1JNJA 3WNPA 2VDLL 5FEBA 5F3HA 4RFEB 1WICA 1T6WA 5JIIA 3OBAA 3SCMC 5IFJA 1JVKA 5DF0A 5KSAA 1INQB 3QFJB 1JGUH 3RVWD 2BSRB 3U2SB 1LILA 1VFMA 5C09E 1I3UA 2GW5A 4LHUA 3NZHL 3U1SL 4H1LH 4JG1L 1T0NA 1WV7T 5I0ZA 4JKMA 3O9WD 1DLHA 2OJZH 1H3TA 2CLZA 3MYJB 2QADC 5EC2B 1S7QB 3Q1SH 4XHQA 3W0WA 4HJGB 2VSDA 1P6FA 3W11D 1IMHC 2CK2A 1LO4H 3CD4A 3CCHA 5EC1A 5E9DB 1JTPA 2VR9A 1X5JA 2P5EB 3ZMRA 5EIIA 4GQ9L 2WBJC 2ARJB 4LGPB 3RIFF 4GT7A 4HT1L 4MNHB 1I7UA 1SY6A 3BJLA 2FX9L 1VA9A 1C16A 3BWAB 2ITCA 4KFZC 2ZUQB 3QUYD 4CMHB 4JO3H 3CMOL 4XB8A 3ULUE 1M4KA 2Z31B 5SX4I 1ITCA 1GC1C 2AJXH 2VYRE 3BVNB 1X5AA 1BM3L 3IFPB 3MUHL 3D9AL 4X4YA 3KNBB 4JQIL 2EE2A 4C54A 1ZHBA 1N0LA 4WCYH 4JY6B 2HH0H 4HWZA 4A6YH 4NWTH 3VGDA 3MRFA 4GSDH 3ZTNL 4F2MA 5L0QC 2D31A 5EU6E 1P5VA 3OB0H 3LQMA 1FVCB 5ITBL 1MJUL 4LIQH 2ICES 3UROR 1D7FA 3RZWA 4N0UB 1MIML 1RI8A 4GOSA 1ZLVK 3IETB 3TZVD 2VDRH 1CT8B 2ZOKA 3BD3A 4BA8A 4ONGH 2X4SB 4K2UL 1U8PA 3GGWA 4QHLA 4K07A 5K33A 1MVUA 3QCUH 3MLWL 4RFOH 3V6OE 4MQXD 1SYSA 4QHNA 2H6PB 4LOUC 4HF5L 1X5YA 2MSPA 5HYSG 2DBLH 1U58A 3DWTA 2R56H 2X70B 3MBXH 3OMZA 2E7HA 2Y1VA 1JFQH 4GG6E 1S7TB 5I2IA 4OZGB 2VERN 4XPGH 3C60D 3QXUA 2ICWB 5HHXL 3HR6A 5F1IA 3UPAA 1RULL 1MJ7L 1DSFL 4F57L 5FO9A 4KRLB 1NBZB 4LSPL 1RK0B 1FO0B 4MDIA 1UKQA 1XR9A 3I50H 3RWDB 5JMRA 3UTQB 2D7TL 3ARED 1D5IH 3FKUS 5GJTL 1CLYL 1S7UB 1QBAA 2HRPL 1RUMH 3ETBF 1A9EB 5DJYB 3KG5A 4WW2C 1XF3A 3HZYB 3O11B 5DFVC 4U1HB 4L4VE 4M6OH 3U46A 5LQBH 3VG0H 2B5IC 4FQCL 4JZJA 3GSRB 3N85L 3VFTB 1K3ZA 2IWGA 1DVFD 1OTTD 5LGHL 5LAXA 3LKNA 4F7TA 1NDGB 4Z95L 2B5IB 4TSAH 3IU4H 1H5BB 5ILTH 1X9QA 4BH8A 3D1MC 4JN1L 1ADQA 2DQTL 3G6DH 2MJWA 5A3ID 5DZLA 3V7AE 2VAJA 4ODXA 5DD6B 4RRPG 3UP1A 2X1XR 1EERB 1P4IH 3M8OH 7FABH 1MRCL 4XNZB 3GIVA 2P49B 4HUNB 3B9KA 1HEZB 1AP2A 2YPLB 1ZLWK 4QHKI 4DOHB 4LCUB 5CUSL 2OXGA 3VFUA 4Z76A 4MXVE 4QTHA 4OIIL 3T2NH 1IKNA 4PJEE 2EEDA 2EH7H 3VU2A 4UV4H 4KJYB 3VXRB 1AKJB 4R2GD 1KLGB 5JHLL 1E4WH 1RZ7H 5TDNB 3CDFA 3UJIL 3MNZA 1B9ZA 4R4FL 5J6HA 4LLQB 4UZGA 1RUQL 3LEXA 4G6JH 3ES6A 3FO0H 4WFHE 1IJ9A 3M07A 35C8L 3OKNA 1YN7A 2ATPA 4Q7DA 2YUWA 3RKDD 3WBDA 4YGAB 3QO0B 1T2QH 4XBGA 3DX6B 3K8LA 3I2CL 5C7XH 5EOCL 4PRPA 5IQ9B 3MCLL 1DUZA 2I26N 5IG7B 5AZEH 2HT2C 3SGDI 4CN4A 1N4XL 3CDYA 2NQCA 4UT7L 1LO5B 1RK0A 3BEVA 5AZ2H 4WTXA 1TQCC 5F9OH 3RAJH 5GHWL 1MCWW 5D2NE 3NZ8B 4I18A 3MLRL 5GIRB 3WIIH 5DJ8B 5D70L 1AGFB 2FB4L 3FQNA 5C0NC 5I1CL 1VEMA 3UPRA 4YHOH 4KTDL 2H3NB 1WC7A 4MCYB 2AKRA 4XVSL 5EU4A 1CWVA 1A6UH 3GHEL 4DK3A 5I18H 2H8PB 3AROA 4M7ZC 5INCB 3S3SA 5IHUL 1TZIA 4FQ1L 4UBDD 5EU5A 2I60H 4YXKH 4PJGA 5T1DL 2RGSA 2PNDA 5BOZG 2E8YA 3O2DA 4MXVF 4Z0BL 2C26A 3J8F7 5HVFB 3ZDYE 2NXYC 1DQMH 3GMOB 1K6QL 3MOAH 4H8WL 5CMAB 5F7EH 4KZDL 4EDXA 4JZNA 4X6FB 5I76B 3SGEH 4Z7VA 1CFNB 2XN9D 5L8KB 3QI9A 4OJFL 4D0CB 3TPUA 2ADIA 2J8HA 3U4EA 3DVNA 3QFDA 2WV3A 2FHCA 4KTYA 2DTML 3C8HA 4ZTOH 1FH5L 1WAAF 1A7NL 4KV5F 2RAMA 5JPNB 1P9MC 1WUNT 3PHOB 4ZXBD 4JY5L 4Z6AT 3VW3L 3PWLA 2H32A 4QXTA 4KKBC 5F70A 3MRJA 1Z5LA 4N9OB 2DQHL 3KWWB 2ZOKB 2FGZA 1HHGB 3VXUB 4G8EA 3KPPB 1MFBH 1D5MA 2EIDA 3VWKA 3GSWB 2EO9A 5GS0D 3VXSD 2KQMA 1BP3B 2NPLX 3DMMB 4TN9A 3UDWA 3KPMA 3IGAB 1TPXB 3BKJL 3PV6B 1ZTXH 1PSKL 2AGJH 4HHAB 3AREB 3CPLA 3HAEB 2BSTA 1F45A 5ERWA 1IEHA 1A4KA 1M7DA 3FZUD 4Y2DA 4ZXBA 4KAQH 4UU9A 2XTJE 3C87A 2KPNA 4Y1AE 5KSVB 3UBXA 2RFXB 3MMEA 1G84A 2NY5H 2A6IA 4LEXL 1RJZB 4AT6A 3L3IB 4Z7QE 1EEQA 5CIPA 5EOQL 3QI9D 1SMOA 5ECJE 1FAIH 5HGDA 4TUKH 2YMXL 2LE9A 4PJBE 4OLYL 4P5TA 5JTWA 4XPBL 4PJAA 3PWNA 4GBXD 2YA2A 3PGDB 4PRAA 4K7PX 2JJVA 3FB7A 4WUUE 5TF0A 3FB8B 4MQTB 3KDMA 1WBZB 2FJGA 5E5MA 4I2XE 1NFKA 5CMAA 4DKDC 3QDGE 3PQYA 1VGEH 3CVHB 1T20B 3F65A 4KKNA 1NBYB 2E3VA 3FRPA 1I7TB 1ODAA 3KPPA 4H25A 4JR9L 4FTVE 3BDXA 3ZKQD 2ZUQC 3VFNB 2C5DC 3DYOA 1KIQB 4NQVA 3GJFH 1IFHH 4TNVK 4IJ3C 3T4AA 5I8OH 4OCWH 3OGCB 4L8BA 2RCSL 4Y5YA 2GIYA 5J7CC 4FQJL 5IHZA 4OZIE 1FP5A 2D7QA 4ZPVB 3OJMB 4DKFL 1BEYL 3E6FA 2A6KA 5FM5O 1B88A 2P8PB 1FFPA 1A7PL 2CKBB 5C07B 3HLAA 1HXYB 2BHYA 1J5OH 5I1DA 4L3EE 4MA7H 3O3AB 1R3LA 4KVNH 5C0FA 2FLBT 3O3EB 3EJYD 5IKCA 4NT6A 5GRUH 2D7TH 2PTTA 3AB0C 2CLRB 4PJAB 4UDUB 4MS8C 3O8XB 4YC2C 2OS7A 5E5RB 2GFBB 1MJJB 2XPGB 5IROA 3F12B 4NN5C 1OARL 3BQUA 3LEYL 4N1CA 4YEFA 5D72L 5BO1H 1LD9A 1ZVSB 5L2KE 3HB3D 4X8XA 3WD5H 1OAUH 2EDJA 4DWHA 2Z8RA 1VGEL 3FQTA 2DD8H 3QEGL 4F58L 2ZSVA 4PBWD 2R0WL 1T83C 1BJ8A 4XPHL 1D5ZA 1JFQL 4PP2A 2R2HA 5DMIL 1QLRA 3H9SB 5E4EB 3RUGE 4JFPB 4KU1A 2DQTH 4Q6YA 5BXFB 4UTAL 1VEPA 4OGYH 3TO4B 2VDPL 3EYVB 1GZQB 1H8SA 4XPAH 3GIZL 5E4EC 4WU5B 4UIKL 3I6KA 1FLTX 1RZKC 4LLMB 4OF8A 4FQ2L 1K3IA 2XG4A 3QCUL 4LAJH 2ENSA 4Z18A 1UM4L 1EEZA 1I3VA 3GMRA 3ZYIA 4HS3A 1SJXA 3O4LA 4U0RC 4HKXA 1CLZL 1RPQA 1MHPL 4HFUH 3TIDA 5HHQA 4E0RB 1CLCA 3T3MF 4JFDB 3LKPA 2ZP0T 3E6FB 3OKOA 5EOTB 4A6YL 4HV8B 2NY1B 3GJFB 1BBJA 3TF7C 3SEPA 5D8JH 4HWBH 4Q2ZA 5FHAH 4HSQA 3OL2A 1W72L 4GRWB 1MFCH 2VE6A 3BH8B 2ZCKL 3N50A 3PL6D 3VFRA 3D6GA 5E8NA 4PGEA 1I9JH 2VC2H 5GRYA 2PR4H 2IANB 1EJ6A 1T21B 4J8RB 5DQJA 1CR9L 3LPGA 2HJKB 4RIRA 4WTWA 1U2CA 4PJXE 4LBEA 4G6FD 5DUBB 4ZUTB 3VXMB 1MY7A 2Y4SA 4UINL 2OR7A 5EBWB 2FX9H 4RFOL 2FWOB 2H1PL 3GHBH 4P2RD 1UM6L 4NP4H 4O2CB 4BFIA 1X44A 4PD4K 4TUJA 4M3JA 1F4WH 4OLUL 1MELA 4X8JA 3ZHKA 2NXYD 4NZRL 4N0FA 3JWOH 3QUKB 4ZQKB 1OP5H 4M6AA 3OZ9L 3ARSA 1P4BH 5KW9H 2XI9A 5IK3B 1IGTB 2P44B 1QR1A 4ZFOB 3CX2A 1IEAA 2BNQD 3P4MA 4QTIL 5J89A 5C0ND 4X4XA 4X6DB 2F9BT 1I9RH 3D9AH 2F19L 3LRSA 1QLFA 3SKOB 2MTPA 4P9ML 4PBVC 4PB9H 4PPTA 1ZHBB 5DVLA 4WFEE 5D7KE 3T0VA 5I17B 4OZIB 3MLRH 4YR6A 4PJFE 4IRSC 1CE1H 3U83A 3V4PL 3V5HA 3O6LL 1NL0L 1QA9A 3PWPB 2VKXA 4GW4B 3W82A 1OGTB 3KLAA 3JXAA 3DURA 3WD5L 3I2CH 4MYWB 1JYVA 1DEEB 3SDCA 5D6DC 5ISZD 3WO4B 3MJ8A 4S10A 4MZ2A 5E8EB 1U8NB 1KCVL 5EU7E 4KJYA 2HWZH 4P2OA 2N4IA 3BYTA 4YX2L 3G9VA 3DX7A 1ACYH 3LY6A 4HCRA 2GSGB 2UWEE 1WCBA 3MRIB 4LHUD 1HDMA 1QO3B 1E4WL 4OFKA 2G5BB 4G42A 4U1IB 5CSZA 5EZJB 2NXZC 3QIWD 1VKXB 5DFTA 4MWFA 5LBSH 4J12A 3V4VH 5KSUA 4X4YB 3IETA 5HHMD 2AJVL 2CIIA 3BKYH 3QPQC 1NLBL 5JDJA 4KK6D 1DE4A 5EPMA 3EOTH 4UIKH 2EE3A 4YNYA 3P4LA 4G8GD 2XRAH 4XNQA 3JTSA 1N64H 4HPOL 4ZD3L 2ARJQ 5IUSA 3EUUA 1MCFA 4BUHA 5B4MD 5FCSH 2Z35A 1S5HA 3MJGX 3UTQA 1GGIL 3T2NL 1LNUB 3RNQB 3NIFE 4KV5E 3DO7A 4OGAC 4OQ1A 1CE6A 4G9DA 3R1GH 4FQCH 4NN6B 3QUYB 4HQQL 5EBMB 4MAYC 1WQVT 4CJ0A 1DN0A 4I77H 4YDIH 2VDNH 1J0YA 4NN6C 1UCBH 2Z31D 2VLRB 3LH2L 1XGUA 1ZS8A 1DBAH 1MCLA 2AJYL 4WY7L 3KXFD 3VXUA 4Y19D 1IT9L 2R4SH 3V8OA 5C0JB 5F6HI 4NQSA 3TESA 2HTLD 3GSNL 2PCPB 4U31A 2P46B 1J8KA 1BHGA 3KJ6L 1QSED 4X6EB 4AQOA 2BNQE 4FQQB 2CKNA 5DEFA 3OPZL 1RUML 2F74B 5E8DL 2IPTL 3GO1H 1HZHH 2ZZUT 4HIIA 1H8NA 4ONFH 4XVTL 4X9GA 4Y8DC 4RA0C 5CJOL 4LOUD 3VGAC 3DNKA 1S7XA 4L4JA 2EZ0C 1FL6B 5I8KL 5J12C 1LE5A 3P0GB 4FXGB 4MJIA 1JI1A 1U92A 2E27L 4ZFZA 3SOBL 4U49A 5D5MB 4OCXL 1T1XA 2GK2A 3B9KB 4AENB 2DJUA 5FOBB 5GGSY 1MFAH 3WO4C 4QRTB 1F2XK 1CDHA 1CZ8L 1GPOL 2JCCB 4WV1B 4J3OC 1P7HL 1XGQA 1QYGL 4KPHH 3UBXI 1I1CA 4JFEA 5ETUA 5ADPL 3DXAB 3PP4L 1DBJL 4HXAL 2DQHH 4TVPD 3C6LD 1F11B 3JWOL 1XF5A 2GUOB 4JQXA 1J05B 4QCIB 2R8SL 3BWAA 1OWWA 3B4NA 5E6ZA 3C8KB 1EHAA 4LEXH 1GGBH 1NEZG 1ND0A 2VXUL 1N2RA 2AS5M 1CTNA 1BM3H 4G9DB 4NJ9L 1QSEE 3QNZB 1FNGA 4JN2B 2UWEF 4I1NB 4RMRA 4QGTA 3MGOA 3S4SG 1AE6H 4LPXA 1K4DA 2FX8L 1FN4A 3CH8A 3P9MB 1LHZA 3PG2A 3MNZB 1A1NA 3OAZH 1ZS8B 1ZHLA 4Y19E 1OGAB 1PSKH 3GJEB 1F4YL 4XP9L 3OJDB 4P5MB 4YAQA 1GRWA 1JE6A 2JLLA 1ERNA 2P42B 1T04B 1S9YA 2E7LC 4PV8B 2NW3B 1LEKB 4L3CB 4JFZH 5I1CH 5KG9B 1NFDF 1WFTA 2PO6A 1NH6A 2IG2H 5KVGL 1DP0A 1JGEB 2QQKL 4G5ZL 5IKCB 1T5WB 2DLEA 2JK5A 4RSVA 4MZ3A 4DAGH 2LV4A 4QHNB 3BP7B 1FCCA 3JTTB 1R0AL 4OD1H 4KKCC 1RK1B 3INUH 5DR5L 5F88A 1A7NH 5CEYA 1QBBA 4S1SH 5C0CB 3LSOB 3BP6A 4Y5YC 5I6XB 1JPST 2VWEE 5H2BB 3IU3B 4L5FL 1MJJA 3PJSA 3LQZB 5CEXB 2EIBA 3KYOB 4LU5L 3L7FB 3WE6A 4GG6F 4FA8A 5HI4D 3M45A 5TE4L 5E2WL 2APTA 3ARWA 4RAHA 2ADFH 1ZSDB 3B2VL 4MCZB 3Q3GA 1QUNA 4E41D 2V7NB 2VQ1A 4JJ5A 5JIPA 5EC1B 4FQ1H 1ZGLM 3O45A 3PXJA 3QEQA 2W65A 4KKAC 4X4MA 3REWA 1KCRL 2HKFH 3IF1B 3UX9B 3JV6A 3REVA 1GXEA 1CICD 2XOTA 3TJEH 3AGVA 4NUGL 4O02L 5EWIH 5D7LE 3I6GB 2W60A 4YIQB 3ARBA 1I9IH 4OFPA 3MXWL 4P5TC 2AXGA 1IAKA 2MKLC 1ULVA 5KSAB 4DTGH 1RMFH 4MNQA 3L3JB 3MRNA 3QISA 1PG7X 4LCYA 2J6EA 2OTWA 3PL6B 1ORSA 1A7PH 1W72B 5FB8B 4ETQB 2Z93B 5D7JC 5I1KL 1T04A 1FZJA 1JZ3A 2C3HA 2Y06H 1BVLB 5DQDH 3SDXB 4JDVA 3TN0A 5LQBL 4N5ED 2CDEB 4K71B 4RMSA 4M6OL 4JCMA 4P9HC 4R9HA 4WO4A 1TDQA 3UO1H 2YA1A 5J0BA 3D48R 4ZO6A 3G6JF 5EZOL 2HRPH 2FHBA 4NQDA 3GM0A 4PRHB 4PUBH 2CR6A 4FFYL 3X14B 4Q0XL 3X3GH 4WEUD 4RAUA 2EH7L 5FUZL 1KB5A 3LMJH 5BVPL 5E2VL 1HYSC 2Z0BA 2Q86A 3H2WA 5AAMA 1YJDH 1T66D 4KUZL 4LPTA 4OQTH 1F4XL 4ESKA 1RUKL 1VADA 4RGNB 5GGTA 1X5IA 4PTUB 3M8OL 1T2JA 4NO0B 1I8MA 2GT9B 3QIUD 3HG1A 4R97B 4F9PC 1JPFB 3F8UB 1TLKA 1XGTB 3DTXB 4NCDA 5C07A 1AGEA 1YMME 4H1LA 1EHLH 5DD5H 3BP5B 3RFZC 2YRLA 3X17A 5EFIA 3TT3H 3VRJB 1CD8A 2P4AB 4MAYD 4PJDF 1OWRM 3AS0A 3DARA 3FQRB 1W0WB 1NFDE 3PGFL 3CZFB 1U9KA 5JO5B 3D3VE 1A3LH 1PBYA 3HI1B 2OJEA 3DX9B 1KJ2H 4PLKC 4HKBB 2AEIT 4EUPB 1MJUH 3LB6C 5ID0A 4KAQL 4KK8D 4MXQD 1IVLA 4DUXA 3X11A 4BFEA 1QBML 2VDML 2C1OB 3PNWB 2Y6SC 3PWLB 3G5XB 1X6LA 1EFXD 2XTJB 4NWTL 3SDXA 3UJTH 1FG2A 1ZA3A 2DM3A 5KN5B 3IJSA 4HGKC 1AXIB 4NCC2 4KWUA 4CUCA 1PZ5A 3IRPX 1N26A 4C83B 3DRQB 1S9VA 4F9PA 4M93C 1BLNA 4TVPL 3RWCA 3NFPB 1NUNB 5C0RH 1JYXA 1RZIA 4Z77A 1OAKL 5DMGC 1R24A 1ZT1A 4LLYA 1SVCP 2I9TB 1YYMH 1B0RB 1EO7A 1RY7B 3G5YA 4FQLL 1EZVX 4IJ3B 2EZ0D 4U1MA 1PYWA 3QEUB 5ALCL 5D1QD 2HLAB 4WUKH 4JFPA 3NAAL 4S1DD 3VFWA 5BXFA 4QXUH 4PJBA 3C6LB 3MLVL 2XZQL 1B4JL 1DQLL 5ICZB 1TMCB 1GZPA 2YPLD 4XP5L 1MQ8A 2Y5TB 5BZWA 4CU8A 5L2JA 4ZUVB 4OD3L 4JRXD 3QYCA 4BFBD 4Q97A 2DQIL 4LQ1A 1A3RL 2JJUA 1TJHH 3QUMH 1ZVHA 4PRIE 4BK4A 4ELMB 2C1PA 1CFSB 3E3QC 3HUJA 2EICA 1H0DA 5EO1A 1YEIH 4DN3H 3O2DL 4K7PH 4TSCL 1JWSB 3WXWL 3BEWB 4L8SA 5CWSA 1YEFL 4GAJL 2E6JA 3MBED 5D7JA 3RDTB 4H0IA 1JL8A 1CQYA 5E94A 1UACH 2I5YL 5FUOL 3EYOB 4P4RB 4YXKL 3OKEB 4WCYL 2VXVL 1ZAGA 3DX6A 1F6FB 2P8MA 4LLAA 3ARBC 3FO1B 2AI0L 1D9KB 3QXVA 1PEZA 4NHUA 3QRGL 5CBEB 1HH6B 1JV5A 3S35L 3BO8A 2PYEA 1ONQA 4XP4L 2ZOLB 3GB7B 3K3QA 4HX1B 1H9VA 3S4SB 1C08B 4QYOB 5TQ0L 5E5UB 2VQ1B 4D0BB 5I1GL 1F00I 3O8XD 3GBLA 3IDJA 1KTKE 4LPUA 1N7MH 5D96B 3MV9B 5E2TH 1MCEA 2BZDA 1P53A 1Q0XH 3MJ7B 4X98B 3H3KA 5CP7A 4EUPH 2EKJA 3O2DH 3RVVD 4L4TA 1FNHA 5IM7B 4XMKL 3G5VB 3BEVB 2VXTH 4OZHF 3QG6A 2FH8A 4XP1H 1A3RH 5DEFB 1CDUA 4LFHD 1LK3L 4OD3H 3ROOA 4G6JL 1ZXQA 1U8IA 5F7DB 2ESVB 2V7HA 3MR9A 4NNPH 3QXAA 4QEGA 3VD7A 2WUCH 3EJZC 2OQJA 4CRPA 2ADGB 5LVEA 4UV4L 4D0DA 4XCYB 3WUWB 3IXAB 2BFVH 4I0CC 3UTSB 3QWRA 5EU3A 4XGZB 1LEIA 4E41B 5EIQA 1U8MB 2DN7A 4P2QD 4J3WA 3RUGA 2W9EH 2WIMA 4X99B 1YC8A 2PO6C 3QUMB 3QP3A 1IGIL 1LWRA 4ISVA 3DUSB 1F6AA 1SM3H 5MENE 4V1DD 2EDXA 3VFMB 3ET9F 5F1SA 3IKCB 4HULB 5SWQA 1R3JB 4HEPG 4JRYB 3N1MC 5B38B 2J3SA 4YR6B 4L4VB 4XC1L 4DGVH 3IYLW 5IV2A 1JWSA 4JN1H 2BMKA 4PGCB 3UYOD 1NFDB 1U8OA 4FFZL 1CFTA 1IM9A 1Q1JH 4AENA 3WN5B 4OZ4A 1SYSB 5I74B 1FO0A 1G1YA 3QA3A 5E7FA 3NTCL 4F33A 4IRJC 4POUB 5ANME 3L3DB 3X13B 1A1MB 3TYFB 8FABA 5LXGH 3LV3A 2P43B 1JGDB 4F7TB 3S36L 1A6WH 4GBXB 3TWCL 1TJIH 1U42A 5BV7C 1DE4B 2ADIB 3VDBA 5ABDE 3FFCA 4WI2A 3FQUB 4FG6D 4X98A 4KDTC 5ACLA 3EOBA 3PP3K 2BERA 2V2XA 5FHBL 4YBQD 1P2CB 5AYUH 3MXWH 5I1AB 2VDNL 5KSUB 4EUPG 4XX1G 4RWHA 3QJFB 3HRPA 3C9NA 3QNXB 4PYHA 5L7XH 2OI9C 4XPTL 3RZCD 1RUAL 4K23L 2B2XH 4TULL 3RVTD 4NO0D 4KHTL 3WFHB 3O9WB 2R56L 4KI5F 3O6ML 4JZOA 4WHDA 4PJ8B 1M6OB 4L29B 5EU6D 2GJ6A 5DVMA 3T0EE 1F97A 4HKZA 3SO3C 1P1ZA 1T66C 2WBJA 5IB5B 1F42A 2YD1A 1RIVL 3H8NA 2APFA 3DO7B 1IGJA 3I02B 5GGRA 1BZ9B 2WINB 3AUVA 4ODUB 3ZE0E 1PGRB 4FOMA 1AI1L 5T3ZL 5D1QB 1YMMD 3V6ZB 5D7IF 4EBQL 1QPPA 4N5EC 3H42L 4H0HB 3S9DB 2ZUUA 5C86A 3HC3L 4FQXB 5LGJA 4I18B 3OXSB 2AJZB 3WFBH 3TNMA 12E8L 3PGCB 2AV7A 1MEXH 2AJSH 1QRNE 4PJ9C 3RPIA 1J0KA 3SCMA 2WBWB 1K4CA 1BIIB 5FA3A 1CF8L 1FORH 5KANG 2BRRL 5BZDB 5E2JA 1LDPL 5IFHH 3FN3A 2AI0H 1A7OL 3GMNB 3TJHD 1H3PH 3LB6D 5CJQL 4BFGA 1VERA 5C3TA 3RRQA 2YWYA 3QEHA 3TA3D 2G60L 3RBGA 1BQHG 3O4OB 2XFXB 1O7SA 4R96A 2Y6SD 1QG3A 1PVHA 5BW7A 2EYSA 4KI1A 4HT1H 1U6AL 3RY4A 4RX4A 3ROLB 4JDVB 4ELKA 1BFVL 4XC3L 3QRGH 1F2QA 5HVWA 5B39A 1A7OH 3TA3A 2VITB 3HPJB 1ZANL 2G2RA 3L5HA 1W72A 1KELL 3GSOB 4QRUA 3V7MA 4XRCA 4Y5YB 2VL5B 5CD5C 4YE4L 4C55A 3JVGC 1VENA 5HJ3B 4XP5H 4JAMB 1E6OH 5T1KA 3UTTA 3TO4D 4J3VA 5ENWA 5HHPA 3UEZA 3RL1B 3HC3H 5CEZD 3EJJX 1G7JA 4NNYA 4D3CH 3OZ9H 4ODBD 1BZ9A 3WXWH 1YYML 3X12B 1U8KB 5HD8C 4FZEH 3ZKXB 5ADPH 2D4DA 3WUZA 1IQWH 4K3EH 4F7MA 1IAOB 5JUEL 2DBJA 4TOYL 1IZKA 5DHVB 2GSIA 4Q9BA 4JRYD 4DW2L 4KZEH 4WUUD 2R0LL 3GRWA 1VADB 5D7IA 1B4RA 2JB5H 3SDCC 3U0PB 3W2DL 4KKLC 1FZMB 3V95A 5GGSA 4R3SB 4R0LB 1C7TA 4LLVB 1AR1C 1T0MA 5DEGB 1Q0YH 1D6VH 1CDGA 1PX4A 1BX2A 5K9KB 4HUKB 4LNVA 3FAWA 4TULH 5CJOH 2RHEA 4P46B 2NR6C 4WNQA 4XCEA 1CXLA 1VGKB 2EC9U 4P4KB 4P0DA 4OBSA 3BP5A 4Y89A 5TF1H 2YD9A 1CVSC 2KQNA 1L7IL 4WHTA 2BSSA 4LHJB 5D7LD 1JPFA 5F1NB 5C0AA 1BIHA 4HZAA 2J8UA 1A47A 4HKBA 3TNNB 5JQHC 2RFXA 3WV0A 3BMWA 2BNQB 5CKAA 1HHJB 4UU9B 3V5KB 3K2UH 2YK1L 4CU6A 4K94L 3K7UA 4ZPTA 1G9MC 3KPRB 4RNRA 3V6OA 1QR4A 2BNUA 3HRZA 4OLWL 4Y16C 3C5ZB 1W8NA 3VFRB 3LH2H 3RWCB 2PYFA 4LARH 3V0WL 5DMKB 2BC4A 2OCFD 3FOLB 3FN0L 3FQXA 2A83B 3CH1B 4F37F 4MNGB 3H3PH 3VI4F 1R5IB 5I8KH 1GAFH 3MO1B 5BVPH 2J8UE 1DLFH 5DJXA 3FHAA 1IL1B 3IFOB 3WHXB 4YDLC 1SMAA 3M1BB 4GAYB 4JFEE 5A3IC 4L8BB 4PR5A 1OTSD 3ZKSD 3TBSA 4JGJA 4Z8FH 3TCLB 5GGSB 3EYQC 4ONFL 4XVTH 2MQ0A 2R1XB 1IGML 2QLVB 1P84J 1S7WB 3WDIA 5DMYA 1SM3L 5L7XL 3N9GL 4K9EC 4PREB 4GUPB 3N0PB 1BVKB 4MA3B 4WDIB 4YK4C 1GC1H 4IOSD 1FBIH 5A2JH 2L0DA 3THMH 2FZ3A 2Q7YB 5IHLB 1HWHB 1QRNB 4PJHA 5GGUB 1B3JA 4OFIA 4PTTB 5F72S 4JVWA 2FO1A 4CDGC 3VWJC 5HYJA 1CD1A 5E08L 1DBAL 3T0BA 2V7NA 3ALWA 4JJ5B 3T0XA 3MRBA 4HGWB 1Q38A 1TJIL 5ITFA 2XY1A 2DYPB 2XWTB 3CJJA 5C3LD 1A6AA 4KMLB 1FNEB 5IMLA 4OSUL 1MI5E 3DIFA 3O0RL 4X6CB 3Q2CA 3G9AB 5JA9A 1AIFB 3O3EA 1UWEH 3DVGA 5FF6A 4WI5A 3PF2A 2GAZA 2PTTB 4L4TE 4RFEA 2Z9TA 4DGVL 5DHXB 3MYJA 5EC2A 2KKQA 5GRJH 3RBSA 4PJEA 3CH1A 1XCQA 1OF2A 3QDMD 3QXTA 2A6KB 4K3GA 3GSNA 1Q9KB 1MCHA 1OTTC 1YY8B 3BT2L 2CKBA 5F8QC 3CFCL 1IBGL 3O6FB 4XT1C 4HCRH 1KBGL 1KCRH 2R1XA 3GZKA 1CLOH 4JQVA 2AJVH 4OKVA 5E8OA 3DSNA 1X7QA 4J6RL 5IVXE 4V2CB 3P9WB 5DRZA 3FL7A 1CGSL 5HYIA 1UJTA 3Q6GL 5DJZA 4YDJA 4QT5B 1WTGT 1P7QB 2R0KL 1CG9A 4NRXA 3P4OB 1LO3L 1S9WB 3ILPB 5H37H 4K7PL 4TSCH 3P2TA 5CGYC 5D2LB 4FTVD 5D2NA 5FGBA 4GG8A 1BD2E 3CSYB 4P5KB 1F4WL 4ZFFB 2BNRA 5F9AC 4WI4A 3PXHA 1FFQA 3RU8L 4WI3A 5JO5A 4PJXB 3EW3B 4PREA 3ULSA 5HHPB 3GUTA 4K3HA 4APQD 3K1KC 1J1OH 4PS4L 5GGVH 4FZ8L 3KYOA 3VFNA 2FO4B 5IW6B 1NC4B 1FZOA 4XP4H 3O6KL 4JFXB 4OGXL 1Q94A 3L6FA 2AGJL 1XCQB 3D3VA 2VZUA 3KPRE 5FK9B 1IE5A 3L9RB 1MLCA 5GRXG 3B9VA 3WEXB 4N8VB 4EUPA 4M1CD 3BIKB 3BPNB 4I3GA 1N6VA 4NKMB 3GMLB 3TH3T 5IEHB 2YZ1A 5DURD 2UUDH 1YEFH 4QOKB 5EUKB 4D9QE 3HC0B 4K9EL 1PQZA 1R6VA 2XNAA 5JW4R 4UBDC 1RIHH 2JELL 3HE7B 1MHPH 3HFMH 4KQ3L 4NJ9H 1X5LA 2VLRA 2P47B 1TXKA 4OLUH 4KXZH 4EI5B 2D7MA 1S78D 5DGQA 1TZHB 2J8UB 4OZGE 4ODWB 5C0EA 1A8JH 1IGCH 5E70A 3OXRB 4NN5B 4MDJA 3VJ6A 2AEQH 3U6RA 4M7JL 2ICEB 3MLXL 1S7TA 2Q3ZA 2DI7A 1QFOA 3TBTA 5IBLC 1QNZL 3TH4T 3DECA 1TZIB 3P73B 2GTWB 3RIFK 4RDQF 5JOPE 4Y2DC 3AXLA 5BCAA 5J12B 4YFEA 1SJHA 3QI9B 3BGMB 4Z7VB 3WNKA 1OPGH 3GNMH 4EI6B 3FN9A 3QIUA 3QFDB 1YNLL 3LEYH 4WIQA 1VFOA 4XVSH 3GSWA 5E6IC 1ZVYA 2VMFA 3A6BH 4PJ8A 1FGVL 4YO0B 3D3VD 3DVIA 5ISZE 1A1OB 5TH2B 2A73B 3MRRA 4LDLB 4W68A 2LFGA 5F9WC 4TNWF 3VWKC 5D1QC 4A6YA 2BJML 4LQFL 3SPVB 3MRJB 4HWEH 4E5XA 5IB4A 4ACPA 3UJJL 5F1OB 4PJ9A 5IR1B 1AO7E 5DJDB 1HH9A 5C9KA 4P2RE 5DZNA 5JXAL 2O93L 4APQA 1D9KA 3QG6B 1P9MA 3BHBA 1WBYB 4UILL 1GH7A 4I2XA 2XZZA 3L5XL 4FQ2H 3JTSB 1UZ6F 4X7DC 2YXMA 5GSRA 3TBVA 1CFQB 2Z91B 1OGTA 3EFDH 3OJDA 3ORJA 4FTVA 4WY7H 5DJ2B 3QI9C 4GW1B 5DMIH 2DDQL 5DYOA 3VFUB 1T22A 3WS3A 4OZFG 1A2YB 5I75B 4LCIH 5DRWB 5EU3B 4LSRL 3O41A 4HPOH 4XMPH 5KSVA 2HP4A 2OTUA 5EIIB 4UOJA 1Z0NA 4Y4KC 1Z3GH 4ZXBB 4HV8A 4XBGB 1DL7H 5HDLA 1I4FB 1F4XH 3ARBD 4LRNH 3WN5A 1HDMB 4JR9H 3SGJA 4M6NH 2NR6D 3VRIA 2OXHA 2KZ1B 4AYFA 3RJQB 3HI6H 5F93C 5L88L 4NKIL 1XCTB 4JFYB 3RWJB 4IOIB 4P5MA 1P7QD 2LU4A 5IB2A 5D7SL 5KVDH 2Y07L 4Q58C 1FG9C 3EGSA 3MACL 4PB0L 1CS6A 4E41A 1J12A 2ARJA 1S9KC 1UXWB 4LP4A 1YNTB 1HWGB 4ZNEE 4M6MH 1MOEA 3QH3B 3FMGL 4F33B 5C71A 2HWZL 2J6EH 3KPLB 3D85B 2QKIA 4PJEF 5F6IC 4KDTA 3CVIH 1GCFA 1LO0L 5I1KH 3GIVB 5B3JE 4JAMA 2HJLA 4AG4L 4GG6A 2X4UA 5GGQH 1EMTH 3MLYL 4Y5VA 2PYEE 4WI9A 5F8RC 4IRJA 3CIQA 4WFFD 3HI6L 1QR1B 1KCVH 5DXWA 3OAZK 2X89D 3EO9L 1AXSB 1DSFH 2V2TB 3GUTB 2NCMA 4QOKE 1I8IA 3EJYC 4QRRE 2AAVA 3QQ9D 4JKPH 4GXUM 4YFDB 1Z3GL 4H8WC 1J1PL 3MV8D 1I3RA 3B9KC 2AXJA 5J9PA 5MEOB 1RZFH 3BD4A 3L3KA 3FJTA 4HUWB 4UV7H 2X4SA 3HB3C 4WEBL 4WTZG 2ICWA 4FNLH 3S5LG 3ULVF 1GGYA 4MJ5A 3B9AA 5GS0H 5I8CA 5IHZB 4LVEA 5IGXL 1X5HA 1HINL 3W39B 3MUY1 1M7XA 3MJ7A 1DN2A 1FH5H 1H3VA 2FECL 1MAMH 1P5UA 5DR5H 3WDJA 4HMDA 2A6DA 3PWVB 2E8ZA 2QKIB 1IL1A 1BMGA 3BGAA 4ZYKA 4WW2A 1RJLB 4HX1A 4HZLA 1K8IA 4R26H 1OAXH 1AFVH 1WGOA 3T1WA 2R2HB 4MJIE 4J3TA 3A6BL 3WKML 2F54E 3ZHDA 4PY7B 1WZ1H 4OCLC 4K8RH 2VDQL 3ZSTA 2DQFB 4NCC1 4ETYA 5DDHB 5DUPL 3WHE1 5IHUH 3DUHA 1IGYB 4HWBL 3MODH 3K4DA 4YNYB 5C0AD 5J57B 1KTRL 2IADA 4C57C 1IKFL 1UG9A 3WFZA 2EYTA 4JHAL 3O6KH 4R26L 1UZ8A 3FO2A 5IB1B 2X4UB 4LLUB 2DYPA 2XWTA 4HMCA 1QLRB 3H9SA 4Y0GA 2GITB 3G6JB 4PS4H 4AIOA 4N1HB 1FFOA 1R3KA 2VKWA 3GBNL 3TBWA 5E8DH 1GZQA 2IQAA 4OI8A 3P9LB 1QVOB 1U3HD 4NQSB 2EXWC 3PWPD 3SJVA 4PTTA 5IGXH 3OR6B 4CVZB 3UAJD 1T0NB 4L8SC 1KXTB 4OJFH 4DFIA 3Q48A 1R5WB 1J87A 1LO3H 2D7NA 3QULB 5TE7L 3DVGB 2R0KH 5FF6B 2K7QA 4PJ9B 1N5YL 4ODHH 4AH2B 1KIRB 4OF6A 1DQQB 1HHIA 3OR7B 4HWUA 4KPHL 3A67L 3MREA 2HT4C 1HSBA 3GFUA 1WFUA 1U8OB 5KS9A 3IU3A 4MB4A 1YMHB 4LHQB 2D2OA 1YY8A 1A0QH 5FA4B 4M6NL 3U30B 3SE9L 3E8UH 4OCSH 5K9OA 3CLFL 3TVMC 2AJ3B 4LLDB 1KJ2A 4NO5A 3NFNB 4Z5RB 1NMCB 4K3DL 1T1YB 4RA3A 4QHMA 5GRUL 4NRYB 2XA3A 2IBZY 5MEQB 5L8JB 1RZKL 2DMKA 5GRJL 5B4MC 3MLYH 2NY6B 1CXEA 4MA7L 4LSTH 1CGVA 1UZ6E 4OCYL 2EDNA 1U93B 3QUXB 5BO1L 1CL7I 1MHEB 1JNHA 2YN5A 3CUPA 2EEBA 4DKFH 3LEVL 4PRHE 3IVKA 3HR5A 3QDAA 4MVBC 4X6DA 4ZOCA 2DQFA 1Y18A 2CK0L 3P9LA 1IT9H 1VESA 2C3VA 2P7TA 4HK0B 5I1JH 43CAB 2GKIA 1FFOB 5D4QA 3SCMD 5FGSA 5CHNA 5FB8A 1J5OL 4XBPA 1FNFA 3OHXB 1EO8L 4EI5C 4JREB 4JG0L 3OGCA 3HI5H 1AGDB 3STBA 3BYYA 1ZLSL 2AXGB 4AEHH 4YHKH 1FBIL 1YMMA 3G6AB 2HG5A 4Z7UE 3MRNB 3MUJA 3QULA 3X14A 4LSTL 4LK4A 3B5GA 4GXVH 4PRHA 5I73C 3PABB 1NL0H 3KPQB 4JGMA 3W11C 4OCWL 2P1YA 3FOMB 4ZOBA 4CU7A 4ZODA 3K4AA 2DKMA 3WHXA 1PX3A 5DVOA 3QDJD 4Z5RA 2CDEA 1NAMA 1J0JA 4PB9L 5FKPA 4LGSB 4ZOAA 1FDLH 1BQLL 3DUUB 4Z7WB 4X7EC 1U8LA 4M7JH 1DANT 3RVXD 5HHNB 4NO0A 3WFCL 3PP3H 2QHRH 3CZFA 4FP8H 4NYLB 3LEXB 1LE9A 4OSUH 2JF1A 5BRZD 3RZCA 1HIML 4MD5A 4XCNA 3FO9B 4U3HA 2F54B 4HUMB 3MO1A 2VITA 3AS1A 5HDBF 3TYGL 3VWKB 3DI3B 2J88H 4C58B 3M1BA 3TN0C 1P4BL 3J7HA 1IAIH 5CEXA 3C5ZC 4JKLA 1JZ4A 1ZHLB 3FB5B 4GSDL 4OV5A 4AMKL 5EZIH 2EIZB 4YK4B 1KB9K 3ME0A 4G6AD 4YC2B 3FFCD 2R1YB 4NOFA 5DJAA 5SX5H 1A4KB 4Y2DB 1BZ7A 1U93A 2CH8A 1OOAA 5LGKA 3C8DA 5SV3A 1XEDA 1S7VA 4KROC 4DCQB 2DI8A 2B8OT 4P2RA 1BQHA 4NM8L 3TZVC 1A6TB 4XRCB 2NY4B 2WNGA 3OHXA 2GHWB 5CIPB 1EPFA 1IM9D 4HF5H 2PR4L 3HC4H 3KPSE 5HGDB 1HHKB 3SKJH 3QWOB 3MLXH 1I9RL 1F3RB 2WQ8A 4JGUA 3MODL 1W72H 4NRZA 2AEQL 3LKPB 4EDXB 5IJKA 2UYLB 2XV6B 4NQCB 4K2UH 3EDKA 3V0WH 3W81A 3RU8H 2AQ2A 4U7KA 3TH2T 1EHNA 4P99A 4XCEB 4ZO8A 4C56E 4PJGB 4LIQL 4I5BB 2JELH 4OLWH 1PKQA 2DJ4A 4P2QA 1A2YA 5E6IB 3QWRD 5F7UA 5C6PB 4DEPC 3O3BB 3D18A 3MXVH 1N6UA 2BY0A 3FONB 3OR6A 1FVEB 3AS2A 5ESVA 1LO2H 4LP5A 4NZUH 2HRLA 5F6IB 5SWZE 1QLEH 5I2IB 1HHHA 4M62H 4ZNEA 2JCCA 3O2VL 3QQ9C 3BT2H 2BC4B 1KGCE 4QRTA 3KLDA 4L4TD 5GGVL 2FJFB 4P3DB 1OQOA 2ITDA 1NMAH 1A6ZB 5IFAH 2AEWA 2FIKB 2YC1A 2IALB 3QH3A 4O51A 2YD3A 3ARPA 2XQBL 1EO5A 3QEGH 2BNRE 4XWOD 2YWZA 4KKAD 5D72H 4LF3B 2HLFD 4HIHA 3OXSA 1CICC 4GS7C 1JNLL 4H88H 4JRXE 1MRFH 4YHMH 3BQUD 4YQXH 1QFPA 3KYKL 3FQWA 4H20L 4JFQA 4EXPX 1RUQH 1OSPH 4PGBA 1ZK9A 3SY0A 1VACB 3R0MA 3Q6GH 1EA9C 4LNRA 1RU9H 1K4DB 1AGCB 3EFFB 3OF6D 3D0VB 1Q9WB 2A9ML 3RDTC 3MV8E 1LEGA 1EAPB 2YN3A 3MBEA 3DRTB 1CIDA 5I16A 3UMTA 1KBGH 2DOCA 2ADJB 2J6EL 4NFCA 1FV1A 1IBGH 2HT3D 2CUMA 5DC0A 1FVEA 4MJ6A 4DKAA 3SCMB 2YSSA 2EXYD 3E6HB 1TVHB 2JIXB 1EIBA 4GKOA 1RZ7L 2FEEL 4JRXA 2R0ZL 3WS6C 4OT1L 4XGZA 1LEIB 2VLRE 5J9PB 3UBXB 5E9DE 3SHSA 3HE6D 3ZT6A 1FNSH 4OLVL 1HYSD 2FJGB 2WZPD 2P5EE 1Y6KR 2CUIA 8CGTA 3HAEA 3WMSA 2A6DB 1BD2B 3RGHA 5I1LB 5BZWB 2Z35B 5EO0A 1C1EL 1B90A 4X9BA 1UKTA 4F80A 5T5FL 1RZGA 4QNPE 2MNUA 4YO0A 2EXWD 4Z0XA 1S7XB 3PJSB 4N0UA 4BZ1L 2CKBH 3HPJA 5C0BB 2X4RB 5E08H 4MD0B 1HQ4A 1D5BA 1TJGL 4Q9QH 1A1MA 3TYFA 4HFWA 4K94H 5DURB 2WAHA 1CFVH 1QFWM 1RK1A 2X4OA 4GBXA 3SDXF 3LIZL 2ITDB 4PD4J 3LV3B 3ESVF 3THML 4TUJB 3RNQA 4YHNA 4NKDA 1U58B 2EDBA 4U6XA 3D0VA 3T0EA 2X1OA 4HJJH 3EOBB 1KF9B 4UIMA 4X6DF 2OM5A 1IGMH 1WIPA 1P2CA 3U4EB 4MAYA 4PJIF 3S88H 5HGHB 4K8RC 2AXFA 4S1QH 1CXKA 1NEZA 3V0AC 4BSWB 4MXQC 3JV4B 1AHWA 3MRKA 4LIQE 6FABH 1P6AB 4Y2DD 4K23H 1BFSA 3D39E 4HH8A 5DI8B 2IFFH 4U1LB 2X9YA 5DQ9B 1G6RB 4HUUA 4X9FA 3NBNA 1OSZA 2X4TA 5I17A 1TTUA 1JTTA 3HG1D 1WEJL 2UZIH 1F5WA 1CL7H 4LLMA 2DLFL 2R4RL 5BJTA 4U6HA 4UB0L 3FT4A 4XCFL 4QYOA 1CFVL 5GS0C 4XVJH 3IKKA 4GW1A 1MLCB 2VQUA 1UM5H 1KEMH 3ARYA 3EGSB 3RTQB 2WUCL 4HKXB 2CKBL 3MJ8B 2HFGH 4BZ1H 3SGKA 1JHKL 3U7WL 5F3BA 4Z7QF 4LVNB 4NQDD 4WENB 4Q6IC 4GW5B 1IGCL 5C08E 4R4BA 2DM7A 1JNNL 1OL0A 2M2DA 4FXLA 4RMWA 3FTGA 3HZMA 1KYOK 2G5BA 1I7UB 3EYSL 4GKSA 4P2OC 2QQNL 5C9JA 5EA0L 3UXFA 4J3XA 5F3HB 1WAAA 5CKGA 3HS0A 2BHUA 2AK4E 5C0GB 2CLZB 1N7ML 5D6DA 4BZ2L 3PWJB 2IAMC 5ADOL 3L5IA 2JJTC 4OFYD 1ZHNA 3AS3A 5IJVB 2Y72A 3NOIA 1S7RB 3DX7B 5TPWH 4PJDB 3R8BB 4X4ZA 1XGPB 1Y6NR 1AO7B 4IRSA 3RGVC 2AK4D 4YXHH 2Q8BH 1E4XH 4NQCD 1KNOA 2G9HB 1I1RA 3GMQB 3RVXC 2OBGA 1HXMA 4LEOB 3T4YA 4WEMB 1GOFA 5GHWH 2IALA 3QEQD 1J18A 1MRDH 4BQ6A 5IB3B 3D25B 1KPVA 3MCLH 5F9DC 4AIZB 2DMCA 3OAUL 3SKMB 2YPLE 3KLSA 5DD3L 1AI1H 5BRZB 4PJEB 4S1DC 4QF1B 1P69B 5BMFH 3EHBC 4NBZB 3O3DA 5KOVC 2R9HC 1MHCA 1TCMA 4O58L 1DQML 3F7PC 2R23B 4X5WA 4P49A 1CGSH 4U6VL 1NCBH 1UQSA 2X44D 4NHCH 2I9TA 1OT1A 5H8DA 4Q2ZB 4MQ7B 5IMOB 2NY7H 5CP3A 1KIPB 2GTZB 5E8PB 4HCRL 1AH1A 1NFIA 5CUSH 5C0BE 1JZ7A 5F1NA 1NBYA 1NBZA 4WV1C 4TTGA 1IGFL 2HVJB 2SEBB 2UY7A 3DO3A 2DLGA 5T1LA 1LP9B 1PAMA 1RVFH 4UI2A 1EUTA 3WFBL 5K59F 4YHLH 2C9AA 1DCLA 2PW2A 3QEUA 2F54A 5HGBA 4IM8A 1QFWH 3H42H 3MLTB 1AQKH 5FV2A 1ACZA 3TWCH 4N68A 1NCCH 3QJHB 2M8XA 2DQIH 4M7LH 1DVFA 2VZOA 4EZMA 1C8PA 4RGNE 3REVB 1HH6A 1JHKH 4N0YL 3LKRB 4JM2D 4GG8B 4WNQB 2R2CA 1CLYH 4M1GL 3CFDB 4JJHA 3VXNA 3OKDB 1XMWA 4NM8H 3RY6A 2W9LA 4XCFH 4GW4A 3ZE1E 1N2RB 3B43A 1EVTC 4X5WB 3ARFB 1ORSB 3T3ME 3EJZD 1MJ7H 5J6GA 5EN2A 2DQEH 3O3DB 1YEDB 1LVEA 4OZIA 1IGIH 4FXKB 5C6TH 4DQOH 4RISL 1TPXC 2Q86B 1I3GL 5HXMA 3IFOA 1JWMB 3MRHB 2FX7H 3C60A 3STZB 3LMJL 1A9BA 2VIRB 3L3IA 1MI5B 4XNXH 5KSBB 4IMKA 1OD9A 3VD9A 3V0VB 2VDOL 4YGVB 3N85H 3MRDA 4XH2B 1QEWB 5KS9B 4I4WB 1KTDB 43C9A 1K8DA 2I07A 5I71B 4L4TB 4S0SD 1U3HC 4PJFF 2QEJA 2CDGA 1F8TL 5DD0H 4OTXL 4L3CA 1LEKA 1NCNA 1V3LA 1KCKA 4I5BA 4MJ2A 1C5BH 1U3HB 1QSEA 5FYJE 4XMKH 5ACMA 1QFHA 4P48A 1A6VL 5DD5L 1DQTA 2LTQB 5J1AB 3DRQA 5E99H 2YRPA 4O2CA 4MD4A 2EYSB 2Y5TA 1YN6A 3ZDXF 3U4AA 1T1ZA 4Y19A 3KXFA 3Q6FA 1IZJA 2XWBB 5DUBA 4ZUTA 3NIGE 3JV6B 2Z8SA 2D0GA 5DSCB 3HR5B 3IJYB 3EDJA 3WJJA 2HG5B 4P46A 5JW5A 4KGJA 5GJSH 3TJHC 2XKNB 1KG0A 5HYSB 4DKEL 3V8CA 3Q3GB 4F7PA 1T0MB 2GJJA 4GS7B 3P0YL 4R6UA 3QG7L 3ARGC 3I6LD 2ATKA 5EZOH 3O2WL 2W38A 1SEBB 5FM5M 1DBKH 1XGPA 3V5DA 2IBBA 4O58H 1NCWL 2CIKB 3WFHA 3QUYA 3I6GA 1YEEL 1MI5A 2CRZA 5JUEH 1WBZA 5E5MB 3FT2A 4G8GA 4YDJB 3RNKB 1EEUA 2VUYA 5JXEC 3P4NB 1J1XL 4QXTB 4QRPB 1DQLH 2VABA 4LLYB 1RZJC 5DJ6A 5EU4B 3W0WD 2Z92A 3QIWA 4L29A 3ARUA 1BBDL 2YA0A 2FATH 4M03A 3HG1E 3T3PE 2CDGB 3DVNB 4YHML 2OZ4L 1OW0A 2FH6A 3BUYA 5AWNL 1BOGA 3ARZA 4HIIB 3SE9H 4ZXBC 2WWKT 1T7ZA 1NCAL 3MRGA 3QNXA 2F5AH 4NQXA 1DFBL 3N06B 32C2B 1W0YT 3DXAA 3SDCD 3CMOH 3N1FC 4JN2A 1KENL 2NTFB 3UJTL 5BV7L 2ADFL 1WCBB 4NN7C 4LKCA 3DHMA 3UDWC 2E5EA 3P77B 1WSST 1RFDH 3BPNC 5CZVH 1CGUA 1AXSA 3QHZH 4NN7B 2W0KA 1H5BC 1HKFA 1YEJL 4HWBA 3ULUL 5T1LB 2IPUG 3BGFC 2XTJC 3BZFA 3LN5A 3D39A 2YPVH 1MEXL 1NGPH 3NA4A 3KPNA 3V6ZA 1VSCA 2PW1A 2BDNH 1E4JA 2GUOA 3RUGB 3OAYH 3QG7H 3IVKB 4LCCC 1CFTB 1FN4B 3P9MA 4UIMB 4P23B 4FFWD 4M8QA 4Y5XB 4G7YH 2OX5A 1WBXA 4EBQH 5FCUH 1IM3A 1X5XA 1QHOA 1M1SA 3W9EA 4YHZL 1BF2A 1J10A 1A6PA 2CMRH 1ZA6A 3W39A 3QXAB 1MJ8L 4MCZA 3CPLB 1N59B 3BRFA 4AEEA 4HUXB 3IDMB 4ZDHB 4Z7WE 4QKXB 2R9HD 4PV9B 2EE9A 1MAJA 2VDLH 4U1LA 4P23D 5F6HJ 1UWGH 4L3AA 4KROD 4NZTL 3D2UA 1IAOA 2VLME 5GSVA 1AHWB 3E1F1 1DUZB 1IC5L 4BZ2H 5IG7A 2FJHA 5TFSL 4R96B 2DQJL 5FUZH 1T3FA 3ULVH 3L3DA 3KHQA 3X13A 5T1MB 4FFYH 5FECB 2DWEB 2N56A 1F4AA 4OZFA 1A14H 1A3LL 4LSSL 2AXHA 4GKZB 1AD0A 3UO1L 5LJYH 4O5LL 3BW9A 1B6UA 4I18C 1WC7B 4YEEA 3IXTA 2BMKB 4PGCA 3MRRB 2PO6B 3PL6A 5IW3A 3PGDA 5L6YH 3ZE1F 4CMHC 3GSOA 4ELMF 3H7LA 5KVMC 3OSKA 5B3JF 2XWJA 5DJ2A 3BE1H 4S11A 5B22A 4WW1A 5J3HC 3L3GA 1G9EA 3VXME 3NABH 4P3WA 4PGEB 4HXAH 1DBJH 1NCUA 1RJCA 5GGTL 2CDFB 1FRGL 2NZIA 1H3GA 2CQVA 4ONHA 1UCBL 3MRQB 4OD2A 4QRSA 1EUUA 3MBEB 3REWB 4GAGH 2HFEA 4UT6L 3QA3B 2DKSA 3HMWH 3PUCA 4NQCE 2L4OA 4MA8H 4Q6IB 1T22B 2EDHA 5CJ8A 4KC3B 1E6JL 1IKNC 2DKUA 2OTUB 4Y4HA 3GI9H 3OGOE 1M7IA 2J1KA 4O2EA 5DZOA 1IC5H 3RPIB 2KDGA 2BOCA 3QQNA 2HKHH 4XAKE 2V5RA 4S2SA 1HZHL 1KN4L 4QHUA 3VI3F 1AO7A 4G8EB 1I4FA 2DQDL 3O4LE 5DFWH 3TBVB 3AM8C 1F11A 4R7NB 5TDPB 4QRPE 3WIHA 5GS1A 1FV1B 1A9EA 3SKMA 1LDSA 2DMBA 1ZA6B 2VNCA 2Y06L 5DQDL 3TBWB 3WS3B 3FMGH 1YNKH 5LBSL 5I9QB 5T1MA 2A9MH 2MHAA 4L3EA 1QFWL 4FRWA 5TE6L 1MLBA 1NLDH 4JZJC 1V8HA 2VH5H 3PWPE 5E8EA 3G5VA 3D2UB 1WISA 3M17A 5J4MA 4Q9RL 3ZYZA 2GJ6B 1OSPL 4LASH 4XNQB 3MV11 3JV4A 3RWJA 3WSQL 5ESAB 1NCDH 3QQ3B 5A2KH 1AXTH 5JMOC 3D69B 1AP2B 3MRLB 4U1GB 4MWFB 5IW1A 2NY3C 2NW2A 3IXTB 3NIFF 4KTEL 4LVOC 3T0AA 3VH8B 2EXYC 1H3WM 4WI7A 3NCYS 5HBBA 5HY9B 1M05A 3HUJF 5IFAL 4KI5C 4OD2B 3GMNA 3ALPA 2NY0C 3MRIA 5E2WH 1NBVL 1N64L 1Z9MA 4JO4L 3RHWF 4GQPH 3FFDB 3SO3B 3FB6B 3NN8A 4AL8L 2FWOA 5H94B 5GS2H 1TZHA 3CLFH 1SJHB 4CGTA 5F9JA 4DK6A 5DMJB 2A9NH 3IKCA 5DT1L 2X2YA 4TPRL 4MAUH 4XBEL 3QIUB 4HUVA 5JXAH 2DLIA 1CN4A 3IXAA 1R24B 4LKCB 3GMMB 1MAKA 1PLGL 2M1KA 1AGDA 3HUJB 4JPVH 5C0IA 1JGVL 3U79A 3HA0A 3PDOA 3BEWA 3HCVB 4DGYH 3MFFB 1PD6A 4JFQB 5HYQB 2W9DL 3JZ7A 2Y23A 4F8TA 2Y5EA 1R3JA 2FL5A 4P5TD 1QYGH 3L95A 2VOTA 1CDBA 2IMNA 3S97C 1ZGLB 5TPWL 3BDBA 5JOEA 1UEYA 2BXZA 1ZT1B 4RMQA 5CGYD 4JHWH 2KBGA 3P0YH 4U1MB 4P9HL 2VLJB 4JFDE 2X1WL 5ALCH 5D5MF 2Y7QB 2V2WA 5JLZB 2X7LA 4PJXA 4RGOL 3O2VH 4C83A 3NCCB 1JZ2A 2F8VA 5CJQH 4I4WA 3V9FA 5C08A 1H3PL 1B6DA 1RZIB 3IFLH 3PHSA 5F71A 2YZ8A 3AFLA 1JPGB 3T3PF 1DUYA 4IMLA 1CF8H 1U8HB 1S9WA 3ILPA 3QCVL 4ZFFA 4P2OB 4M7ZB 1KEGL 2QSCL 1YZZA 1BVLA 1TIUA 2ZPKH 3TM6A 2G75B 4HPYL 3DV4B 5IOPB 3IAGC 2OK0L 3DSFH 2JB6B 5AEAA 3DURB 4D9LH 2VSCA 4MNQB 3SDAC 3MV9A 4GRWF 4NZRH 4JPVL 2ZWLT 1NC2D 4W70A 4HIXH 1E28A 3JV5A 3GK8L 3IJYA 3ULUF 4DVBB 1INEH 3U30C 1R5WA 1KT2B 4UDTB 3ZT7A 1UM6H 4MAUL 4XBEH 3RWEA 4TTDD 1AQDB 3ULUD 5C0FB 3N1PC 1N8ZB 1AR2A 1XZ0A 4LKXA 5HYJB 4XWGL 4FFWC 1I8MB 3O4LB 2CDFA 3NCMA 5KSAC 4PJFA 2CXKA 4PP2B 2H32B 1CCZA 3KXFB 1KPVB 3Q6FB 5DO2D 2XN9A 4RMUA 1I9JL 1X6NA 4J4PD 4I0PB 1NGQL 2LTQC 1MWAH 4DQOL 4W4NA 1U8MA 5HHME 2Y7QA 1MQKH 3SDDC 2COQA 3IDGA 2K3TA 3TBSB 3VXUE 1DANU 1FHGA 3LIZH 1DQJA 1NCDL 5FHBH 5KVFH 2FJFA 2ESVA 1ZT4B 3GJEA 1ZGLA 2V9QA 3W0WB 2DIAA 1I7RB 1GGCH 3S5LB 1Y0LA 2CRIA 3KYAA 3LKRA 5FA4A 2OJEB 5EU7C 4PJ7E 1ETZB 2EECA 5T3XH 4AJ0A 4LF3A 4GRLA 2EKSB 4JO1H 1VDGA 2I27N 2VLLA 3B9EA 3AMLA 5FKAB 1PY9A 2YEZB 5MHSD 3ARFA 2Z31C 4BK5A 3EHBD 5CCKH 4PYGA 5ESQA 4WFGE 2JJSC 1KJ3L 2NY2D 1RIUH 5CLTA 5TQ2H 5BQ7B 5IIEA 3BP6B 3MLUH 2E7MA 3QDGD 1QFWI 2HTKD 2WMPA 2NX5D 4LRIC 3BPCA 4OB5L 1KT2A 1IGFH 4UDTA 1OAUL 1QQDB 2DQCH 3QJHA 5IVOA 4KJWD 3MFGB 5E94B 1A0QL 5DA0B 3VH8A 1SHMA 1G7HB 3MJ9A 4I13B 1GYAA 5F7NC 3HAEH 4JKWA 4P4KD 3B9KD 5GS2D 3QUKA 4ZQKA 4XXCA 2QADB 4FQIL 5JZ7D 1H0DB 1ADQL 1M6OA 3ZYOA 4U1KB 1GGCL 3U0WL 3PHQB 2IGFH 2GSIB 2BSSB 3LPFA 4OLYH 4U3CA 5FO7A 3C5SB 5BMFL 2EDTA 1Q9KA 4L5FH 5D2LF 1V3MA 5KJRL 1DQJB 5C0AB 3DLQR 4D9QD 2BVPB 2V5YA 4Z7UA 4GFTB 4U7SA 2OTWB 1FNGB 2YUXA 4MXWL 5C0IB 2IC2A 2PF6A 4RDQG 2W92A 5EB9A 4PJ5D 4HFWB 1G7IA 4BKLB 3ARRA 1UEMA 4PR5B 5IBTH 5KVGH 3VXSE 3PV6A 3H9ZA 2DL9A 3E2HB 3ULSB 1KSRA 1BZ7B 4YHIB 2XTLA 1IAMA 4XWGH 3AREA 3VFTA 2R23A 2K7PA 3LQAH 2YKLH 1QLEL 3FN0H 4PJIB 2A83A 3MRMA 1PG7L 4XNUL 5HDOA 4EN3C 5L9DL 2ZJSH 5IQ7L 2J2ZA 4LLDA 5KAQF 5FYLL 1I1FB 3QO1B 4HIXL 4I9WD 2X4PB 3RX7A 4GKNB 1BECA 3BAEL 3QUZA 4J1UB 4ODSH 2C7UA 3MUZ1 5CAYB 3I02A 3G08B 3FQRA 4LSDA 3DSFL 4U1JB 1YEIL 2UZXB 4X6CF 4KUCD 4JY5H 3VW3H 2VXUH 5BZDA 3GRWL 3WFEL 3MRCB 3QHFH 1GGBL 5C1MB 5C0CA 4WU5A 5EOQH 4BSWA 1E4XI 2EDLA 3PDDA 5CGTA 2DTMH 4H1LB 3X12A 3DV4A 3DBXB 4Y4KB 4UUJB 2P5WE 3BP7A 1L7TH 3RWIA 4WUKL 3WNOA 2W0PA 5HHMB 4PIRF 5DRXB 4RGOH 3CVHA 3PQYB 4OGYL 3ULVD 5ISZB 4H8WH 4KZDH 2NY3D 2OQJB 3L3KB 3SGDH 1N0XH 3VH8G 4OI7A 3QCTL 3WCYA 5MEOA 4LLVA 4XPHH 2D9QB 5E0QA 3KLHC 3SDYL 3QWQB 3FTGB 3KYMA 5TH2A 1FO0H 2F58L 1YY9C 4M7KL 2F5AL 5CEZL 4NKQB 4B7IA 2OR9H 5I30H 5DHVA 1SBSH 2YKLL 2VQTA 4OGXH 2RQ8A 2PXYA 4KTDH 5INDB 4FZEL 4O2EB 1NAKH 3T8XB 3BZEA 5CBAB 1G9MH 3CFBA 4N90D 4L8DA 3M17B 1KLUB 1CICB 1KJ2L 4ZYKB 2VAAA 5AZ2L 3KYNA 4TVPE 3RVUD 3UTPD 5E2UL 3OPZH 3RX5A 3IDGB 5EU5B 1RJLA 1G0DA 1T4KB 3QIBD 3MLZL 1XF2B 2AABH 2D03L 3CVIL 4LEOA 5GS0L 1VACA 1GOGA 2AKRB 1XGUB 5TDOB 4OF3A 3LS5H 1SJEA 3V7AG 3EO0A 1IGJB 4EVNB 3N1QC 5E00B 4PJDA 5MENA 4UV7L 3IRZA 3CFJB 1Z6JT 4ODSL 1FFRA 4BQ8A 1DR9A 4F7MB 1AJ7H 4KRPC 3MA9H 3DRTA 2A77L 2AV1B 3QUXD 3O9WA 2BOBB 4CN6A 4PRIB 4MQSB 5DK0B 4BSVB 4OIAA 2GK0B 2N7BA 1MCWM 1VCAA 3O81A 4WUUB 3C9NB 4CJ1A 1A4JB 5IFHL 1LDPH 3CFCH 1ND0B 3V4UL 5KSAD 2BRRH 1OY3B 2HJFA 2X9XA 3CFEA 4ORGA 3IDNB 1NMBH 4J4PC 3MNWB 2X4RA 2BHZA 5T3ZD 4X6DE 2NMSA 4X5XB 1XT5A 3BGFB 1FZOB 4FTVB 5LGJB 2MQ3A 4XP6H 4QHKJ 4LGRB 5FDWB 5C7XL 1IQDB 3WJLA 3IDMA 1VKXA 2IQAB 2ZUYA 2YMXH 3IDJB 3LEVH 2KUTA 3NCYP 3WNLA 1F8TH 3EO1A 4GRWH 4D0DB 4Y1AD 3FO0L 1LK2A 1BF8A 1EZVY 4ZSOB 3T1FA 3MV7A 3W9DA 4MD0A 3QNYA 3FT2B 5I8OL 2ZNXA 1Q94B 5HHVL 4NQDE 3SE8H 1KCUL 1KIUA 3GSVA 1IFHL 3VXMD 4X7FC 5C0EB 3DUSA 1MHCB 4NSKA 4FABH 1JNLH 3FONA 1OGAA 5DO2C 4YDKH 1QRKA 2MCPL 5KOMC 3P30L 4EI6A 5CP7B 3O4OC 1QP1A 3VGGA 5C70A 3WUWA 4OB5H 4QRRD 5HHXH 3MGOB 4Y7MA 2F15A 4EI5D 3U7YH 4CADA 4F9LA 4X80L 1JHTA 1BQUA 1SBBA 3QCTH 3L5JA 5F7YC 1N5YH 1UFUA 5C8JA 1U8IB 1HI6A 3AU1B 4I0PC 4PRIA 4NKOA 4XCCH 5ILTL 2X4TB 1F6AB 3GSNB 4P9MH 4M1GH 4KJWC 1WIOA 4XNYH 3B5HA 3VDCA 4X5XA 3MLZH 4I0KA 4FQXC 4XTRC 2WWKO 1V7MH 2HJKA 1LO2L 1ZEAL 1ZLUK 1NEUA 1LEGB 2C4FU 1T7YA 1YPZF 2Q8AL 1MIMH 3EBAA 1OP3K 5IB4B 3UCRA 2VE6B 3MA7B 4MMXC 3E0GA 1K6QH 3MOAL 2FIKA 3O41B 5F21B 2IJ0C 4WFED 5D7KD 5EUOE 2MFNA 4MB3A 1MCDA 3F58L 1S3KL 1YECL 3SE4A 2DI9A 2HTKC 2WWMD 2GAZB 4MHHG 5IW6A 3SBWC 2VDQH 4P3CL 2BVEA 3HMXH 3TIEB 3VFWB 1MJ8H 2LQRA 1TVDA 3V5HB 4HS8L 3CNKA 3LPWA 3TBYA 4M48H 2OI9B 1N0XL 5HPOA 4G6AC 3EYOA 4P4RA 2BFVL 1RUPL 3WIIL 4G9FD 1JK8A 4JM4H 1UJ3A 1S7VB 1CFSA 4FFVC 4HWNA 1NGPL 1IC7L 1S7UA 2UV3A 2P8MB 1WWAX 1WBXB 2GSGA 5SWSE 3P3YA 5CBEA 1QSVA 4U1GC 1MCCA 3T8XA 2O5XH 3FAXA 5FM4A 4XXDA 1YEJH 3O8XC 35C8H 3BDYH 1I7RA 5E1AA 2W0FA 2A2QT 2UYLA 1VEOA 1CG9B 4OZFH 4PLOB 5AD0A 3HHRB 4R4FH 5E2TL 2W07A 1BQHB 2JCCE 3F12A 4QRRA 5B8CA 3B5TA 4MAYB 2QSCH 3BKMH 4U05A 1XF2A 1MUJB 4U6TA 1A6TA 3I9GL 1MFAL 4FP8L 3WDHA 2NY6C 1KELH 4NKDB 4NRZB 1OAZH 4NDMA 3I6KB 3I3BA 1Q72L 3QWOA 2E27H 3MRQA 1JPTL 1L0XA 2L7UA 2DQCL 4N8VA 1BFVH 5F7DA 2Y36L 4NM4L 1S7SA 7FABL 1SVZA 3IT8D 5D1XD 5DUML 3OJVC 5ADOH 3HNVH 4YFLI 5MERA 3MLUL 2BY1A 3VXOA 5TQ2L 3CSBA 3BUYB 4MX7A 5FYLD 2VLKD 3UTSD 2IFGA 4P2QB 4N8CH 2QQNH 2CR3A 1S7WA 4L4VD 4YWGL 3CXHK 4JFHE 4EQ3A 1I9EA 4NKMA 1X4ZA 1HNFA 3DIFB 3QUML 1BWWA 3DYPA 1Q9OA 4FMKA 5I66B 4G6ML 4LCWD 3Q1SL 1JF1A 4JFDA 4XWOC 5HDBE 2AJ3A 5ID0B 2XKSA 1DBKL 4N8VG 3RVUC 1B4JH 4X9IA 1N8ZA 1Q9LB 1YUHB 3SKNB 5FKPB 3C5SA 3AY4C 5F44A 1GIGL 1NKRA 3ULVC 1E28B 2DTSA 3UTTB 1BEYH 4R0LA 1MFDL 5B3NA 1IEBB 3B6SA 5E4IA 3QUXA 4XCNB 4G43A 2A6JA 4C56D 1WTLA 3VMOA 3S96A 1MQKL 3O6FC 3RDTD 4UT9L 2G5RA 3BSZL 2G75A 5IOPA 3PV7A 4M8QB 4BYHA 5LG1A 5MEND 3O6FA 3LRGA 5C0CE 1NGQH 3CSYA 4QOKD 1MH5B 2BCKB 2R2EA 2P7TB 3C08L 4HK0A 3SY0B 4WHTB 1OHQA 4HIJB 4AK1A 3P4MB 4K3DH 5DA4A 4TSAL 1A3QA 1FE8L 1XIWA 3DVFA 3WIHH 3FOMA 4YHPA 1XF4B 2R29L 3U0TA 5IWLA 5JPMA 1I8KA 3A0OA 4ETQA 3W5NA 3RVTC 3DI2B 2FO4A 2BNUB 1BPVA 1INDL 3X3FL 3HE6C 2APWA 4O2FB 5E8OB 1YEHL 4LSVL 5FYJD 1U92B 4F2MB 1KB5H 1TFHA 3VXTB 1UYWL 2YEZA 1NGWA 2MMXA 1U8LB 4YGVA 4G8FB 1SY6L 5HPMB 5I73B 5IMKB 1NLDL 2BJMH 2PXYD 1ROWA 5MI0C 1KTDA 43C9B 3K2UL 2XWBA 4Y5XC 5DRXA 1AC0A 4ZAKA 3Q5YA 4P59L 5I1HL 1NMCC 2MPAH 4JDTH 4M1CC 5JQ6H 4MMZC 1Q9LA 1A6WL 1FAIL 4NOBA 1AY1H 4F57H 4HXBH 5BS0B 3SQOL 1NGZA 3HLAB 2VIRA 1JF1B 2FBJL 2V17L 1NC4A 3S98A 3K2MC 1GGUA 4O5LH 4TTDC 3ULUC 4RZCB 1OTUC 1KN4H 2GITA 3G6JA 5E8PA 2FECI 1KIRA 3MOQA 4TRPH 4XAWL 4X7SL 3T65B 5JPNA 1FNSL 3PDGA 4OLVH 3FO9A 1S78C 1K4CB 4PJ7A 2CLRA 4PJGE 4UDUA 5SWSB 4PG9B 3OR7A 4JO3L 5IT2L 4CNIB 2R0ZH 2NY1D 3VWJB 4JHWL 4NZTH 2DQGL 4KK6C 4MNQE 4G9FE 4N0YH 3A6OA 4PJCA 4DFHA 5B8CC 1A7QL 2EDDA 4JE4B 3CDGB 3D0LB 5EBLB 2VISB 3GKZA 1INEL 3RGVD 3WO3B 5AG8A 1FYTA 5DRNA 1DQQA 1SEBA 4JFFD 2GT9A 2XIDA 1G1CA 5KZCB 3QUZD 3T0EB 4YHYB 5ITBH 4D9LL 4IHOB 4GUPA 5CLWA 3BPLB 4YH6A 2XZAL 1WWWX 3IDYB 4ZUWB 2VDKH 1JGVH 1TCRB 3B8YA 5CZXD 3ZKMC 1E4KA 3KPLA 2F5BL 1U41A 1NGWB 3KXFE 3W5MA 5GS1B 5HYEA 1QPXA 3L3GB 1FIGL 3CK0L 1WFOA 3MRPA 4QHMB 5I8CB 4WW2F 2W0FB 2J4WH 3MSPA 4TQEL 3TO4C 2WLYA 4QGYA 5IBUB 4KJQC 1MLBB 1TVBA 4CMMB 1HH9B 2V9RA 2FYYA 1MCKA 1YPZE 3H0TB 1OQXA 1A4JA 4Z7UF 3SBWA 2NY2C 5DD6A 2HTLC 3TV3L 4U6HB 1NMAL 1AIFA 4A6YB 3SE4C 3W2DH 1BJ1J 1RURL 3QQ4A 3H6JA 5JOPD 3RI5F 4UNVA 3MV7E 4CL7A 4LU5H 3WL9B 4YZFF 2VLMD 5J6GB 3GHEH 1HQRA 5DYOB 5I18L 2XA8H 4R3SA 4KKLD 2BXYA 3BZ4A 4KVCH 1JGDA 1F4HA 3VXRA 3TNNA 1WT5A 1FFNA 5HHOD 3FRUB 5FCUL 1OGAE 1NAMB 4NZDA 3VGEA 5I19H 2VLKB 3UTTE 1A5FL 5JZ7C 4P4KA 2I25N 2O61A 5HHOA 5HI5C 1IM3B 2QR0A 1I8LA 5JW4M 1FPTH 2NW2B 4KROB 2VN7A 4ONOA 2PYFB 3VGAB 5HY9A 3C09B 4ZFZB 1P4LA 3JWOC 4C4KT 4PBXA 1JHLH 4F9LC 5KANI 2CRMA 3ZO0A 4HKJB 2VDPH 4NQTA 3C6LC 4LDEB 3JWDC 3DGGA 5DK2A 1PJ9A 5C0BA 1RURH 2G9HA 2GYSA 1EFQA 4NO3A 4N0RA 3GMOA 5IK3A 3DPBA 2WUBL 3TEUA 4QXUL 4XZUA 3KPRD 4IBLT 4BQ9A 4RFNC 5EO0B 4U0RB 4F58H 4HUXA 2V5MA 1HI6B 4X7SH 5DMKA 3BIKA 1J0IA 2ZUTA 2DWDB 2FR4B 2FYYB 3WSQH 1YNTA 5C0AE 1UZ8B 3FO2B 5IB1A 5I74C 1HNGA 4LASL 4NHUB 1BBDH 4ENEC 2K1MA 4LCIL 3GMQA 1I1AB 3L7EA 3RWHB 1OTSC 3L3OA 1FRGH 2J8UF 1KPUB 3GJFK 4ZFOL 3KLAB 4WFGD 3IU4L 3S34H 2SEBA 3WJLC 3BPOC 2GJZB 3VXSB 4LSQH 1BQSA 1G7LB 2NY4D 4R90L 1KFAL 1CL7L 1I1AD 5CSGA 2E7BA 1INDH 3X3FH 1CZ8H 1GPOH 5EUKA 4ZTPH 2DAVA 2E9IA 3LN4B 3GJFA 4J4PA 1I8IB 2FBOJ 2DQGH 1EJOH 1MCSA 1II4E 4G9FB 1NAML 4HK3N 4U33A 3SDXE 3VFMA 1UJ3B 3CFJA 1S7QA 3OKLA 5FA3B 5IF0B 4YAQB