3LZLA

Crystal structure analysis of the as-solated p19 protein from campylobacter jejuni at 1.45 a at ph 9.0
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
157
structure length
157
Chain Sequence
GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
molecule keywords P19 protein
total genus 32
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzlA00
5I0XA 3PJNA 2O6DA 3LZOA 3PJLA 5I0VA 3NRPA 3NRQA 2O6EA 5I0WA 3LZNA 3LZPA 2O6CA 3LZRA 3LZQA 3LZLA 5I0YA 2O6FA
chains in the Genus database with same CATH superfamily
3X11A 5GHWH 2VQ1A 1AMYA 1T0MA 2X1QA 2D31B 1QBBA 4LMQE 1QEWA 5BJTB 1Z6JT 2DYSB 1OSPH 4UV4H 3PHAA 5EUOF 1T1ZA 2YN5A 2OMVA 3DX9B 2HB0A 4BKLB 2BINA 4BFKA 4NERA 1NFDF 3VH8G 5SX5K 3UO8B 2JJTA 1MCBA 5I1LA 2XZCL 1PW3A 4G3YH 4NQTA 2QBWA 1M3JA 1YLBB 2GCYA 4KVNH 2ODHA 2NY1D 3EFFB 3M86A 3QJRB 1PJWA 1GPOH 2OM5A 3DECA 5KYXB 4UZUA 1F42A 2OMVB 1S78D 3DX9A 4GW4B 4NLAA 3MLVH 4IMKC 4WJ5A 1SLUA 3SEPA 5JW5A 4ZUVA 3ZDXE 4DKDC 3O0RH 3B83A 5AOMA 1E42A 3ZTEA 5AD0B 5SX4H 3Q2VA 1CTOA 1F5WA 4I1RA 1JXGA 4J8RA 4QTHA 1P4BL 5E08H 2IDCA 5AEAA 2R7EB 4O58H 4KRNA 4TLTA 2BSED 1P7BA 2BIIA 3P2DA 5JW5B 4JPVH 1BVOA 5I1GL 1U8KA 4M93C 3SQOL 5JIDA 3MODL 1JG9A 2ARJQ 4MBOA 3LDBB 4M1CC 3U9UA 5I1DA 1A4AA 4TVPD 3ZL4L 4XVSH 4U1LB 2AJZB 3MUUA 4HK0A 4Y9BA 3Q6FA 1I7RA 3GO1L 1IAIH 1JK9A 5C0BD 3SDXA 3FT4B 2OL3H 3VI4F 1IJNA 5DWUH 3S8WA 2UVFA 4YDMA 1KIPB 3DARA 4NFDA 1U41A 4PWKA 5CZXC 4CC1A 4HEPG 3ROOA 1DVZA 4WNJA 1OTTD 4MASA 4HEME 3QUMA 4APQB 3L3GB 1R19A 1ZIAA 1QTSA 5KUKA 3DETC 1Q9OB 3BHBB 3P2BA 3DX0A 1OCOB 3PHQB 1JHLL 1J1OH 4CBZA 4ANVA 1BQHB 3UPRA 4PI0A 4DGIL 2C9QA 3UAJA 1D5XA 3DK2A 3IN2A 1L9SA 4YNYB 3T6WA 1NIFA 1PZSA 5I1JH 1AZCA 3U7AA 4ZRGA 5BCAA 1H3PH 5D2LA 1R1CA 2P5EB 4PJEF 1TCRB 4FQ2H 3NA9H 3O11B 1DHKA 3TO2B 4DKFL 2Z4TA 4UIMB 4Y5VB 1W6LA 5CLZA 3T0EE 1H3VA 3QSKB 3HE6A 1MFMA 3IMSA 3DI2B 5DUPH 3D06A 5D7IB 5JHAA 1JNNH 5TPWL 4NZ8A 2TAAA 1H3PL 3K71A 2LAAA 2J6EH 2R2CA 1GVIA 5J6HB 3MOAH 1H8LA 3AG3B 4OIIH 4YXHH 4AQ8C 1LE9B 4H1LG 1CICC 5K9OA 1YMHB 1I82A 4RBPH 1VB9A 5HJBA 3CC1A 1KGCD 3FAXA 3FPYA 3P73B 5IBTH 5IHZA 5AD0A 4JB9L 4MZRA 1JV5B 2WVUA 2A6KA 4N0UA 4N5EC 4BHUA 2VLJE 3SE9H 1JZEA 3L4VA 3SGDI 3TYFA 3BKML 5DYFA 5CBAA 5E7BA 4ANUA 5B7MA 3CDCA 3V6FA 2RB8A 4PJ6A 3PP4H 1MCCA 4M4PA 1F2QA 3S35H 4YSTA 2BVOA 2ATPB 3VB9A 3AXIA 4OLXL 1E8ZA 1C8PA 4ICWA 1V5JA 1WICA 1OP4A 4XXWA 3T2NH 1PZ3A 3MBEB 3O2WH 1MVUA 43C9B 1P4LA 1A7RL 4S2SA 3UBGA 4AEEA 1GTNA 5D8JL 2PR9A 1QLRB 1A3RH 3VD9A 2F54B 2AJVH 3NRPA 2EIDA 3COOA 4HWBA 3LB6D 3TPUB 3CZJA 1CDUA 4LSTH 1KT2A 3A6BH 3FB7A 2OKMA 5EBGA 2LU7A 4ZX6A 4YXHL 4PTTA 1F41A 2QQLH 4ODVL 4RFNC 4AQ1C 1Y0LA 4UTBH 1HL9A 4NO5B 5K93A 3U0PB 2ZP8A 5CR1A 3RPBA 4P9HC 5CP7B 1ACZA 1I3UA 4UILL 4X2UA 2ZT9C 2WLIB 2ALAA 4FNPA 1C7SA 3S37X 4FE9A 2DD8L 4M7KL 1FNAA 1CN4A 2VQUA 4XC1L 5J9PB 1T2JA 3MPCA 4NN5C 2YEZA 3FMGH 2XKNB 2DZEA 3HE6C 1A25A 1DLFH 4RCAA 1T21A 5CILH 1DJWA 2P43B 2J8UF 4ODHH 4OB5L 3TCLB 5ES4B 5JQ6H 2JE8A 4LVHB 1KTJA 3CDFA 5LHDA 3CSPA 5SWQB 3Q2CA 1RUMH 2FEDD 3SDCC 4HX1A 4XBEL 4XOCA 4UILH 2D7TH 4YPJA 3GUFA 5L2KD 3D3VB 4ZOCA 5DJ2B 1QNZL 3HAEA 2FX8H 4MYWB 4Y2OA 4Z0XB 5EFIB 4AC4A 5I1JL 1DJSA 2NY1C 2GEQA 5CJ5A 3D6GA 2H3KA 3OKOA 1HILB 1K6QL 3BZ5A 4FQHB 1NUGA 4ZS7L 3T4AA 2PTUA 4HMCA 1GAFH 5DQDL 1J18A 5JQ6L 4KDTC 5K69A 3TCXA 2ZXWB 3OKKB 2WUBH 2O93L 1KENH 4EAEA 3TNNB 1QI3A 3BUYA 3ARGA 3FL7A 3L2NA 2CD0A 3NAAH 2BIMA 1P84K 5IHHA 5DXWA 2E7DA 3VFSB 4NZDA 4X83A 4N2BA 4ACPA 3P3RA 1SMAA 1F97A 3RYMA 4GKOA 1JUFB 2W0PA 3DUHA 3REWA 1U3NA 1YNLL 1FBIL 4NUMA 4PRNA 1X4YA 1IGFH 4PRPD 1OALA 1J48A 1CFVL 4RIRB 2F74B 2KDGA 3CDZA 4JJHA 2FO1A 1AANA 3B2VL 5LBGA 3T1FB 3K1KC 4B0MB 3PV6B 4HVBA 1BG1A 4UIMA 4GJTB 4N1CA 2BOBB 3GC3A 4WTXA 3ZE2E 4A7GA 3ECUA 5GIRA 1RZKH 4Q52A 2Y7NA 3PXHA 4XCEA 3NGBB 1FNGB 3HW7A 2VLJA 4GSQA 2W88A 4JM4L 1SZNA 5HYQB 2B08A 4P2AA 3FS9A 4MX7B 1XSJA 1IB5A 1WISA 3UP1A 1TZHB 5C71A 1EA9C 4X6CF 3S4SA 3PGFL 1MJUH 4M7LH 4HU8A 4OV5A 1O6SB 5IBLD 3MLRH 4GRLB 4UT9A 3WJMB 5EEYA 2MWCA 3LKNB 4MMXB 3QJVB 1LWHA 2Y5EA 2VDNH 3SDCA 4R4FH 3CGTA 5E4EB 1F11B 2XG4B 4WFHD 1FG2A 1ACYH 3MLUL 1ICTA 5LVEA 5DFVC 4J3UA 4AYSA 3I75B 4JZNA 1HH6A 3ASOB 4FEIA 3UYRL 1O6SA 3U2JA 4I77H 3OJDB 4ELMB 4M43L 1NCDH 2J57A 5CNHA 2GI0A 3D3VA 1GHFL 1EH9A 3HPJB 4B9FA 3K6SA 5F7YC 5DS8B 5AOLA 5HYQA 4ZX3A 1DBBH 2GJJA 2UYLB 3RPIB 2XRAL 3O8XC 1VENA 4ISVA 4OJAA 2WXKA 2RFXB 4QRFA 1V27A 1MJJB 4F37K 1HCYA 4JHWL 2L4OA 2N7SA 4HF5H 2WYIA 4U4IA 1D5XB 2QSTA 2FB4L 3CE1A 4YL9A 1MRDH 4LLWA 4C83B 4YBLB 5J06A 3WMSA 1MWOA 3K5SA 1FFNB 3C5ZB 2WP3O 4B53A 1IBDA 4U6XA 1ASOA 4NAMA 3ME0B 5KSBB 2WXOA 3QIWA 3QORC 3H0TA 1EGJH 3GFUA 5FDWA 1WGVA 3LNEA 3QISA 1RZQA 1UQSB 2DEYX 2ROYA 4RDBA 5I0ZA 3MDJA 3MV9B 3RWIA 2PW1B 3BH8A 4IQHA 4Z7NF 3L5IA 1XXFC 3IDXH 1YAIA 2QPUA 4KUZL 1M2VB 4HHWA 3BGMA 3BKJL 2FH8A 3SE3A 2J44A 3NABL 1KIRB 1XGQA 1QFHA 4IGBA 1M05B 1E9PA 2YFNA 3NRFA 4I9XA 1AQMA 1YQVH 3CH8A 3QO0A 4XNMB 4NQDD 4Z8FH 3B9KA 3MRCB 3B1TA 1SBSL 3DPBA 5FYLL 5T1LB 1J0ZA 4K3GA 1MFEH 3PWVB 1DQQB 2CRYA 4MNGB 2AEOA 1S7RB 3NSYA 3VXQA 2UWEA 5JMRA 3LVTA 3BSZH 4Z76A 1R3IL 2VDKL 5F1SA 1NCAH 3CXDH 3GSNL 1MIMH 5DA0B 3TYFB 1U4EA 1PLCA 2CQVA 1SOSA 5D5MF 5DZ9A 3GGWB 2XVGA 3RIAF 2IADB 4P2OB 3DRTA 1AXSB 1K5NA 3NIDB 4MQSB 4JFFE 4QRBA 5A2JH 4P3DB 4Z7IA 1R3IH 3R4DA 4BDVB 2OSXA 2VISB 2TSAA 3Q43A 3ZIMA 4JRWA 1YPZB 4KDVA 5IW1A 1JPSH 2Z93B 2JI1A 3EHBD 4QPEA 2FNWA 3TVMB 2N0MA 3M8OH 1FO0A 5CP3H 2R0ZL 3V4UL 4E5XG 3L4XA 2XUWA 3S48A 4ZFGH 1HKLH 1JWUA 1L0PA 3DMMD 1QSEB 4FC3E 4MXWH 4I9WE 1BX2A 4Z9KB 5DLML 4G5ZL 4PS8A 4UM8A 2J8UE 2NY2B 5F1KC 1DDTA 5LAXA 1JDAA 1IAOA 5EEWA 3QNZB 5I8EB 3CPLA 1BIHA 4DPAX 5HDBE 2X44D 4HPYH 4H0LC 3SQRA 3B3BA 4OFIA 1SQ2N 3MRKB 3NTCL 4ZTEA 1UH4A 1JZ6A 4UI2A 1MJ7L 4K8RH 1IM9D 2R2BB 1TZHA 2AEQL 4OJFH 4FFZH 2EXYD 4OF5A 1HCZA 4W4NA 5DRZA 1MCFA 2EVGA 1TLMA 2A99A 1FO0H 3O6MH 2MCMA 4KKLD 3MCG1 5M95B 1NL0L 1SVBA 3H53A 2AABH 1T0MB 4ZFFB 2V0AA 1A5FL 5CZXD 2F1BA 4MD5A 4BWUA 4F9LA 4F33A 1KJVB 4UAHA 4Y4FA 2H1PH 3QAZC 2CDEB 3V5KB 3KPOB 5L2KA 2J5LC 1TMQA 3L6FA 4M7ZB 5JMOC 2E6QA 4OJDH 3GK8L 4UANA 1YNTA 1NICA 4WI0A 3VI3E 3B7TA 2WQ8A 4FN0A 4CW1A 1KYUA 5D1ZC 4PRBB 1KFAH 2ALWA 3MR9A 3STBA 2XXFA 4FQXD 5D7LD 4U1IB 3OAYK 1YY8A 1R33A 1GJUA 2K8MA 3FN0L 3L4TA 3N50A 1GA2A 3LZFH 2YJQA 3LRKA 3S9DB 2OAAA 1D9KC 4LL9A 3K72A 3PIQB 3F62A 3N85L 2H0FA 4GBXA 3I50H 1W72A 3VQMA 1SXZA 4LCUA 2P45B 4PVMA 5GZNA 2AKRA 4K2UH 3SDYH 2CKNA 5ALBL 1NLDL 3MMEA 4NUGL 2AMGA 5GGTH 1VGKB 1ZK5A 3NN8B 5ITBH 4G8EB 1BVKB 5DZVA 2ERJB 3CFBB 4AY0A 2H26B 4YE0A 4WHTB 4QF1B 1FJ1B 3ZHFA 3ML9A 1I3RB 4CGTA 3ZGIA 4JO4H 2ZYRA 4Z7WE 5CN1A 3V9CA 1QRNE 3KDMA 1YPZE 4OD1L 5E0FA 2QVIA 4JY5L 5EZIH 2ROXA 2ZSWA 2L3BA 1TITA 4LHQB 2KDYA 3POHA 3ROOB 1U6AH 5CMAA 4YDZA 1UA6H 1OP9A 3U0TA 1PTZA 2WTRB 3IEAA 4XWOC 3V4LA 5C3IA 5CCJA 1A7OH 4OSUH 4EZMA 4M3JA 4QRRD 2K7QA 1Q4NX 2H4EA 1W8NA 4TF4A 3U4KA 3V52L 1F4YL 3ENEA 1DQDH 2GTQA 3UBXA 3L3JA 3K8LA 3GIVB 4WI5A 4LRIC 4BH8A 2AGJL 2PO6C 2VABA 2GUOA 5GPRA 2Z6FA 2X3BA 1PD0A 4WENB 5GRXG 1BOYA 3C9NB 4H13C 4Y16B 4NO2A 4OGYH 1ADQL 4JFZH 3ECVA 1QNIA 2J1XA 2QKIC 3QCUH 4WU5A 4AE1A 3VXRD 1P53A 1UXSA 1EMTH 4LSPH 1YZZA 4MS6A 4BH8B 4PJXB 5D1ZB 2CG9X 5CEZE 1PGRB 1KY6A 3MV8B 4AQEA 1NGQL 4OZFB 2VWEE 4F9LC 1N2RA 3QS3A 5KS9E 4CL7A 5GS0H 5LUMA 5I1KL 3L9RA 4G43B 1JTPA 2AAAA 3HG5A 4UM9A 1VFUA 1UZ6F 1ZHLA 3A6CL 3AABA 1JGDA 1U2CA 4G6FB 1Q0YL 4QYAA 5BS0B 1T3FB 2NR6C 4XBPB 4CVXB 3U1SH 3MV7D 4IU2B 5DMKA 3NIFE 1WAAE 1LO3L 5HVFB 1DP0A 1RUAH 2DM7A 5CGMA 1OLLA 5DO2D 4A7QA 1RJLA 1TTUA 2EXYC 5A6IA 4PS4H 3O6LL 2CU9A 5FHAL 3QHFL 2CO3A 3QNZA 1R3HA 1AZRA 1HCFX 2GITA 3B2PA 4M6NH 5KOMC 1NBQA 5KVMC 1IC4L 1MNNA 3VXME 4AITA 4P05A 1RULH 3DJ9A 2F19L 3ARBC 5C2BH 4R0LA 2SEBA 5F1OB 3BH8B 5B8CC 2BJMH 3MBEA 1J5OL 2CR0A 3I6LD 2VMDA 3EG9B 1NIDA 1V3MA 4W6YB 4Z7QB 2C9XA 4BYHA 1T03H 3HMXA 4X7TB 3ZE0F 1BM3L 1FF5A 2BNQB 1M71B 4FFTA 3GMQA 3UC2A 3F2LA 4IRJC 4PY7A 1VFAB 5L2KB 3DYMA 1T5WA 1YAZA 3T65B 1I9RH 3BDXA 3QUXA 4WI9A 4AV4A 4EI5B 4L1LA 5CLYA 2YA1A 1KNOA 3C5JB 1ZPUA 1FVDA 2CO7A 4JM2B 2N0KA 4OIAA 4WV1A 2BNQA 1RURH 2WTPA 4KOCA 4PCKA 2VLLA 4HZAA 4PIBA 4HCFA 1NBZB 3V7MA 1ZD6A 4I2XB 5E6IB 1GY1A 1VFMA 3AZUA 3VFNA 1KG0B 3FB8A 4W6XB 2AEWA 2R8SH 1E50A 3QK0A 5TGBA 3EYOA 4L18A 4P4RA 1TTCA 1SYSB 5I76B 4EXPX 1WFIA 3N3EA 2ENQA 4XRCA 1K6QH 4X0KA 1MCJA 4BK5C 1VADB 4OIIL 1I8KB 2FECL 4BGDA 1DBJH 1JFHA 1PEZA 2RCSH 3AS1A 2VGLM 3QCUL 3BXNA 2H0PA 3VRIA 1B0RB 1KIUB 3L8QA 4U1NA 2ZXEB 2YRPA 4K71B 3OQRA 2UY7A 4LRNH 1MREL 4AGNA 4J6RH 3N6YA 1SLVA 1FVCA 3FQ4A 3JUYA 4TQHA 4H2CA 3CVHB 1GHFH 3VFNB 3RIFK 3QORD 3TV8A 3TYGH 4ELKA 2XETA 1DUYA 3B5GA 4PV9A 3INUH 4KXAA 4BFIA 3CJJA 2ZCZA 1ZTXL 3U2SB 4JG0L 4JPWL 4OM0H 3ZMEA 5F96H 3ASWA 4J8RB 2AJSL 5B3NA 3UXFA 1F3DH 5BUAA 2PYEE 1OAJA 4PWHA 3P9MB 1WSST 1TQCB 1NGWA 4PJFB 4RIRA 4QTIL 2JJWA 3NJFA 5MEND 2GSMB 2Z9TA 3X1FA 2DJUA 2VXQL 4MJHA 1I7ZA 2VUKA 4UQ3A 2X1PA 5F7DB 5INCA 5K39B 3VWJC 3ML8A 4HOZA 3QJUB 4X5QA 1YNTB 2OTUA 4DPRA 5IFAH 2FEDC 3SDCD 3JQOB 5ANMA 1IFRA 4ZXBA 4IKIA 4JN2B 3MNVA 3VGEA 4XXWC 1AHMA 3ZSTA 3LRMA 1SJEB 3BAKA 5K9KB 2B2XL 1S2EA 5I1DB 4KK5D 3I85A 2WSDA 1H5BB 2FJHA 4NT6A 3CZGA 1BD2B 4FQIL 3HVNA 3V6FB 4ATTA 4XXCC 1IKNC 3ZQWA 3QUYD 2ZAGA 4P59L 1WC7A 4L2LA 3MMEB 3L1GA 4G6JL 4XP4H 2ICEC 4GP4B 1L3WA 2O5NA 4Y89A 4OZHA 4UT6H 2BOLA 5GJTL 5GGVY 2YPVH 3ES6B 3AT8A 4APXB 4PRIE 2W5PA 5AKRA 1MW3A 4PP1D 5E00A 2OTUB 1RZFH 4TL5A 1EAPA 1AD0A 2FNBA 4UCFA 4NUQA 3WNIA 1GGCH 3O4LA 1OLZA 3RILA 4EUPB 5DS8A 3EJCA 2NY4C 4OLWH 3S97C 4OKVB 3JWOL 4HKJB 5IF0A 2Y6SD 1HNFA 1KULA 2QJDA 4QT5A 4TULH 5F9OH 3QDGB 3VFSA 1T1ZB 1UADC 4JO2H 2HSIA 3IE9A 3F7QA 4MAYD 3UTZA 3ZDYB 5F8QC 3O11A 5J5EA 4MXQC 2WLYA 1OHZA 4AX3A 3O9WA 4PW3A 4Y5YA 3CSGA 5BO1L 1J1XH 4LASL 2ENPA 2VSDA 3U2SA 1WYJA 2VR7A 2BSSA 3O8XA 3V6ZB 1SDYA 4L0PB 5EULV 4AYMC 1E7VA 2XX0A 2WLKA 4OLVH 4YDKL 1MJUL 5E4OA 2IQ9L 8FABA 3S4SB 1FH2A 2O30A 1BVZA 2Q0ZX 5CZRA 4Y7OC 3DO3A 2QGDA 3G5YB 1N68A 4RAVB 2DH3A 2C3WA 1GC1C 1LO5A 1UB6B 2NY1B 3KL3A 5ALCH 1KTKE 5EPMB 3RTQD 5IOPB 4OUUA 4CU6A 5BPPA 2NY5L 1T7XA 3PWJB 3TURA 1KLGA 1OTUD 4KUCD 1OP5K 4URTB 2AK4B 3L4CA 2AXGA 3WU1A 3UTZB 1LYQA 4JPIB 4ZXBB 1Z5LB 4XNUL 2P52A 3NJHA 4A37A 1LO2H 4NO3A 3WUWB 3PWPD 2N4IA 3Q9PA 1MZYA 3C6EA 4WY7H 4JRXA 3RAJH 1PSKH 3LS5L 5HBBA 4AYEC 4OW6A 3X1EA 5IZ7A 2FWSA 3ZE1F 3ALPA 1CMOA 3V8OA 1QR1B 3PNWB 5E94B 1H5BC 3F3HA 4A7GF 4K9EC 1CL7H 4OZFH 4LIQE 4KKNA 3WV0A 1EVUA 4PV8A 2H6PB 4U1JA 4LBAA 2A77H 4P2YA 5E51A 4ZT1A 5G5DA 4ECNA 3VXSA 1DYZA 3OX8A 3T1FA 1EAOA 3TEXA 4N8VG 2V2TB 1T6WA 5ADPL 3SCMA 2CBPA 5FO8B 1BZ9B 2H8PB 3JWDH 43C9A 1LDPL 3TONA 4IK6A 2LLNA 1MJ8L 3L5XH 1EEYA 5EBWA 3V8CA 3DPDA 4BZ1A 3BAWA 1TYEB 1MCOH 2DQTH 2IFFL 3NP4A 4UOQA 5AZ2L 3ULUF 2Z92B 3WIAA 4CVZB 4MDIB 1SVZA 2A83B 1BMGA 3IDIA 3ARFD 2OMXA 3FCGA 3OAUL 2NZIA 3VXOA 1JIBA 5DA4A 5FFLA 3VE0B 3II1A 5K59E 1U8MB 1INDL 4FNUA 2HRPL 4YDJA 4XN2A 3MGTA 2Y22A 3AG1B 1AZNA 1M7UA 4M48L 4Q2ZA 1HXKA 2ZCLL 4JCWA 4WUUD 4RESB 1OF0A 2DQUH 1A7NH 2I7SA 2DBJA 4G8GD 4F93B 4FG0A 3NRQA 5CD5D 1R5VA 3EBGA 3FQTA 3GLZA 3RDTA 1MCPL 5DEGB 1OD7A 4AIZA 1MFCH 1UZ8A 1PDKB 2VLKD 4AL8H 5IJVB 2NMSA 4EVNB 3LOWA 4LLWB 6FABH 4QRQA 3EJZC 5C0JA 1F13A 1WITA 2W92A 4JM2D 4WWID 3DO4A 3GIZH 3L7EA 1OCWH 4GKLA 4FTDA 1SLWA 3TJEL 1QG3A 4IBZA 3EDFA 3ISYA 3MNMA 3U48A 3UZVB 3X13B 1BAWA 1YEEH 2CGYA 5FCSH 3TNMB 2A0LC 5D1XE 5B1AB 1QATA 4Y5VC 5JTWA 4IKJA 3IMRA 5LAPA 2MIZA 1QPXA 3DX8B 3LNGA 5KN5B 2QR0A 2WXLA 3CVHA 3HC3H 4KXBA 4N25A 3OD3A 5HVGB 2X0WA 2MCPH 4DZBA 3K46A 4P06A 3CC5A 3QGVA 1DJXA 2XYCA 5AW7B 3HE7D 4ES8A 3MO1A 3WJJC 1PIFA 4IBVA 4IRZL 4Z3FA 3SKOB 2JWYA 1MCLA 1PY9A 3NJJA 4MCMA 4D0CB 5KW9H 2I9TA 1G9NC 1S7QA 3AY4C 1N5YL 1F8TL 3QYNA 3VCLB 3GMPB 3L17A 3FU8A 4KI5D 4K8RL 2PTVA 3EH2A 2Z8WC 1S7UA 2DMHA 2VDML 4HIJA 2BNRA 1DQJB 1IE5A 2XWJA 3KW7A 1G6RH 1YEJH 3HFMH 1BXUA 4FXKA 3P2TA 1XD1A 2MMXA 2DQCH 4LPCA 1JXDA 2VDRB 1X5YA 4IRJB 4ODWB 2F61A 3M1CA 2YRBA 1OGAA 5E5RB 4JG9A 1PZBA 2ZKHL 4XCNB 3RVVD 2OZNA 4B9YA 1GW6A 3C8DA 2A9NH 4BDVA 1JXKA 3NCXA 5D2LE 4HUWA 2YZ8A 1SEQH 4Y8DC 3VFVA 3WY2A 4CADB 5B8CB 3AU0A 4YHNB 3WL9A 3GZPA 4Z23A 4G8GE 1UKQA 1TSHA 5I75C 2OCCB 3DVGB 4JO1L 5DUML 2QHRH 3KGTA 3WIFA 2D8KA 5TFSL 3AMKA 3VG9B 1W0WB 4L8BA 1QUNB 3GI8H 5FECB 4G1MA 4M4RB 5AOKA 4FADA 2HJFA 2O6PA 3PNWA 4PJ5E 3KCPA 3ZRCC 2DDQL 1Z9NA 1N5AA 4JRYE 3D5OF 2BZCA 1NEZA 1XSIA 5EOQL 1G6VK 5FA4A 3DBSA 3RDTB 4YO0B 2FZ3B 3L6FB 5AALA 5HDOA 1FCGA 1IC7H 5F70A 4WO4A 3IGUA 2KLTA 3MSPA 1ZRUA 4C56D 2BDNL 5EN2B 1KXQE 1QFUH 1EZUA 4IKNA 3ZMNA 4Z7WF 1MN4A 3SE3C 1BAGA 1WD9A 2XWBB 1RUQL 5EORH 4U6TA 4Z7QE 4WQOA 3QUYC 1CBJA 2EP6A 5MEOA 3RZCA 3GRWL 5IVNA 1NL0H 4X5XB 3U0WH 4EQ3A 1HHKB 4ORGA 4CVZA 3BVTA 1Q72L 3OJMB 3ZQ9A 4CN1A 4EIUA 1J9QA 2VDOB 2KLRA 2ZD0A 3LKRA 3MRGA 4YXLH 3RURA 2NRDA 4LCWD 5BRZE 3MROA 1U8OB 5JXED 3QG6B 2JLPA 1IT9H 2PXYD 3VI4A 1KFGA 4KY1H 3KWUA 5EU4A 2O6FA 4KWUA 4WUUA 1WFNA 4XWOD 4EI6B 3E2HB 3E8VA 2VIRA 4MWFA 1EHXA 3LN5B 3ORJA 1THAA 2X7LA 1G7IA 4MAYC 4M61B 2VH5L 3VWKA 4HH9A 2J2ZB 4PG2A 3BISA 3RIKA 1KWKA 2GK2A 2QFRA 1K72A 4TNGA 3MZGB 4U0RC 1FSKB 5BZXA 1H3TA 4HT1H 2JKLA 1PD1A 5BVJA 2OR9H 1G7IB 3F12A 4RNRB 3S5ZA 5IWLA 1E90A 3MREB 1M05A 3LEYH 4JKNA 5I23A 3U1SL 4AH2A 4AKOA 4OQTH 2WVVB 5JHLL 1X9UA 1OCRB 5HPOA 3W82A 5CIPA 3QG6A 3HMXL 4LCIH 2PTTB 4XXCA 3V7AE 2WVTA 3KPLB 1ZIBA 3BIKB 4RMWA 1TENA 2IPTL 3Q3GA 4XVTH 1YN6A 5E8EB 4E68A 1JF1A 1CXIA 2R0KL 2DLFL 2YFOA 4BKLA 4V11A 2X4RA 4HH9B 5JIPA 1A1OB 1WA1X 4TKWA 5GGRA 3QIUD 3MX0B 3NABH 1OANA 3WDIA 5SV4A 2IGFH 4HUXA 2DBLL 3C5SA 4KJQD 4OQTA 1RHHA 4GXUM 4EKXA 4OLEA 4KHXH 3E3QE 2CIIA 2JTYA 4MNQB 3VD0A 2X10A 1KCWA 5HVHB 2X2UA 3QEHA 4PP2A 1TQTA 1HL4A 4JUSA 2IWKA 3SE9L 1ZE3H 2K6WA 1A7OL 4IHBA 4PJ5A 4PVBA 4OTXL 4GG8A 4WCYH 2QZQA 3MODH 5DDHB 4ZAKA 4HD5A 4R90H 5F7EH 4NCC2 3VTAA 1U8CB 1F58L 4U1KA 3KPQB 5IT2H 3RB7A 2P24B 5HYSG 4KHXL 2NNXA 3GSOB 3H2QA 2VO5A 3O2WL 2E75C 3O41B 4XAKD 5IKCA 4I1PA 4YR6B 3HC4H 2HFEB 4YZWA 1PY4A 2XNAA 3BSGA 4ZMNA 1DANT 5D1XB 4O2EB 5JHDA 4NCC1 2ZIDA 2VXTH 5LWYH 3MROB 4UOZA 3D85A 3OG4B 2XOTA 1FZKB 2EO9A 3IJ7A 3POCA 1YQ2A 4PWFA 3M1BB 2I26N 4FA8A 3BN9D 4MYPA 4P4RB 4YHIB 4KJWD 2P3YA 4YDKH 4ZBJA 2IAAC 3WY3A 3SE4A 3IE4A 4FD0A 1CDYA 3A47A 4HAKA 4MHHI 1Y18A 3TVMC 1OAQH 1IILE 2YKKA 3B6SB 4XP9L 4Z7NE 4BFEA 1NEUA 1YYCA 3SPIA 2BIHA 4WO0A 1KB5L 4BCYA 4J4PD 5GZOA 3FUDA 3SQBB 1QTYT 3BE1H 2ICWA 4WSGA 4C8XA 2FIKB 5HHQB 2DQJL 1CGUA 3GT6A 3KHOA 2EAEA 4PY7B 3CHSA 2K6ZA 3SOBL 3W9EB 3IRZA 1PAMA 4IDJH 1O0VA 3QUXC 1U8HB 3ZUNC 1RZFL 2BFGA 5AW4B 1YDPA 3GM0A 3KAAA 2V7HA 4ZMXA 1UVQA 5AVRB 2BS71 3CFDA 4MZ2A 4QRTB 1TKWA 4FFYL 3FQNA 5EWIL 1WBXA 2FX9L 5C0AA 4F27A 3NIGE 3OGCA 2N7AA 3EGDA 5DJCB 2VDLL 1SXAA 2P9RA 3RRQA 3EOTL 4L48A 3KCWA 3ARSA 1KTDB 2XCMC 5ITFB 5T1KA 3DRQB 2EDHA 3QULB 2BVYA 4MBRA 4DVRL 2KPWA 4C4KO 3ABGA 5IW6B 2OPCA 4N8CL 3T3ME 3SDDC 1T0OA 3V5HB 5HPMA 2YEQA 5IQ9B 2ISDA 4XZ4A 4CVXA 5CD5C 4G5AA 1QRKA 5CBEA 4WNQB 3DBXA 1NOLA 4WU7A 4N90D 1CURA 5DVPA 3SE8L 1T7WA 1KYAA 1KZYA 1DBBL 2IPKB 3D0LA 4UINH 3FFCB 2FL5A 4KKQA 4OZ4A 4OZFG 4YUEH 4Z7UE 1K8DA 4OZIF 4LSVL 5GRUL 2HKHH 3OKEA 4RX4A 3RGBA 1QHPA 4WTZA 1KB9J 4DK6A 4LVOC 4I18A 2LU4A 2DQHL 3A5VA 3JTBA 4YHLL 1OCCB 4DEUA 2MNUA 2P1YA 3MOBH 1A7PH 4WTZG 4JY4B 5EOTA 3WKQA 1KOAA 3MYJA 4NC1E 4OR1A 1XZ0A 2HKFL 4MD0A 3ZE2F 3ZYOA 3U9UB 2DQDL 3TIDB 1AKJD 3VH8A 4XBEH 4S11A 4Y2DD 1RULL 5AKTA 2F54D 4PTTB 2WXMA 2CLZB 2YUWA 1VGKA 3NA4A 1IU1A 2CGRL 4DAGL 4JDTL 1FNGA 5DVLA 4R7LA 2E27H 4PJCA 5J3HD 4ENED 3ARPA 4AMXA 4KK9D 2JELL 3NFPB 4FI8A 2C1OB 3NEOA 4QRRE 1AP2B 3LS4H 3T9WA 1VGEH 2QV4A 1I8MA 1ILSA 1BEYL 3MV8E 4U1SB 1T7YA 2Z7ZA 3O45A 2IPKA 2A77L 2ZG2A 3HHRB 3JYBA 3S5YA 2AJ3B 4MS8D 2I85A 4AXWB 5AVYB 1UWGH 2EEBA 1XEUA 4ZUVB 3QXUA 4QO1B 3JTSA 1XGRA 3S3JA 4U6VH 2HG5B 2X1XR 1U8HA 1M1XB 1UD8A 4IMKA 3ROLA 1RVFH 4MQXC 3KLLA 5F89A 4DIXA 1JBJA 1CXKA 2CMRL 1AI1L 1FG2B 3DXAD 2MPVA 4AUUA 1WBYB 1CGYA 1Z1WA 4WWOA 1INEL 8FABB 1FRGH 4X8JB 5EU5B 3EAKA 2BVPA 1NQBA 3F00A 3QUZC 4GMTL 4TNVK 2ZNXA 4G7YL 3IWUA 4HBQA 2R56L 2XC8A 3LZRA 5DQ9B 1WBYA 4D9QE 3GLAA 2RACA 5TGBB 4G6MH 2X4SA 5D4JA 3TBVB 5DCCA 4E9TA 1OF2A 1ZLDA 1IKFH 1U92B 2MFNA 4GP5B 1RIUL 1IAIM 1NJ9B 2OYMA 2B4CH 3HAEB 4U6YB 4Z0XA 4B6ZA 4GRWE 3ZTDC 1R75A 1HHIA 2CO7B 4JM2A 2XV6B 5E24E 1RZGB 4BSVA 2GJ6A 5EUOE 4N26A 3JXAA 3KNBB 5IQLA 2GYSA 4RMUA 3SQOH 3VFTA 3J07A 3BQUB 1NIEA 4PJ9A 1HNGA 2XIIA 3LTVA 1UASA 3K91A 3CDZB 4L4VB 1SLXA 3FFOA 4D7BA 5GGTA 4HOWA 3ES6A 5JYLA 1L9OA 3BAEL 2R1WB 2APXA 3A4FA 2AEIT 2FWOA 4Y9GA 4N0YH 3CN3A 1V10A 3QJXA 1ZLUH 1G1CA 3LN4A 5EBLA 2EADA 2D9QB 3DGCR 3VXTA 4AVIA 4EI5D 2E7LA 1VCAA 2CUMA 1UXWA 3L3OC 3QT2A 2CKBH 1OF2B 3FUNA 3TS8A 1CQKA 4XI5D 1GZPB 1S7XA 2DMBA 3IU3A 3RFZA 2BM3A 1CJYA 3M88A 2H2SD 3T0VA 4YHYC 4KITB 1B4JL 2YWYA 5DTFB 1KGYE 2D0HA 5HYEA 3T0BA 1E4KC 1WZAA 1YEKL 4GRLA 4JAMB 3PAZA 1QPPA 3S96A 3ARRA 3F58L 4I13B 3IDIB 2JLLA 4ZTOH 1WUZA 3E1ZA 1T20B 2IQAB 5E8PB 4V2BA 3EDKA 3JWDL 4ZSOA 3IGLA 4MQTB 2DLTA 1KYFA 4LSUL 1BREA 4D94A 1A6PA 4QRPA 3QHZH 3NJKA 3WDJA 2A9ML 1CLZL 2EIMB 4FZEH 4L4JA 3WIHH 1KGWA 3L3KB 4QWWD 2Z7UA 4YHKL 2VRAA 3L54A 5T5FH 3FO2A 2X38A 2CO4A 2UUDK 3C09C 1BIIA 2WXPA 3FQUA 3FT4A 2BOBA 2GIXA 4G71B 4JFWA 4KAQL 2E9IA 4JHWH 3KBFA 3U36B 2J6WA 2WK2A 1QSEE 3GSNA 2PW1A 1KJ2H 2HX8A 3V10A 4XE5B 1X5HA 3MRPB 1CFQA 4PUBL 4HBCL 2RMNA 4UUJA 1DBMH 4K9EL 5IK3A 1E28A 2VN7A 2WNWA 1NAKL 2PWDA 4JB9H 4JFHE 1MI5A 1HINH 2YRLA 1TJHH 1HE7A 5T1MA 3QO0B 4DPCX 4ZTOL 5SWSD 1SJEA 2JI3A 2YHGA 3SYPA 1HOEA 1KGXA 3O6KH 4DN3L 1UB5B 4P3WA 2OK0H 1QI4A 4WFGD 3NJMA 2XZAL 4HKBA 5IHLB 5DD1H 1A7PL 3IRCA 4FDWA 3LRGA 5C86A 5C3TA 4A7UA 4PD4J 4KNSA 3NJLA 4GT0A 1XB6A 2DLHA 1KBKA 3ARZA 2EDEA 2JIXB 4G8IB 4DGVL 2NNRA 3L5JA 3PHOB 2HG0A 1XD0A 5ADPH 5FYLH 1N64L 5JZ7C 4DAGH 3T0ED 3FDWA 5E8DL 1B0RA 1KIUA 2WN3A 2D9CA 3BLBA 2LHAA 4Z1PA 3OMZA 2J8UA 2V7NA 1LP9F 5I1EL 3L3IB 3QIWC 1UJ3B 2VZTA 3GBEA 5JOFB 1IGJA 4GO8A 2EDLA 4OI9A 4X42A 3EZ8A 1S7XB 1DR9A 2WLJA 4Y4FD 5H37H 3QQ9D 5F7DA 4BFIB 4Q9BA 2R29H 1A1NA 3DTDA 4WW2A 3SKJH 1UM6H 1MW2A 1P84J 2FX7H 3V0EA 4KK8D 3LKRB 4CRPA 4YHNA 1S5IL 1JZ8A 1HHIB 2XN9E 1AI1H 2W65B 3EGXA 1GC1L 1T5XA 2VE6A 1SFDA 4GOSA 3FQTB 4ONGH 4B9KC 1A66A 1ZV9A 1CG9B 1I7UB 3ZDYF 2E8ZA 1DO6A 3K3QA 4M02A 1P5UB 3ECBB 3DSFH 1YA5A 4PG9B 2LW3A 4OGZA 5CS7A 1OE2A 2EXWC 1ZLWH 1QPKA 1URIA 1QBML 3II3A 1AHKA 5DEZA 2R1YA 4H20L 2UY6A 3VFPA 2HRGA 3BZ4A 1AXSA 3L3IA 3MJGX 4UBDC 3FUKA 3ARWA 1E4XL 1ZDSA 5I6XB 5DVOA 1ZJAA 3I6GA 2AZUA 3KL0A 3LDBC 1XCXA 3LHPL 3ZU8A 1WPCA 4E41A 2F5AL 5EO9A 3HMXH 1J8HB 5KBLA 2XWEA 1T03L 3TBWB 5GGVH 5AW1B 2JKSA 3VFUA 3LPPA 4MFHA 4B27A 4NXKA 3R1GL 3ARDC 4NZRL 4K07A 1U8PA 5I66A 3GMOA 5EIQA 4Q6YA 3LRHA 1I7TB 2R9HC 3Q06A 4Q6KA 5IBUG 4Y4HD 5EDSA 3X1BA 2YJLA 3OMAB 3KVDD 3EH5B 2X1OA 4FEMA 5HGBB 1YPZA 2FGWH 5IW1B 3GLEA 5TDPA 4G1MB 4M4RA 4H26B 2DKSA 2BHZA 5C0EB 3MRNB 3BWSA 1MI5E 3LN5A 5DJ6B 2HMIC 4X98B 3RWJB 4NCDA 3W81A 3W37A 3LHPH 4HFWB 4MJ4A 3IFNL 3PQYD 4ZOEA 1RFDH 1IM3B 2Q86A 4E42A 1OK8A 2NXZD 3QRGH 1JL8A 3HS8A 2KZWA 3Q0HA 2V3FA 2VSKB 3MLWL 5CGYC 2J3SA 3OZLA 3BGFC 2MH4A 3MBWA 4LL4A 1MUJA 1ZT1B 1NIAA 3HG2A 4FHBD 3RNKB 2BNRD 2WHVA 2W0KA 5C0GB 4XPBH 4FTVD 5DRZB 2PCFA 3DSNA 4YFEA 3D18B 5CJBA 1DBKH 3V0GA 1QLFB 5T5FL 2IOIA 1SJMA 5IW3A 3L3JB 3MBWB 2ZUSA 1KZQA 2PTTA 2QR0B 4WFFE 1FFOA 4L2YA 3QG7L 1ZT7A 4PRPE 5B39A 5D72H 3LMJH 1S4IA 4LHJB 3CHPA 2BERA 2PWEA 4F8NA 2EXTA 2FIRT 3AUVA 5BV7L 3NSDA 3EBAA 1F02I 1A3LL 1JK9B 1O7DC 3CSYA 2Z31B 4LSRL 4PSRA 2J73A 1B4RA 3OR6B 5C0DB 3T2NL 1N59B 4ADGA 3D3VE 1JNLL 5G2NA 2BP8A 4TUJA 4HKXA 2VABB 3QDJA 2EC9U 3DX8A 4LCCC 5EC2B 2H9GA 2XQ0A 4OI7A 3ZDYE 1OWRM 3SDAB 4FFYA 2YGNA 4AV5A 1A0QL 5KYWA 3W39A 4RWYH 3OZ9L 4IJ3C 2DMKA 2CHWA 1GSKA 3O6LH 4K15A 3U79A 4QLWA 2H6PA 4U1JB 4J1UA 4JY5H 1HH9B 2OMXB 3QDMA 3VXOB 2G2PA 4FF9A 3EJSA 4M6MH 3OB8A 2DQFA 4HDIB 5C2BL 5HYJA 2C8NA 1FJ1A 4GQPH 4TSAH 2N1TE 3T0EB 2NY0C 1PYWB 5FFGA 5IB5B 4MNQE 4NKDB 3WXVL 2D7NA 2CDEA 1TZGH 1SBSH 3VFOB 3ATDA 4AVJA 4G83A 2I60H 3FO9A 5IMMA 2FR4A 2XN0A 3TF4A 2YMXH 3M46A 1J8RA 2XWBA 2N01B 3MRQB 4JUTA 1NC2A 2YA2A 1MCSA 1NAML 4FFWC 5DMGC 5LBSA 3ZE2B 5IB5A 4WDIA 1E9QB 3HI5H 1QO3A 4C4KT 4KJWC 1SDDB 4B9IA 3VXSD 3EUUA 3R06A 1EZLA 3S35L 2AK4D 4WJKB 5BZWB 1CF8H 4W9EC 4F7TA 4DO6A 4RFOH 4R4BA 2OMZB 2DEWX 4U6XB 2YLKA 2ZCKH 3IXTB 1EZVY 5F7WC 3G9AB 2GHZA 1ET8A 2DTML 4GG8B 1IGTA 1TTFA 2P5WA 5D1XC 2CJTA 3IMBA 1C5BH 2HJFB 5H8DA 3UC0H 1N9PA 2WBJD 2AJVL 3QWOA 4W9ZA 4W9JC 3V6BR 1U93B 3O6FD 1AY1L 4X6CE 5EU4B 2H41A 2B7DT 2VC2L 5EWIH 3O41A 3IVKA 4Z7OF 3LNIA 2IGFL 1LD9B 1YJDC 1RURL 2J71A 3CN2A 5DEFA 1W0VA 3HBPA 1EFXA 1WWBX 2XKUA 4PJ5B 3TT3L 1NLDH 3BHBA 5KTEH 3V5KA 1A1NB 5SWSA 3QPXL 4KVCH 4J3SA 1AXTH 2XTJD 1YSOA 3L5HA 3MLSH 1D5ZB 3IS1X 5I5JA 2NPLX 1I1RA 1CFNB 1DN0B 2O26U 2P8MB 2NUTB 5JIMA 4OF6A 3VD7A 1GZQB 3FRUB 4AYFB 4GBXD 4KKCC 1WZMA 3QJTB 4L4TB 2GBAA 4OLUL 4HS8H 3QCVH 3W5NA 1Q9OA 1MCNA 5GRUH 2ZUTA 1A6UH 4W6WB 1A6VL 2R1XA 3K8MA 3IMTA 2FUTA 5E4EC 1HU8A 3FBQA 4F58H 4DESA 2ODIA 2CBQA 2GJ6D 2X7LB 3QEQA 4Y9FA 3S7GA 3U0WL 3VG0L 3BPNC 5JA9A 3OLDA 4JFEB 4ZOBA 1A7QL 4I85A 1KJMB 3QPQC 4KOBA 2H3NB 1LE9A 4ZW7A 3DO7A 4YSPA 2OJ1A 2Q76A 5DYOB 4WJ5B 4J2XA 3ATAA 2VDKH 1WJ3A 4JRYB 1I53A 2ADFH 2YBRA 1NDGA 3UMTA 1X9RA 3IDJB 4KK9C 3P4OA 4GRWB 4K9EH 3VD3A 4LBEA 1HNYA 1K2DA 2EC9T 2VLJD 5IEKA 1KGUA 5JPMC 5BRZA 2XXGA 2ZCHL 1CD9B 2QEJA 1SXSA 4IYKA 4UTAA 3H4HA 4YBHA 3T3PE 3MRRA 4PRIA 3MLZL 3KLSA 4Y4HA 1XGYH 3MUGA 1QLRA 2C9UA 3PPSA 4Z7AA 3ZZQA 1JI1A 1NANH 3FFCA 5EPMA 4F7MA 3KJ6L 3OG6B 3X3GH 1WCBB 1AGCB 2YN3A 3P77B 1KPUA 1ORSB 2QHLA 1EGJL 3FHEA 2ZG1A 3RI5K 2ZPKH 4DGVH 1KYOJ 5CCGE 5D70L 2VDLB 2IH1B 1EO7A 2BVUA 2KKQA 3QAZB 4U1GB 2FBOJ 1IKNA 4PCTA 4PRHE 4XVUD 3O2DL 4K9JA 1ORQA 5IB3A 4XNBA 5CN3A 2MHAA 4BQ8A 4HKZA 2ZQKA 3SO5A 5DGQA 3T77B 4H5SB 1L9PA 4GS7B 4R4FL 5SWSB 1FVDB 5DJYB 2VERN 5TQ2L 3DROA 1ROCA 1FGNL 4FHJA 5DURB 4OCWL 2EE2A 2NY4B 1KPVA 3Q6FB 1TJMA 2WJ5A 1E4KA 3JVGC 1MFEL 1RZGA 2B14A 2F7OA 4QHMB 1AE6L 4BSVB 3IXTA 4DN4L 1MCHA 1WIUA 5IHUL 1HZHH 4K5OA 1Y0LB 3UBXI 2G60L 5CHNA 2FO4B 4NHUB 4HIPA 4BQBA 5AZ2H 4OKDA 4LGRB 5DT1H 4NQED 2HJLB 2GSIA 1ED3A 1I1YA 3H9YA 3KWVA 2A6IA 2XN9D 1N6QH 1T7ZA 1ZSDA 5FM4A 2AVGA 3ARGC 1M2OA 1UKTA 1CIDA 2YAHA 2H32A 4HAFA 3TH3T 2BY1A 4N6RA 3TNNA 2FUQA 1M71A 4BZ2H 3HBZA 43CAA 1KBWA 3SDDA 3IM1A 3JZYA 5F6IB 1XF1A 4WF7A 2WBXA 2PR4L 1SUHA 4G9FA 1EAQA 3PY9A 1R47A 1RIHL 5H37G 3UX9B 1N8OE 1Q9WA 4JY6B 3W0WB 4DSYA 1A1MA 4P2RE 3OMIB 3OHXC 4EMZA 2IDTA 4QRRA 2NXYD 2ADIB 2W80C 5D2NA 3CFUA 4PB9H 5E5LA 3UABA 3F7VA 4G5ZH 5E2WL 3CDGB 2WQWA 5KSBE 2H2PD 2MQ3A 1RK0A 1OARL 5EO1A 4I5BB 5F1IA 3FO0H 5IHUH 1CDIA 5ENWB 2XQBH 3RWEB 2PR4H 3LNDA 5K33A 3A67H 2GSIB 4L1DA 2OMBA 3TO4D 2FK9A 2Q10A 2D03H 4Y1AA 1B0GB 1HZLA 4X7EC 3HS0B 1R5WB 3N43B 4BFRA 5IMOB 3KPRA 4HK3N 1ASQA 4Q9CA 1GMEA 5B1JC 1FL6A 4PWJA 3NJXA 3BH9B 3OPZL 4LCCB 3HE6B 1KCVH 4XNXH 3KPSD 4GAJH 3U36A 3T71A 1FL3B 2H3NA 2P28B 3HS0A 2DKMA 4JX0A 1FV1B 2PYFA 3TESA 2XACC 5IGXH 3BQUD 3NK3A 4IDJL 4JQVC 2WXHA 3DX1A 2E56A 4YFLF 4CMMA 4MJIA 3N06B 4KTEH 3B3IA 1OD9A 2BNQE 2UYLA 3HN5A 3MGAA 2X2IA 3FH7A 3QCVL 2ZXQA 1BF2A 1VCBC 4G8AC 3UPAA 5ISZE 2WINA 4KZDL 3VH8B 2J12B 1LWJA 5IEHB 5A43C 1L7TL 2XPZA 2WBWB 4XNXL 1LEIA 3DV4A 4U6HB 2D7OA 2YAEA 3FU7A 2W95A 3H9SB 3IXAB 4WTWA 4PBDA 5AYUL 4CMHB 1TJGH 4HUUA 3H3BC 4I0PC 2NTFA 3ZSSA 5EBWB 4JHZA 2KYIA 1TG8A 1YEDB 1CGVA 4Q8BA 3MV7A 3WE6A 2WP3T 5K9KA 3L3DB 3HC2A 3B2VH 3APDA 1Z2KA 1JV2B 3QG7H 1GZPA 4HCRL 25C8L 3C6LA 2EUXA 1NGXB 2QLVB 5DJZB 3N40P 4QTFA 1DQVA 2PYFB 3GD1C 2N3JA 4HZLB 2EKSA 1WA2X 3OGCB 2W81C 4L23A 3TF7C 1PNCA 2V3DA 3L9BA 3P40A 4JG5A 1MIEL 5E5UB 3SGEH 3OVUB 3EXLA 3BH4A 1GYUA 1MG3C 4KI1A 4TRPL 2DICA 1QBAA 1QR1A 4JY6A 3BI9X 1HKFA 4UIKH 5E6SB 1UCTA 3EO9L 4PI2A 5DRWB 4L8BB 5AW3B 5JYMA 4HLZG 1AD0B 4QHPA 3RPKA 3SO3B 3VMOA 1XF4A 3V4VL 3PPEA 5CJXC 2OMTA 1MLCA 1EANA 4PJ9B 4GAAA 1WH0A 1GAFL 4Y9CA 2BWIA 5DQDH 1QVOA 3RY6C 4H8UA 5HJ3B 5JOPD 2ITCB 4WHYH 2BVEA 1F1DA 3PDOB 4GKZB 3ZJAA 4NRZB 4CDHA 3ZDZB 3WY4A 3QCTL 4IW4C 4H26A 1DZBA 1CFMA 3ARGD 3P0GB 2A7BA 1BJMA 2D0GA 2J5WA 5KVGL 1M9SA 3TBYA 5GJSL 1A6WL 2E0PA 1N4XL 4QAMB 3B9DA 4S1DC 1J0JA 3QUMH 4MA7L 4X5XA 4XOAA 3DGDA 3K2UL 3LRSA 4NO0A 5FC9A 5B21A 2M83A 4YLCA 5HI5C 15C8H 3WJLC 1FGVL 1M56B 5IB1A 3BEVB 3DURA 2K4WA 2WQAA 3QZPA 4HWBL 2PCPA 2V2XB 2XWTB 3HB3D 3S5LG 4UM8B 4P23B 4ZS6C 4DN3H 1JWMB 1IAMA 2YUZA 4FNLH 3VD2A 3K4AA 2PKDA 4JZJC 3AACA 2FRGP 1DEEB 4F2MB 4PVNA 4U0QB 4DP5X 4N4YB 4F7MB 1H8OA 2ZCKL 4DKFH 1GGCL 4R7DB 1VFOA 5JXEA 2CR6A 1DBAH 1ROWA 5I8KL 1QAWA 1ZHNA 2APFA 2VXTL 4WI6A 5IUSA 5KVGH 5KW9L 1FZMA 3IJYA 4HIHB 5D1QC 1JTTA 2LR4A 4G1EB 4PG9A 1MFAL 5FXCH 4ACTA 4BUHA 1RZ7L 2ESVD 1CXHA 2VC2H 4RAUA 1BF8A 3O4LE 3CFKA 4I4WA 1OV8A 3BH9A 5LCVH 3VXUA 2XZQH 5E8NA 3RLSA 1UC6A 1T7VA 3D39E 3IDUA 4FQJH 3MRIA 3G6DL 3EYUH 3VRJB 3UBXB 2IH8A 2X4SB 4DETA 5LXGL 4Q2ZB 3HUJF 3S0PA 4CC4C 5FYKD 4A2LA 4F92B 3PU7A 3RY5A 2VUOA 1PZAA 5I1CH 1DBKL 1W72L 3NJVA 1MIEH 4PW9A 3SGJC 2PMZA 3QJZA 1JGUL 1R9FA 1U8PB 3V2AR 2VW7A 3W9DA 3JWNC 1CIUA 4DVBA 2FSEB 5CGYD 4MDIA 3NZHH 4NQSB 5E5MB 5FK9B 1DBAL 1RH8A 2PW2B 1IGML 1WEJL 3QZOA 1MI5B 3W56A 1MNUL 5HDBF 1LMKA 4M62L 1C16B 1RERA 3US1A 4LNVA 2A6DB 4WW2F 1QRNA 2XBDA 4NQEA 3BUTA 5KSVA 1I1CA 3L4ZA 4FQQA 4WEEA 5CD3A 1BZ9A 2H8PA 4FYSA 3E6FA 5F7LB 1KIRA 1KACB 2ZWYA 1EZSA 5I9QC 3WLBA 3V0IA 2GABA 2Y6SC 5E6UB 5EF1A 3ULVD 1UOLA 2Y3NA 3Q2NA 1XGPB 1I3VA 3WKNA 3NMEA 5KN5A 4WKXA 4GBXC 12E8H 3TIEB 3F12B 4RNRA 1ZDQA 4DEPB 4HJGB 3X3FL 2JXMB 3VQLA 3CFQA 1FNSL 4ZMZA 1GH7A 2NY2D 3QQDB 5DRWA 5DEJA 2ED9A 3A0OA 1NMAH 1ZE3C 1MREH 4N2EA 1ZHKB 3RKDD 3FMGL 4JHVA 4M61A 4OJCA 5EZJA 5I8CB 1BD2E 1E9PB 2JH2A 5JOEA 1UWXK 3GXMA 2AV7A 2DQ6A 3VRLE 4PJDF 3KHQA 3TN0A 4NENA 1GS8A 2NNAA 3FH5A 3NFNB 5E4IA 4H44C 1WCQA 1FFOB 1J9CT 3A6OA 1TVBB 2WO3B 3UOAB 3WNPA 2HVKA 4ZTPL 3F6JA 2VRQA 4LLDB 1S3KH 1UATA 2VLMD 5C08E 2AZAA 1AFVH 3IJ9A 3K4ZA 4TVPE 4AT6B 2R8SL 4IGBB 1ZGLP 2BX5A 1A3RL 1ULVA 4KMLB 1EMTL 3EJYD 3L3GA 3GXIA 1DLHB 2DKUA 1FYHB 1B2WH 2WINB 4XN5A 4N0UE 4W9DC 1CFNA 4DKTA 5E6IA 4FFYH 4B96A 2X4PA 4XO3A 4QUOA 1UA3A 2KQNA 2K6YA 3GDCA 4LKCA 1IAOB 1QUNA 1JGEB 3NACL 4QKTA 5IVXB 3EIFA 4NQDB 3VA2C 4MMXA 4O5LL 2K78A 3K5RA 1RZJC 2IJ0C 1U2YA 3VXSB 5CO1A 2Y4SA 1SOKA 2Q8BH 3N1QC 2XZCH 1IGTB 4J3VA 2JKWA 4X9GA 4LXFA 3C87A 3CBKB 3LKPA 3I02B 3HZMA 3Q5OA 3ZDXB 2XBTA 4NX0A 4C83A 1GCYA 1J1PH 2CJ3A 3S3DB 4AQ8A 1CLYL 1W8OA 1NIBA 5E99L 3ULVL 3BZEA 3IPBA 4PJGE 3U9PH 1JYWA 3CAFA 5BV7B 3KLHC 2Z34A 4KJPC 1ZKAA 5BOZG 2DM2A 4G8GB 4JPWH 4ETQA 1GYCA 5E1AB 4HULB 3O6FC 4JGNA 2V6HA 5AAMC 1UZGA 3CQQA 3K80A 3KXFE 1SDAB 1DQLL 3VDCA 1A0QH 3LKOB 5MEPB 3I9AA 5KG9B 4YDNA 2Y2YA 3HEIB 3QUZB 4GKSA 4KJYB 3CFCH 4XBGB 5DQJA 3ARFB 4EN3B 3QQ3A 1UD6A 1YN6B 2Q7YB 3SHSA 1AZVA 5E70A 3GRWH 4Q4IA 4HXBH 3RX8A 1N3NA 3WY1A 4FZ8H 4K4KA 1E9OB 3Q01A 1E4WH 1YN7A 2V5SA 5GGQL 2JKTM 4JPKL 3FRUA 1X5AA 2W9EL 1FN4A 3O8XD 3R0MA 1TZOA 1AHWB 3EH4B 5KVGE 4LCUB 5C07B 5F7EL 4HH8A 4E9YA 5F1NB 4YXLL 4N2CA 3DX7A 4P23D 3KGSA 5D1XA 1O9ZA 5J13B 4DHLA 1F0LA 4H1LH 4TQPA 1FBIH 5KBMA 4AVKA 1P6AB 1QLFA 1SYVB 5F3BA 4G7RB 4G72B 4X98A 2BRRL 4CN6A 1O7DE 2R23B 4LLQA 3TBSA 5HXMA 4QHUA 2EEDA 2MEJB 4ZQKA 3BT0A 5J56B 1TPXB 1GYVA 3TV3L 3BWAB 3T1WA 1B6DA 4AEHL 4KMQA 2JMRA 2BSTA 4X8XA 2I07A 3N1MC 3Q1SL 1TNNA 4XAWH 4MWFB 3MNDA 2EINB 4GUPB 1SYVA 5E56A 1NPNA 3D0VA 5T1DL 1AZUA 1SM3H 1HSAA 5F21B 4YXKL 4JQIL 3QWOB 2GBTA 4DP7X 3OL2A 4K5PA 2E9GA 4ADJA 1YEFL 2ZSWB 4CJ0A 6FABL 5I66B 1G7PA 1A1OA 1B90A 5TH2B 1FFPB 5DR5L 4MSWA 1AIFA 3VACA 4AQOA 1MQ8A 1R3LA 3J8F7 4ZDHB 2J4WL 2JJTC 4XCNA 3QYMA 2EYTB 2BVOB 1GSMA 3QIUC 3WIIL 1LO4L 1FZJB 3S36L 4E41B 3CLEH 2GJZA 4ODHL 1G9NL 1FNHA 4WK4B 4W81A 1C5CL 2WUCH 5IFJA 3ARYA 3W11C 1KCSH 3SDDB 2F53B 1QFWL 3RB5A 5IMMB 1OAKL 4FLSA 2A9BA 4HSAC 5DC9B 1A8ZA 2A9AA 2ICWI 3EGSA 2A1WH 3T0EA 2KI6A 1LNUB 1MCOL 3UG4A 1D6VH 5ADOH 1SJXA 2JJVA 3ARBA 3QDGD 4QIRA 5AZEH 3NJGA 5IW6A 4XBGA 3GRBA 2K8QA 4A66A 4I1NB 3TJPA 1G5GA 4JRYA 1OAUL 1A2YA 3HJ0A 3G5WA 4PRBA 3RY6A 4TNWF 3GS7A 4OZIA 2ATKA 4WCYL 1HH9A 3OKYA 1B4LA 3CU1A 4OZHE 5BQDA 4HGMA 2HX9A 2Y7OA 2ZYSA 3K6IA 3EF7A 1PS3A 3UMNA 2PO6D 2XVKA 1KEGH 4S0TD 2VZ1A 3C12A 3PWJA 1YEKH 3OXSB 3GDBA 5HHOA 5I6KA 2NCEA 5IB3B 1KBBA 4FI6A 4NNYB 5DLMH 1ACCA 2JKJA 4JFPB 3IDGA 2R56H 4E0RB 3TT1H 4ZMPA 3MRFB 4K3EL 1F4YH 4RFEA 5EUOA 1XZ0B 1S3RA 5ECGA 2I32A 3NPZB 1CI5A 4HALA 2IDQA 5AKSA 4GYBA 2NY7L 3HAEG 1LWRA 1B9ZA 1MXGA 4PN6A 4GUCA 3S96B 3VSUA 1USQA 4ILDA 3DWTA 5C09E 1FA4A 3WFHB 1MHEA 4FTVA 1I9JH 2EIEA 1I3GH 3D9AH 4UQEA 4JRXD 2EDTA 4XPTH 2WWMD 3MUGB 5D2NB 3NH7H 1DCEA 1QNZH 1SHMA 3DVNA 4L3CB 4PWIA 1ZGLA 5IMLB 4HUUB 4BK5A 5IHWA 4QRAA 3IAQA 4QRSB 5ACZA 1MJ8H 3L5XL 2DQHH 4YHLH 5G55A 5EHFA 4Y2OB 1NINA 4H0IA 3ETBJ 4N1HB 5EZOH 1PZ5B 4R8WH 4BHUI 3LB6C 3DXAE 5HHVL 1ZWIB 1T89A 5E6ZA 4FQCH 1J1XL 4K55A 4LASH 2DQEH 1KTDA 5I82A 4Y4KB 1MEXL 2X6CA 4V33A 2QVKA 2MHAB 4IBSA 4L9DA 2KERA 4I89A 4QXVA 1KC5H 3H4FA 5DD6B 5F6HI 1FVCB 4FNQA 5H94B 3GMMA 1WBXB 1WIOA 4PMFA 4Z7UF 5C0AB 3VXRE 4Z7VA 1DQTA 3V0DA 4CDGC 3O3DA 3JV4A 5F44A 3C2AL 4GMSL 3MRJA 1T0NB 4PJCE 4Y5VA 3REWB 3SD5A 2ATAA 5D55A 4N6QA 1VDGA 4GQ9L 4TQ8A 4ZXBD 3VRIB 1E9QA 2AHIA 3HZYB 4P2RA 3GNML 2BS9A 1RHFA 5E8PA 2WWKT 4KI5F 2UZXB 5KZCB 4GAFB 4UT6L 4CC0A 4HPHA 2D31A 1XH0A 1ZS8B 4Y5XC 2GT9B 2JCCA 3EFOB 5I1CL 1U91B 2BRRH 2R4SL 4XNQB 4QGYA 3NYKA 4DK3A 2HFFB 5L0QB 2OULB 3KM1A 1PLGH 4LARH 1M42A 3EJPA 3CSBA 4M3HA 1IZKA 2Y69B 2C9VA 1KPUB 1ORSA 1BZDA 4NN7C 4UQ3B 4K5NA 5INCB 4XHJD 1UACL 3ZE0B 3G5YA 3W0WA 5DMKB 4PGEB 4W9IC 4PQXA 4KZ0A 1T20A 2FECI 5CEZH 3MRPA 1NGWB 1T2QH 3RQ3A 3QFJB 1IAII 1YUHA 2P4AB 3HLAA 4JHUA 3DDGA 2JKRM 5ALCL 1IX2A 3JWNG 5FUCE 4J12A 3MA7B 4XPGH 2R0LH 4ANXA 4FRWA 3QR0A 2VTFA 5HGAA 3FAWA 2DLFH 2VXUL 2CLZA 4XTRD 2BFVL 1XF3A 2TRHA 4JM0A 3UAJD 3H8NA 4P5TD 4Z18A 4BXSV 5A2CA 3WE1A 5DD3L 2NT0A 3EYVA 1R0AL 4GW1A 4YEEA 3EG9A 1LK2B 1FFNA 3C5ZA 4NHCH 3UG3A 1UKSA 3KPSB 5DZAA 1J0KA 1G5AA 2IBZX 5DJ8B 1JCVA 3OWEA 2C3VA 5MENA 3PWPA 1NFIB 4WEUD 1G0DA 4MJ5A 3TXAA 5D6DC 3EOYG 1BFSA 1BQHG 3TFKD 4G7VH 4P4KB 2YD3A 2VJXA 3WE6B 5BV7H 3IFOA 3QUYB 1SPDA 4OB5H 4EO5A 3HG0A 4S1DD 4PRID 3FHAA 4N0CD 1DL7L 1FLTX 3CLFL 4JMXA 4PS3A 2Y06L 2DWEB 4KC3B 4GXUN 2I7OA 5E6YA 3RTQA 2DYRB 3BPOC 1FDLH 2AK4E 3DV4B 1YMME 2ZX8A 3ABZA 3AQDA 5E9DA 3U82B 3QUXD 5AG8A 2KLSA 5TDNB 2XWTA 4X80L 3X12A 1QR4A 4RX4D 4QO1A 5KZCD 1HDMB 1X5LA 3FT0A 3HI6H 4RBPK 2ZJSH 5B3JE 4BE5A 3RHWK 4FABL 2WGXA 4WW1A 2CO1A 2PPDA 5IJDC 1XAUA 4Y2DB 4IOSA 4FFZL 1VFBB 2FAUA 3PG2A 1UM6L 2Z3FA 2ZP0T 2EIZB 1HIML 1ZSHA 4DOHB 4KQ4L 5FKAB 1E2VA 1KN4L 1TTGA 5HI3C 5ID1B 4HUVB 3MUZ1 4MGXA 3F6LA 4HK3J 1RZ7H 3RIAK 1ZXKA 5AVWB 3OKMB 4BSWA 5DSCB 3WDHA 1FL5B 1N7ML 5KYNA 5GRVK 1K4CB 4Z7NB 7PCYA 2DQIL 3TIEA 4K7PX 2VMFA 3DI3B 4JFFD 3GI9L 4ZUWA 3PL6B 3JV6B 4WWKA 5LGYA 5I6XC 4JPQA 1A4KA 3F65A 3DUSA 1NMBL 5F2FA 4YDIL 1SF3A 1AO7E 2BPBA 2EZ0C 4XPHH 4BSJA 2YGQA 1D7DA 2F8OA 4HC1H 1Q8MA 3F7VB 2VH5H 4HEMA 1XIWA 5IWLC 2K7PA 3T8XB 4NZUH 2EYSB 2Y1VA 5E1HB 1DEDA 3A24A 2DQIH 1GS7A 3G6AB 1OGAB 1JGUH 2G2RA 3CH1A 1S7TA 4N2LA 4D0BB 3MYJB 4Z7VF 4A38A 5BZDB 1ZV5A 2HX7A 2OJZH 1MRCL 2NZ9C 3Q13A 3W9DB 4LB8A 4L8SA 1MIML 2P5EE 4IHOB 1KN4H 2Z0UA 5DUPL 4ANWA 3MLRL 1QD0A 1N70A 4JGUA 5I5RA 5DD3H 4W9LC 1V7MH 2JK5B 4PCSA 5LAXB 3RVWC 2RGSA 3QRLA 2QPEB 4IRSB 4A2FA 1RPQA 1SXCA 1CE1H 3DIFA 1YQVL 3LNHA 3MLTB 4XNZB 5CU5A 1A21A 1WS7A 1UJ3C 4P2RD 1FL3A 4WJG3 5EZLB 1UGKA 1KB3A 2DB8A 1NCCH 1EHKB 1U3HD 3L1OH 1EJOL 4LPYA 1VKXB 5DJ2A 1OO2A 3IYLW 1SN0A 5FKPA 3QB7C 5F7MC 3MCYA 3FFCD 4QHMA 4EEEA 5DMIH 3QDJD 3QFGA 2GIYA 3UIZA 2FT7A 3PWUB 4NN5B 2C9RA 3QXDB 1RIVH 1IGCL 3GBMH 4FKHA 2QPDB 4K5LA 3WTSA 1I1AC 1NAKH 2QSCL 4BD4A 6PAZA 3QI9A 3Q8BA 2XVBA 4TUKL 4PGJA 1DE4B 1CDJA 5I18L 4TV3A 4BH7B 3GSUB 2AQPA 4LOUC 1I7TA 5C0JB 5D8JH 5DJ0A 1CLVA 2YUXA 2YUVA 3MJ9L 1A4CA 2COQA 2YC1A 2CKBB 5D7IE 1X5ZA 4PJAE 2ZYHA 3KBPA 1MFAH 2A4EA 1RJYA 3GI8L 5L8JB 3O0RL 3EJRA 2IBGA 3Q9QA 4QF1A 4WUKH 1MUJB 2QV2A 2VCOA 4NPKA 2VC2B 1Q9WB 1UCBH 2XXCB 4W9CC 4F1ZA 3AADB 1BJ8A 3ELAT 5HHMB 4AJYV 1YNTF 3VXPB 3UTPD 4Q97A 5HHOE 3NZ8A 4NRXB 1WAAF 3C6SB 2ZWLT 1P7QD 2IDFA 3MBEC 1XIWC 1A6WH 4GBXB 3DV6A 4L4TD 5BVPL 5ICXA 4K7PH 2VOTA 3BAJA 5HHPA 2IH3B 4EDWL 1KMGA 5FDYA 5G4OA 1E6OL 2XNAB 4P46B 1ACYL 2V5RA 1EQWA 2XV2A 3AXHA 4PJDE 4UQ2B 2FYVA 3ME0A 1B0GA 2PETA 1HYSC 3HE7A 1GGYA 2LAGB 4NRZA 5GS0C 3TBTB 2Z31C 4FNRA 4MXVE 4HFWA 1OEZW 1QTPA 2IC2A 4V1DE 2X42A 4HIHA 4TRPH 2WAHA 1VZGA 3F7YB 1X6NA 4ZXBC 3BZEB 1RHHB 3GLDA 1NWOA 4LKCB 1W8EA 3N1PC 5CWSB 1UJ3A 1ET5A 4N5ED 1DVFB 5FEBA 1AXIB 5T3XH 3TBWA 3FTWA 2XVLA 4TPRH 4W9FC 3WNOA 5AB2A 4UOJA 3DJRA 3RTQC 1IBFA 3W9EA 1A3QA 2UZIH 1O5DT 3FF8A 4H25A 4M9OA 3MRKA 4TSCH 1JWMA 1OTUC 5ETUB 5AVSB 2Q3AA 4HOXA 3UYPB 1BLNA 5C07D 1IC1A 3UAAA 2GITB 5HJDA 1E3FA 4NWUH 3C5SB 3GMPA 3L4YA 4NQUA 1W91A 3MJWA 5F9JB 4RMVA 2XKSA 3GZOA 4WAFA 4AVHA 4DJMA 4HFUL 4QOKA 1P9MA 4ZMQA 4TSCL 4OJFL 5A6LA 3VDBA 2IAND 3K7UA 3LYRA 4X7SH 2A2QT 3GS4A 4PTUA 1H6UA 2CPUA 2IPTH 1E28B 3MA9H 3FTXA 4LK4A 1BM3H 2EDMA 1Z5HA 3KPRE 4GKSB 4RGMB 2HH0H 3E6HB 4QHKI 1EBPA 4QXGL 5T3XL 5I0DA 1EZVX 3K8KA 1GGIH 3CMGA 3GS0A 5C0CB 4ES9A 1GS6X 2PCXA 2N56A 5EO0B 4WWKC 1MDTA 2XBZA 1W2KT 4J3XA 5EC1A 3NOIA 2ZWKA 5GZNC 2HMID 4PJHB 4P2QE 2UX7A 1V7NL 4JHAL 4ALAL 3EYQC 5E03A 4EIBA 2GAZB 1YYLL 1J8HE 5I73B 1S7SA 3HE7C 1AD9B 3VGFA 4HS8L 1RUKH 4NJAH 4FCHA 3IFLL 4DO4A 1ZVNA 4ELME 1T6VN 4K3EH 5I15L 1P7QA 4KGJA 1WZ1H 3GJFK 5E1IA 2I25N 3BGAA 3DRTB 3O2DH 4UT7L 2YD7A 1T1YA 5JORB 2OP4L 5GS2D 1DBJL 3QIWD 2BNRB 4JL1A 5AUMB 1AG6A 1OP3H 2J88L 4XWGH 3AXLA 2N1KA 3UC0L 4F2ME 3V0AC 3EFDL 3UG5A 1IL1B 1DQQA 2IDUA 4RDQF 3VXQB 3KH3A 2VMJA 1YNKH 5LB1A 5DMYA 4KJYA 3UAJC 1F90L 2NT1A 4ENZA 3BVNB 4O4YL 2A9DA 4G82A 3I6GB 1HHKA 3H42H 5I19L 1GJWA 4KRPC 4N3UA 5HI4C 3RVVC 1MRDL 2IF7A 3CFKB 4XN8A 2X28A 4YFDB 2YPVL 1NFKA 1G7HB 2AABL 2QGEA 3RGVA 1MAJA 2ADGB 4M8QB 5FYKU 4G7YH 4X9IA 2XQYK 5I2IA 4AYDC 1XGUA 4LEEA 3D0VB 4HC1A 4PJ8A 4X7DC 1OAKH 3ZT6A 3R7RA 1AGDB 1S9XB 1GZHC 3FTUA 3HC0A 5DS1A 3BP4A 4P46D 1R24A 5EUKA 3B37A 4UBDD 3DUUB 3RGVD 1CICD 2CLRB 1FO0B 1NGZA 1P2CA 2WY3B 4FULA 3WS6C 3TBSB 4TLSA 1ZMYA 3CVHH 4YWGL 2GUOB 2X87A 5AZEL 1S9XA 2GQHA 4UMGA 3QEHB 4NUPA 3QIBA 4OT1L 1ZA6A 4ZSOE 4DFHA 2YXFA 1BVLA 1BXXA 1D5ZA 1J1PL 2F8VA 3WS3A 1WBZB 1J8HD 3QPXH 5MHSE 2H5UA 5CJOL 4L29B 2E4FA 1NSNL 2NY0D 1KYOK 3MX0A 2B9AA 4PD4K 3RVTC 1LEGB 2R9HD 4QRUA 1WLHA 3SOBH 1BP3B 5D7JD 3WLBB 4UB0H 2FD6L 2ITDA 3NSJA 2V5YA 3U7YL 1JFQH 1J87A 1MI5D 1WHPA 2Y9RT 5KVFE 3RFZC 4AKPA 2ZWZA 3NBNA 4ZUSA 2CCVA 1AZBA 5J89A 4XNZC 1RQ5A 1WCBA 2W0FB 3VVWA 3TO4C 1JZ5A 3IVKB 4YN3A 3GZKA 4XNQA 3QQNA 2NTSP 2OXGB 2XKNA 5CEZL 3INUL 4KZCA 4MA3A 4PJAF 3BSZA 3AWGA 1PNDA 5AW0B 1EJ6A 2VLRE 4FXGA 4PB0L 3ETTA 1AP2A 3DX2A 2EDKA 2HJLA 5FPIA 3NP3A 4GLRI 1VPOH 2Y3AA 3FULA 1FI8C 4LLQB 2KBGA 4G9FE 3HE6D 3NACH 1XGRB 5CINH 3VB8A 3FSAA 3KD4A 4ICXA 5F6IC 3TBVA 2AXWA 3M45A 2ZG3A 1IAIL 5D2NE 3N44F 8CGTA 1SVCP 3L2LA 4TQEL 2BMKA 3B9EA 4PJ8C 1HTYA 1AAJA 4WY7L 3ZPDA 2Y7SA 4BUQA 4NC1C 3ARGB 3GMQB 3KPMA 4KKPA 2BP0A 2HN7B 3HE7B 5DD0L 2H1XA 4L1BA 4QJ5B 3MV11 5L7XL 4EZKA 2X4PB 3LQAH 4R4NC 4G2AA 3MAWA 3VDAA 2YRZA 3LIUA 4XCYA 2ZONA 3KDPB 4PJEB 4NAJA 4XNMA 2FQEA 3KPSE 2CHDA 4L3FA 4PGCB 3OHXA 4QRSA 3S98A 4LLDA 1U91A 3V0WH 2MRYA 1A6ZB 2EDNA 2E9BA 2W38A 4PJCF 4HIXL 3ZDZF 4RGOH 4N0FA 2VO8A 4RA0C 4GS7C 3EDEA 3X11B 2HTLC 5IB4A 1KDJA 3QULA 1D6EB 2RJMA 2J7LA 1JPSL 4GINA 4AQAA 2OCFD 1D5BB 1ED3B 3ZL2A 3IJEB 1HL8A 3G5VB 3F7KA 1A6ZA 3VU2A 2WCSA 4XBMA 5LCVA 4TL4A 3TZVB 4N0YL 4ODSL 3HZ3A 4Z7WA 4FTVE 2EVFA 1AGEB 1RJZB 3FBKA 2BNRE 2BJML 1J5OH 2J6EL 5H94A 5DDHA 3PFQA 4ZAKB 3UCQA 1JGLL 1OOWA 3AJ7A 3P54A 1MCKA 4X4ME 2CAKA 3TZVA 4C59B 3VXUD 5F0MB 3D2UA 1UYWH 4I18B 5HGAB 5HHOD 4NZJA 2AQRA 4XC3H 3TYGL 4PLKC 1I4FB 2IDSA 2Y36L 3G04A 3UJJH 1H15B 1I75A 1OGAD 4JZOB 5C7ZA 4PRPB 1BZEA 4QMEA 1ERNA 4OCRL 4N0FB 3WLWD 5ICUA 4GI9A 1FN4B 3TIDA 4P2QB 1XGYL 4IRZH 4KX9A 3OKMA 3SJVB 1C1EH 1KWGA 1A2YB 4YLBA 3VGBA 2IH1A 1E5UI 3GMRA 3OJDA 4OLZH 1HWGB 1XTLA 3BKCL 1NFDA 4RMQA 1NBCA 1SDDA 5DMJB 1BAFL 2ADJA 1SJVA 3ZTNL 4FZEL 4PREA 4ZYKA 2BSBA 3JWOC 3ULSA 2PCPB 2V2XA 3BVUA 4NQVB 5KS9A 3MGOA 1CPUA 2HT2C 1CK0H 5KBPA 4PJAB 3C2AH 4GMSH 4KKLC 3SB3A 4PR5B 4MAYB 1XSOA 3B2XA 5DO8A 2ZSVA 1BQUA 3ULUC 2VDQH 4Z78A 3HHMA 3L3DA 4XP5L 5KS9B 4O2FA 1PG7H 1S7TB 4TQIA 4D0BA 4RFEB 4P5TB 5EUOB 5J1SC 2F58L 2DL2A 3BP5A 3D2UD 2W0FA 3FO1A 1M1XA 1TQUA 4QAWA 1L6PA 2KPNA 5IM7A 4KQ3H 4FFZA 4K3JL 1R17A 4PJIA 5L0QC 5AVZB 1X5GA 1N64H 4LDCA 1AE6H 1TU2A 4LSQH 5AYTA 4K2UL 2CHNA 3WELA 2VDRH 3OAZK 2H32B 5E2VL 2VKXA 3QFJD 4EUPA 1BFVH 1F4WH 3QUXB 1TZIA 4I18C 1OSZB 2VLRD 4GAYA 3H3KA 3W0WD 1QSZA 3QEGH 1LO3H 4MJIB 4V2CB 2CE6A 5BNXD 2E76C 4E9WA 2WANA 2AQNA 4HWNA 4LDOB 3MC0A 2KQMA 5ID0A 2FJGB 3MNZB 3HR5B 4ZG1A 3SGDH 3TEZA 2GJ6B 4CKQA 4J3OH 4OVUA 5D7IA 3TZVC 3F8UB 1IMHC 3WO4B 1KBVA 3RL2A 2LTQC 4CMHC 4AIZB 2CBOA 2W07B 3IGAB 1WV7T 4Z7WB 5HDQL 3K6OA 2O72A 3DC0A 3PGFH 4XPHL 4J6IA 4XH2A 3ZDXF 4ENEC 1NA8A 4EOWH 1KPVB 5J13C 2CUHA 1AGDA 1JZ2A 1NM4A 4JDEB 3GXTA 5DJDA 3WMQA 1Q0XH 1LO0H 4ZMLA 2H1PL 5IV2B 4MLIA 1ACXA 1OGTA 3IAGC 1AQDB 4GSXA 1VADA 5BRZD 3WG7B 5JOFA 3X12B 4HKBB 4OZHB 4JFZL 2MPAH 3WEOA 7FABL 4MB1A 3O6KL 1TNMA 7TAAA 1OM3H 2HUEA 4G7SB 1KFAL 2XT1B 1E3ZA 2GY5A 2YR3A 2BW5A 3ARFC 4PGCA 3RWDB 3KW8A 2BSEA 4FKKA 1RI8A 5CUSH 5I71B 5L2KE 2CBTA 4DW2L 3M17B 1J86A 4DP2X 1R5IA 1NDGB 2R1WA 1GOFA 2K9UA 1NCOA 2P80A 5HHOB 4ZZFA 3T0WA 4HJGA 2CM6A 4MA8H 1HL5A 1OIOA 1FPTL 3QWNA 1IIKA 4O02H 2J25A 2DEXX 2ZX7A 4B0MM 1S9KC 5C09B 1S5HA 2EE0A 1G7QB 2E74C 5TFSH 2C1OA 5J3HC 2FQDA 3GJEA 3US9A 5EZJB 5I8CA 2K9FB 5D1QA 4LCCA 2A38A 5FR3A 4F7EB 3ARQA 3WD5H 3V4PB 4J3TA 3WLWC 2BZDA 1U3HC 1ZLWK 3WXWL 1H8NA 4JN1H 2FJHB 1U8KB 2J1ZA 4IJTA 4ALAH 5CEYA 3M1OA 4LCWE 3VWKB 4JRXB 4OD3H 5DURD 5DD5L 2G3NA 2WQXA 3N41F 4JFUA 3G6JA 2HFFA 2HTLD 2YO3A 4JO4L 4PRDB 2Z91A 4JW3A 5KAQG 3TC9A 2MTPA 4H1LA 3UBXG 3EYQD 3FUIA 3IU3B 3RFZB 1T22B 2YQBA 5T1MB 3APMA 3F7RA 5F9WB 4ODXB 4JFED 3O3BA 2YBGA 4UNVA 4AC2A 3QEQD 3LQAC 2MSPA 2X6MA 4PJGF 1A64A 4H1LB 3BAYA 5FA4B 5IVXE 4Z7OB 4XOEA 35C8L 1RK1B 3VI3B 4LEXL 5FUZL 2JB5H 3IFOB 1EV2E 1AOHA 3H3PL 3STZA 5LQBL 3GSQA 3VI3F 1OAXH 4XMKH 4XMPH 2J72A 1KCKA 2HH0L 4MS8C 3DIVA 3L3KA 3TEYA 3HRPA 4XO9A 3R8BB 5IB2A 3D34A 3ZKMC 3LH9A 3BPOB 3NTCH 1QP1A 5EEUA 1BYPA 4ZX4A 2BNUB 1VACA 4JDZB 5FKAA 2PNDA 4OKVA 2EDDA 1WHOA 2V8MA 3FTYA 1XBRA 5LCVL 2VDLH 4N68A 4X9YA 5TDPB 1RCYA 1WFMA 2R2EA 3UJTL 1S78C 4HZLA 4LOFA 2EJ1A 5F9AC 3RL1B 4BZ2A 3H9HB 2ICES 2BOCA 3WJJA 3IDXL 5C0CE 3FSZA 4LSSH 4QOKD 3VI4B 5FOJA 1WFTA 3FB6B 3GWJA 4FYQA 2WWKO 1JHKH 1G4MA 4QGTA 2D3VA 3NZUA 4QYOB 1KB9K 2YPLD 1TVDA 2A9MH 1XGPA 4XRCB 3VI3A 4OH2A 2CDGB 5SWZA 5EEXA 2P5WB 2IADA 1PEWA 2J8UB 4U1MB 4NWTH 1KGJA 2ADFL 2VLKE 2I9LA 1TTRA 2G5UA 1OB1A 1A02N 5GSVB 2J88H 5IJBC 4I77L 3KPPA 2GI7A 4XMPL 4O58L 4GRWH 3QXAA 5TE6L 4HWEH 1TVHB 3T6XA 3KYNA 5K5YA 3UAFA 2JIXA 3P0VL 3K6FA 4Q9RL 3FQ2A 1M7DB 3MO1B 3Q7JA 4OQTL 3X1NA 4B50A 1O75A 2I9LB 2WXIA 5FW8A 3EHBC 3CZKA 1QMUA 3NIFF 4F8PA 3MJ7A 1JZGA 3ESVF 1AXTL 2EVJA 4DZ8B 1NCBL 4R26H 3JWOH 1FV1A 1YMHA 3NZ8B 3MA9L 1OHQA 3QWQB 1S7UB 3KPSA 4G6KH 1KV3A 4HIJB 3WFZA 4Y16D 4X7CC 5AYQA 4GG6E 3VFVB 5MP6L 5AOIA 2EEXA 2ZTBA 1A65A 1WVZA 3QIUA 4FAAB 4LDLB 3TT1L 1KLUA 2HT3D 1DJZA 2GFBA 2ZKHH 4JO3L 1L5GB 4PJBA 3LPWA 4Z7UA 4PJFA 1W0WA 2Q6WA 2WMPB 3ZGHA 4K0OA 3FUMA 4U1HA 2BSRB 5GGVL 5A2LH 2EDOA 3OKDA 4RAUB 2NUPB 3DHMA 3DX6A 3G6JE 3P4MB 3VWJD 4D8PA 3ILPA 3DIFB 1C5BL 3L08A 3W39B 3EYUL 4GB9A 3UTTB 3LMJL 4F57L 5FO9A 4CU7A 1YHPA 3JWNE 1H3GA 5BRQA 4R7DA 4DPBX 3IBOA 3OGOE 1S7VA 1E8YA 1IC5L 1C12A 3HPJA 2NX5A 1JDDA 4OF0A 5M7QA 2OTPA 5DEGA 4OGYL 2GPZA 3P02A 2OL3L 1D7CA 2HLEB 2R2BA 4QDGA 4K23L 4PJ8D 3BRGC 1FPTH 5JOPE 4XMLL 5KWYC 3CSFA 1ZPLA 5D1ZD 1UEMA 4GMTH 1HQ4B 1G0YR 1KXTA 1YEGL 2APTA 1GC1H 1I9RL 3LS5H 1DDHB 2B59A 4U31A 1PKOA 3CZFB 5D7IF 3CN0A 1D5IH 2VXSH 4DVRH 4BFJA 1E8WA 5D4QA 2RHEA 1KLFB 1H3UA 1VZIA 4QTIH 2IG2H 2BK8A 1KTBA 3LRSB 4NO0B 1I8LA 2H0EA 4NO0D 3K2KA 3TGXA 3RWJA 3F83A 3PV7A 4LSDA 3QIWB 5AYUH 3WEMA 5FB8A 3O3UN 4LU5L 3BP6B 2ZZUT 1U95A 1N0LA 2YWZA 3RVXD 3K4DA 5F96L 2DM4A 3S88H 4AGMA 1S7VB 3F7PC 4RETB 1YDPB 1BVKA 2PUQT 5FAAA 4PJ8B 4F7CB 3SPVB 3DOSB 4RFNB 1SEQL 5F0JB 5K1JA 1IGJB 1EO8L 3CLEL 4HCRA 3VQ1C 2FIKA 3PIQA 5HHQA 4Y4FB 5HI5D 3BO8B 3N91A 4GNKB 3S88L 3QEUA 3L9EA 3GBNH 1SY6H 2VXVH 2JNZA 2JV6A 1U3YA 2MJWA 3A21A 4LF3A 5INDA 2OQJB 2B8OT 4HKXB 3FOLA 4I48B 3VU1A 3NCJL 3CFBA 2IG2L 5EO9B 5E9NA 1XIWB 1P1VA 3FSOA 3CSYB 1RZ8A 3C60A 3LSOA 4MCZB 5GXBB 3GUTA 2BP0B 1LQBC 1E43A 2GSGA 1CDGA 2HN7A 2HVJA 3QWRD 4E9XA 4LEOB 4U1MA 4FOMA 4NS0A 5D5MA 1G7LB 3LEXA 1TFHA 5L2JB 1Q9LB 1WAEA 4N2GA 2A4CA 3Q1SH 2X4NB 2E47A 3MREA 3UYOD 5AAWA 2V8LA 5TE4H 4PV1C 3F04A 4OF3A 5GGSB 1ZA6B 1SY6A 4G6AC 4I3GA 4JRFA 1EAJA 4MMZA 4W4OA 1KDIA 2YGPA 3HG1B 3L3HB 4J4PC 1XZWA 5J1AB 2P8LA 1CDHA 3MLWH 5I16B 5TH2A 2R0KH 43CAB 1JPTH 5K9JL