3LZRA

Crystal structure analysis of manganese treated p19 protein from campylobacter jejuni at 2.73 a at ph 9 and manganese peak wavelength (1.893 a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
158
Chain Sequence
b'GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 28
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzrA00
3NRPA 3PJNA 3PJLA 2O6FA 2O6CA 3LZLA 3LZNA 3NRQA 5I0XA 2O6EA 5I0YA 3LZRA 5I0VA 5I0WA 3LZOA 3LZQA 2O6DA 3LZPA
chains in the Genus database with same CATH superfamily
1A7NL 2JJTC 3ESPA 5F70A 2JKRM 3THML 4N85A 1I1FA 4BFBD 1DUZB 4IIQC 3MRKA 1QUNA 3B9EA 3CXHJ 3GRWH 4ZW7A 3SE6A 3DRQA 2ZUUA 1WWAX 3QDJB 3QP3A 2DOCA 1AJ7H 4JFYB 4G2AA 4IEFB 1P4IH 2Z34A 1VENA 2FD6L 4J1UA 5DC0A 3RWJA 5CBAB 1BF5A 3OAZH 3MCKA 3I9GL 4MJ2A 4KUCF 5GRXG 1KEMH 5FV1L 4L3CA 2ZXBA 2R15A 1BCIA 4U1IA 3WKML 3FJTA 5I9QC 4ODVH 1YN6A 4JHVA 1MHEA 5C2BL 4XP1L 3BZ4B 5C07E 4C4BA 1DQKA 3B3IA 3D39B 4FX5A 1HOCA 1RUAH 4H0LC 4MDJA 2EDQA 2YQGA 4DZ8A 3IEAA 4M02A 4APQC 3D51A 1OWWA 3I50L 4Z7WF 2QV4A 2V37A 3EDFA 1KB3A 3L4TA 1RLBA 1TQBB 1W0WB 5CGTA 3BP6B 1DVFC 3NEOA 3IDYC 4OIAA 2N4IA 4R4BA 3QBTB 1QBLH 1JXGA 1KCRL 1U3JA 4I13B 2EIBA 1YEDA 4NWUL 1MFNA 1P84J 2FTAA 4OKVA 2YEZA 5AVYB 1O5PA 3QFDB 1R3KA 3RWIB 3T0EC 4G70B 5GRJL 1PCXA 3I75B 4XMKH 5DDHB 2EXWC 4QHMB 1UB5A 2YUVA 5CIPH 4B96A 4BFKA 3SGKC 1HZHL 5C07B 1QBAA 1FE8H 1FZJB 4PRPE 4GQ9L 2RCSL 2I60H 3WLWC 4R8WH 4W9EC 4PB0H 5F88B 1K6QH 4HC1H 4CU6A 1DE4B 3GF8A 4IKNA 4TNFA 4LLYB 5CZVL 3GSQA 1PY0A 1QSVA 5E4OA 1Y7VA 5HDQL 5HYEA 4TXVB 3X1FA 4M6NL 3OR7B 3S98A 2GITB 1J0HA 3BGMA 3ZHDA 1L9TA 2XFGB 3QUXB 3IPBA 2YLKA 1JYXA 2FGWH 5CUSH 1M7DA 4K9JA 4F9LA 2J6EL 1XB8A 1PBYA 4NERA 1N0XL 2W81C 4WI6A 5DI8A 1GTNA 4TRPL 5DF0A 1RZJH 3QG7L 1CQYA 4OY9A 3U4BL 1AR1B 3DUSB 4LIQL 3LEVL 4DP0X 3UG4A 3FUFA 4JG1L 4QTHB 1MY5A 4X5XA 2VWEC 3G5YB 4HMCA 4PRPB 4TUJA 3SCMB 5FYLH 3B2MA 3RURA 1BXVA 2AJXH 2TRHA 4G9FB 5F89A 1AZVA 1CGWA 1GYCA 3O6ML 3WY2A 5HDWA 2HVBA 4OZFA 3CLWA 2BJML 3FB8B 1IBZA 1RHHB 4U7SA 1ZLSL 5JMRA 2DLEA 3OC5A 1OAQH 5AW3B 4K7FB 4TSCL 3TEUA 3N42B 5AWNH 3SODB 3S8WA 5ENWA 2X7LB 3V6BR 4B6ZA 3DO4A 4O2EB 4M1DL 2OBGA 3H9HA 3T0VA 4J3OH 4F7CA 1IM3A 2NY2D 4LT7A 3MV7D 5DFTA 2XIDA 3FBQA 3GIVA 1SJEB 5EBLB 1VFOA 1JUFB 3C8HA 3K6NA 1AE6L 2YQ3A 4FI7A 3VXTA 2IH3B 1AHMA 5K39A 1B0RB 2EEAA 1QPPA 4XN5A 5ILTL 2AZAA 2JTYA 1DHKA 3IRZA 1WT5A 1VDGA 3P0YL 4WTXA 3JWNC 5CN1A 2DWEB 4XB3A 3CC5A 3NJKA 1X5MA 2F5AH 1TZAA 1F0LA 4HPOL 2ICCA 3HNTH 5T1MB 2ETWA 3GTVA 1XR8A 5H8DA 3DGCR 1FL3B 3NJNA 5DA0B 5IHZB 1NFDA 2ENYA 3MA9L 2MQ3A 3MUUA 4HQQH 4KKCD 5C09D 2VLRD 2ZP9A 1AQMA 1WS8A 1Y6MR 5E5RB 3GTNA 3FMGL 3X3GL 4YHLL 4UDUA 1QD0A 5D96C 3DV6B 3TZVC 2W95A 4H88H 4PYGA 3CN3A 4R7VA 3IMVA 5DGRA 4ZSOB 3RNQA 3FCSB 4OZHE 2YD0A 1CB4A 4F15C 4G7YH 3PHQB 1IU1A 4K3DL 4G6ML 3QZBA 3LKPA 1BX2B 5EPMB 4JCLA 1NQBA 1I7ZA 2J4WH 1J5IA 4HWNA 4NQUA 1HINL 2GW5A 4Z7IA 3U7WH 3FO0L 3FT3A 2WKOA 1UH4A 3L3OA 3VQ2C 5JORB 2CA3A 3IDJB 2YMTA 1OSYA 5C08E 4P2OA 1P5UA 2ZX9A 3N44B 1MIEH 4QLRA 3SDCC 4FEMA 4NXSA 3U36A 3VE0A 3U2SA 1A1NB 5HGHB 4X7CC 3RHWK 5EF3A 3TF4A 3CFEA 2JTDA 2IPKB 1L0QA 5LAXB 4JO2L 5CSZA 3UTTE 1UOLA 2YPLA 4PJ7A 1U8JA 3B6SA 1WBYA 3CH1B 3K1KC 1IX2A 3CD4A 3TV8A 2XV6B 3HB3D 3L3HB 4OZHB 5F7HA 2Q6WB 3NOIA 4MJ6A 2XTLA 5C9JA 2FZ3A 4JHZA 1LVEA 1SJMA 3C5SA 4IDLA 5E8PA 1CBVL 4HS6A 3HAEB 4EZKA 5GS0H 1JCKA 1DBBH 1UM4H 3VFOB 3DMMD 1PY9A 1HEJC 2YFOA 1AZZC 3PPSA 1JK8A 1WWBX 2YAHA 3M1BB 3RG1C 1LO0H 1N6VA 3G9VA 2AEPL 4NNPL 3BP7A 5C08B 4R26H 4FA8A 4YFEA 4GAGH 2XWDA 3W0WE 1EO7A 1JZ6A 2DQIL 1R1CA 2FR4A 2K6WA 1BVNP 3C2AH 4RIRB 3KAAA 3IYLW 5GJSL 2PPFA 4WGWB 5LHDA 1YPZF 1ZHKA 1ZV9A 2OP4H 2CHWA 2XTJE 3MLZL 3UTTB 4ZTOH 1IBGH 2R51A 3LH8A 1YO4A 4OSUL 4Z7OE 3IGUA 4QEGA 5FGBA 5AB0A 3QFJD 4B7IA 3ZYJA 2VLKD 1H3VA 3MI6A 1GS8A 3TXAA 5DHEA 2BW4A 5I0YA 4FC3E 5CP3H 1Z5YD 1DVYA 3BDYL 4OF3A 2H8PA 3RGVD 4GAJH 4K55A 4CVZA 5BMFL 5DO2C 2HVKB 3CVHB 3ZT7A 5FO9B 2CBTA 1NCNA 1E4XH 1VZHA 1P7KB 3BN3B 4PJHF 2Y36H 1J1XL 3WHE1 4I1PA 2CHXA 1MUJB 4XVSH 5A3ID 1KLUA 1HJBC 1FWXA 1YEWA 1GIGH 2LTQC 1HESA 2WINA 4M8RA 1OAUH 4MJIA 1HNYA 1H8SA 4GI8A 4H8WL 1C8PA 1GOFA 1YQVH 2XTJB 1JPFA 4ZFZB 1I3GH 2O30A 4WJG3 1A66A 1HWGB 1MHCB 4Z7OB 5I6MA 4WUUA 2HT3D 3GBEA 1XEDA 5TF1H 1WRFA 4OLWL 5F1OB 2I9TA 2D03H 4TV3A 5D4QA 3VXSA 1UQSA 4Z6AT 4G8FB 2L7JA 4L3EA 3GSNA 4DEPC 1XF4B 5DD5H 3VFPA 4UOW1 5DQJA 2NUTB 3BOVA 1HXYB 3RKPA 2G9HA 1UZGA 4N0FA 4QRRE 1HSBB 3DA0A 4PJGA 1PU0A 2AQQA 1H6EA 4OZGE 1WEJH 2P43B 4QWWC 4YLCA 5I1HL 3VYOA 3AZUA 3GSOA 3RIAF 4MMXC 3KCWA 1E65A 1TTBA 3A23A 4N90E 5MENB 4NQCD 2WW8A 3QCVL 1IBBA 1XSIA 2BIOA 3D18A 3G3LA 1GZHA 4D0CB 5DHYB 3HZVB 5E9DE 4LOUC 2X4NB 3EH2A 3HFFA 5E95B 4F1ZA 1EAPA 4K8RL 1ZLWH 4I0PB 3IAQA 5K9QI 3EUUA 1RZGA 2WNWA 1OF2A 3KJ4C 4ODUB 5E4IA 1UWGL 3HAEH 4H1LA 5CINL 3OKLA 2F54E 1KPUB 5ECJE 1E9OA 5E08H 1YSOA 3FBKA 4P2CG 4LQ1A 4QRRB 3KLAB 3SPHA 1O6TA 2B15A 1UZ8B 3POCA 4OZGB 3O3BA 5C92A 3UOAB 1UJ3A 3O6KH 1FH2A 4OJFL 3VFSB 5T3ZD 4OCMC 1RUPH 2H6OA 2X3BA 3A4DA 5KZCB 2LFGA 3A6CL 3F2LA 2X2IA 3R4DA 4AUJA 1WAAA 1CFVH 1T0NB 4W9CC 2X4QA 4P2OD 4R4NC 3QDHA 3ZT6A 5E2VH 3WL9A 1UYWH 1P7BA 4PVNA 5E9DB 1PQZB 1WYJA 3VH8B 4B9IA 1MN4A 1Y18A 5GGTH 3ROLA 4ADJA 2YPLD 4C4KO 3IJSB 4ZMZA 1EO5A 1A3LH 1U8HA 2CA4A 3GZQA 4FFYH 5D2NA 2HKFH 1NFAA 1HI6A 1EZLA 2F54B 2A4EA 4YK4C 3CVHH 2G5BB 4GI6A 5MI0C 2EUVA 5IHUL 5CD3B 3A4EA 1I1CA 3ETBF 3ZL4H 2YD2A 1PZ3A 1OEZW 1QLFA 5I8CA 3E1ZA 1Z3GL 3TNNA 3WN5A 1UKSA 3UEZA 2H3NB 3UBXI 4TKWA 3QI9B 3WTYA 3FQRB 4LVHC 4YHPB 3AADB 2UX7A 1S9WA 3IWVA 2ODIA 5DJZB 3RWHA 4X6DB 1SRDA 4W6YB 2JE8A 4X5PA 2NZ9C 1MG2C 4JUSA 5AZEH 1KB5B 4Z7WE 3T6ZA 5F6HJ 1RIUL 3FCBA 4K9EH 2HKHH 1PLCA 1UVQB 3QCTL 4Z23A 4A6YB 2R1YB 4NKOB 4BZ2A 2IBGA 5KSBE 2F5BH 1NTDA 1HKFA 3PJSB 4FAAB 4KHTL 1QO3A 4DP2X 1TQWA 3TCLB 3HI6L 2B59B 1QI4A 4ZUVA 3LEYL 5HHOE 5T8IA 2V5YA 5KBNC 1ET8A 3K2UH 5FUZL 3SYPA 4AL8L 3SOBL 5CGMA 4JQVA 5GGQL 1PZ5B 3QWRD 3ZDXF 5F7MC 2GCYA 5F7DA 1N64L 4WY7H 3NMEA 1RD6A 4HV8A 5D7IF 5I0ZA 4R97C 3IDNA 1QNIA 3ULVC 5DZLA 4WFHD 3MVSA 4UYQA 1BDYA 3KPSA 1TVBA 5HVGB 3MO1A 4Z7WB 2R0WH 4LEXL 4MJID 5CEYA 2E59A 1S9VB 1OCWL 3N0PB 4HCRA 4U6VH 5KSBB 4KMTL 5KUKA 5LXGL 2HRLA 2X6MA 5MP6H 4WUUD 3NBNA 2CUMA 3VXUE 2RQ8A 5GQBA 2KLTA 5DK2B 4AMXA 5AVTB 3ZKXC 1Q9OB 2IBBA 5HHOB 1K5NA 3VXSD 2DQEL 1E30A 2AJYH 1Y6KR 3KYMA 1EWHA 1TYRA 5DHVA 4FRWA 3UYOD 2HLFC 2C9PA 3EHBD 4XO9A 4WW2C 1WCBB 4Z3FA 3WXWL 3FHQA 1VACA 4YPGB 3VFNA 4MX7A 4Z77A 5IV2A 4YSPA 5FM8A 1E7VA 3NH7H 3PWVB 5ESVB 4HVBA 3DTXA 3MBEA 4LIQE 4KDTA 4M03A 5EFIB 1J1PH 1C9SA 4HSCX 3BO8A 1ZS8A 1DJHA 1KN2H 5LBVA 4HSAC 3TVMA 3FZUD 1NIBA 3ZQXA 1I31A 4M1CD 2NNAA 1DUZA 3B9AA 4V1DE 1Z66A 2KH2B 3VXUB 3SDYH 1OSPL 4IBLT 5HHMB 3QDJA 2WC7A 4LQFH 4JFYA 5D7HA 1VADA 4FCAA 4AV0A 2AJUH 2NR6D 5CBAA 2DKUA 1BWWA 2RH0A 5DJ0A 3AXIA 4LBEB 1M7IB 4FG2A 4UAHA 5I17B 1B90A 1FO0A 3RB7A 4QXUH 1D2OA 4YAQB 4BQ6A 1J86A 4XWOC 1XF3B 2WBJB 5IW1B 3O3AB 1B4TA 3MOBL 2L7UA 1KB5H 3BZ4A 2JI3A 2X2HA 4YC2C 3DJTA 4R7DB 1BVNT 3MQIA 1DQLL 4XCNB 3DIDA 3SYQA 2FBJL 3KE0A 1FGNH 2HFGL 2QMKA 3CFCL 1JZGA 1VPOL 1FPTL 4HIHB 5I1GH 4EN3C 4Q9RH 4OJDH 4PJEA 3KYAA 4JVUA 2PABA 1NAMB 1W0WA 5DMIL 5DRZB 4V1DB 1SVBA 3ASWA 3SDDA 3BP6A 4HJ0C 2WP3O 1OGAE 2VISB 4LLDB 2ZSWB 2VRKA 4I0CC 1MW1A 4WU7B 1OK0A 1ZTMA 3TBVB 1HAUA 2LLNA 2FYVA 4JG0L 1JRHI 2WYZA 4PUBH 2WXFA 2ZCHH 4ZTEA 4A2DA 4F8OA 1S9KC 3WLBB 2L04A 1IC7H 4FMFA 7PAZA 5IVXB 4KTEH 1BZEA 3MBWA 2Y5EA 3ZUCA 4NM8L 3N5AA 5DDHA 4QHMA 3S36L 1S5IL 3LHPH 3MLRL 3F58H 4L8DA 1SBSL 2OTWB 5C07A 1FZJA 1HQRB 4NS0A 1SDYA 4KXDA 4OB5L 5HJ3A 5EBGA 4F8LA 5K5YA 3NRFA 4Z8FL 5F88A 2ZKYA 3JVGC 3LH2H 1AGDB 1TCRA 4LLYA 2VERA 3BWUF 3HS0B 4OLEA 4X7TA 3CLEH 3PFQA 1IIIA 1OGAB 2FWLB 3OR7A 1INDL 4XP5H 2GITA 3NCJL 3QUXA 5JQIB 4DOHE 2VR5A 1F4XL 2XA8L 4XGZB 2PXYC 3GXNA 5DJ6B 3O0LA 4OJEH 2OMVB 3FCTB 4LE8A 2X88A 2EYRA 5AVSB 2ID5A 5TDPA 3DUSA 5JIPA 3II2A 1ZPLA 3EFDH 1YY8A 3OX8B 3TIDB 5J57B 1L7TH 2VDNL 3KLKA 1EIBA 2KPWA 4LAJH 3WS3A 4PRPA 4UZUA 3WIFA 3F7PC 3SCMA 4YHKH 1G5GA 3NFSH 3ESNA 4MQXD 3FB8A 1RHHA 2VL5B 5IQ9B 3KPSD 1KCLA 4RSYA 3RPIB 2EEFA 5DU7A 4K7FA 1E43A 3IJYA 3PDGA 3G04B 3UGEA 4MKMA 4O2EA 4PW9A 3HG0A 1KCVL 4Q6YA 3RVWD 4DOHB 4FZ8L 4FZEH 1L7IH 3TBTB 1SJEA 4JZJB 5EBLA 3B9DA 2CIKB 3QT2A 1CFMA 1JUFA 4XVOA 4L0ZA 1WAEA 2IH3A 1B0RA 2OJZL 1Q38A 3Q2LA 4PRHE 1TNMA 3BAXA 3V0HA 3GKWH 3VSUA 4F8NA 1Q9LB 1A6WL 3CZGA 2ICEB 2X4UA 3QUZB 4ESKA 4N0YL 2BK8A 4XNAA 5T1MA 3H3BC 4TNWF 3G5XB 2E9GA 1FL3A 3RAJL 3RX7A 3ZR5A 5IHZA 1NAMH 3PPEA 2ZT9C 1CS6A 2O72A 3JUYA 4NZRH 4YSEA 2EH7L 4FQHB 2CJUL 1MDTA 2CRIA 2Y25A 4L4JA 1FFTB 4NZ8A 4W6WB 1P4IL 3TVMD 2ZKHH 1KJ2H 2WKLA 2R4RL 4QY8B 4I2XE 1E5UI 1NKGA 4KZEH 4HJUA 4GQRA 4XOBA 5AW6B 3FCSA 4YR6B 4ZFGL 5F7EH 4WFED 3EOYG 1KXVA 4AGOA 3C60A 1GGYA 3L9BA 1ZLUH 3FYIB 4PRHB 1A1OB 1BX2A 5EPMA 3EXLA 3ZGIA 4GPVA 1KG0B 5C0ND 4JM2B 4NOFA 3MRIB 1CCZA 2BOCB 4UUJB 4F57H 1J0YA 3V5DB 4UT9A 2D4FA 5HHME 3SIKA 5JORA 1VB9A 3BFWA 2DH3A 1AIZA 3ARXA 4UV4H 2JB6B 2B1OA 2RR3A 1EA9C 4I1RA 4E9QA 5MHSE 4R2GB 5HGHA 1A1NA 4Z76B 3BXNA 2DQHH 3L3IB 2MH4A 3TO4A 5E4AA 1IC5L 4OUUB 2VDPB 3VW3H 3DX6A 3NGBB 1J12A 4E9TA 2PKDA 4ZO9A 2C1OA 4IU2A 1CYGA 3SDDD 2A77H 3L3HA 1ECZA 4OZHA 5CF3A 2IWKA 4GKZB 4TMPA 1X4XA 2Q6WA 3S5LB 1GAFH 4HKXB 4FFZL 2OCJA 3ZDZB 1JE6A 4MB1A 4PJ9D 1XGQA 5EIIG 4AEEA 1S2EA 4CMMB 5JTWA 3P02A 5IQ7L 3VFOA 1GZPB 5KOVC 2XPGB 2P28B 5IUSA 2R29L 3BSZH 1CGSL 3MJGX 4PB0L 2O6CA 4ZOBA 4NRXA 4X7SH 3KDMA 1E0OB 3M1BA 4GLRH 2DY2A 1XGZA 5C08A 2AKRB 3V52H 3FHEA 5T5NG 4QRUA 5C07D 3L48A 4URKA 4RIRA 4WKXA 1E4JA 2ZX5A 4KJPD 3IWUA 3QW9A 4LCIH 4LK4A 5E7BA 4ENZA 3CDZA 1CL7I 1ZEAL 3UTTA 1MVUA 5TH2A 3RA7L 2ZPKL 3K6DA 2P5PA 4HALA 5CEZH 3U83A 1N68A 2ICES 3DPDA 5LLIC 1RZJL 2IANA 5EORH 5FAAA 1I8IB 2R39A 4OJCA 4RRPA 3AW5A 2X40A 1YDPB 3MRFA 4JN1H 3HMWL 4F9PA 3J7HA 4FFYA 3OAZK 4YWGL 4N1HB 1JZEA 1CVSC 4FLHA 1DUYA 2VUOA 1GMIA 1OARL 2YSTA 3SZKC 2AJXL 5FO9A 4FF9A 3L3JB 3UH8A 3IPEA 1ID5I 4NM4L 2BIPA 4DVRH 3UZQB 1F00I 1QRND 3S34L 3QEQB 4M48H 2NY2C 3STLA 3W0WA 3OG6B 1M56B 3OBAA 3R8QA 2DYPD 4QI3A 1WD9A 4S1DD 4LESA 4DGVL 2HRPH 1CD1B 1O7SA 5EO0B 4F33B 4L23A 2IV8A 4ZFZA 3JYCA 2YQBA 2IPTH 5LNGA 2IDFA 3H7BB 4N8PA 1KJ3H 1MHCA 1WK0A 1Z9MA 4IMLB 5FKPB 1TQCB 1SFDA 2LAGB 4O02A 3OKDB 1MVFA 1P6AB 2BOBB 2DQDL 4R90H 4XBMA 5J3HD 2QTVA 3KCPB 2EDLA 1Q94A 4JFDD 3GLZA 4EI6B 3OMZA 3QXTA 3DSFL 4WK0B 2X05A 3US0A 3NCBB 4KKCC 3ZDXE 1PZAA 2NXZB 5K93A 4UQEA 3RZWA 1HXYA 2JNZA 2O5XH 2YPVH 4ZUUB 4YSTA 1HSBA 1UH3A 3RVUD 3VFWB 4E5XG 3U1SL 1BV8A 2AK1H 1H5BC 1A9VA 2X1PA 3SYOA 4JCMA 1V10A 3BDBA 5FA3B 3RLSA 3SE3A 2OYKA 3P0VL 2X38A 2NTSP 2W91A 1AQKL 3RY6C 4ZFOL 2VR7A 1A7OH 3OKYA 5MEPB 2YD8A 1XZ0B 5C6TH 3LCYA 1IL1A 2M83A 2R69H 4D0CA 4G80B 1QFHA 1JVKA 1S7QA 3HZVA 5EF1A 2WNGA 5F96H 2BVEA 3KPQA 5KW9H 2D3NA 2Z65C 3L4WA 2CJTA 4I0PA 1S7UB 2NY0B 2QSCH 3V4PA 5PCYA 3QXVA 2Z35B 5IWLA 1OWRM 4ODUA 2O5NA 1NGYB 5JW4N 3O2VH 2PYFA 4WFGE 1KPUA 2X6AA 4M7ZC 3U7WL 2ZOTA 3JZ7A 1PZDA 3C60D 4QRRA 4JG9A 4ZAKB 5JOPE 3QS2A 5IREA 1MJ7H 3NIGE 4OZGA 5C3TA 4EBQH 4OV5B 5JHLA 4NHUB 3K6IA 3HB3C 4XX1G 4KK5D 1CZ8H 1M05B 2MQCA 5JHBA 2BY0A 3T8XB 3Q2NA 1XHHA 4AWJC 4LP4A 5DMKB 5HYSG 3S96B 4HOWA 5DUJA 3MUZ1 1KYDA 3UPRA 1I8LA 2UZYB 4PJ6A 1PQZA 4N2EA 5E9DA 1U91B 3DMMC 3OLEA 3GLEA 1CICB 3TO4D 3VH8A 2FECI 4LCWE 3CFNA 1TZ8A 3WDJA 2OJ1A 5JW3H 3IJSA 5GS0L 2HUEA 4HUWB 2BC4A 3CQPA 2BZDA 2WB7A 1UADC 2F54A 4GT0A 5LAPA 5LCVH 1J10A 2P49B 2Y06H 1QX1A 1I9IL 1C16B 2AVGA 3V0WH 1LO0L 4Q6KA 3RGBA 4PW3A 1PSKH 2ZOUA 5CD3A 4R26L 4F93B 4K7PL 1I7TB 3NIGB 4HXBH 1GH7A 3BMWA 1MELA 3E6FB 4N2MA 3F84A 2H3NA 2CAKA 5CXPA 5IMMB 3FQRA 2QTEA 3CG8A 2OP4L 4YHPA 5HHQB 2VJXA 3NSDA 2E9WA 5C08D 1PIGA 4F9LC 1OSZA 1KB5A 2YK1H 2ZXDA 4QTIH 3DX8B 4HWEL 3EJZD 3RGVC 1QQDB 2RIKA 1XGPA 1UVQA 4G6JH 2UY6B 3UTTD 4A6YA 4JR9L 2R1YA 4NKOA 3F8UB 4NBXB 4X4YB 5A3IC 1U6AL 1M9WA 4LARL 4XXCA 2XLLA 1FRGL 4XP6L 2IAND 1O0VA 3TCLA 2Y36L 2B59A 1DBJL 4JO4H 1C1EH 1CR9H 4X9HA 4ZX4A 1CFSA 4K15A 3LQAL 5LGJA 2QDVA 2F7PA 2NY3B 3OZLA 5HI4D 1JFQL 3ABZA 3QNXB 2E7CA 3KL0A 4TQEH 3RFZC 4XH2A 2MCPH 1KIUB 2WGXA 2HT3C 2OK0H 3L9EA 3CC1A 4Y4HB 4A7SA 1GYUA 1QLRA 4WU5B 3ARFB 5F7FA 1MVYA 5C0GB 1CFTB 4LPXA 1TETH 3W0WD 4CVUA 3JZYA 4Z7WA 1QBBA 2XVBA 1U8QA 1MFAL 1SJVA 5TF1L 2WHVA 4XOCA 2CHZA 3ZHKA 4UQ9A 1S9VA 5I6NA 1X4YA 5ABZA 4TLKA 3D0AA 3E0GA 2NY6D 1G4RA 5KSBA 1M2OA 1WT5C 3BKJH 3EYVB 3UMNA 4UDTB 2ODHA 2OMTB 3ROOB 1X7SA 1EPFA 3GO1H 3DDFA 1ED3A 2YD7A 5HHOA 5KYXB 1Q9OA 3S88H 3VDBA 4UQCA 2WTPA 4M61B 2K4AA 4M1GL 5F9WB 3FAXA 4ZFFA 3IVKB 2ZAHA 3QDGB 3HI5L 4LLUB 1OAYH 3RUGE 1SHSA 1C5CH 4A68A 1X3DA 1WCBA 3IU4L 4AIOA 3BGAA 4JFVA 1EJOL 3MNVB 4YPGA 2XICA 1ET5A 3PHSA 3GIZL 1EZVY 2BOLA 2VERN 2NXYD 3BWAB 4MLSA 3LZFL 4F24A 2FATL 4OI8A 1BM3H 5DZ9A 5EFIA 4G82A 4YQXL 1VEPA 1HHIA 5F1NB 1H3TA 5AAWA 5A6LA 5C0RL 5CSGA 1LTXA 4PREB 3LJ3A 4OCWH 8FABB 1OCCB 5IB4A 4ELME 4QJ5B 2NW3A 3WELA 4FI8A 3U9PL 2FLBT 2BS71 4S2SB 3L3OC 1E5YA 1F5WA 4LGPB 1ACCA 2BSDA 3N1GC 4N5ED 3IBOA 4OIIH 4O2FB 4P2OC 1P5UC 5E6ZA 4LBEA 3RUGB 1M7IA 2X3CA 4ODHH 4DP5X 4UNVA 2EUZA 1RUPL 3FN9A 3QJOA 2ORBH 2ZJSH 2A6IB 2OAAA 2J6EA 1TPXC 4M5YL 4XBGB 1E5BA 4Y2LA 3UEQA 4YAQA 5K59E 1II4E 5FO7B 2ISDA 5IW1A 1ERNA 1JPTH 5FX3A 3WHE0 1YEIL 2C9XA 5KG9B 2VMFA 3MFGB 1IGCL 2E76C 4LGSB 2Z91A 1WA1X 1FVDB 4G6AD 3L9YA 4AIXA 2AXHA 4XCNA 1ZGLP 1C08A 4XN1A 4HIHA 4ZMXA 3GWJA 4JJOA 1A4CA 2APBA 3J8F7 1MCKA 1EMTH 2ZKXA 2XN9E 1SN2A 5DRZA 3P73B 2XWXA 5E9DD 4N25A 3KJ6H 4LCUB 4BZ1H 4KY2A 4ELMB 4F8QA 4DWHA 2VISA 4LLDA 2ZSWA 3COOA 3ZL4L 5BCAA 3K4ZA 2XN2A 5DMJB 4WU7A 4CDGC 1AXSB 3TJEL 3TBVA 2CKNA 5F97E 4L37A 3FL7A 3ATFA 4JQIH 2GJZA 3A6BL 5IJKA 3WLBA 3UTZA 4J8QA 3NPSC 5SV4A 3AAZB 1KTLB 4ABUA 3IPFA 5K9JL 3FNKA 2GC7C 4UOW0 2GHWB 5DJDA 3D25A 4NP4H 4JHWH 2BP0B 4CJ0A 1HZKA 1FIGH 2OTWA 4K9EL 1HQRA 5FGBC 3T77B 3APFA 3KH4A 2J88H 1WO2A 3IDMB 2F5BL 2C8NA 3QRBA 4B5ZA 4M29A 3QXAB 1GCFA 1RERA 3BPOC 5D7SH 4UT7H 1SVZA 4Z7AA 2Q2EB 1AGDA 4DFHA 4AKOA 4UILL 3HS0A 1EZVX 2XN9B 3QYMA 3ZO0A 1BM7A 1S7VB 4M8VA 2O6DA 4RMVA 1OGAA 1MCRA 2AXGB 5A7EA 1ZLWK 3RZCB 3TP4A 2QPFA 5J6SA 1SHMA 4XGZA 5DD0L 2BO0A 2IDUA 1IGFH 1VA9A 3P30H 4LRNH 5DJ6A 4IBSA 1OE3A 4XXWA 4AW4A 4KUCD 4G8EB 1FHGA 2OMVA 1NCGA 3FCTA 3VFTB 3QQXA 5IEKB 4PRID 3WFHA 5DFVD 2NSXA 3TIDA 4Z78B 1T7XA 1OTSD 2IPUG 5SX5H 2D0HA 4I77H 4XX5A 4OCSL 1QEWB 3D69A 4KAQH 4K2UH 3PXJA 4RWYH 2VL5A 2BZ7A 2DD8H 1TTAA 4Z7UF 3RPIA 1KY6A 5LNDA 1GGUA 1E3XA 1AD0B 5IG7B 1FH5L 3BPCA 4JKWA 4PG9B 3EHBC 5TQ0H 5GGVY 4NO3B 2AJYL 4FFWD 2ZG1A 3CN0A 2DIAA 3HE6D 3DIFB 4G1EB 4PLKD 3TBTA 4JZJA 2OMXB 3F7VB 3WHXB 5KVGH 1ZE3H 5ICZB 1GTFA 5HHOD 2XBTA 1KBVA 1KELL 3C5ZB 3FZUC 5IOPB 2EDWA 1J1OH 2DJUA 1JNLL 1GZHC 4HJSA 4WFFE 1J1PL 4M1CC 1FNHA 4B0MB 5EF2A 5A2BA 1OHZA 1BFTA 4U2ZA 9CGTA 3CLFL 1T03L 5I8EB 1Q9LA 3QUZA 1NM9A 4ODTH 3G5XA 3LTVA 1XGYL 3H0TA 2NR6C 2EECA 5IGXL 4XC3L 1YECH 2E86A 5AB9A 3GQFA 3B7YA 3NIDE 4PD4J 1ETB1 1FBIH 5F1IB 4FQXB 4FQHA 1NGPL 3AVEA 4JGUA 4LQFL 3CCHA 1YNKL 3D2TA 2CCLA 5AVXB 4P57B 4IMKA 2DLFL 2XQYG 3MUY1 2WIIA 3TBCA 2RBLA 4NN6B 1UJ3C 1JZHA 1WZAA 2YXFA 4JDZB 1JRHL 1KC5H 1PIFA 3OKKB 3UAJA 4Z0XB 4HG4K 3F64A 4PRHA 1A1OA 4FXKA 4GW1A 3TPUB 4OGQC 4EI0A 3IDXH 3D4YA 3QEUB 4JM2A 2E8YA 3VGDA 1PFCA 3MRIA 3HRPA 5AG8A 4RA3A 2UX6A 2WPGA 3R06A 2EDDA 2VXSL 5C0JB 4Q9RL 1CU4L 3MV11 2JB6A 4UIMB 1L5GB 2W59A 3LS5H 2AXFA 2WUCL 3BKYL 4X5WB 3BVVA 4I5BB 4IU3A 1KYFA 4XCYB 3ILPB 2YAEA 3NIDB 1CVRA 3B1TA 4Z76A 1JZ7A 4L1BA 4AVKA 5F93C 3LRKA 4KKAD 5I6XB 4KKPA 4PJBF 1RZFH 4OUUA 3VI3F 1S7XB 3NRPA 2VQ4A 4I2XA 2YAPA 4GW5B 3PABA 1ITCA 5JOFB 1IC7L 4UMSA 4Z1PA 2QGBA 4Y8AA 1OQXA 2MJWA 3HG5A 4GKZA 3GSUB 3S5LA 2F8XC 1BVOA 1IB5A 4HKXA 5C3LD 3DGDA 5TDOB 4CMMA 1MCOH 4U0RB 3K1DA 4NXKA 1KXTA 1GZPA 1IKNA 1WFNA 4BQCA 1GKEA 1ETZB 2JI2A 2XPGA 1UXLA 1JF5A 3SKOB 3GHEL 3LH2L 5E2UH 4UTAL 1KIPB 1ZJBA 2AKRA 1B6DA 1XR9B 3CLEL 2WSDA 1JV5B 4TQIA 2ZUWA 4Y1SA 4YE4L 3TYFB 5ACZB 2ADFH 1SMOA 3AT8A 2Z64C 1C7TA 3QNYB 3QZWG 2IH1B 4FQQB 4JQVC 4KITB 4ZFOB 4PJXB 4XNBA 4NYLA 3H2QA 4OZ4B 2QPDB 4HH8A 4HBCH 3QSKB 5AKVA 2DEXX 3F05A 2A0LD 1JBJA 1I8IA 4MQXC 4ZW8A 1NBZB 2B1AH 5DYOB 2PNDA 1FAIL 2B4CL 2OMZA 2FL5B 4XCCL 3MRQB 1ACYH 3MJ9L 1MRFH 4G7VL 4ZRGA 3SBWA 1O6VA 1MAJA 3IAGC 2OV0A 4DGYH 3QPXH 4PRDB 3UZQA 3FQUB 3GJFB 4MA8H 4LHUG 1N3NB 1SXZA 3RVWC 5KS9F 1A4BA 4OF6A 1CLVA 4Y4KB 1UB6B 1L6XA 1QKZH 3JWDC 3QH3B 2QZQA 2NY5H 1GOGA 2FH6A 1JWSB 5BXFB 2CKBH 4F33A 5C6WH 3OPZH 2IDTA 2AJ3B 1ZLDA 5E1AB 4FZEL 1L7IL 3BE1H 3I85A 3H7BA 4I89A 3IRPX 3QS3A 3IFLL 4IMLA 5FKPA 3UZVB 3K71B 4Q6IC 2CR0A 4Z3TA 2BOBA 3EH4B 3S97C 2RQEA 2VN4A 2YEVB 2GK0A 2IF7A 2YN3A 3QO1B 3WNLA 4GKOA 5DLLA 4BHUA 1WTGT 1YJDC 3MA7A 4J3TA 1RZ7L 2D73A 3SDAD 2AFNA 4RMSA 3TVMC 3FUHA 4ZUUA 3VFWA 4L2YA 3VB8A 5B7FA 4PV1C 5EOCH 5ITFA 1IC4L 4XP4H 1PX8A 5FA3A 1XWVA 3WEXB 1I4FB 1T2XA 3LPGA 1JYWA 1GMEA 5MEPA 4KX8A 2AI0L 5C0NC 5F7EL 4G80A 1PDKB 3JWOH 3ZDYE 1AC6A 1MZZA 3EOBB 4XT1C 3L2NA 3JBG7 1S7UA 4N2OA 1NFIB 2Z35A 1BJMA 1NGYA 4DKEL 3B7UX 4DT2A 1ADQL 4RFEA 5AW4B 4GAAA 3RX8A 2YD6A 4AM0B 4RX4A 3V4UH 4CNIB 4A2GA 4U1SB 4E36A 2DM4A 2XV2A 1ORQB 1R19A 4BA0A 2R2BB 3BZEB 4OLXL 4OV5A 1Z7JA 2AF2A 2GKIA 3SDDC 3NJXA 3LQMA 1WHPA 1M05A 2VLJB 4G42B 4LKCB 5AW2B 5JIKA 2A9MH 3TL5A 1UCBH 5HDBF 1XBRA 4KKZA 2JKSA 1CL7L 4PJ9C 4UF7C 3AY4A 3R18A 4R2GD 2HAZA 2W9EL 4DO4A 3ZDYB 1U91A 4AC2A 1RZ8B 5JHMA 1COBA 1RIVH 2FYYA 2X10A 3NDZE 5CJQL 4PVBA 3ARSA 3R1GH 4HHAA 5ERWA 3TFKD 3ARVA 3PDOB 3SBRA 3V6OE 3Q8AA 3D52A 4HUWA 4HIPA 3PWLB 4UI2A 1ZKAA 2ITCB 1C12A 3IGAA 4XNDA 2KKQA 4KJPC 3F85A 5KBMA 2B2XH 1NCDH 2VDOL 3V52L 1CQKA 3GJFH 1UKQA 4ANKA 1I7TA 2NNXA 4L9LB 3DV4B 1MHHA 2HX8A 3D85D 4B9CA 4L18A 1X9LA 2VZVA 5IMMA 1HOEA 4C4KT 3ZO9A 2ZTBA 4FKKA 4U1LB 1R6VA 5I15H 3RYMA 4KFZC 4MQ7B 4EN2A 3HNSL 2ARWA 5CEZL 2AQNA 3DX8A 3FT0A 2F7RA 3NTCH 4N9GB 1NIDA 1QQDA 2V9UA 4IRSB 5HHVH 1A22B 2UY6A 4AQEB 2JELL 2V3EA 4LCWA 2G2RB 3MLVL 1E8YA 4X4YA 1ZVSA 4Z0BH 4HZAA 3O6FB 5CN2A 1AGFA 2OR9H 4DVRL 4S1DC 2FX7H 2CR6A 4GKLA 3UYPB 1IGMH 1ILUA 1ZLUK 4K8RD 3QPKA 3KBEA 2XETA 3VFGH 3IJ9A 3IM1A 1IFRA 1EQWA 1PG7H 1R5VA 3O2DL 5F7BA 4PN6A 1KIUA 2PP9A 5FGRA 6PCYA 4LOVA 1XGUB 4MJ4A 5J3HC 2YSSB 3BVDB 5IFAH 2W9DH 3E1F1 5C0GA 1CFTA 1MKFA 2AK4D 3GXIA 5I76B 5INCB 3HKZA 1MLBB 4L1TA 1JJUA 3H9SA 3L1EA 3C9NB 4YZWA 5JDSA 4A7GF 1CDBA 1JHTB 2ZWSA 3VAEA 3RVUC 3EYVA 2EYSB 4ZYKA 3G6AA 2OMTA 3ROOA 3DOHA 2ZQKA 4WI4A 5D72H 1AHWB 2YPVL 4AZUA 5EEVA 1EXUB 5EO1B 1GGIH 2O5YL 3B2VL 1HKLH 1ZXQA 4BH7B 3IVKA 2X4TB 4LLUA 5BUPA 3MR9B 2G2PA 2L4OA 2W9LA 1KUMA 3S37X 5A2FA 2NXZD 3ZTNH 4N0RA 2ATPB 4MHHI 3FONB 4GG6E 2PCYA 1G84A 2ENSA 3BWAA 2Q86A 1KGJA 3HG3A 1RIHL 3LIZA 4N87A 2ZKWA 1LK3L 1N7MH 2MQ0A 1TTFA 3DOSB 3PL6A 2BINA 3UYRH 2P42B 3AWEA 3IU3B 1KXVC 5F1NA 1S9YB 3C60C 1DYZA 4F5CE 5DD1L 4UV7L 3HZMB 4F2MB 2DQMA 2GG1A 8FABA 1N26A 5E9AA 2HUHA 2Z8SA 4N2CA 4KK5C 2HA1A 5I66A 3MJ8B 1DSYA 1INQB 4JPVH 2NY0D 5L0QC 1DJGA 3QIWB 4EBQL 1MWAL 1A6TB 2RB8A 4HEME 1K9TA 1MFBL 2XBZA 4O2FA 1OM3H 1Q72L 1CZ8L 1LDPL 1MNUH 3NZ8B 2DTMH 4AV4A 5TFSH 4RX4D 5ALBH 4BD4A 3TO4C 3MRNB 1Z6JT 4ZMTA 4GG6B 5FS5A 4NQEE 1EGJL 1JCVA 5BVPH 5FO7A 2FWOA 1CE6B 3QZPA 1FVDA 1E42A 1RJYB 2MMXA 2BSSB 3PGDA 2MNWA 2J5WA 3GPEA 4JPIB 1DVQA 4QR7A 4QPEA 3NSJA 3MXVH 2VO5A 4ZZFA 4PMEA 4HIIB 1QW9A 3F62A 2J5LC 1BOYA 2BNQE 2P8PB 1BQLL 4LCUA 4ELMA 5IBTH 1Z2KA 4N2IA 2HYMA 4FDWA 5I8OH 4NZDA 4R0LB 4O2CB 4QIRA 2NDFA 5KSAB 1DN0A 15C8L 3L3DB 4WFGD 5CU9A 1DQIA 2JV6A 4P2AA 3EJZC 4GKNA 1XVSA 3QG6B 5JOPD 3AAZA 4NQEB 2XI9A 4NUJB 2FQEA 5EU6D 5F0JB 4QTIL 4XE0A 4ALAL 4WI5A 5DO8A 2WP3T 5H35B 5CP7B 1A9BB 3T0AA 4NRYA 3TN0A 4EDXB 2IG2H 2WLYA 2E6JA 3ABGA 4TVSa 3MACH 3OKEB 3ZXAC 3NRQA 4U1NA 1ZT1B 1KBWA 3FB5B 1DVXA 1QNZL 3T2NL 5D7EA 4F9PC 5ELIA 2HPTA 2WTRB 2YRLA 2WQ8A 5HI4C 2XN9A 4MXWL 3CVCA 1E4WL 3BVWA 4J6RL 1CXHA 4LCWD 4LXFA 2AXGA 1CXIA 3RZCA 4PSPA 3GSVB 4CAGA 3I6LE 2XJKA 4Q74A 3ULAB 5EEWA 5HHNB 4TQEL 3BEWB 3A21A 1VESA 2YARA 4MNQD 4N2KA 3VFTA 3A24A 4XNXL 4AQAB 1PZCA 2ZZUT 2P8MB 1TJHH 4P5KB 2DM3A 2NY6C 3MZGB 5E6SB 4Z78A 1O5DT 3Q8EA 4JCWA 3PWPE 5DLML 3GBNH 3VVVA 4YXLL 3ZMRA 5DEGB 4C54A 1A4JB 1RZKH 4K94C 2DMCA 4BGLA 1MF2H 2V3DA 3WE6A 3DOIA 4WWKB 1M2VB 5BO1L 3FRPA 4OI9A 2PR4H 1XO8A 3VFUA 1IUZA 1AD0A 1I85C 3DX2A 3GO1L 1U3HA 3H9SD 3NABH 4G8AC 3QQNA 4KV5E 5IG7A 5KOMC 5F71A 3S88L 2QFRA 3I84A 4NO3A 4UBDD 4A2HA 5DJ8B 2NXYC 2YZ8A 2ZG2A 1BAFH 1UOWA 3DIFA 5BW7A 1CLZL 4JFSA 3NA9L 4G1EA 4IIZA 1SYVB 3SE3C 3F7VA 3WHXA 3VFVB 1XAUA 3HNVH 4P5MB 4QXVA 1VFAB 2PWEA 3C5ZA 5IOPA 3WGVB 4W9FC 3EJCA 4R7LA 4UU9B 4PGBA 3PWPB 4FFZA 4UZSA 2H2SC 1DQQB 1J18A 1HHGB 1R3IL 4FADA 4Q9BA 4IOFD 2GJRA 2WO2B 3WYRA 4I3GA 2CDGB 5AZ2L 5IWLC 25C8H 3WUWG 4UOZA 3P77B 2R29A 3QJFB 2BSEA 2R0LH 4NZTL 1I8KA 2J44A 4N5EC 1SQMA 3RL2A 3CUPB 3RWGB 2M26A 3VACA 3PL6D 3HE7A 1TCMA 3JV6A 5HJDA 4BJLA 2JFCA 2PN5A 1A25A 3ZTJG 3DX9A 4OIIL 4P57A 1CGUA 4Y2OA 4PTUA 1L9PA 1F86A 1B2WL 5CEXB 2GI7A 4JX0A 4G6AC 2D3JA 3OKKA 5JIDA 1JV2B 4OVVA 1JPTL 2YLHA 5GZOA 1KB9K 4O4YH 4AE1A 1R46A 1ZGLM 3VXPB 3CNKA 3QEUA 1A21A 5HXMA 1N18A 2XRAL 5FHAL 5C0JA 5KVFL 2VDRB 3QHZL 5DEFB 3KVPA 5EG6C 1U3ZA 3L6FB 5HHXH 4H4NA 4UIMA 3HFML 5ADOH 4H8UA 1TTRA 4X5WA 5FA4B 3W5MA 4I5BA 4LFHD 3RIFK 3ILPA 1X5GA 3QO0B 3JT0A 1OW0A 4AW7A 3MRBB 1S7XA 1J88A 1I53A 2VSCA 4GW5A 2E3VA 3ARUA 4GSDH 5JOFA 4X0NA 4XCFH 3UROR 3DUUB 1HSAA 1F4AA 1SY6H 2BDNH 3GSUA 3WNJA 3B2UD 4NP4L 4G5ZL 4OQTL 3V0VB 1UD3A 3CU7A 3WO4C 1M7XA 4DK6A 5TDOA 4NUGH 1I3RB 1FC1A 4QRSB 1ETZA 3MRPB 3DECA 1J8RA 1KGWA 4NQSA 3LNFA 4WWPA 4IIQB 3SKOA 1OPGH 4HD5A 1KCKA 3EGDB 5L4IA 3SEPA 5HDBE 4XXCC 4XZ4A 3TN0D 1XR9A 4AVIA 3T04D 5KANG 1IMHC 1AP2B 1BF2A 2XQBL 5ACZA 2H32B 1UFGA 2WLKA 3DTUB 3QNYA 3X14B 5C0BE 3I6GB 2IH1A 5DFVC 3C08H 3QZMA 4FQQA 3T0EE 4ZFOA 4QO1B 1G7MB 4OZ4A 1EJ8A 5I9QB 5IR1B 3UBGA 1OTSC 3OXRB 4ZK8A 4KNSA 2WD0A 4DQOH 2EDFA 5L8JB 4X9YA 2IO5A 2GC4C 1A7RL 3M8OL 1KEGH 3MOAH 5KJRH 2FL5A 1A7BA 4ZD3H 3GUTB 2WK2A 2F7IA 1CN4A 4KAQL 4C56E 3EBGA 3N1MC 1FDLL 2WOYA 3TT3H 4MA3B 3MLSH 2DD8L 4FFWC 2AJSL 3PGFH 4JL1A 3AUWB 1RUML 3HE6C 4GOSA 1DVFB 3IDYB 4Y4KA 1R4XA 1IGTB 2UXTA 1UB6A 4PLKC 2W94A 3HI1B 2X89A 5C0FB 2BSCA 4F7EB 5T1JA 1E4HA 1JWSA 2A73A 1J5OH 3FAWA 3US1A 4IBYA 1AXTH 1C5DB 4G11A 5C0BB 2AJ3A 4JY6A 4JFZH 3MLTB 3VSVA 3T0EB 4MWFA 2N0KA 5F6IC 1P5VB 1U3HD 3CGTA 3K71A 1BPLB 1O7DE 1WITA 3DX7A 3Q9PA 4LSUH 4W9ZA 4B27A 2WAQA 4GXFA 1UT1A 2D7MA 1A7PL 1SXBA 3GHBL 2VWEE 3LN4B 4NAQA 4CKQA 1JVLA 1QEXA 1ULVA 2R0KL 2YBRB 5I8KL 5JYMA 1J9RA 2DF3A 4C56B 2A38A 4ODTL 1HL9A 3FCUB 2VDRH 3NSFA 5AAWC 2D31B 1UWEH 3C5ZD 2CK0H 1G7PB 1PEWA 2HFEB 1X6LA 4PI2A 3BD4A 2UWEE 3MRJB 3FDWA 1TFPA 2VC2B 3O3DB 1F3DJ 2WLLB 1I4FA 3CVDA 4XO3A 4I3SL 4BWUA 5C86A 1Q0YH 4FQCH 1E40A 3Q5OA 4AQZA 5J89A 3WIIH 1BZQK 3GM0A 4LKXB 1KC5L 1QP1A 2VO8A 3SJVE 3GI8H 1PDKA 3HE7D 2EO1A 3JWNE 3L2LA 4KXAA 1MCNA 1NFIA 3ARTA 3IDXL 2DJ4A 4MS8D 2BVQB 4HBQA 3UTOA 3C75A 2XPZA 4CVWA 1AXIB 4CW1B 4FERA 4JPKH 4AM0A 4K3JH 4P9HC 4FHJA 4KKAC 2LQRA 4U1SA 5G4MA 7PCYA 5GZOD 4DP1X 1WZ1H 3L1OH 2XWEA 4WFFD 2R2BA 4RA0C 3BZEA 2UWEB 2WCGA 2G3NA 5EBWB 1CF8H 5SX5K 1RZFL 4G42A 2ICWI 4LKCA 2H32H 4OFQA 3OAUH 3NACH 5I1IL 2X1OA 1QTYT 4N8VG 3SYAA 1NOAA 3B4NA 5IJKC 3PV6B 1QLEB 4NAMA 3SJVB 3AS3A 4D7BA 4FA7B 5C7XL 4DN3L 5IM7A 1RY7B 4HPYH 5JR1L 3HC0B 1UGNA 5IVOA 3ZYIA 3ULUL 2XZQH 3OM3B 4BQBA 1PNDA 2NUPB 3OQRA 5D93B 3VSTA 2Y2YA 5E9NA 1MQ8A 3PWLA 3NCFB 1MAMH 2YRZA 5EA0H 2BWQA 4J3BA 4V33A 3EXJA 3LZQA 1VFUA 4AEHH 2GIYA 4TLUA 3ULUF 1PFOA 4TULL 1U33A 4P4KD 2P5WE 3DV4A 4M56A 5TDNB 2YEQA 4E9YA 5D96B 3TZVB 4HJEA 2VW6A 2A0LC 5AALA 3S4SA 4BCYA 4U1LA 2OL3H 5IIEB 4MQ7A 3CXDH 3EFOB 4HBCL 3SD5A 4GNKB 2Q5BA 3OZ9L 3VX0A 3KYOA 4N9GA 4IRSA 1QBML 2QQNL 5FUOH 3L2MA 3OKMB 3LXCA 4AQEA 4XRCB 1MQKH 2G2RA 3A22A 3BKCH 2OR7A 1YC8A 1ES0B 4A1RA 3O6FA 1TSHA 1NA8A 5FK9B 2LFEA 1INEL 3EIFA 3QPXL 4NLAA 1EV2E 4KTDH 4FQLH 3SDCB 1F3JA 3L5XL 2HN7B 1WFIA 3OWRA 4M4PA 2QKIC 2P5WB 1KENH 4OGZA 8CGTA 3IMWA 4BM7A 1UACL 3V79C 4PJ8A 1XGUA 3DIVA 3Q43A 4F7TB 1N5YH 1OAXL 5DURB 4KQ3L 4AYGA 2WQAA 3UBXA 1J5CA 2FAUA 1LXMA 2AGJH 2DEWX 5I76A 1UM6H 5INCA 2X89D 1MLBA 2D7PA 1CDUA 5AD0B 1LEGB 3SDAC 4FABH 4ERSL 5E5MB 4MAYA 2AITA 4IGBA 4DERA 4UT6H 3UACA 1XL6A 4ONHB 1NOLA 1WJ3A 4MD4B 3ZKSD 4P2YA 4D8PB 1AHWA 2AQRA 1OF0A 1MCLA 1E9PB 4XP4L 4BH7A 2CLRB 2X4TA 1MREL 4PJCB 3ARBD 5GS0D 3DI2B 3O4OC 1S3KH 4LL9A 4BWWA 4NSKB 1G9EA 1Z9SB 5L8KB 1RLWA 3N2JA 1JWUB 2ATPA 3FONA 1I9JH 2YXMA 4YVNA 5I2IB 1U8MB 2PYEE 4IMKC 4XPHL 4KTYA 4A7UA 5B8CA 1HC1A 2C3GA 2OMBA 1E50A 2DBJA 4JHBA 5D1QE 2BVPB 3DBXB 1UZ6F 3JWNH 4EO5A 1S9YA 1KN4L 1UA6H 4FXKC 5DJYB 1AQ8A 3HZMA 2X28A 1T5KA 1G9MH 4AQOA 4K5LA 3V0IA 5IB5B 3MJ8A 1A3ZA 2AEQH 3LMJL 2NCEA 3VXQB 1P7QA 3CFJA 2BRRH 3QIWA 5EZPA 3C09C 1PL3A 1SMDA 2CDEA 3BIAX 1L9SA 1XD0A 3NZ8A 4LSTL 3HW7A 5SWSA 3S2CA 4N24A 3TEYA 2TSBA 2A9ML 4JQXA 2XVKA 3MRNA 5AQ0A 5H37G 4EE2A 5I1JL 4GG6A 2L7QA 1EO8H 3AY2A 2PYEB 2EKSB 3NGBC 1RJLA 1NL0L 4H8WC 3TFKC 1SJHB 3GSWB 1MFEH 1RJYA 5IJVB 4M6ML 1JERA 2BSSA 3PWNA 3EYUH 4JJHA 4JPIA 1WD8A 2EXTA 2H9GB 1N5AB 1A6ZB 3KR3H 1ASQA 4F5CA 4DEPB 4RFOL 2JIXA 5LBSH 1WV7T 2LABA 4J3WA 1A02N 1WIUA 4QGTA 4XMPL 1CXEA 2ZOLB 3L7EB 1XT5A 2B2XL 4FQJH 3RNKB 4NT6B 3VRJA 4JY5L 2V5TA 3HMXH 3AQDA 4GXVL 1X9UA 1TFHA 4PBWD 4R0LA 4MMXB 4YZFF 1A5FH 4HEMA 4OGYL 4KKRA 3PFUA 1CT8B 2BFVL 3L3DA 3SQBA 1V7MH 1YMMB 2WXLA 3AXLA 4NHCL 3F6JA 4RMRA 3AABA 2EKJA 4TNEA 4BEIA 3VTMA 5DVKA 5DZAA 4NQEA 4PRAB 1FNAA 4NUJA 3FUEA 3WTXA 3KPOA 5E99L 1BQSA 2Y7NA 1KTJA 4AQ1C 4XO5A 4CSTA 5CP7A 5H35A 3FF7A 5AOMA 3GK8H 5HHVL 4EDXA 1S6NA 2P1YA 4FTVD 4OLZH 3KJ4B 1XDTT 2MPAH 4ICWA 3U0PB 5J6GB 3Q3GB 1ZT1A 3FB5A 4M7JL 4K8RC 5KVFE 4Z3JA 1RPUA 1NM4A 4JFFE 4JDTH 4LNVA 2BNQA 1EEQA 2X1QA 1HCVA 3FO1B 3R7QA 3SBWC 4LVNC 2OW6A 2Y7LA 1RQ5A 1U95B 3GSVA 5B39G 2GYSA 3UC0H 2XZAH 3IK2A 2YAFA 2UZIL 4TUKL 3WAKA 1PG7L 2DYSB 5HHNA 3DHJA 5L2KE 4U1MB 3BPNC 2W9DL 4AQAA 3SD2A 3EOTH 2P8MA 4P5KA 4NQQA 2AVFA 2ZD0A 1RHFA 1FORH 3VGFA 3GNML 2V2WB 1SYSB 5IBUG 2CO6B 4PJ8D 3GC3A 5DEGA 5GRYA 5E70A 1YLBB 2ZCKH 4NFCA 2OSWA 4TSAL 3E2HC 4YK4B 3VGAC 2JCCE 2GI0A 2K3TA 3FULA 4WWKA 5C1MB 4G6KH 4JFFB 5DR5H 2WGNB 2VSMB 3KYKL 3SKMB 1I1RA 4HIXL 1XTMA 4MAYD 1NCUA 1I9EA 4IGBD 2NT0A 5DJ8A 1QG3A 4LVHB 5CGBA 5AYUL 5E8DL 1ONQB 5L2KB 4YHML 2CLZB 3VFVA 4P5MA 4V2CB 1VFAA 3PRZA 4M5SA 4OGAD 3GJFK 1KV7A 5E8NB 4UU9A 2RFXB 1RUKH 3OB0H 3PWPA 4WNQB 3X1EA 1H3PL 1ESOA 3ARDD 4JFOB 3ALXA 1TQTA 2VXQH 4OF0A 3ZZQA 1HHGA 2UUDK 4AJYV 4KQ0A 3LN9A 2Y1AA 2CDGA 4PCSA 2NY0C 4DVBB 4DO6A 4K23L 5JW4M 1AANA 2E7LA 1G9HA 2JCCB 3P77A 3QJFA 1QASA 4UB0H 1IEBB 3QHFL 3CUPA 3RWGA 3V4VB 4C58B 3P9LA 4UTAA 1DDHB 4Y5VC 1BVZA 1AFVL 1B2YA 2ZYSA 3G5ZB 3IMSA 5I1EH 1RULL 35C8H 5TE7H 5DD3L 1OKEA 4Q97A 1D5IH 3Q0HA 1MNUL 4AL8C 5J6HB 5CEXA 1UWFA 4R97B 5ALBL 5TFSL 3O8XA 3CX5K 4OLVL 1DL7L 4IS6B 3LKSB 5BVPL 1AYOA 1JV2A 1X5JA 3WKNA 3BN9D 3RP1A 1P7QD 3VU2A 3VDAA 4BSJA 3QIWD 3U0TB 5F7UA 4ZS6C 3N85H 4RBPH 4PGZA 3BQVA 3V8OA 3VXPA 3PAVA 4ONGL 5E1GA 5SWSD 1QSEE 4UIKH 2WXGA 2BVOB 5AVRB 5DEFA 1N9PA 3MJ9A 3P4MB 4X8CA 5T5FL 2UVEA 3BEVB 1ZWIB 4CSSA 3WJMB 3TT1H 5FYJE 3ZKXB 2HTLC 3O2WL 3VXME 3QO0A 3VRIB 2GEQA 1ROWA 3MRBA 5I8OL 2VKWA 1YNLH 2JIXD 4GSRA 2SODB 2GT9B 1EBAA 4WW2B 4JHAH 1QHPA 4N3TA 4EIBA 5LGHH 3DUUA 1BSIA 4D94A 1I1AA 5BQDA 3V4LA 2EC8A 3V0VA 4MB5A 3O3EB 4LDLB 2AABH 3DGGB 4OCXH 1T1YB 2IG2L 4G1MB 2W60B 4YSRA 2JJTA 1I3RA 1JPST 1QSEB 1H0DA 1IAKB 3MPCA 1XF5B 3MRPA 1A0QH 4GI9A 4BK5C 2AZUA 2F8OA 1FFOB 2CIIB 4IIQA 2OYPA 2ESVE 3SE4A 3BIKB 4PJ5E 4NKMA 3KXFE 2HB0A 2V8LA 3K74B 3L5WA 1I7RA 4JRYA 2YPKA 4UOJA 5JQ6L 3B83A 4MLIA 1C8QA 2CUIA 1ZD6A 1AP2A 2O26U 3KVQA 4GSQA 4CBPA 1XSOA 4I9WD 3MKKA 3ATBA 4IYKA 5E5LA 4Q0XH 2W07A 3UGUA 2VDKB 1TZGH 4EF3A 3X14A 3I6GA 3MHZA 4BCXA 2IQAB 1UM5L 2BNQD 2IV9A 5IR1A 2Z0UA 3OXRA 5BS0D 2SEBA 1BMGA 3PWJA 5ITBL 1TJHL 4YEEA 2Q8AH 4U4BA 5DS2A 4YC2B 4BSVB 5EBMB 4XBPB 3CHQA 1KLFB 3O9WA 3ULUE 3C5JB 1AGBA 1EAJA 5LDSA 4KNUA 1RZKL 2E56A 2JQZA 4EN3B 3T65A 2XIIA 4ZS7H 1ADQA 2A6JA 3S36X 4MA3A 4XZUB 3TM6A 3QQ4B 4YO0B 4FE9A 2ESVB 1G6VK 1X5AA 4UBDC 6PAZA 4PJ5B 3NIFE 3NABL 1DVFA 1H15B 3IDGB 1ASOA 1IGTA 2KS0A 3A67H 1N4XL 2X6BA 3L16A 3MRCB 3HI1A 1LMIA 3V4VH 4B97A 1NDGB 2BY3A 5EEZA 2WCPA 1W16A 3VI4F 4AT6A 3K91A 2EIZB 4PWEA 1BAFL 5DJAB 5F9WC 5C0BA 2NTFB 5J11C 1XB6A 3T0EA 1ZSDB 5JNYB 1AOHA 3Q06A 1P5VA 4IK6A 1EFQA 3BVTA 1AAJA 2CGRL 4G72B 3ULVH 2IOOA 1GKOA 1T1XA 3HNVL 3FO2B 4NBZB 1JTOA 3SGKA 4BH8B 4IOFC 3I6LD 2EUWA 3LN4A 4FJZA 2OXHB 2QELA 1FNSL 1NMCC 4PCYA 2GTWB 2YA0A 1NLBL 3OMNB 4YE0A 1UUNA 3BVNB 3BZFB 2YBRA 2Q3AA 4OVUA 1T0MA 1FVCB 1HXMA 4C56A 3BWUC 1TO4A 3IKCB 3PL6C 4GIPD 2VR8A 25C8L 4X7FC 1T1ZB 1XD1A 4HOMA 3FOMB 1G7PA 3ES6B 3N41F 4GUPB 4HXAL 4QAMB 2TSAA 3NIFB 3PWPD 4XX1E 2OSYA 3MRJA 2XIBA 3VXRE 1IGIL 3TBWB 1SQ2N 3LZLA 4YBQD 3W56A 5SX4I 3O3DA 2WLLA 4QAWA 1CYXA 2PXYB 5EOTB 1WGVA 1KDJA 4RGND 1GR7A 2DBLL 4LKXA 4AGLA 2OYMA 5CZKA 2OKMA 4GRMB 4JJ5B 1BG9A 1VJSA 1MW0A 5K9OB 5F0MB 2GTQA 2KI6A 3LNGA 3P4MA 4ZXBD 2BVQA 1QSFB 1W9XA 3O8XD 4YSOA 4CW1A 2NY7H 3O0RL 4QYAA 1GGBL 1HH6B 1R75A 4AEIH 2Z8WC 1G4MA 2BWDA 1OOAA 2W1NA 5EOQL 1HNGA 2J6WA 3DROB 3OHMB 1JGLH 3VXRB 3MRHA 2YA2A 1N70A 4QTFA 2R8SH 4HU8A 5IFHH 1CD0A 3EFFA 3O2DA 3B2UC 4RLDA 2VDKH 5JO5B 5DZJA 1UZ6E 4IBTA 1RV6X 2PCXA 5SV3A 5KJ4A 2WUBH 1KTRL 2FDBP 3PV6A 3SJVA 4JRXD 1QFWM 5ALCL 3RI5F 3NEEA 3GUTA 4UM9A 1FCCA 2OTPA 4GH7B 4PWIA 5DS8B 5IMOB 1E6JL 1T2QL 4ZFQA 3TN0C 4D3CL 3GMOB 1WBZB 1WDAA 3UL4A 2J71A 4DKFH 2HVJB 3KW7A 4LDCA 1I1AD 1FNFA 4N9OB 4XPTL 3ARED 3HC4L 4M62H 5F0PB 3OKOB 4NI6A 2CXKA 5KVEL 3A5VA 3HHRB 1NMBL 5HDRA 5I1AA 4TVUA 3F7KA 2WLZA 3AG4B 2VITA 2MFNA 1RK1B 4MJJA 4WNJA 5IIEA 3QUYA 3EFOA 4JRYD 5CZRA 1A6VL 4DQOL 4RZCA 5AB1A 5AW0B 3V95A 4K5OA 4MJ5B 1EJ6A 5E1IA 1J8SA 3OKMA 4XRCA 4AGPA 1BBDH 2CJSA 5HYFA 4UQ2B 4ZD3L 2VDQL 4Z5RB 2VTFA 3UC2A 3FQ2A 1HE7A 4YZFE 4PGDB 5D71H 4IQHA 4XN9A 3GSRA 4HIQA 4HWUA 3PGFL 5D9SB 3WIHA 4P0DA 4QHUB 3ZE0B 1BYOA 4RAUB 4WGVB 4IJ3C 3O9WD 2QPUA 2ZXWB 4WCYL 4XO8A 1U3HC 2YJQA 1MWAA 5C0DB 2A83B 3HZYB 3T3MF 5FM5O 1IRAY 4IRJD 2DWYA 1N12A 1GVIA 3SGEH 3APNA 4YLBA 1DVFD 4ZMLA 1EGJA 3BT2H 5I30L 1MH5B 5FCUL 4X9FA 1U21A 4JFXB 5AD0A 4HCGA 1LEGA 4DAGH 2DMBA 1D9KA 5E5MA 3C5ZC 5C0BD 4KKQA 1IBYA 2OQJB 4X6EB 5D1XD 3QJXA 1FHNA 4ZMQA 4AK1A 3HZKB 4ONHA 5T1KA 1PZ2A 2ZX8A 2EC9U 2CK0L 1DJWA 3RDTA 4HLZG 1ZANL 5J12C 3TV3L 5KVDL 4KK9D 3GMRB 4YDNA 4BKSC 3UDWA 3SGEI 1BVLB 1YAZA 5HI5D 3HE7C 4NOBA 1L9NA 1JWUA 4FHBD 5AW8B 4LLVA 3H3PH 3GS7A 5I2IA 1MFCH 1U8MA 4RESB 2ADGB 2WXPA 4JDEA 4MS8C 5DS1A 1P4LB 1URLA 3U46B 1NBQA 2H45A 3OL2A 3DBXA 1JN6B 1NCBH 3ZHFA 5GZOC 1RZJC 5DJYA 1YA5A 1EEYB 4N22A 4O9HH 5E2WH 4H0GA 4G3YL 3VWKC 4DTGH 1MZYA 4JPKL 1TDQA 2AS5M 1MIML 3R8BB 4Y9EA 4K3JL 3KGUA 5CEZD 1WZKA 1P53A 2GY7B 5IB5A 3ILQD 3AC0A 1WZ1L 2N01B 2NY2B 3L1OL 3VXQA 3GZOA 4OD1H 3TBSB 1CE1L 2GSGB 5G55A 1G6RB 1ZXKA 3KZ8A 3F3HA 5ISZA 3QC6X 3RWCA 1SOQA 2FJGB 3CSYA 1MOEA 1MI5D 3OAUL 1E2ZA 1MXDA 3EJSA 3KNBB 1U93B 2ZWLT 4YHNB 2JQAA 4TVPL 1JD7A 2EKSA 3FFOA 3GSWA 4WI0B 2DTSA 1K85A 1QOKA 5IJVA 2ITFA 4X2UA 1C5BH 5D1QA 3RL1A 1FP5A 2H9GA 2XZQL 1N5AA 3PXHA 2PMZA 3U1PA 5LN4A 4FFVD 4P4KC 4JB9H 3V9CA 2ZOLA 2CUAA 3DX4A 2OZ4L 1H5BB 4P46C 3HRZB 3RNKA 4UM9D 3VMPA 4FJYA 2H6UA 4V11A 3WMQA 1CLOH 4KRNA 3KWVA 4WQOA 2AQTA 4ORGB 2Y23A 3QR0A 3QXDB 2F1BA 3KPNA 1P6FA 3S35H 4X6CF 1YEKH 2ARJB 3RWJB 4ZMPA 2OL3L 3GEWB 4XP9L 4PRAA 2CMRH 2G4GA 4L3CB 3SQOL 2OXGB 2ZCLH 4P8QA 2ZUQC 4U6TA 1BFVL 2VXTH 4HOXA 1MCFA 2HZHA 5LG1A 3U0PA 1TQUA 5J6GA 3Q3GA 4Y5XA 5EC1B 1IFHL 3NCYS 1HOCB 3QIBA 3QUYD 4M7ZB 4CC4A 2ZE0A 1MCJA 5D7LE 4DZ8B 3KD4A 3NK3A 4B9PA 1KCSH 1M9SA 4H20H 3WI9A 1WA2X 1FVEA 2BFGA 2DN7A 4KXZH 2FX9H 4FQLL 1BJ8A 3TYGH 3FKUS 5IUCA 1EHLH 4B5EA 3AFLA 2A9NH 2I27N 2AXWA 3QFJE 4H1LG 3KS0J 5IJCC 3VQ1C 3MRLB 2VLKE 4F37F 3SPJA 4R4BB 2Y7QB 4A7QA 3F00A 4YFLI 2FSDA 3LAFA 4PJDF 4GO9A 1YEDB 5JW4Q 2VAAA 4UCFA 4LSSH 4DFIA 4PWFA 4K7PX 4GSUA 2YEZB 3MBXH 2AGJL 3DMMB 1R3KB 1TEFA 1UM6L 2CBMA 5KTEL 1TZOA 1G87A 1F2XK 4GRWH 3LZOA 4XN7A 1SYSA 2CO6A 2XA3A 5DSCB 1D7DA 4HH9B 3DYPA 5DURD 5L7XH 1W72L 4KXZI 3UADA 3DJZA 1HWHB 1YYLH 4JFFA 5D7LB 4D0BB 4EUPH 4L8CA 1YEFH 3WSQH 3ARBC 5GS0C 1W15A 1GW6A 4JVPA 4N2GA 3SKMA 3WXVL 2ED7A 1D9KD 2IDCA 3OSVA 4K3EH 5JQHC 3BKML 5HI3D 3MLXL 4XVTH 3QFJB 1G6RH 1OAZH 1DBML 1MJ8L 2VLKB 1A4KB 4HIEA 5L6YL 1ONQA 5L2KA 5T1KD 3AUVA 2CLZA 1AZNA 1I9JL 3RDTD 2MEJB 4J23A 4L4TE 2WXOA 3AG3B 4PBVC 3RGVB 4JFUA 4KPHL 3CSBA 5DI8B 2RFXA 3PU7A 4WNQA 4OQTA 4JFOA 3W11D 2XWZA 4Q89A 1TYEB 2D7NA 4N2AA 2H1PH 3LS4H 2CRZA 2PCPB 2XHNA 5D70H 2MOQA 2EH8H 2ZAIA 5C7ZA 1G9ML 2JCCA 5D8JL 1MCSA 2I69A 1O75A 1IEBA 4NQCE 2XVLA 3V4VA 1P9MC 4RMWA 1WUZA 2X0VA 3FU3A 3APDA 1JDCA 2OZNA 3L3GB 3G5ZA 4LDOB 3MODH 3ATAA 4L5FE 1N19A 4YXKL 3RFZB 2IXQB 5DVMA 3STZB 5J6HA 4J12A 5ANME 3TONA 5ENWB 1Q9WB 3IS0X 4KGLA 3LQAC 2XN1A 2FBRA 3QQ9D 4IS6A 1ILSA 3LKSA 1HCFX 4L4TB 4ZTPL 3U0TA 3NJFA 5FOBB 3OG4B 3W3BA 5ISZD 2ZNXA 3EYUL 4G7QB 1E4KC 4WO0A 4KKNA 3B9VA 2BVOA 4NCDA 1OIOA 3L8QA 3QCUL 3OPUA 4AYDC 3B37A 3TEZA 1ZWIA 3VRLF 4N6QA 5T3ZE 3QIUD 4NQCB 3NZHH 3WJMA 1AQDB 3ZHNA 4N2LA 2ATAA 1XR8B 2IQ9H 4FYSA 3VRIA 1KCUH 2OFQA 5D1QD 1TJMA 1NKRA 3QB7C 2GT9A 4WW2A 5JDJA 4HJ1A 2ZOWA 3OF6D 4AC4A 2AQ3A 4MYWB 4PJ7E 1G1OA 4UDUB 3N9GH 2VB5A 5EIIA 3RNQB 3DX1A 3O3EA 3Q6GL 1KV3A 2EZ0D 3DGGA 4LLMB 1T1YA 1DQDH 5D4IA 3VA6A 4AIZB 4G1MA 2W60A 1ETJA 4N2DA 1QSEA 3E80A 1IAKA 1JAEA 4D9RE 4BDVA 1XF5A 2FQGA 1DFBH 3OXSA 1KBGH 1FFOA 2CIIA 5AYTA 3BIKA 4GUOA 3E38A 3L3OB 1ZHLB 2UXFA 4YPJA 2CPCA 3VXMA 5GRVK 3WAJA 1U8NA 5GRZA 2EACA 3N91A 4P2OB 1P5UB 4LMQI 3QIBD 2AEWA 3DKHA 3CFEB 3LKQA 5GS1B 1KFAH 1TPXB 1QUPA 5B7MA 4PJ7B 1V7NL 1W8EA 5AENA 1WBYB 4HX1B 4PJ8C 2HFTA 4GXUN 1H8OA 3MXWL 3T6WA 2ZYHA 2AAAA 1X5KA 4HJJH 4BSVA 4J3OG 1R3LA 3BSHA 3DTDA 4M93C 5EBMA 4XBPA 1KLFA 1ORSA 3C5JA 5C9JB 2QFPA 2OSLB 3T2OA 1BJ1J 4ZO8A 3C5SB 1M6UA 3INUH 5E8PB 1A2YB 3S7GA 4MRCA 1CBJA 4LP5A 1KMGA 4LHUB 4N8CL 4UOQA 4MAYC 5FUCE 4XZUA 3QQ4A 4YO0A 2Y07L 2ESVA 4JPWH 4IGBC 1MY7A 1ODAA 4PJ5A 3KWXA 3KXFA 4N4YB 1H15A 3IDGA 4HS3A 4KX7A 4K71C 4OZFH 2O5ZL 1NDGA 3GM8A 1F97A 1RKRA 2EIZA 2FR4B 1UWXH 5DJAA 1DSFH 4OGAC 2NTFA 3VFRB 2EDNA 3PP4L 1A4AA 1PNCA 2H0FA 2Y0SA 3GMLB 3NPSB 4A67A 3ARDC 3ZL1A 2X9ZA 3BJLA 4JGMA 3PYCA 3O81A 4BH8A 3ZOAA 5D1ZI 3EG9A 1QFPA 1ZTXL 5F7NC 2OXHA 5B8CC 1YEGL 1XAKA 3BESR 3NZSA 2Z1PA 3BZFA 3ABLB 6CGTA 2NZ9D 1FVCA 1IE4A 3IKCA 3WE1A 1OD9A 3JVGA 4K9EC 1BGXL 1T1ZA 2X70B 3T3ME 1NPNA 2VR4A 4GUPA 4YDMA 5CCKH 4PJGE 3TBWA 3J2PA 5I1EL 3MCLH 4HOZA 5HP5A 2DWXA 5TE7L 2PXYA 3BN9C 1XSJA 4L5FH 4MJIB 3QIWC 1NUFA 5EOTA 1A3QA 1HYSD 2JJWA 1JGUL 4M9OA 2JCWA 4W6XB 4GRMA 4IK7A 1NBVH 1XF2B 2ENJA 5E8OB 3P40A 2OS7A 2R4SH 2HH0L 4JQXC 4UTBL 3REWB 5A43C 4H8HA 2Y72A 4ZDHB 5K9OA 3AMKA 2IGFH 4G43B 3U7YH 3NN8B 3V0EA 4WUUB 4D9LH 1J11A 4W70A 2WTOA 4TQHA 5J4MA 2I9TB 3JYBA 5C0IB 5GSRB 3VXSB 1HH6A 2J8UF 4U1HB 1G7LA 3IDIB 5ABDE 5B38G 3S5YA 3S3DB 4AENB 3V7AG 1JNNH 2APVA 2DDQL 3T3MB 1IILE 1ZA6A 3VFPB 4HZLB 3DROA 2WZPA 3RBGA 3QZNA 2EILB 3VXRA 4PJGB 3V0DA 1YEEH 4CJ1A 3K0YA 4YHZL 5H4ZA 3NYKA 5HYSA 5JYLA 5AW5B 4MSWA 5JO5A 1P2CA 4R0LC 4TTDD 5LGHL 4NO2B 4WK4B 2DQJL 3G9AB 3MLUH 4BUGA 1TLMA 2FBOJ 4ONFL 2EC9T 2QHRH 2V17L 3DETD 4JVWA 4W68A 5DRWB 4QHKI 3WFBH 1AKPA 2AABL 4PB9H 4XNUH 5IMOA 2W0FA 5DS8A 4Y9FA 3CK0L 1JDDA 2YAQA 4MMZB 1Q90A 3BH9B 3BH4A 1RZGB 1A0QL 1DVTA 3U9WA 5AOIA 2XKNA 5KEZA 4M5ZH 4NCC2 1E8WA 5FDYA 2VAJA 5DQDL 2QJDA 5LWYL 2C9SA 3UJJL 2J55A 3OB0K 4NJ9H 1NUNB 2HT4D 1QSED 4R7NB 4X80H 4KKLD 1V3LA 1I1YA 1QTPA 2EDBA 5D7KD 2CLVB 5F2FA 5EZJA 2ED9A 5GPRA 2WQRA 3NUKA 4KK8D 5F3BB 4TVPE 3NPZB 5C0AE 3VXMD 3VX1A 1EHNA 3KBPA 2X4QB 3IN2A 3MNMA 1U8LA 1LO4L 1S78D 3PV7A 3AMLA 4UQ2A 5AEAA 4YDLC 4MAUL 4EI5D 3N04A 3ZE2F 5JIQA 4Z5RA 4QRTB 3L4VA 3P3TA 4PGDA 5B3SB 1AG0A 5DRNB 4LSVH 2EJ1A 3SDXF 1MCPH 4LSPH 4Y7MA 4XWGH 2GTZA 1HI6B 1QHOA 5D9SA 1WPCA 4PLNC 3D9AL 1MRDL 5MERA 4RBPK 2YUXA 3A67L 5K9QG 4YHYB 4M7LH 2VXVH 5AFAA 2A83A 2EVHA 1QLFB 1I9RH 3MLYL 3ARGA 4ZX3A 4RAVB 1LHZA 1FFQA 3KXFD 1EVTC 2D0GA 4EMZA 2EDOA 4ZNEE 3RWHB 5C0AB 3M7OA 4WO4B 5HY9B 3SKJH 5TTRA 5EEXA 4B50A 4YJZL 3CHXA 3RPBA 2F1EA 1B88A 4LU5L 1N6UA 1RU9H 2OQJA 4X6EA 2YIHA 3ARRA 2B7DT 2R0ZL 4MVBD 3MV9E 3V6FA 4KROD 4Y4FB 2R9HD 3ZDWA 2D7QA 4LCCA 4QGYA 3TA4D 3UTQB 4S0TD 4YBQC 1YCSA 1MRCH 3GSNH 2E7LC 3ZN6A 4PJDE 4R4FH 1E6OL 1QO3B 2WXHA 4N26A 4YDIH 2JKWA 3GMRA 3HAEG 3ULUD 1KXHA 2BNRE 2E9IA 4RGNC 5INDB 1WZMA 4QXGL 5TPWH 1DBAH 2G2NA 3QRGH 1ZPUA 2ADGA 2K6ZA 2G3ZA 4ZXBC 4AE0A 4HV8B 2YMXH 1KPVA 2G4EA 5D5MF 3SY6A 1P4LA 3U46A 2DQCH 3O8XC 2FB4H 5TE6H 4ANVA 1JN6A 4KGJA 5AVWB 3W2DL 3MO1B 5TQ2L 3J07A 5BZZA 3GBML 1EEYA 3MV9B 3DRTB 3L4XA 5DC4B 2Q7YA 4WUKH 1UEYA 3NFPB 5FB8A 5ICYB 2B4CC 1U2CA 2CO2A 1A3RH 1QRKA 2XZZA 4CN6A 3TBSA 2GSGA 4WFEE 1GPOL 1K5NB 2FJGA 1MJUH 2HG5B 4OAWB 3KYMB 1U93A 2WBXA 3FS9A 5DHVB 3EJRA 4YHNA 1BZOA 1EH9A 4HT1H 3WEAA 2AEOA 2LHAA 2VUYA 4Q6IB 3AU0A 2WZPD 1KBPA 1VACB 4I7ZC 1FCGA 4PJAE 2X2JA 5J7CC 1NPJA 5FGSA 4EVNB 4K4KA 5AOZA 1I1AC 3M86A 3FQTB 5G5DB 2F15A 4NNYB 3BO8B 1ZS8B 3AREC 4MA7L 1HX0A 1A7QH 4FYQA 2WAHA 4KH2A 4PJEE 3A6OA 2PPDA 1H5BA 2QZ5A 3HRZA 2VRAA 4LDEB 4N0CD 1I8AA 5CZXD 3WD5L 2NNAB 3SE4C 5EUKB 5FEBA 1E8ZA 4ORGA 5C0CE 3QXDA 3RY6A 3K0WA 3ZTCC 2X0WA 3C6LB 1VADB 5BZXA 3HJEA 2ARJA 3X12B 5DJ0B 4AG4H 3BPLC 3U0WL 4KUZH 1U4FA 5F6HI 5D2LF 5L9DH 1FO0B 1IAIL 2EDKA 2XACC 3BP5B 1JF6A 1O6SB 5IHBA 2OXGA 4FQIL 4NJAH 4S10A 1ZHNB 3PUUA 5JUEL 4ODXB 4PJAB 1EERB 3HC3L 4RH4A 2VXUH 3UMTA 1HL4A 2E7HA 1BBDL 4G6FD 5I1CH 5BRQA 3ZE1F 5EC1A 1LP9E 1GJWA 3O9WC 1DJZA 3ALPA 4I8DA 3EBIA 1S46A 4GAYA 3TC9A 1DQMH 4PJEB 4BZ2H 4ZX5A 1VIWA 4NKIH 2DI9A 4PG2C 2ZONA 3LKRB 4IRJC 1OV8A 4BRJA 2F61A 3MUGB 3SDDB 5IBLD 4M4RA 4XMVA 1NLDL 3MRLA 2NNRA 1SZNA 5I23A 1FLTX 2Y7QA 1PG7W 1K3IA 3LY6A 4PJ9B 3NSCA 1SHWA 4OH2A 1FNGA 3EO9H 1ET7A 2WVVA 3BT2L 3DMMA 5D1XC 1WLHA 5GGVH 3MBWB 4F7PB 5BRPA 2ZNWA 3RBSA 4Y5YC 4KNQA 3F83A 4FQ2L 1TG8A 3K6OA 4OGXL 4NN5C 4ODWB 1FV1B 1QRNE 4L8DB 2QVTA 2WXKA 4HH9A 5DSCA 5LGKA 3ARGD 2X6UA 1NCHA 4HUXB 1RVFL 1XBDA 1OP9A 5HJ3B 1LP9B 3OR6B 5DJXA 3BGFC 1LO3L 1A14H 3ESOA 3JT2A 4HCRH 4KK9C 5D7LA 1IT9L 5T5FA 4BUQA 4D0BA 4JO1H 4QCIB 4S1QH 3QNFA 3P9WB 5HI5C 2PUQT 5JXAL 1TCRB 2BSBA 1J48A 1MG3C 4MRBA 5GGUB 4AMKL 4X7TB 1CGXA 4A37A 1WTLA 3JWDH 3QFJA 4O58H 4RMQA 1DEEA 2VLKA 1A4KA 2DMKA 3HPJB 4OCLC 3H9YA 5KSVA 4DGIL 3S3BB 1MFCL 4JFDE 5DHVH 3FTWA 3KWUA 2VQTA 3RGVA 5IY5B 1S7WB 1NBCA 4M6OH 4FQ1L 4NUQA 4NWTH 2EYRB 1E27A 5TDPB 1M4KA 1O7DC 1YY8B 2CM5A 2IDQA 1QRNB 2LVEA 4XN8A 5E1QA 4KVPA 4DW2H 5EF0A 3WUWB 3ILQC 1P69B 2PCPA 1D3CA 4MZ3A 1EJFA 4P9HL 1YJDH 2DIJA 4KHXH 3WS3B 3WKYA 5C3IA 3WIFB 3HTLX 2H26A 2DYPB 4BFOA 3FT4B 3VYNA 3OB8A 3KEDA 4KX9A 3UO1L 1QVOB 1AIFB 1I3UA 2KMWA 1NCIA 3CJJA 1AI1L 2GK2A 3L3GA 1V3JA 2XQYA 2VW4A 3P69A 3IJYB 3RHWF 4OZIF 2YD4A 3RFZA 3ESUF 2IXQA 2Z7WA 4RQQB 1M3JA 3STZA 1KYOJ 1Q9WA 1HXKA 4E68A 4F58L 4JFDB 1N6QH 2IADA 5EU7C 1JHKL 3CBJB 4L4TA 1TU2A 4CDHA 1FO0H 4S1SH 5FOBA 3ZU8A 2ZXCA 1A6UH 3GT6A 4FFVC 1X5HA 1ZTXE 1PLGL 2PF6A 4ZW3A 5T1LB 1C5BL 2B8OT 3D3VD 3TIEA 3D0LB 3GI9L 4JB9L 3KL3A 2IBZY 5D93C 5IW6B 1LL1A 4PGEB 2X4UB 4NQCA 1UH2A 2CO4A 2V5SA 1AQDA 3NCCB 1V3KA 4JO5A 1AGEB 3HG4A 1FUNA 4IHOB 2GIMA 1FZKB 1A9EB 1K4DB 1M71B 3D7PA 5AVZB 4N5UA 5ETUA 5HGAA 3PAYA 1HE8A 4NZUH 5ANMA 4ENED 5DUPH 3S35L 5IW3A 4Q8BA 4E9SA 5CLWA 4KJWD 3WDHA 3RJDA 4H26B 2YGOA 2CMRL 1RSYA 2MNUA 3ZLQC 1BIIA 3ZL2A 4ZT1A 3QUYC 4K73A 1G9NL 4LLMA 3T0DA 3BUIA 4AIZA 2VXTL 3C60B 3GFUA 3GLDA 1T20B 2X9WA 4AJWA 3FTSA 4YFLF 3QZLA 2V8MA 4Y0GA 5D55A 2WQSA 3P11H 4JG5A 3ARYA 1ZHLA 3LNDA 5L0QB 3TYGL 3KPLB 4YOKA 4GO8A 2R1XB 2VDLL 3IETA 3QZWA 1CI5A 1JPGB 2A9NL 4HISA 2H4EA 1URIA 4BXVA 5GS1A 3BXNB 3TO4B 4NPYB 4FN0A 2H0EA 5DFWH 4FLOA 3L9RB 2DJMA 3DX6B 4XMLH 1KGXA 1IE5A 4HX1A 5J1AA 4KRPB 2ZF9A 3BYTA 2C1OB 4IU2B 5TGBA 1THCA 2JK5B 4JKLA 2HLEB 4XNYL 5CILH 3SBQA 1HT6A 2FX8H 2IANE 4HMEA 1RP9A 1SF5A 5F3FA 5LN8A 2OSLA 1B4JL 2R2EB 5BUGA 1A2YA 1F90H 1RXLA 3DSNB 3I6KB 1XGQB 1D9KC 2J5LB 1Y1UA 4LHUA 2VDML 3AS2A 5HI3C 1YYLL 1NSNH 12E8L 2IAMD 4XPBH 3I2CH 3AGWA 1OTUD 4NRXB 5AW9B 3KDMB 1RUQL 4NQDE 5DGQA 5KSUB 4ZZKA 1FFRA 3RDTC 3QUMB 4QRUB 5C0EA 1SBBA 4XVTL 4YUEH 1XX9C 4LSRL 1OAZL 3VFRA 2VR3A 5D7LD 2FSEB 3GMLA 3CDZB 3OLDA 3GS4A 3W11C 2DRUA 3FQWB 1MVUB 2IBZX 3TX4A 5TH2B 3UDWC 1SM3L 3EBHA 5H4YA 3VXOA 1F4WH 3UPCA 2I9LB 4HUMB 4A55A 1OT1A 3SDXE 3VWJD 4RMBA 5GS3A 3CBRA 1MJJB 4H0HB 2F8VA 2IANB 4JE4B 1CLYL 3UG3A 3I02A 3DC0A 4ALAC 3MRFB 2H1PL 3AS0A 3E6HB 4A7TA 2EH8L 2APTA 4MXVF 5DWPA 2FUTA 3QWRA 2XKSA 1DUYB 2X70A 4P06A 1KULA 1TMCB 3WTWA 3ZJAA 3CPUA 1F41A 3MRGB 1JXDA 2CUHA 4WHYH 2XWBB 1QFWH 3QQ9C 3WJJA 2QQLH 1TOXA 3TNMB 3TWCL 3W0WB 3STLB 4NGHL 4LL4A 1IKFH 1QWNA 3TA3B 5ADPL 3BZDA 1MSPA 3UGXA 3CFQA 1NINA 1XF2A 5E8OA 3ZY7A 2NY6B 3REWA 1R24B 2C7UB 3L54A 4ZDHA 3WY4A 3SDXB 4G43A 3PHOB 3AS1A 3NN8A 1V8HA 3CDFA 3K5RA 4FQPA 4JKPL 4X9IA 4O02B 3G7TA 1JZIA 2QV2A 4Q9QH 3QIUC 4NDMB 3SOTA 5C0IA