3LZFL

Crystal structure of fab 2d1 in complex with the 1918 influenza virus hemagglutinin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
212
Chain Sequence
PVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVSWYQQVPGTAPKLLIYGNNERPSGVPDRFSGSKSATSASLAISGLQSEDEADYYCAAWDDSLNGFWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of preexisting immunity to the 2009 H1N1 pandemic influenza virus.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin, HA1 Subunit
total genus 41
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfL01
3NFPA 4RA0C 2HTLC 5GZOC 4XCYB 3WFCL 2H41A 4RFOH 3UPRA 4KJQD 4LDEB 5I18L 5JHLH 5F9WC 1DQML 3TIDB 4M1GH 4C56E 1KENH 2A9NH 4H5SA 3IT8D 5FCUH 4RDQF 5CSZA 1JHLL 4Y1AB 3QFJA 3ARZA 5F8QC 1ETZA 1T04B 4PJ5D 4JQXA 4GRLB 1HSBA 3B2UC 2QADD 4PGJA 2F53D 3VJ6B 1FYTD 1F3JB 1HZHL 1HINL 5IHZA 3T3PF 1HYRC 1BOYA 4ETQB 4N8CH 2NNAA 3VXNA 1S7VB 2C5DC 3LPGA 2FLBT 5TQ0H 3ZHDA 1XMWA 4U1NA 3QWOB 4CBPA 2C7UA 2VDKL 4D94A 1WZLA 3DBXB 2KZ1B 3QXDB 4LHUA 5EOCL 1AE6H 3IVKA 3CMOL 4I5BA 1BF8A 2Y9RT 2DWEA 4L8CB 4L3CA 2ZSWA 3MV8A 3KWWA 3GK8L 4U2ZA 4Y5YA 4JKLA 1OTSC 3UTTE 4OZFB 4BH8A 3DX9A 3OKKA 1H3XA 3C6LA 1E28B 2ED8A 4M62H 1E28A 3MGTB 4WFED 1LO3L 5E6YA 4JQVA 3MUZ1 4OCSH 2WLYA 3IDJB 1T5XB 5IR1A 1AD0A 1MJ7H 3ZTNH 4IDJL 4JGUA 3BKCL 3NGBC 3F7YA 4Y19B 3TO2A 1YEFH 3AU1A 4Y0GA 5B8CB 2P5EE 4FQ2H 3QJHA 2VE6B 4R7NA 4I48A 1MWAL 2L4OA 1FVDA 1URLA 3BQUB 3IGAB 3U9PH 3BSZH 3D85D 3KYMA 4HC1A 2Z31B 4J4PD 3DV6B 5IVZA 3HZKA 2W0FB 3HUJF 2H26A 4I0PB 3DX8A 2EICA 2XICA 1EFXA 1U8LA 3ARFD 3BD5A 3O41A 1HOCB 1YN6B 3PUCA 1WIOA 5EU7E 1BGXL 3MLXH 4N8VB 3OGCA 3SOBL 1NAKL 4BKLA 4D8PB 2R0ZH 2P8LA 3VCLA 5T33L 3PIQA 3EZJB 2R4SL 4M03A 3T77A 1CFVL 2I9LB 5I1JH 3ES6A 5GRYA 5SX4I 4YC2C 3ES6B 1B3JA 1T22B 3DI3B 3G6DH 1ZGLB 2CXGA 1WEJL 5TE4H 1U91A 3DVNA 5DJXB 4HWNA 4G8GB 2D31B 3ARBD 1BVKB 1NCDH 3RGVA 4NQSA 3TZVA 1U58B 1QFWL 1U8QA 1WC7A 3B9KB 3FO1B 4A6YB 5J12B 3V7AE 2W38A 1U58A 1WC7B 3IXAB 5CEYA 4U6VH 5ESQA 5GS3A 4LCCC 1HIML 5J56B 2OTUB 3I3BA 4HCRH 3WL9A 1AGCB 3MV9E 2BOBB 2C3WA 2VC2L 4M93C 4CNIA 4JN2B 4BQ6A 1OTTC 5E95B 2J8UB 4LEXL 3UO1H 4XVSL 5KW9H 4HS8H 5EBGA 2JCCF 4XGZA 1JNLH 4UAOB 3T2NL 5TF0A 4XBPA 1JGVL 1U3HA 1YN7B 3FN3A 4HKZB 4ODUA 4QOKD 5IBUB 4AJ0A 2X4PB 2PR4L 3D0LB 4PJIE 5DI8A 3GMOA 1CL7L 1SJHA 3HZMA 4ODWA 3HN3A 3FFCB 2EEBA 2AJZA 3BIBX 2DWDA 2EECA 2GI7A 1HNGA 3NIFF 4OF7A 4QXTA 1JUFA 4PJEB 3EKCA 4PGCA 5I1KH 3EOYG 5HHOE 2YC1A 3RQ3A 4PS4H 3CFKB 2BFVL 5C08B 1SJVA 2VDOH 1RZKH 5E94A 4AZ8A 4CW1A 1OF2B 1EJ6A 3WDJA 3DIFA 2EE9A 4GRMA 3DPBA 4PJCE 4CW1B 4B7LA 4MZ3A 5INDB 1U0QA 3IU4H 1UH4A 3N85H 3BUYB 4MAYA 5T5NF 4JVUA 4WDIA 2JB6B 2EKJA 2ORBH 1I7UB 4K3JL 5GRVK 3VI3E 1D7FA 4X6BA 3E6FB 2R23A 5KSBA 4P23A 1YNTB 1FIEA 3FQTA 5FA3A 1KC5L 1QRND 4MAYD 3IGAA 2X4UB 3O3AA 3QG6B 4HZLB 2NY3D 2VE6A 1R5IB 3KPTA 4UQ2A 4LLMB 2AKRB 1TZIB 5ANMB 2VLJD 3MRNB 4L3EB 4LDOB 4V1DD 4WWKB 1MHHA 2IALA 4LLWA 4TUKH 5CGYD 4Y8DC 2XZZA 5D2LB 3RA7L 4JKKA 4PJAB 1S7SB 4PBXA 3U7AA 4UILH 2JIXD 4YQXL 1CDJA 4Y2DD 1KSRA 2DBLH 2YPVL 1ONQB 4RX4A 3V6OE 5TPWH 5C9JB 3U4AA 5D1QC 5GRUH 1HQ4B 4I0CC 1RJZA 4HPOL 2OZ4L 3UO1L 4ZNEE 2R0KH 3BGMA 3AGVA 3OXRA 4PS4L 1BVKA 1F6AB 4WW1B 4F2MB 1HHKA 3OJMB 3BD3A 2I5YL 3NABH 2H32B 2X4QB 3G5VA 3O0RL 3X3GL 3BP6B 1IAKB 2XTJB 4WU5B 4L8SC 5ITFB 1I85C 4NWTL 5EBMA 2E7HA 3K46A 3UTPD 3QQ3A 5F21B 4KJQC 1NBVH 4CU8A 3AVEA 2HLFC 1A7NH 5IBTL 4AH2B 4KKAC 2V5SA 5I1DA 5F1NA 3S88L 4JFFD 3H3PL 4OFVA 2VLLA 1CFTB 1AGEB 2IPUK 1S9YB 5I1JL 5L8KB 3VRIB 5JUEL 3IU3A 4ODTL 3TPKA 3D0LA 3BPNC 2VC2H 5IEHA 2EEAA 5FO9A 4XBPB 3QIBD 2I9TB 1E4KC 5E8OA 3AAZA 5KVEL 1FLTX 2GTWA 3HI1A 3BGAA 4YXKH 5T3XH 5CHNA 5JQ6L 4NP4L 4YZFE 5DC9B 3AS3A 5SX5K 5T5FL 1EO8H 1LP9A 1HXMB 2R1YA 4K8RH 1MCNA 4LK4A 4Q9CA 3EYFB 1MWAH 1MCSA 5HHNB 4M4RA 3KXFE 5CEZD 4TRPH 5FYKU 4GG8A 1J1XL 5FUOL 4QF1A 2VDLH 4MJIA 1D5MA 2AP2A 2BXYA 3HC0A 4AQOA 2C1OA 5I8CA 1BD2A 2F58H 1FL3B 1BFVL 4BUGA 2QHLA 5IQ9A 3LEYH 3QXTA 4ELMB 3KXFA 4HIJB 3DUSA 2F54D 1QRKA 3GSQB 5DLMH 3RL1A 1N8ZB 2QR0B 3QPQD 4X6DF 5HYEA 1KB9K 3FQTB 4XP4L 4NKMB 5DMGD 4G9FB 3EO9H 1MI5B 1WCBA 3HZYA 3FT2B 3RVXD 5ADPL 1MCOL 1BFOA 3I85A 4YR6B 4HIIB 1CIDA 1KG0A 2VXUH 4R8WL 1B6DA 4R96A 5DJ2A 2JTDA 1NAMA 1NCNA 3PWVB 2WAHA 3NFNB 5GGVY 4MLIA 3FO9A 3S6CA 5D2LA 2AEQL 4KKCC 2IALB 1G6RH 1OM3H 4X5WB 3OGOE 4JFDA 2EH7H 3HE6A 2X2YA 4V1DB 3V95A 3X3FH 1UZ8B 3MRCB 4GAYA 3VH8A 3F8UB 1T1WB 2DQCH 5HGBA 4U7SA 4PJBF 4Z7UB 4HHAA 1QSEA 5DHVH 1EXUA 1E4WH 5BRZE 3SE3C 2Y07H 4OLZL 4UT6L 5HBBA 1OQXA 2GJ6A 4PJDA 4ZSOB 4NHUB 3S8WA 4XP1H 5J13C 2HH0L 1MJJB 5IMLA 3FRUB 2Z8SA 4JZNB 3W11C 4WW1A 5C0RH 1WBYA 3GMNB 3QUYC 2VDRL 1J18A 3ULUC 3BW9B 3ROLB 1BLNB 3LKOA 4RIRA 4PJ8B 3BW9A 3ROLA 3MLYH 5AD0A 2XQBL 1HINH 4BM7A 2X9WA 2A1WL 3T3PE 3TM6A 5AWNH 1MCHA 4ODVH 2V5RA 3GSWA 2FIKB 5HYSB 4WEBH 5CJ5A 3INUH 4S1RH 2WZPD 3GSWB 3RY5A 2XA8L 3KPNA 4KRPD 4PRPE 1CFSB 1V3MA 1FAIH 1HSAB 3S4SG 3PHSA 1ZA3A 1KTRL 1SJXA 3KYAA 3PWUB 1FO0B 3BEWA 3F7PC 1DBBL 1DN2A 4XZUA 2HJKA 4O02H 2YA2A 3U36A 4J12A 2QQKH 4PRNB 4XZUB 2LABA 4GG6B 3GM0A 4L8SA 2CK0H 5DJXA 5C8JA 3SE4C 4JAMA 3HUJE 5IESH 4YFEA 5DGQA 4P57B 3SDCD 5L2KB 4M48H 3IFOA 3RX8A 2R1XB 1LO2L 1KIPA 1A6ZB 1DE4A 1U2HA 1U8IA 5CEYB 5IESL 4L4VB 1FNEA 4Y2DC 1INQA 5HDBF 4P2RB 1JZ5A 1FH5H 4P2RA 5JHLL 3EAKA 1MAML 2OL3A 1D5MB 1Z0NA 2VZ1A 1F00I 4RGNE 2VLRB 3ZSSA 4RNRB 4PRIE 1OLZA 2FYYA 1QNZL 2Y07L 4OLZH 4UT6H 1TVHA 2VR9A 3TYGL 4NQDA 4F33A 1AIFA 2I07A 5JW3H 1QSFB 1V7MH 3KPRE 4LLDA 2HFEB 3KXFB 2PN5A 2FRGP 3G5ZA 5IIEA 2BNRB 4PY8J 1U8PA 4G6AD 4TQEL 1U8NA 1UFUA 4NCC1 1MY5A 2EYRA 1MREL 1U8NB 1OM3L 3RX5A 2X89A 1OP3K 4FFYL 2X1PA 3H3KA 2GJ6E 4MAUH 3BP7A 3HI5H 3ZYJA 3O8XB 1IZKA 4XXDB 1A3RH 3RGHA 5L88H 2IBGA 1D5ZA 5T1MA 2HMID 1S9WA 1NLDL 3B9KD 3IFNL 3EDJA 4DEPC 5FO8B 1JRHI 4KWUA 1YJDC 4JZJA 5IM7A 3JVGA 1FO0L 4CJ0A 2QTEA 3P77A 3GSVB 3H42L 2OSLA 3P4LA 3SDXB 4JZOB 1G7JA 3Q3GB 2PETA 2Z8VC 3MRPB 3MLPA 3KR3H 1BWMA 2XKUA 2GK2A 3LEYL 2ZG1A 1J0HA 1P6FA 2CJUL 1HHIA 3GSOB 1DBJH 4ODHH 4BJLA 2D03H 3MGTA 5J13B 1IE5A 4LFHG 3ILQD 2CDEA 5CKGA 4BK5A 5KSBB 3BKMH 4HWEH 5IVXA 4MNGE 2N1KA 4MQ7B 5I75B 5B8CA 4PGZA 2BK8A 4IIQC 4Z7OF 4TULL 4N0YH 4JFPB 4XNMA 3SO5A 1LEKA 4LLAA 1S5HA 4K8RD 5ETUB 2AKRA 3ULVL 2N7AA 3OX8A 1JGLL 1MI5E 2A6IA 3ARDB 5EBWB 3WN5A 3UYRL 5AYQA 3VGGA 4K23L 1UH2A 5JIHA 2DN7A 1RULH 5HYIA 2YRPA 1GOFA 2H32H 5HVGB 2XN9E 1CK0L 3QXVA 1ORSA 4Y5XA 5JMRA 1MHEB 4OFYD 5IFJB 5E5RB 3NAAH 4LMQI 1X6LA 4HK0A 1QO3B 3H3PH 3QDMB 3TA3A 3QYCA 5F7DA 1QO3A 3KHQA 5M95B 4DUXA 3P30L 3BHBB 1UM4L 1A9BB 2DYPD 3VXUB 4PJ9C 3T4YB 2H8PB 5DVKA 2NY2B 2AW2A 2NYYC 2P24A 3KPLB 4L5FH 4W68A 3SKJH 4LPYA 3RGVB 3SCMC 3TZVB 4L4VA 4DVRH 3EJZD 3PWPD 1A6ZA 1DE4B 3MLSH 4C4KO 2OQJA 5LGHH 1RZ8A 5I16B 1INQB 1NGWB 1QLRB 1QEWA 4S1QL 3MV9D 4X4XB 4Z7NE 3P4NA 1M7DB 4L4VD 3P0VH 2CO7B 5GIRB 2AK4D 4CVXB 1UA6L 5DUML 3O4LD 3S36X 1YPZB 5HDLA 3RP1A 5C0AA 3GUTB 4OFIA 1FNSL 1D6VH 3BPOB 1BJ1J 4FQHA 4ISVB 2EC9U 3TA3D 1BF2A 4LKCA 3M8OL 2C4FU 3OBAA 4OD2B 4UIKL 3MV7E 1KN4H 3ULVD 1DBML 1MWAB 3RWGB 5ILTL 2BVYA 2QADB 4CVZA 1OPGL 5C0BA 1IM9A 3MRMA 5C86A 1OAKH 4ZD3L 2EXWC 4NN7C 5FK9B 5IMOB 1G9ML 4JHAL 1CICB 3ZKMD 5C6TH 1W0VB 5IM7B 1DUYB 5IOPB 4QF1B 5CGMA 3ZE2E 2R2HA 3LIZL 2H3NB 5A2KH 4J3SA 2MQ0A 5HGDB 3JTTA 3OL2A 4D0CA 2ICCA 3TVMB 5L9DH 3OB0H 2VYRE 1NCCH 5MENB 1A6WH 3UBXB 5LBSH 3GSOA 1AC6A 2V5YA 4I3RH 5DJ6B 3U9UA 4HG4K 1P2CB 4M7LT 5D7LD 1INDL 4M7KL 1G9NC 5SV3A 5JIPA 3ULUH 1TJGL 2XRAH 5I0DA 2R9HC 1I7UA 4LVHB 4DZ8B 3MNZA 2BNRD 4PP1C 4R26H 4WCYH 3ILQC 1RIUL 3G08A 4JFEA 4OD3H 2Z0BA 4XHQA 2VDOL 5IB1B 4RGOL 1C5BL 3UTPE 3CVHL 5FA3B 2R15A 1JGUH 5D1QA 5J6GB 1MRDL 3PQYA 1CXIA 3PWVA 3UYRH 4JFYA 3O2VL 4P59H 3OWEA 1FE8H 4DN4L 2EDOA 4EUPB 4FMKA 4LP5A 3SDYL 2QKIB 3QPXH 1RURL 1ZOXA 1JGDA 3LKPB 2M8XA 3IU4L 2VLKA 4HKBB 4PJ7B 1JNJA 2NCMA 3BN9D 5CJXA 4QXGH 1U92B 1A02N 2X89D 2I26N 1WAAA 4PJ7A 1JNLL 1D5XB 1CLOL 4G43B 2CUHA 4ZS7H 1RZIA 1I4FB 4XC3H 5D7JC 3KPQA 4WY7L 3BGMB 5BW7A 3K4ZA 2Q7YA 3VD3A 1GZPA 4U1GB 5EU3B 3CC5B 1FSKC 3PL6C 3MXVH 3KPLA 4ZQKA 2P7TA 5SX4H 3QUMA 2A74B 3V6FA 3GSRB 2H8PA 4M7ZC 4JFQB 2CQVA 1KCRH 3I84A 1FGVL 3BP4A 5I19L 5CEXB 1XCQA 4R3SB 1XZ0B 5F1SA 3EYQD 1UWXH 1NGWA 1QQDA 1SYVB 2XKSA 3MCLL 2K7QA 5EG6C 5SWZD 4AIOA 3WNKA 1YPZE 1FDLH 3QUKA 2OR7A 1I7TA 4WJ5B 3SE4A 5DR5H 2IPTL 3MXWL 1IEBA 4GMTH 4OZIA 4J2XA 4PLOB 4MJ6A 4QOKA 4Q0XL 3GUTA 5C07D 4PJ9A 1FO0A 3IU3B 1PQZA 3S97C 1NJ9B 4APQC 5KVDH 5HHOA 1GCFA 2EDQA 1MCIA 2CRIA 1GGCH 2GY7B 5GGSY 2G60L 3F5WA 2IBZY 5C0BE 3GGWA 3D39D 1M6OB 1WWBX 3SN6N 3RWIB 4YDJA 2IG2H 4PLKD 1KCLA 4LPUA 3EYFA 5EPMA 1J11A 4BFGA 1JPSL 2J5LC 3ZDYF 1EO5A 5CBAA 3CUPB 1C16A 3ARBA 3HE7D 4MXQC 1RD6A 1BIIA 3IDGA 4DGVL 1I8IB 1S9VB 3OKKB 4L4JA 3QUXA 4GKNB 5J6HB 2NR6C 5TDNB 5L2JB 2YD5A 4HFUL 5CFHA 4YFLI 3AM8C 2C1OB 5I8CB 1CGUA 1PAMA 3H9HA 4WDIB 2DKUA 1GGBL 4M7LH 4LLUA 5IQ7L 1U8OA 5FKPB 2CKBB 4P4KA 1I9RL 4ZUSB 3VXTB 5I8OH 2NTFA 2XWJA 5GS2H 2JJTC 3TH4T 2CDGA 3MRRA 1XGQB 3HE6D 4OGXH 4JFEB 4PG9A 3GSNH 1Q1JL 2FX8H 1BMGA 1V3KA 2M1KA 4F9LA 4YXLL 1Q72H 1XT5A 4JZJB 1S7UA 4L3CB 4QY8A 4XHJD 4WFHD 4QYOA 1TPXB 3L5IA 4L29A 5H2BB 1MCDA 3ZTNL 4JFDE 2GYSA 3SE9H 5F3BA 4ZFOL 3TJEL 2D9QB 3GSNL 1SBBA 4H0IA 1YEKH 2W59A 3LD8B 1R3IH 8FABA 4P4RA 3UZQA 4UQ3B 1DDHA 5DMGC 5EN2A 4CMHB 1ZWIB 2DQEL 2YD1A 4MS8D 5CD5C 4HX1A 5IMLB 1PYWB 1A2YA 4NRZA 1DQMH 4HX1B 1DVFC 4KZEH 3EYUL 2UVEA 1ZSDA 3MROA 4MJID 2A6DB 3IXAA 2P45B 3SDAC 3HE7A 3KYOA 5HTSA 2Y5EA 3TVMD 2B1HH 2G5BA 1JTOA 4NT6B 3MREB 2DQUL 1JNHA 1FYTA 3NIGE 3SKMA 3WIIL 2EXWD 1GZQA 2F53A 1L7IL 2Q76A 3RIAF 3O11B 3G04B 3E8UL 1CF8L 3B8SA 1RZJC 4QTIL 5EU5A 2NXYD 4F7TA 1H3VA 3C5ZA 5TH2B 3TBVB 5I18H 2DQIH 4PRHE 3IKCB 1Q94B 1J8HB 1R3HB 5I1IH 3NPZB 2K3TA 2I9TA 3TF7C 2YD8A 4PJFB 4XP6H 5C0CB 3H9ZA 4GRWE 4E5XA 3T0DA 3O6FA 4Z7VB 5KSAC 1UXSB 5ALCH 3HE7C 3WNLA 3JWNC 4XCEB 1RZ8B 2CSPA 4M1DL 4M43H 2J3SA 4S1DD 5DJCA 2ZCKH 4HBQA 2J8UE 1FRGH 5SWZB 4O2EA 4Y2DB 3IDGB 4X7SH 5FHBL 4HEME 4JM2F 5TDPB 1CS6A 4WHYG 5T1LD 5D72H 1HI6B 2FJGA 3QCUL 2EH8L 4C58B 4HLZG 3FQRB 5J11C 1WT5A 3B2VL 5B4MC 4I3GA 1NANI 2BNUA 4G9FE 4K71C 3N9GH 3LV3B 4P59L 2VL5B 3RDTA 2X42A 4U1LB 5ID1B 1M05A 3ARGD 3VW3H 5H94A 4MCZB 1CCZA 4HH8A 3QUZA 4EBQL 4PREB 3BZ4B 2ARJA 4EI6B 1AJ7L 4J3UA 4LLMA 2EIZB 3PQYE 1T5WA 4X5LA 4Z7WB 2VQ1B 4OD3L 1S9WB 4LSTH 2Z92A 5EZIL 5F7EL 2Z92B 3V79C 3LN5A 3PQYD 4I3SL 3SGDI 1FGVH 4D0CB 4AEHH 3HFMH 4V1DE 5A43C 4YEFA 5TFSL 1TXKA 2Q7NA 3EOBB 1EHXA 3MOAL 3FTGB 2O61B 1A0QL 5F3BB 4QHMA 1UZ8A 3MRCA 5LKNA 2W1NA 3QULB 4MAYC 4XP9L 3ME0A 4WCYL 4JRWA 5D7JD 2E8ZA 1MCQA 1EGJA 3L5HA 1P4IL 2F74A 3BQUC 3ABZA 4PJEE 4F9PC 5KSVA 3W9DA 1IZJA 3LEVH 4PTUA 4XNMB 2F54B 1D5BA 3BFOA 2YD7A 4YHNA 5D2NC 1Z0MA 4HJ0D 2ZJSH 1QSZA 2PW1A 1T3FB 4H25A 5CZVH 4PJHE 3NIGF 1KBGL 4JFYB 4JFED 1MI5D 3HZKB 3QQ4A 1JVKA 2VABA 1M71A 1JTTA 3C09C 3LKQA 2QEJA 5ISZE 4OCWL 5GGQH 1S7SA 1P7QA 3BP5B 3MJ8A 4IHOB 1SY6L 3P9MB 5D1XD 5KSAA 2W9LA 1TITA 4JZJC 4W4OA 2VZUA 1OAYH 3NCYP 1YEIH 3K7UA 1ZA3B 4NQVB 1N26A 3BEVB 1FZKA 5FO9B 3OXSB 2WANA 4B5EA 3WHXB 3BHBA 3N85L 4I13B 4CL7A 2BRQA 1WZKA 3I9GL 1U6AL 1RZGA 2A74A 3O4LA 2EYTB 3KPOA 4ZAKC 5C07B 3H7LA 5F9JB 5SV4A 4OZGB 5KW9L 3SKJL 3TWCH 2V9RA 4NWUH 4OZHF 2D7QA 3WIHH 5C70A 1UA6H 5DUMH 4CU6A 1FFRA 5C6TL 3RJDA 5H37G 1FNEB 3HZVA 4Y5VC 2AAVA 2DICA 3GJFK 5T5NG 5L6YL 4YDKH 2NY1D 2A83A 5FYJH 2QV2A 3DX7B 3JXAA 2DQJL 5CBEA 1EERB 1NH6A 5K9OA 2FJGB 4WFHE 1PQZB 5GRZA 4IRZL 1KPRA 1B0RA 3IF1A 3GBNH 1X5AA 1IGCL 4LKCB 2PR4H 2Q87A 1Q0YH 1N6UA 5C0FB 4PJGA 5GGSA 2ZP0T 5DO2D 5FB8B 5DRXA 4ZUVB 4HW6A 5FDWB 5C0BB 3L3GA 3CU7A 4GH7B 3UTSD 1NEUA 4LEXH 2P5EB 3RUGF 1D5ZB 1LP9B 5T33H 3WNPA 2DJUA 2NY4D 2ENSA 2X7LA 1A4KB 4P2YA 1KG0B 5EPMB 3IJYB 2XYCA 1RFDL 1H3UA 4KQ4H 4MB3A 1BGXH 3NIDE 1K8IB 2B0SL 2NY5L 5LCVH 4M6NL 4WTWA 1T1XB 5JORB 3ZDZE 1KPVB 4NFDA 3SDXA 2FEDC 5FO7A 4LCWE 1CGSH 3RWJB 4LRIA 1ZVHA 3HNVL 5HPOA 3H0TB 4L4TE 3QQ9D 4CN6A 1JZ6A 1KJ2L 3DXAB 3B9AA 1K4DA 1UENA 3FQNB 3DXAA 3HC4H 5JHDA 1EXUB 4FQ2L 3QULA 3RU8L 3HCVB 1MVFA 1KIQB 4G8GE 1NFDF 1RJCA 3RAJL 3BKML 1HKLL 4HWEL 3TO2B 3FRUA 3OAUH 2AERT 3C6LD 3OG6B 3W9DB 2X4TA 3MQIA 4K2UH 4X6CA 4WO4D 5D1QB 2QSCL 1AJ7H 5KANG 3LAFA 1N64H 4AEIL 5EO0A 5EO0B 2R2BA 5CLTA 4N9GB 4KMQA 3OKDA 4X9HA 4Q9RH 4KRLB 3SO3B 1JGDB 4JFDB 4FTVB 1FG2B 1ZLSL 4BYHA 1VDGA 3FFDA 2CIIB 1KJVB 2ADIB 2ARJQ 3CH1B 4FFWC 2AJUL 3V5KB 3CFBA 4KVCL 5DC4B 2YPKA 1AI1L 4PGBB 2EC8A 4M43L 4TSAL 1HHKB 4U1MA 3JUYA 3LMJL 3ZDYE 5B4MD 4PR5A 3MSPA 3B9KA 4NO2B 4I4WB 4MSWB 3N1PC 2D31A 3QSKB 1I1AD 4POZD 2EDBA 3BP6A 5ITBH 3VXUD 3CPLB 1INEH 1J0ZA 1YC8A 3GMQB 1AC0A 2OTUA 1JI1A 4OIBA 3IFPA 3TO4A 3B9KC 4X6DA 4O02L 4OF0A 3RWDA 5L88L 3LHPH 3MACH 5BV7C 5C0CD 1WTLA 3TNMB 3E8UH 2CKNA 1OGAA 2FEEI 4P2OD 3EOAA 5I76B 1DL7H 5IB3B 3VI4E 5C0FA 1ORQB 3QP3A 4F7TB 1QYGL 3G5ZB 4Z7WE 4LF3A 5IIEB 5L2KD 1NQBA 2CLRB 5D6CA 3RUGA 3UJTH 3KPMA 3WO4B 4GAJH 4EI5C 5DI8B 4P2RD 1GOHA 5E6IC 2FBOJ 3SKNA 1KEMH 3QEUB 4X4YA 3FRPG 4QCIB 3KNBB 4H20L 1Y6KR 2JJSC 1JUFB 4DAGH 3RI5K 3TESA 1E4JA 2UVFA 3N1QC 4X4ZA 4UOJA 1QPXA 4KK5D 2HH0H 4URTB 3X17A 3OJ2C 1G7PB 4KDVA 1B6UA 3HI6H 4RNRA 3QFJB 1QLFB 3MBEB 5B22A 4L4TA 5E94B 4FXKA 1N7ML 1CGWA 1JWUA 1XGUB 1CLCA 1FL6A 1G6RL 1JPGB 5BRZA 4U1HA 4KRPB 1Y0LB 4O00A 1VFBB 3OKOA 3QT2A 3NZ8B 1KEGL 4UINL 4XP5H 1ZT4B 5BZDA 5K9KB 2XTJC 4JQVC 5EOTB 3B83A 1S9XB 4YHMH 1TVBB 2NLJA 1FP5A 4P2RE 2X4UA 3Q48A 4OZIF 1XGRA 4UB0L 3HC4L 1CLYL 4WEBL 4OKVB 4GMSL 4LQ1A 1IGML 4X8JA 1S7UB 4X0KB 2WWMC 3C2SA 1K6QH 3O9WD 1AGDB 3IETA 1S7QA 4DN3H 5DLML 3GSXB 1X7QB 4OQTL 1P4BH 4KV5F 4OIAA 4OIIL 4G6JL 3S36H 4N0UA 2VQTA 1BFTA 1FZJB 5JXEC 3PIQB 4LMQE 4WFFE 5I15L 3UJIL 5CINH 3B8YA 3LRSB 3DYOA 2AQ1A 2CO6B 3T4AB 5C0NC 1BJMA 2ADIA 1A7OL 2OK0H 2XY2A 4POUB 2VUYA 3PXJA 3KXFD 4H8WC 3STLA 2HRPH 3O45A 4UQ3A 1OAZH 5A1AA 5MP6L 1PGRB 5IROC 1A9BA 1ZA6A 3O4LE 3DV4B 3V5DB 1CQKA 2V7HA 2LE9A 3GB7A 4J7RA 2XTLA 2F9BT 1UQSB 1VERA 2APTA 1FVCA 4ORZC 4S1DC 3CXDL 4PB0L 3GIZL 4G8FA 3UJJL 4NN6C 3L3DA 5KVEH 1JWMA 1I1RA 1I8KB 4RQQA 5EIIA 2V2WA 5FA4A 2XN9A 1CFSA 3Q0HA 2AXGB 4P3WA 3V0WH 4K8RL 5HY9B 4C56B 3IFLL 3VXSE 4P2QD 2I9LA 4K3EH 4GMTL 4RGMB 3AMKA 4ODUB 4YXKL 4BQBA 4P2OB 4W4OC 5D8JL 1HHGB 3SY0B 1J8HA 1R3HA 3O2DA 3ARXA 3FB5B 3WSQH 2XZAH 4MD4B 4W6XB 3OKMA 4DGIL 3HI1B 1VADB 4FXGA 2EDDA 4JB9L 4HLJA 3WXWL 2E27H 5DDHA 5ANME 3WHE1 1Z3GL 1ZHKB 5FUOH 5FECA 1NC4B 3MFFB 4K94C 5L6YH 2ITCA 2VLJE 3MXVL 1KELH 3G6JF 4FFWD 5GZNC 1SY6H 2ZKHH 5B38G 3O2WL 4X4XA 3PWJB 3AS0A 2QBWA 5GRUL 3PDDA 3V4PL 1CXHA 2Z31D 4YDVB 5T5FH 2VDPH 3WXVH 1RJLA 1RUPH 4ZFZB 3RWCA 1M7XA 4DTGL 4WGWB 5ERWA 2DL2A 3RHWK 4J8RB 1MCFA 4QOKE 1JCKA 5DD3H 2Y72A 4P5KB 5D7LE 1EVTC 2PYFA 4HDIA 4LRIC 4PRDB 3U82B 5HVWA 3VD5A 4RX4D 5IWLA 3EO1A 1YNTA 2UV3A 1GHFL 2VITB 1XR9A 3WNMA 5ENWB 5JO5B 2JB5L 2EYSB 4QRPB 1L9MA 3EFFA 3U7WL 4TPRL 3QCTL 2OBGA 3K4AA 5IVNA 3BDYH 1A5FH 2KH2B 1B88A 1I9IL 2RB8A 4JY4A 5BVPH 3CVIL 4HH9B 4KMTL 4M9OA 1NANH 4AEHL 4EQ3A 3NFNA 3LQMA 4PJAA 4J4PC 3MLVL 5IBUG 1UH3A 3L3IB 4ZDHB 3U6RA 4DGYH 3EGSA 4NQTA 5HGBB 3ARVA 4NKDA 4NZUH 3SQOL 4HPOH 1LWRA 4WTZA 3LH2H 1BVZA 1TZGL 1YJDH 2ATKA 3BKYL 2RFXB 2AJ3A 4MX7A 1RZKL 1DBAH 4OLVH 4AENB 2XWBB 1A2YB 4Z9KB 5ICYB 2GJZA 4JM2C 7FABH 4NZRL 3ZKNC 5KS9E 3FMGL 1TMCB 2JCCB 1OTUC 5CGYC 1BEYL 1TTFA 5D72L 2NY6C 4XI5C 4RIRB 3LOWA 9CGTA 1QBLL 4OKDA 2A6DA 3I6KA 4JGJA 3VFRB 2FJFB 3EDKA 1EFXB 1U8LB 5C6PB 4G5ZH 2FGWL 2FX9H 4NQCE 5EORL 3SQBA 2IGFL 4B7IA 5IJVB 3MR9B 4Z8FL 1CFQA 4J6RH 5HPMB 2P42B 2MCG1 2ATPB 4RGNB 4HJJH 3REVB 5EIIB 3WUWG 1KELL 3QEQA 1IFHH 2A6JA 4ZAKA 1N5AA 3GMRB 1S3KH 43C9B 1KCVH 2PW2B 2UWEA 5ESVB 2G75A 3ECBA 3R06B 3LDBC 5DFWH 2PW2A 2UWEB 2NW2A 1K8DB 1II4E 3BEWB 2QQQA 5E9DE 3A67L 4S1QH 3IDXL 4JG0L 1RZFL 4TNWF 1ZLVK 4NZTL 1ZHBA 1EX0A 2FSEB 1BOGA 4KK9C 2IPUG 3ARDC 4U6XB 3L5WA 4K7PX 2ZSVA 1WEJH 1HH6B 5HI4D 5FYLE 1BX2A 1TCRB 4M8QB 1DP0A 5IB2B 2EDJA 2D7TL 2HFGL 2PYEE 1AQDB 5EULV 4R4ND 4UBDD 4BK4A 4FTVD 3EJZC 4XP6L 4F33B 3ZT6A 5JIKA 1N59A 1LO4H 1UB6B 4XXCC 4KDWA 1FFOB 2HFFB 3HAEG 1AO7A 4NKQB 4EIZC 2HT4D 4I77L 1VPOL 1R3LB 4DZBA 4Y89A 3WDIA 3CX5J 1MOEA 3PWPE 5E6IB 1IM9B 1MEXH 2F54E 3RZCD 12E8L 1XH3B 3C2AL 2R39A 3TBWA 4PRPA 1MFEH 1F6FB 4JLRA 1RUKH 4QRUB 4XWGL 3VXSA 5LG1A 4JPWL 5FO7B 5C7XH 5J1AB 4FQJH 3GSVA 5DUBB 2HRLA 1CTNA 5MEQB 3QH3B 3AB0C 5EOQL 1AXTH 4FZ8H 4EVNB 4IJ3C 2ADJA 4UDUB 3UX9B 1QFUL 3FJTA 1S7XA 5JPNA 1U8JB 2NW3A 1XIWA 4QHMB 1HHIB 4JM2D 2RHEA 3MNZB 1BQLH 4GW4B 3GSUA 5DT1H 2GT9A 3S9DB 3PGDA 4ALAL 1T80A 4PG2A 3S36L 4XPGL 4HF5L 5F9WB 3WDHA 2UZYB 3MYZA 5JXAH 1DQJA 4M62L 2PXYA 4PRAA 1MHPH 2W60B 2H1PL 2K9UA 1EJOH 3OKEB 4L29B 5GRWA 2R69L 3PHQB 2VABB 1KF9B 2Q86A 1OAQH 1G7MB 4PV8B 5INCA 4NT6A 4QTHA 4CMHC 4PRIA 4LP4A 4HULB 5BXFA 5D93B 3H9SB 4MQSB 4RCAA 4D0BB 5M94B 5J1SC 3VH8B 1T0PB 3BP5A 3MJ8B 4R4BB 4YHPB 3T4AA 3O11A 1YYLL 2DMBA 3QEQB 3CFBB 4YDIH 4X6FB 2H9GB 5C7XL 3QDMA 1X5YA 4JPWH 5ACLA 5LWYL 4L8SB 3L1OL 2FCBA 3T0EC 3K8LA 4GAJL 3VFUA 2PNDA 4ZQKB 4K7PY 5TE6H 2KQNA 2NX5D 4OAWA 4PJ5B 3V4UH 3PWLB 3BN3B 1BZ9B 1UZ6E 3MJ7B 1HILB 3V7MA 4N9OB 1A1NA 5JW4Q 3EHBC 4PJCB 2WBJD 5A3ID 5F6IC 3CLEL 1J1PH 1UM5H 4TVPL 1I1FA 5FUZH 5F9AC 5DD5L 5DSCB 5JDSB 4MHHG 3JBG7 5HYJA 3MRDA 3HC3H 3QEHB 3RWGA 4CVZB 4D3CH 3U2SB 1BPVA 1AKJD 5SWQB 3O6FB 4XXDA 2XQYG 2PO6C 1P53A 3S5LB 1G7IA 2YEZB 4QHLA 3ET9F 1EHLH 3WKNA 2AVGA 4CUCA 3V7AG 5C09A 3LB6D 3DMMC 4XNQB 4O2FA 3FQUB 2HTLD 2H2PD 4M93B 1VHPA 3RNKA 3RPKA 1DZBA 1E4XI 1I8IA 4QO1A 2R2CA 2BMKB 5D96B 3AREA 2BMKA 3PGFL 1G7QA 4Y1AE 3ZKND 1RUMH 2YRZA 3U7YH 4EVNA 4J6RL 5A16B 3X12B 4XH2B 3UDWA 1WITA 5EUOB 3X12A 4MQTB 3EO1B 2R4RH 1F45A 2J6EL 5E8PA 3DURA 1UXWA 4PJIA 4QXGL 3L3HB 1P4LB 4XVJL 1FIGH 1MFAH 3S5LG 1JGEB 5ALBL 4RMSA 4WFGE 4HKXB 5D7JB 4M02A 1U8HB 1S7QB 2IH1B 3KLAB 3MGOA 4NJ9L 5EWIH 4M7JL 3ZTJG 3BWUC 4OGAD 2AK4E 3KDMA 3LIZH 1KJ2A 1KIRA 1OD9A 2Q86B 3QDJB 3CVHH 2NY7L 1B0GB 5D4QA 2PXYC 3UTQB 3TFKC 1DVFD 2V7NB 3AY4C 5D7IB 3MRIA 1CT8A 3RIAK 4J23A 1Q9LA 3CH1A 4ONHA 3Q6FA 2NTSP 4JFDD 3RAJH 3FFDB 1NEZG 4WV1C 3OAZK 3DGCR 1ED3B 4MD0B 2XRAL 4WUUB 4OCNC 3V8CA 1NCWH 1UYWL 2B5IC 5C2BL 3O45B 1A22B 3ZKSD 3C08L 1HKFA 1WBYB 2X1XR 4MDJA 4YWGL 3RHWF 2JB5H 3EFDH 3F7VA 4FQ1L 1CI5A 2GSIB 3HMWL 4EZMA 1IAIM 3GSRA 1K3ZA 1Q9KB 3L5XH 4L9LB 1FJ1A 4Z7UE 4MCYB 4NUJA 1MLBA 2ZG3A 4M6NH 4EJ1C 4LCCA 1CZ8L 1OB1A 2E9BA 1YN6A 4QWWC 2EEDA 1LVEA 4N90D 1RK1A 1I1FB 4GRLD 4UT9H 4X7TA 3LEXB 2VDPL 4WUKH 4QRRE 5JTWA 3QHZL 3QJFA 4Z95H 5I74B 1OOAA 1U95B 4GQPH 1T6VN 3MYJB 3PWNB 1EVUA 2DD8H 4HT1H 5HYJB 2OP4L 2APWA 4PRHB 3HPJB 1GGTA 3VFTB 3P30H 5JW4N 2CLRA 2FL5B 4OTXH 1CXFA 2ENYA 2NQCA 2WINA 4X5XB 1J88A 3HB3D 4HMEA 2X40A 4WWKC 2W92A 3BT2H 4LSRH 3IJYA 4YHKH 5HHXL 5IMOA 1PX3A 3S5LA 3VWKC 3OZ9L 3MMEB 4GBXA 1OCWL 5E08H 5CBAB 2OX5A 1D5IL 5CEZL 4JQIH 5DD0H 1CVRA 4LCWD 4IMLA 3MCG1 3EFDL 4FQ1H 3W11D 4YDVA 1IGFH 1U2CA 5D1ZB 4GKNA 4LGSB 1JWUB 1XGUA 1MJUH 4MAYB 2HFEA 1LE9A 3HNSH 2W07A 4ZUUB 1RJYA 5E8DH 4N0YL 5HHPB 5DWUH 3R8QA 8CGTA 5DQJB 1UKQA 3V6OC 4XVUC 2VLJB 3UPAA 4XC1H 1S7VA 3L5XL 2CKBA 2X4OA 1BBDH 2HKHH 2X44D 4Z7OE 4HCRA 5H94B 4FFZL 3D85B 3GIVB 4MJ2A 4XRCA 3BH9A 2OZ4A 3U0WH 2AXJA 4XAWH 2D7OA 2DWEB 5F1IB 1X4YA 2A73A 3NN8A 1YY9C 4K7PL 1PG7L 4O51B 4Q6IB 2B8OT 3GSXA 3V6OA 1UGNA 2VXVL 1F02I 2F5BL 5DHYA 4XVJH 3KPSE 5AG8A 1FQ9C 4GW1B 1P4BL 1W0WB 4TVSa 5DHYB 1QSFE 3WNNA 2COQA 2WQRA 3HI5L 1P4IH 3STLB 1RJZB 3QUYA 4NHCH 5KVGL 4XP9H 5ICYA 3I75B 4MNGA 4D3CL 3SDAA 3BISA 4WHYH 4NHUA 1T6WA 2VR5A 4O5LL 4ONGL 4ZUTB 25C8H 1IGJB 3MLRH 3RX7A 2RAMA 2H32A 2VDNH 5IHBA 4BSVB 4UV7H 1FVDB 3BQUA 5E1AB 4LSSL 3GKWL 5BZWB 1QRNA 2VQUA 3TT3H 5FUZL 3VFRA 1QR1B 3LCYA 2HT2D 4HFWA 5IFAH 4L3EA 4LCCB 4YEEA 1T03L 1BQHG 3FQWA 2FEDD 5IMMB 3L3DB 1YDPB 5E2UL 1TPXC 1VEPA 1FH5L 1HE7A 3GBLA 3VFOB 4QRQA 5GS2D 2QLVB 4PJ9B 3QEQE 1BM3H 4KROB 4JDVA 4LF3B 1FZKB 1RMFL 4TVPE 1AHWB 4YHLH 3SCMD 1RY7B 2Q7YB 3AAZB 2FHFA 2WINB 2GIYA 2FD6L 1T4KA 4LSQH 4X4YB 2IH3A 3ZE0F 4LPTA 1RZGB 4TOYL 2MCPL 2Q8AL 4KI5D 1FPTL 2YWZA 5DK2A 3NZHH 3WIFB 2E8YA 1A14L 3NA9L 5T3ZE 3HPLB 3PP4H 1DJSA 3DLQR 3DMMD 1FAIL 1XF4A 3AUVA 4I0KA 5DDHB 1F11A 2DM3A 4KK6D 4XXCA 4X9IA 2AJSL 3WS3B 1U41A 1LEGA 3S98A 2NY1C 3QQNA 3MUY1 1BQHB 4DVBB 2LTQB 1OAQL 1TETL 2J8UA 5F6HI 3MLYL 4PUBH 5B3NA 1NMCC 2VNCA 4J3WA 2ERJC 3MJ6A 4QRTA 3RVUC 1A6VL 1YQVL 3ULVC 3RL2B 3L1OH 3ARBC 4HF5H 4ZUUA 2DQGH 4OD2A 3VI3F 1O0VA 4DZBB 4NNXA 2C3VA 2GFBA 3HG1A 1ZT1B 5JR1L 1INEL 3OKNB 5DT1L 2Q20A 3UTZB 1MCLA 2AABL 1R0AH 2R9HD 1EBPA 5EU4A 3VXMA 3O3BB 3LKSA 1YEJH 1PKQB 3T3ME 3E3QE 4OKVA 4CMMA 1EBAA 4PD4J 1IAOA 1SEBB 2X7LB 1KPUA 5DTFA 2CMRH 4MNQB 5I1CH 3LMJH 2ZG2A 4JFOB 2A1WH 4MNQA 3N50A 1LK3L 4F3FB 5LQBL 5DGRA 1AXTL 3Q5YA 4FZ8L 4D9QD 1EJOL 4JY4B 4OLWH 4PRID 5JLZB 2V2TB 3QH3A 4FQJL 1D9KA 3MRGB 2ZPKH 4P5TA 3RWHB 3T0VA 5C0GA 5GS1A 3ZHKA 1EZVX 1HQRA 5DUPH 3SGDH 5E00A 5I1CL 1C8PA 1WT5C 4LKXB 3S3SA 1S7XB 1T5XA 4HIJA 5I8EB 5FKAA 2WWKT 2BDNL 1I3RB 2VKWA 3NZ8A 5FGCE 3VXTA 5C92A 2W91A 5HDOA 4N0FB 4DKAA 2EIEA 2I27N 3FT4A 5JW4R 1F8TL 1JL8A 4JM2A 4HUXB 3X3FL 2QSCH 2GUOA 4EN3C 1E4XL 3PNWA 4KHXH 3SE9L 4NUGL 3WJLC 4RAHA 3L3KA 4KFZC 1L9NA 4XPGH 3DXAE 2O5YL 3VWJB 1FYHB 4XPAL 1IGTB 2VISA 1E6OH 4K3DL 3S35L 1YMMB 4L9DA 3OKDB 3V4VH 2W60A 3DX8B 2H2PC 3S96B 1YNKL 3V0VA 2WV3A 5FA4B 1T1ZA 4WV1B 4MXWH 5D2NE 3SO3C 1FAKT 5HYQB 43CAA 4A2LA 4PBWD 2L7JA 4RMRA 3Q1SL 4XP4H 3P4OB 1IEAA 3ECBB 3R06A 4G8IA 3D69A 3MBED 5FYJD 1JHLH 4NQCB 1ADQH 1X5LA 1O7VA 4IS6B 5TF1L 4XT1C 4KHTH 2HJFB 4PJDB 4ZSOA 1T0NA 5DJAA 5HHMB 1NPUA 4JFHD 3WIFA 2UZIH 5AUMA 2CH8A 1CG9A 1BZ9A 4DGVH 1KN2L 1TETH 4JDZB 4KDTC 1BAFL 1X9QA 4TRPL 2IPTH 1JWMB 4XVTL 4XWOC 4JVPA 1BHGA 4X7EC 4FABH 3AM8A 5GGUB 4XAKE 3QDGD 2BOBA 4C55A 1NBYB 5GIRA 5B39G 1WISA 5ECJE 4X7TB 4ZAKD 3BKJL 1AIFB 3F65A 5CJ8A 1JI2A 1QBLH 5DSCA 1AGBB 5KSAD 5D1XA 1ZE3C 4FQHB 2E7BA 4ISVA 1IMHC 5E4EB 3SY0A 5TH2A 1U8PB 3TBVA 1XGPB 1FFOA 1F3JA 4NZRH 5DEFA 5HVFB 4NO5B 3LV3A 4X6DE 1JHKH 3SKNB 2J5LB 4PP2B 3LS4L 2APVA 4U49A 4KPHL 3S88H 3T1FB 1ZANH 1CLOH 3L3GB 5D71L 1DLFL 1NC4A 4I9WD 1I8LA 1MSPA 4F57L 5B39A 1X5GA 2WIIB 2Z91A 4QHLB 1JJUA 3A67H 3TC9A 5J1AA 3ILPA 4HIEB 3SJVE 4OLXL 3VXSB 4MJIB 2FBJL 4PFEA 1W8NA 4FXKB 5TJWK 4LSDA 1PZ5A 3O2VH 3BE1H 4OLUH 4F7MA 2XI9A 4HJJL 1G7QB 4ONOA 5EU7C 1QSFA 1XIWC 2V5TA 5DJDA 1NUGA 2GSGB 3UTTD 1FL6B 4LLUB 2VAAA 2RR3A 3BQUD 5I1GH 5T1KB 1Z5LA 2R8SH 4Z5RB 3FT4B 2A77L 3IAPA 5EZLB 1XR9B 3BD4A 1XGQA 1AQKH 4GW4A 3QFJE 3LY6A 4UILL 3KYKH 3FOLA 4Y5XC 4TUOB 1P4LA 5BW7C 2BSSB 4YC2B 1U93A 1L0YA 1OSZA 4JO4H 5L2KE 1SQ2N 1F4HA 4K7PH 3IETB 2DTSA 4DKDC 4KKLD 3RBGA 1WIUA 4TTDD 4KQ3L 5MHSE 4HBCH 3CZJA 1TZGH 3CZFB 1UCBL 5DD0L 4Z77A 5F89B 5T1LA 5C2UB 1E6JH 4WHTA 3AMLA 3PV7A 3BE1L 4OLUL 3D48R 2XZCH 2VMFA 3EJJX 3RY4A 3U4EB 3IAGC 4X6FA 4YFLF 2BNQB 1ZV5A 4LASL 5CEZE 1CDCA 5DJYA 1FFPB 3HRZA 4F57H 4OV5B 4NC1E 3FZUD 4NFBA 3T4YA 3T2NH 2WIMA 4D9LL 5I2IB 1FNSH 2AK4B 4YGVA 2YRLA 4IIQA 4ZFGL 3L5WB 2R0LH 4LARL 1YYMH 3OR7A 1CQYA 1VCAA 1FGNH 1EEZB 5J12C 5LJYH 5IVXF 1EEZA 3MLTA 1QEWB 2D2OA 4WGVB 3WV0A 5E08L 1EFQA 3GMQA 1H5BB 5ABDE 5TDOA 2VZOA 4Z76A 2P5ED 4XPFH 2W0LA 4D8PA 4F7CA 5D7SL 3TNMA 1VGKB 5JHDE 5ESVA 3RJQB 3VXQB 3DYMA 3AREC 3V4PH 4KROC 3HPJA 5KS9F 4YWGH 4NNYB 4GBXC 3VGEA 2VJXA 3M8OH 2IH3B 2OXGA 4TSBH 1A47A 1UACL 5C2BH 4HS8L 3MRDB 4JRXD 1WZ1H 2HAZA 2Z31C 1VADA 2E27L 4GRLC 3W82A 1JYVA 3V0WL 5L8JB 4N90E 5B39B 5J1TC 4JLRB 3QAZC 3IJHA 3ZKXB 4JFZL 1FL5A 3KLHC 2NY2D 1FFNA 5E4EC 3T65B 1SEQL 1FFNB 2Y6SC 4LAJH 5FM5M 5KJRL 5CSZB 2L0DA 3M1BB 1AQDA 3H0TA 3HMWH 1AR1C 4ZPTA 1RV6X 4KKLC 1OTUD 4P9HC 5ERWB 5BV7B 4KTEH 5I17B 1C5CL 1LMKA 5ACZA 4Y19D 5I17A 5GGSB 2M2DA 3RNQB 1MRFL 4M7ZB 4MHHI 1KT2A 1KN2H 1C12B 3O9WA 4RZCA 3BKCH 2R4RL 3CMGA 5I15H 5BZDB 4XNXH 1DLHB 1NAKH 5IV2A 1ZVYA 3E6HB 2HYMA 1L7TL 3L3HA 5GSVB 4WI9A 4N5ED 5K59E 5MEPA 3MGOB 3D9AH 4EUPA 3H42H 1YUHB 4JO3H 1OP5H 4NCDA 5HHME 1OD7A 4GRMB 2V7NA 4O9HL 1Q0XL 3GNMH 4OSUH 1QLEH 3GBML 3QWRD 5D7IA 5SWSD 4RMWA 3TJEH 5I73C 3QDJA 4WENB 1IKFL 4PJXF 5FGRA 4GAGH 5E00B 1JMXA 4L4TD 5F7MC 4UNTA 3S7GA 5I75C 1HCVA 2XG4A 3HCVA 4OLWL 5KSVB 1NDMB 4NUGH 2NZ9D 1AFVL 4EDWH 1LGVA 1RUML 1IKNC 1W72B 2VERN 1P5UA 3F7VB 3FFCE 3MNVA 3GB7B 3GK8H 4HWZB 2AJYH 5EDXA 5EUKB 4MXQD 4DQOH 4NRXB 3MTRA 4HJGA 3ZT5A 4OCMC 4RISH 3VH8G 4OZGE 5HGAB 3MACL 4ZO7A 4R2GC 5CMAB 3L9RB 2D7PA 1HOCA 3GJFA 5E0QA 3W0WB 1VKXB 5I0ZA 4OCXL 2ILLA 1A3RL 2ZPKL 3AC0A 4X98B 4OCRL 3SBWC 1ZLVH 5CJQH 1AGEA 3V5KA 1CVSC 3BH8A 2OXHA 4LEOB 1EAPB 4Y4KB 1P7KB 3DOSA 4FNLL 3VXUA 4FQXA 5HYJD 4QCIA 5CCKH 3Q6GL 1R0AL 3EJYD 1A14H 3MOBL 5L2KA 3CFEA 1NCAL 5T3ZD 3NZHL 3CPLA 1XZ0A 4N1HB 2BZDA 2XA8H 1OW0A 3HZVB 4QGTA 5F7NC 1A6TB 1NFDB 3O4OC 3RNKB 4DVBA 2W9DH 5LGJA 1TCRA 3PDGA 4DQOL 5DF0A 4UUJB 2NZIA 4PUBL 3NPSC 1MHCB 1OGAB 4XMPH 5GGVL 4P49A 5L2JA 3WJJC 5E9DB 2KL6A 4HIXH 1HSBB 2HKFH 3SGEI 5M7QA 1Q38A 3SHSA 4OCXH 3NCBB 3KPRA 2LU3A 2NY3C 2F53E 4Q58C 4YJZL 3P11H 4NQCD 1E27B 4ZUSA 2VWEE 4P2OC 5HJ3B 3FHAA 1RVFH 5FUCC 5C0IA 4RFEB 2IC2A 3BN9C 5E7BA 2RCSL 1PKOA 1R3KA 5CZXC 4LPXA 3F7QA 3LKRB 3DBXA 3QXDA 4YXHH 3G6JE 4ODSH 3THMH 25C8L 1WJ3A 4NRYA 4U1SB 5I8KL 2BHZA 3IRPX 2C4XA 3QQ9C 4XNUL 2IMMA 2UY7A 1DN0B 1KJ2B 4BSWA 2JIXB 2J88L 1GC1H 3UTQA 2CR3A 3QDAA 4UDUA 3O2DH 3EGSB 3ARPA 1DBKH 3FT3A 3RWHA 1H8OA 4JQXC 4GKSA 2B39A 4GW1A 4YX2H 1ZLSH 4XH2A 2YUWA 2NY6B 1HEZA 5H35A 3ARYA 2IAND 4WUUA 5H37H 1BQLL 3I6LE 1I1YA 1N8ZA 2QR0A 4QEGA 5ISZD 3QUYB 2AJ3B 3HMXA 3LPWA 1NDMA 4ZTOL 5KN5B 4P3DA 1BD2E 4Z0XA 3BX7C 3QDJD 2CDFB 1U8HA 1J7VR 2FB4H 3NFSL 4XCFH 5BZWA 4RFNB 4O4YH 1P1ZB 3V0VB 1A1OB 3MV7D 5ESAA 4Q9QL 2F5BH 1I7RA 4YDKL 2D9CA 1MFEL 3PE9A 4EQ2A 1TJIH 4GQ9L 2XOTA 5IMMA 1Q0XH 4PLJD 1OP9A 5EFIB 4C56A 4R4BA 4OGYL 1CU4L 1JN6B 4M6OL 3T77B 1EO8L 1JK8A 1EUTA 4ZPVA 2J8HA 3I6GA 4Y4KA 3UTSA 2JJTA 2O5ZL 3PG2A 1HHGA 4R90H 3C5ZB 1WWWX 1N4XH 4JHZA 3TA3C 3SBWA 5IVOA 5I66A 1QUNA 2JK5A 4PY7B 2HJFA 3GBNL 4JCMA 1MJJA 4MD5B 5C0DA 4AMKH 1ZHBB 2HKHL 4E5XB 1NGQH 1GIGL 2V9TA 3QA3B 1OTSD 3GFUA 1OPGH 4G7YL 3HR5B 4KJPD 3WFDH 3QDJE 1J1OH 3IDYC 5C1MB 3B5HA 4NNPH 3K81A 4P3CH 4HT1L 1R5WA 3ARSA 1N2RB 5J9PA 2OJZH 3IDMA 3JWOL 1V3JA 4U3HA 5KG9A 1X4XA 3CD4A 4P2QE 1TVHB 5DURD 3RFZC 4QRTB 4D9RE 2HT2C 1CDUA 4AL8H 1KBGH 2HJLB 4JE4B 4U33A 3CIQA 4XGZB 3C5SA 2Q3ZA 3C5JB 5KVFL 2DLGA 1P5VA 1KCKA 4EDXB 2YKLL 3WLBB 2DM7A 4Z7VE 2EYRB 5C0IB 2GTWB 3GO1H 5GXBB 3VRLF 1OP5K 1T2QL 2ZOLA 1JNNH 2A38A 3BUTA 2BHYA 1QA9B 1OAUL 3DRQB 4E9LA 1UXSA 4B41A 4JFOA 3IJHB 1KIUA 3LKRA 2VQ1A 1EK3A 4HIEA 4E0RA 2WIIA 2R2HB 1D9KB 1OWWA 4IMLB 5J6HA 2D7NA 1KGCE 4U0RB 5BVPL 2ZJSL 4NSKB 3A6CH 3K8KA 2MHAB 3J7HA 2OTWA 1U8JA 2NZ9C 3BDYL 1H8SA 1AQKL 1K4CA 2VLKE 1KT2B 1HHJB 4P4KB 3I75A 4MNGB 3DVFA 1G7LA 2OI9B 2DRUA 4OUOA 4ZS6C 2DBLL 5IK3B 4BZ2L 3SKOB 5F3HA 3WFBH 2EYSA 1QR4A 5DMKB 3B2VH 5E1AA 5KN5A 3ZKXC 3RVWD 2JJVA 2GHWB 1C5DB 3BESR 3L6FA 1QFWM 1J5OH 1XAUA 1NLBL 4OLXH 4OQTA 4CAGA 1KB5L 2IADA 2YUZA 3WFZA 4O2CA 4Y4FB 2BFVH 4ZNEA 5CJXC 5GQBA 4BKLB 3U7WH 4Z7NF 1ZANL 1F4YL 2BP3A 4JY6A 3BO8B 4KQ3H 4JRXE 5D1ZD 2H6PB 4LLQA 1I3GH 4K7FA 3GO1L 1I4FA 2ICWI 2H9GA 5F7EH 3STZB 2BNRE 3KYKL 2VDQL 3QCUH 4JFPA 4G8GA 4Y1AD 3EUUA 4AL8L 3SDCA 4OQ1A 5KSUB 1IT9H 5KVMC 4KPHH 4JFXB 4OZFH 1LE5A 1NBZB 2NXYB 1AXIB 1QLRA 3O2WH 2E9IA 5GZND 5F1NB 2YMXH 3JV4A 5KG9B 4JDTL 1R5WB 2A9MH 5HY9A 1RUAH 3BXNB 4P9MH 2BY2A 3T0EB 4LLYB 1QNZH 1J0YA 43C9A 3QO0A 3QDGA 2D4DA 3C5JA 3H7BA 1AO7B 3BPLB 4DKFL 2DQIL 2UUDH 1SYSB 3DMMB 4Q2ZA 1ZEAL 1I9EA 1PLGH 5D8JH 1UJ3C 1MVUA 2W0PA 3QEHA 4C57C 1ZHLA 1GGIH 1CF8H 4QTIH 2RJMA 3C60D 5T1DH 1PY4A 2EDEA 2UYLB 1P7HL 2OK0L 1JHKL 3KS0H 1YEKL 4R2GD 1RIHL 2XZQH 1YMHA 1S7WB 2DYPB 3SOBH 1TNNA 3HLAB 4JREB 3PWJA 1UB5A 3TO4C 4K94L 3M1BA 2F19H 4YDIL 1QLFA 4AG4H 3DO7B 2RIKA 5CBEB 1PZUB 1NMAH 5HI5C 1HI6A 2XACC 1XF2B 5ACZB 1AD9A 4WUUE 1JZ7A 4HPYL 1HXYB 4MQXC 2BC4B 5IG7A 3QO1A 2FZ3B 3L7EB 2JB6A 5T1KA 1QHOA 2CLVA 4XCNA 2FZ3A 3L7EA 2B1HL 3PV6A 2VXQL 2VAAB 1G7LB 4I0PD 1ZTXL 3QHFL 3RGVC 3SCMB 3TZVC 5I8OL 4BQ8A 2BSED 3PL6A 1DLHA 3BZEA 1XGRB 5C0RL 3DURB 5IHLB 3NCEB 2R1WB 3QNZA 4PJIF 4KHXL 3IS0X 3G9VA 4XMLL 5C0JA 3RIFF 2EXYC 5JORA 4F58H 5F9OH 5INCB 4X5WA 3Q5TA 3OMZA 1T1ZB 4WV1A 2IPKB 3BSZL 4PYHA 1OARH 3B9DA 3L3IA 4ZDHA 5A2IH 1RUQL 5CJBA 1ACYL 4MA1B 3P0YH 1CGTA 1BD2D 1KJVA 2D0HA 3NTCL 4BA8A 3UEZA 3DHJA 1FCCA 3G6AB 3QBTB 5I8EA 3VG0L 2H1PH 3LQAC 2F19L 3NGBB 4XPAH 4PIRF 1E4KA 4K94H 3GSUB 5DMJB 3H8NA 3MV8E 4Y7MA 1LK3H 5GGTL 2PCPB 4P4KD 1KLGA 4XBGA 2DTMH 5IB5A 2HKFL 1MLCB 4ZXBC 2HTKC 4YGVB 2XTJE 1D9KD 4JRYD 5DEGA 2A6IB 3ARDA 1L6XA 5EBWA 2E7MA 4YZFF 2NY1B 4TUJB 3UROR 4HPYH 4WWID 4RRPA 1TJHH 3OV6A 4OF5A 2WLZA 2KUTA 1GGBH 4M7LL 4MNQD 4RQQB 4FTVA 2YA1A 3LRGA 5EFIA 4ELKA 2WBKA 2CLZB 1YQVH 5IT2H 4MNHA 5FV2A 3C5ZC 3O3EB 1QZ1A 4C83B 3P4MB 4OUUA 4PYGA 3UTOA 4H1LA 3TPUA 5C3LD 3VXMD 4Z6AT 2XXCB 4F15C 4G43A 2UWEE 4NNYA 5MENE 4MXVE 3CFCL 5DQ9B 3R8BB 4WW2A 2A6KA 2ZZUT 5CJOH 4ONFH 3UJTL 1T4KB 3DMMA 2H2SC 3FB5A 4I18A 1BREA 1T21B 2YUVA 1U91B 4CVUA 4I18B 1M6OA 5IHUL 3KPOB 1NAMH 5JQ6H 5F88A 4Z7UF 4JRXB 2GAZA 4XB8A 3CXHJ 5BO1H 5J06A 5CEXA 4JHBA 1PLGL 2G60H 3ULUF 4CGTA 3IDNB 1LO0L 1MUJA 4YE4L 2Q3AA 1C1EH 1YNLL 1MUJB 1XFPA 3ZDZF 1BX2B 4HS3A 2ITDB 4H5SB 1VEMA 1CFNB 4Z7QE 4POZC 5ITBL 4O2EB 4Y2DA 4JKPH 1IEBB 2A9ML 5EA0H 3TBSA 4LSSH 2LAGB 1J0KA 1MHCA 2VLKD 1HXYA 1B0RB 5KAQG 5D9SB 2GSGA 4RRPG 1T04A 3RL2A 2YPLE 4O5LH 3HKFA 5HHOB 1Y18A 2HN7B 3K1DA 3QEGH 5C0EA 3SCMA 5HHPA 2C4FT 4YO0A 3PP4L 3X3GH 4U1NB 4JN1H 4NZTH 2JCCE 1EIBA 1KTKE 4UDTA 4PB9L 1MIEL 3FT2A 1YEGH 1VFMA 4QXTB 1F4WL 4X8JB 5GHWH 5JNYB 2VH5H 1CICA 3F6LA 4E0RB 1K85A 5IKCA 4P23D 3KJ6L 4YHOL 1I3GL 4WNQB 4ODXA 2P5WA 1TDQA 4R0LC 3F58H 3QFDA 1B0GA 1F2QA 2OS7A 3C87A 1MQKL 3VA2C 2IGFH 1A6AA 4WO4B 4G5ZL 3ZE2F 3GHEL 4R26L 3WN5C 5EIVA 2CRYA 2EO1A 4HD9A 4XMKL 4FQIL 1IC7L 4YBLB 4PJCF 5JA8B 4KK8D 1IGIL 1KUMA 4KMTH 2FHBA 5TGBB 5EOTA 1DBMH 3QIUC 1MRDH 3FCTB 4NRZB 4HK3N 2E6JA 3SDAB 5L7XL 4Q9BA 3IB4A 4HMCA 3SDDA 5D2NA 2ICEB 3DO3A 4J3TA 4H25B 2Y5TA 3P73A 4OLVL 1KNOB 1IGCH 3ZDXF 3K0WA 3HAEH 1DVFB 3FO2A 5F93C 3OHXB 1YEHH 35C8L 2J12B 4F9PA 5ANMA 2WP3O 5CEZH 1FORH 4S0TD 2D0FA 1X5HA 1MCPL 2WWKO 4YFDB 2WQ8A 3VFPB 2YPLB 4KQ4L 1MRCH 3HUJB 3OZ9H 1RZJL 5ADOL 3BIAX 4LCWA 1NCCL 4UT7L 4OUUB 3HA0A 4UNVA 1RUPL 1IEAB 4G8IB 3O3EA 3D1MC 4NWUL 5DD1L 4G42B 4P4RB 2P8PA 3GI9L 5J7CC 4TSCL 4H8WH 4OFKA 1OAXH 2OI9C 3U0WL 1QP1A 4HUNB 2A6KB 2V2XA 3D39B 4QNPE 3CLFL 3H2WA 2R29L 1F90L 2BOCA 4YHKL 5HHXH 2FX7L 2PTTA 4UT9L 1ZHKA 4RMQA 3VD7A 4DGIH 1MFDL 2YD6A 5BOPA 3MV01 5B38A 1IL1A 4E41D 3VE0A 1CZ8H 3UYOD 5C0AE 3EHBD 3HNSL 4RBPK 3CK0L 1OB1B 1NL0H 3X11B 5D6DC 3MV9A 1IGFL 4U1GC 5IUSA 4NJAH 3OKLB 3WO3B 3CCHB 3QHZH 1NGXB 1MFCL 3PWPA 3IAQA 4D9LH 3O6FC 3KPRB 2IQ9L 2X41A 2OTPA 3BWAA 4P3CL 5CS7A 4YUEL 4NM4L 2YBRA 1U3HB 4Z78A 3PHOB 1IEHA 1A7QH 4G9DA 2VITA 3GSNA 3VMNA 5D7KD 4FRWA 4AMKL 1ES0B 1QFWH 4EUPH 2MWCA 5DRWA 2K7PA 4WI6A 4GBXB 2Q8BH 4Z7WA 5IKCB 1S5IH 4HKJB 2BVOB 3ARFC 1OAXL 4Y5YC 5F1IA 1UCBH 1WFUA 4XNQA 3J8F7 4K3EL 2ZUTA 1G6RA 1SMOA 2BSTA 4HXAL 2W65A 3I50L 1NEZB 3EJYC 1FO0H 4BELD 1TIUA 1MCWW 3ARTA 2MKWA 3BUYA 3UJIH 1AD9B 4WTXA 4PJHB 4M1CC 3C6SB 1AD0B 4Q9QH 3WKML 3U9UB 1DBKL 4KK8C 1FORL 3GMLA 2MMXA 3MV8D 2PYFB 1A4JA 1EEUA 2A77H 1U8OB 5FKPA 3O9WB 5FYKH 3T0AA 1I1YB 4U31A 3VA6A 3HRPA 4KI5E 2IANB 3UZEA 4NYLA 3DSFH 3MCKA 4MCZA 2AV1B 4CN4A 4ZOEA 2KBGA 1OVZA 3VXRB 1EEYA 1DVFA 1KGCD 5E4IA 1XR8B 5FHAH 5TE7H 5FYKE 1J12A 4ERSH 1M7IB 1R24A 2R2BB 3HFML 4X99B 4Q97A 4P99A 3S96A 1FRGL 2YPLA 1TLKA 3BMVA 2IPKA 3GJFB 3BIKB 2VLKB 2Y4SA 3ZKMC 4IOIA 4OIIH 2Y6SD 2NY7H 4N8VA 5DFTA 4F9LC 4KRNA 1DLFH 5SWZE 2ESVB 3R0NA 1EDQA 3KPQB 1JRHH 4JKPL 1JF6A 1X3DA 3UPCA 4F8TA 4K7FB 5D5MF 3HC3L 3STZA 5F7DB 4LIQH 2VDML 1YNLH 3QUZC 1EUUA 3UTTA 4QRPD 5DC0A 1N6VA 1ITCA 1ND0A 4KUCD 4NO2A 3RDTC 5GS0L 1NC2B 1R3JB 1NCAH 2X4RB 3IYLW 3PWLA 4RMUA 2ED7A 4O58H 1IL1B 4BQCA 1YY8A 3QG7H 3ARED 3LKOB 1RU9L 1S78C 4NUJB 1CIUA 1MAMH 4MYWB 2X70B 3ISWA 1NGYA 2DI8A 3D5OF 4OCYH 4ODVL 5C09D 3BDBA 5CP3A 4E41B 4MA7H 2FIKA 2ADFL 2XQBH 2AXGA 1NBYA 4XMPL 1FYTB 2VOTA 2X1WL 3SKMB 4C83A 4U6HB 3OKLA 5TE6L 1AGFB 1AKJA 1J1PL 1JF1A 2VLME 3PHOA 5D1XB 4IRSA 2P47B 2QQKL 2AJZB 1T1YB 2DQHL 4DAGL 1CDYA 1PD6A 5DFVD 3C5ZD 2EO9A 4PJFA 4Z0BL 2O5XH 3SJVB 3MODH 5GGTA 4XX1E 3BPCA 5DRWB 1R3IL 3NACL 3UAJC 3ARRA 5DK0B 1BBJB 2DQCL 5C08A 3I6LD 4X80L 3KLHD 2OJEB 2YPLD 5JXED 1U8KA 4ZOAA 4Y16C 4MMZC 1U3HC 2ITDA 3MLWL 1V3LA 1QSED 3DX7A 2XWTB 3DO7A 3VGDA 3O9WC 2OTWB 1S8DA 1JZ2A 2I07B 1MCCA 1HQRB 2BVQA 1LE9B 3DUSB 4NSKA 3RVVD 5EBLA 3SEPA 1CGVA 4R4FL 1UWEL 2DQEH 5DRXB 1LDPH 1UVQA 4PJ7E 3QUMH 1L6ZA 3VMPA 4G9FA 4ELMF 2GJ6D 4LCYB 2AGJH 5MEOB 4NKMA 2NY5C 1R5IA 3OB0K 2PO6B 3MLZL 5IB1A 2BSSA 3RPIA 4WI7A 5CP7B 3TN0A 1T5WB 4RMTA 2OL3H 5EOQH 5GJSH 4NRYB 4U1SA 2ZCHH 4HIIA 4DEPB 1HKLH 3RVTC 1X5JA 1XIWD 4X83A 1WFTA 1X5KA 3V5HB 3MRNA 4OFPA 3LN9A 3U0PA 5DUBA 2VDLL 2JJWA 3U0PB 5C0GB 1DR9A 4B50A 1NDGA 2QQNH 43CAB 4M6ML 1DQLL 2CUMA 4M8VA 5ADPH 1ONQA 4L1DA 5MERA 3B9VA 3DSFL 3G6AA 3FQNA 1U92A 3ZYIA 1G6VK 2IG2L 3NCFB 2NMSA 1JP5A 1N6QH 3H9YA 3C9NB 4ZFFB 4LLQB 2YZ1A 3OXRB 3RRQA 1FZOB 2Z35A 1KULA 5I66B 1WAAF 4QHUB 2MKLC 2IBBA 1ZHNB 2L7UA 4R8WH 2UY6A 4OBSA 1NGPL 2ESVE 2F54A 4JFZH 1N0XL 1CWVA 1KJMB 3ZHLA 4Z0XB 5F7LB 1IM3B 3CNKA 4BSVA 4ODTH 5AZEL 4Y5VA 3REWA 1PSKL 3GMNA 4P23C 1IBGL 4JJ5A 1V7NL 4OCLC 1UCTA 4HUKB 1NFKA 4EIGB 1P1ZA 5T1DL 1MRFH 3T2PA 1I7RB 5FAAA 5E24E 3C8HA 2Q8BL 4LBEB 4K55A 1JPFA 3RWFA 1K5NA 1YECH 5HYSG 4L8BA 5HYQA 3VDCA 1DFBH 1VGEL 4WI5A 6CGTA 4PJAE 4DUWA 5DS8B 1FPTH 3DSNA 1ROWA 1PG7W 1I8MA 4KVNL 3IDXH 4CVWA 3JTSB 1I8MB 2EDRA 3VGFA 5KVDL 4FQXB 5F1KC 1IFHL 4ZS7L 5DK0A 3GMMA 1VPOH 2GITB 4JPKH 2MJWA 2HVKA 2QSQA 3IDIB 3TO4B 1C16B 3ARBB 3RA7H 5IW3A 1P6AB 3S3PA 5J9PB 3FQXB 4LASH 4CDHA 1KTLA 4S1SH 5CZKA 5IB2A 5SWZA 4JFFB 4HGWA 1MIMH 2FX7H 3JV6B 1QTYT 4P9HH 4OM1H 3NABL 5TQ2H 4JHWL 3KHOA 3ZDXE 3FN0L 2APXA 5JDSA 3SKUD 5I1EL 3MRFA 4U05A 4NKOB 3T0ED 2BC4A 1KC5H 2Y25A 5HJ3A 2VLJA 1EPFA 1YJDL 3VXME 1PKQA 5C0ND 4YDLB 1OGAE 3WS6C 4M7KH 2LQRA 1GC1C 2HP4A 1WBXA 3MA9H 4UDTB 1MRCL 2CKBL 3JWDC 5HHMD 4TUKL 1ZS8B 2Z91B 3MJGX 4PJ5E 4HIHA 5D7JA 2R56L 1IRAY 1MF2L 3B6SB 2VZTA 3ARFB 3K2MC 2WUCH 2J8OA 1CICD 5H2BA 4M5ZH 2BY0A 3U48A 4F7MB 2P5WB 1VSCA 3SQOH 2ADGA 3BYTA 2MHAA 4QNPF 2ZNXA 3C6LB 3O8XC 4OT1L 5D1QD 4PJFE 3MRHB 4HLZH 2OMBA 1A6AB 4P9HL 3JV0A 8FABB 2B4CL 4U7KA 1IC7H 2F5AL 3ULVF 4FQCL 3F7RA 4ZFOA 4LCUA 2CKBH 1Z9MA 2XFXB 5I1AA 2FWOB 1P69B 1GXEA 3ARGA 1CD0A 7FABL 4LVOB 4FTVE 4TUOA 5DO2C 3FCTA 3WFBL 2V7HB 1QHPA 4TPRH 3MBXL 3MLUH 1H3TA 4IIQB 5ETUA 3F58L 3CSGA 3WXVL 1IGTA 2VISB 4M1CD 5IB5B 2PXYB 4M5ZL 3KG5A 3BKYH 1ZGLP 5DVLA 3UXFA 4ZO6A 2JLLA 1RK0B 3I02A 1OTTD 5I6XB 1CD1B 1KLFA 5DRZB 3FN0H 4M9PA 3AXLA 4ZUWA 3REVA 2BY1A 4DW2H 1SJEA 5JPMA 5I73B 4QHKJ 1TQBC 4X7SL 2J4WL 3MZGB 1JIBA 4LIQE 5AYUL 2ARWA 4X9FA 4K3HA 4FP8H 1G9NL 1I9IH 4YAQA 4GUPB 2EIBA 1Q94A 3IS1X 4U1MB 2ZKHL 1FN4B 1U36A 4M5YH 1C7SA 2R1XA 4UZGA 3ZT7A 1NC2A 2YS4A 3P40A 3QA3A 4JKMA 4G7YH 1J05A 4UBDC 4JKWA 1HCFX 1C08A 2IJ0C 4S1SL 4FFVC 2DB8A 3HLAA 3RTQA 1F4XH 1I8KA 1QACA 5L0QC 1N4XL 1PW3A 4G6KH 2DQTH 4C4KT 3JV6A 2QSTA 1CFNA 1XGTA 3IFLH 4MA3A 3Q1SH 3BWAB 4MJ5A 3RVWC 1K2DA 4PLNC 4PGDA 1XF5B 3DHMA 4ACPA 1UB6A 2O26U 4E42A 1YPZF 2WSKA 4M6MH 5J3HD 4F7PA 4X7FC 5DQJA 1MWAA 1J1OL 4KVNH 1J8HD 4K9EH 1WWAX 2AJXH 3ESVF 5IHZB 3BP7B 4Q6IC 1OSPH 5H8DA 4U1LA 4J4PA 4L8DB 5SWSB 3R0MA 4XCFL 2GW5A 2UZIL 2XQYK 4G9DB 5AZEH 3P3YA 4ZTPH 2E7CA 2R0ZL 3OAYH 1DFBL 3D3VD 4LNVA 1HWGB 3MRMB 3VFNB 2Z4QA 2XN9D 4MWFB 3GJEA 4N0CC 4NM8H 2OM5A 5TF1H 1TJHL 4XNZC 1F8TH 4IRJA 2HRPL 1L7IH 4R97B 1Q9OB 4F7EB 4AEEA 4MJ4A 5GSRB 3MUGA 1NEZA 2DTML 1L0QA 1S7TB 2YD9A 3MRPA 5HDBE 1XF2A 4YDLC 5DUPL 4N0CD 2DDQL 3IDJA 3MLXL 5EOCH 4NQEE 1QVOB 5D1ZC 5IVXB 2NW3B 4YHML 3G5YB 2CDEB 2EC9T 2VUOA 1C12A 4RWYL 1MJ7L 1TENA 2F74B 1ZT4A 1EZVY 1SVCP 1DANT 2OLDA 3AB0B 2DLTA 4XNUH 4KZEL 5DJZA 2AV1A 3U1SL 3L3KB 1XCTA 1Q1JH 3IJSB 3BH9B 2JCCA 4UOW0 1OARL 4PGEB 1NMBL 4OI9A 3VGAB 1V7ML 1LD9B 4HKXA 4WHCA 5GISH 4NRXA 3PQYB 1LDPL 1QFOA 1UKSA 1ZK9A 3ALPA 5JR1H 1KFAH 3ALWA 1YDPA 3P11L 3MR9A 4XMLH 5ESAB 1RHHA 5CILL 3WUWA 1CD1A 5DRZA 1I9JL 3FL7A 5I1HH 3WFCH 3BO8A 1Z6JT 4FFVD 1NKRA 2DOCA 1Z9SA 2IAMC 3C60A 2GJJA 3TIEA 2EDNA 4QHUA 3DECA 5DJYB 3THML 1LK2B 2BCKB 3EYSH 2PYEB 4WW2F 1LK2A 1QYGH 4LHQB 2V2XB 3D39A 3G5VB 2PTTB 3MA7B 3MODL 2P7TB 2CRZA 4L9LC 4PJ5A 4UI2A 1ZVSA 4GRWH 1RPQA 2I60H 2X4NA 3FOMB 5K9QI 4NQDD 2DQGL 4OGZA 1GGCL 5GPRA 1LEGB 5ITFA 1Y6NR 1A3LH 3P4NB 4NQDE 1YPZA 4YHLL 4HIXL 3CDGA 1CFTA 2NX5E 1JNHB 3CDGB 3SGJC 1NJ9A 3LEXA 3EO0B 3STBA 2D7MA 5A40E 1JPSH 2K1MA 2YK1L 1XGPA 1ZMYA 1XGYL 3BPLC 3OKNA 5E8OB 3UTZA 1H3PH 3QEUA 3SJVA 1JHTA 4PJGF 4YHIA 5EC2A 1F42A 5GS0H 2DWDB 4JO1H 2AJYL 5E70A 3BRFA 4LHUB 1HYSD 3D0VB 4PJBE 4MWFA 4DUVA 5GZOD 2DMCA 4Q9RL 2DIJA 3KWWB 1T1XA 1AI1H 4IOSD 5GSRA 3VXUE 3ULUD 1S9VA 1MHPL 1F2XK 1Q9OA 2WUBL 1K3IA 4PJXE 2G2RA 2XWTA 4GAGL 4YPGB 3LPFA 1T03H 3MCLH 4LKXA 3QPXL 4A6YL 4P23B 4U1HB 4LCIL 1E4WL 3TT3L 4ZO8A 4F37F 4LCYA 2VO5A 5I9QC 4G6ML 3DYPA 4POYA 4UV7L 3SDDB 1AFVH 4Q6YA 4EDWL 3E6HA 5BVJB 4NM8L 1EGJL 5F7FA 1REIA 5A2FA 1T20A 3SE3A 2NY0D 4TYUA 2Y7QA 3TVMC 5KVGH 5E6ZA 1BFVH 1IILE 3B6SA 4PJAF 1X7QA 1GPOH 5JHDD 2A73B 5CD3B 2VL4A 3VFPA 2NR6D 3ULUL 3LN4A 3DETC 4WWKA 5AG9A 2WWMD 1KIRB 4P5TB 4GKZB 3LRSA 5J11B 4D0BA 4O9HH 4WVRA 3EDDA 1AP2B 4NPYA 1JN6A 1I3VA 5D7LB 3Q6FB 3C9NA 3W5MA 5IF0B 1IKNA 3VWJC 5F6IB 2ZUVA 4H0HB 5AEAA 4JQIL 2VSCA 1C5BH 2VLRE 2N7BA 1GZPB 2HVJB 3FN9A 3PNWB 2ZCLL 1R3JA 2F58L 3U30B 1A1MB 4WU5A 1SBSL 5HGHA 2DQJH 5DEGB 5EUKA 3LQAH 1AGCA 3OKEA 3MPCA 5C3TA 1QQDB 1SYVA 1YMME 5C0AD 1A1NB 1NBZA 4E41A 1MJUL 5D5ME 3QXAB 1N2RA 4GRWF 2ZWLT 2AI0L 1NGYB 2DD8L 1JWSA 4KTDH 1D6VL 2VLLB 2UWEF 4FQQA 2V2WB 4NWTH 3VWKD 3ZYZA 1FV1A 5FUCE 4YBQD 4QHNA 1AKJB 1N5AB 3RZCA 4G6KL 3EO0A 2R2EB 2ICES 5EU6B 1D5IH 1QD0A 4JY5H 4MA8L 2YBRB 3CK0H 5EU5B 1F3DJ 2I5YH 3ZLQC 5SWSE 4BFBD 1MCBA 1T2JA 2X4SB 4FXLA 1OAKL 1A9EA 2EDXA 4WI3A 3MLSL 4FN0A 4OM0H 2OZ4H 1FNGB 3RTQD 5LXGL 4FXGB 3GMMB 3FB7B 5TPWL 3BYYA 5DMIH 4PJFF 3MLUL 1U6AH 4HGMA 1NC2D 1NUDA 4HS6A 3WS3A 1T7YA 4G8EA 2Y06H 1ZXQA 4Z95L 2ERJB 2J4WH 4XNYL 2A83B 4OM0L 2DLIA 4NCC2 1NUFA 5CIPH 4MJ5B 1K9TA 1F6LL 5TDPA 4NC2B 4G3YL 2R29H 1F58L 1E6JL 3ZO0A 5FYLH 5EUOA 4APQD 3I2CH 3O3DB 3AS1A 1FC1A 2FJHA 4OCWH 2FH8A 4HBCL 2IANA 3QXWA 4I18C 4LU5L 4PP1D 3QG6A 1SM3H 2P48B 2R56H 3GRWL 5A3IC 3RKDD 1P7QD 4PD4K 4GJTB 5MEPB 4QYOB 1UWGL 1GVIA 5C09B 2B7DT 5CWSA 2ZSWB 5EH1A 3V5HA 3H3BC 3MUJA 4JJHA 1ZS8A 3NVQA 4LRNH 4OGAC 2FB4L 1VB9A 5DK3A 4EOWH 3HAEA 1YQ2A 4V1DA 1CK0H 1J0IA 3D18A 1MQKH 2BSRA 3MRIB 3K74B 4KRMB 4OZHE 2ATKB 5GGRY 5EN2B 5I1KL 5CSBA 4JANA 4LQFL 4I0PC 4PJBA 1W2KT 3KJ6H 4XX1G 5IK3A 4YHNB 3KPRD 3CFDA 4JZNA 1F4WH 3UTTB 5EZIH 4XAKD 1CL7I 1NLDH 2WUBH 4JN1L 2GSIA 4MAUL 4X99A 2A0LD 1LE5B 3OX8B 4HUVA 2B4CC 1A21A 3T09A 3N9GL 2CJUH 3VRJA 5CMAA 4R0LB 1FBIH 5JZ7C 4AH2A 3RWFB 2W0KA 3KR3L 2VRAA 1QOKA 3W0WE 1UEYA 1B0WA 3LB6C 3I3DA 2UUDK 4PB9H 3BI9X 4OM1L 3T0EA 1NCUA 4U1IA 4X6EA 3GI8L 1DCLA 1XF3A 5GS0C 3LDBB 1UT9A 4GG6F 4MDIA 3S4SB 3DX6A 2NXZB 3PWNA 3MYJA 1CL7H 4WFGD 3RDTD 4D0DB 1VGEH 4LSVH 1NCDL 4EUPG 4HK0B 1NBQA 4JAMB 3VFMA 1T21A 5BO1L 3O6FD 4YAQB 2P24B 5D71H 3VFUB 3FO1A 2FGZA 4PR5B 2WBJB 2QQLL 1ZVSB 2FSEA 4Y16D 4NQXA 5C71A 1J05B 3OR7B 3RTQB 1Q9KA 2ITCB 4L9LA 3DVGA 2GITA 1C1EL 1G9MC 1YC7A 5DD5H 3RUGE 3HC0B 4M8QA 3K8MA 4M3JA 5DFVC 2E7LC 1CGXA 3BKJH 1WZMA 2F8XC 3EOAB 3EYUH 1JF5A 1N59B 3B5GA 4J3XA 2ZOKB 5TE4L 3HNTH 1LO5B 1X5ZA 2PF6A 4JO2H 4ONFL 2IF7A 1ZHLB 3MX0A 4U3XA 1YNKH 4PP2A 1Y18B 2DI7A 1JHTB 5EC2B 5MEOA 1T66D 1MJ8L 5FDWA 1V7NH 2BVUA 1IBGH 1V5JA 3BZ4A 3WFHB 2NNAB 2IFFH 3O3BA 3VXNB 3KJ4B 5ENWA 4PGCB 3KNBA 4OB5H 1F97A 3QWRA 2YEZA 5D1XC 5CILH 4GS7C 4HQQL 3LN5B 3OJDB 2I60L 1ADQL 2IEPA 3BGFC 3NN8B 3TVMA 4KK9D 3DVIA 1DQQB 3MC0A 3UBXI 2DLEA 2Z93A 3MRLB 3TBTA 1IGMH 1RZ7L 3HAEB 5KSBF 1DQLH 3P9LB 4MZ2A 4RFNC 3VFGH 4H88L 4NQEA 1J0JA 3QO1B 1W0WA 3EDEA 2VDKH 3MZTA 2QJDA 3F7YB 5JHDB 1HHJA 5IR1B 3EW3B 2MNUA 4UINH 5TQ0L 4UMGA 3EYVA 3FAXA 2J8UF 3ARGB 5E8PB 2NLJB 4PJ8D 1DQJB 4LAQL 4V2BA 3FOLB 4TTDC 1T20B 3REWB 3MRKA 4JRYE 1ULVA 2CDFA 1RZKC 1N7MH 4KXZI 4DK3A 5GISL 1QFHA 2O5XL 3VDBA 2VXQH 3KLAA 1L0XA 4WI4A 3O41B 2OYPA 3D9AL 1WIPA 1UWEH 4QRSA 4AQ1B 4G9FD 2NY4C 5E2TH 2V17L 4LPVA 4XWOD 2CIIA 1ERNA 3SE8L 3EZ8A 4IMKC 1N0LA 4YGAB 4K07A 2BXZA 3KLSA 4KKNA 1I7ZB 3I6GB 4N8VG 1MJ8H 1KEML 4KJWC 1RUKL 4XWGH 3LZFL 2XKNB 3QI9C 4P46A 3U83A 3O81A 2P8PB 2FX8L 1G0XA 4RAUB 2AJSH 3KPPA 4PRBB 4F37K 5CP3H 3O6LL 3X14A 3KPPB 4PRBA 2QQLH 3V9FA 1XCQB 3QG7L 1I85A 2GAZB 4JFQA 3L5JA 1WF5A 4QRRB 5I16A 4YK4B 2C1PA 2OQJB 3FOMA 3PP3K 5HGAA 3ZE1F 1I7TB 4KRPC 2R0WH 1LP9E 4PRHD 4NBYB 5E2WH 4YLQT 2B5IB 4OB5L 4LIQL 4EEEA 4X9BA 1VFOA 4JFFA 4P46C 4FZEL 5D96C 1RUAL 4P9ML 3KAAA 3GI8H 1K2DB 4FG6D 1BM3L 4TNWK 4Q0XH 4ELME 2CUIA 1J1XH 4H1LB 3TPUB 1NGXA 4IRSB 3BJLA 2KQMA 5E8NA 3BRGC 5MI0C 1CLZH 2V5MA 2GFBB 3HG1B 4NOBA 5AYUH 4L8DA 3WYRA 2DI9A 4XC3L 5CIPB 3NA9H 3F5WB 4GFTB 2DQTL 3FFCA 2B1AL 5HHVL 4EI5B 1KCRL 3D0VA 4N1CA 4HG4J 3DRQA 1S7RA 1WLHA 2MPAH 5HVHB 1GYAA 3FQUA