3LZRA

Crystal structure analysis of manganese treated p19 protein from campylobacter jejuni at 2.73 a at ph 9 and manganese peak wavelength (1.893 a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
158
Chain Sequence
GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 28
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzrA00
3LZPA 5I0YA 3PJNA 2O6CA 3LZLA 2O6EA 5I0XA 3LZNA 5I0VA 3LZQA 3LZRA 3PJLA 2O6FA 5I0WA 3LZOA 3NRPA 3NRQA 2O6DA
chains in the Genus database with same CATH superfamily
5DZVA 1T4KA 3BKML 2X4PA 2P28B 2Z0UA 4DFHA 4DK5A 3FFCE 3MI6A 4HC1H 3BPNB 4NPYB 1P84J 1U8HA 4CU6A 4JVWA 1N64L 1EHXA 3I75A 3WJLC 2EO9A 4ZUVB 2I24N 5CCJA 4IRSA 1UXSA 4NQTA 2J8UA 1KCUL 3BD3A 5DLMH 4YNYA 2VDOB 3G5VB 4QNPF 4H0GA 5JPNA 3DSFL 4QO1A 3V6OA 1BSIA 4XGZB 2IF7A 4X9FA 5AKRA 1B90A 3GSVA 3U0TB 3VVVA 3HI6L 1RK1B 3OMIB 5D2LA 3RPBA 3DYOA 1JZDC 4PIBA 4RFOL 1NFDE 1J1XH 3FSOA 4LHQB 4K5NA 4C55A 3ZYIA 1R3IH 2NY7L 3O4OB 3MRHB 1QZ1A 2OMVA 1R33A 3LKOA 2P49B 1U8QB 3HPJA 4ZRGA 4JFPB 2H4EA 1AR1D 4H5SB 5CMAA 4K71B 2A99A 4R3SA 4LCUA 3IETA 5JDSB 1E2WA 2GI0A 1QLRB 3T4YB 1Q0YL 2ITEA 4GG6B 4DGVH 4P3WA 1XF2A 3VB8A 4ZMAT 2E59A 3MLVL 1SMOA 4OIBA 2LAGB 1T7WA 4D0CA 1CMOA 4GQPH 1NOFA 3HBPA 3WFCH 5HGHA 4FG6D 1EHKB 2HT2C 4WI9A 2P26A 2ZIDA 3SBRA 1MCPL 2AXHA 1GKOA 1RK0A 4F57H 1JP5A 3D12B 1FGVL 1JTOA 2RR3A 4H25B 3VM7A 2BRRL 3NZHH 3FU7A 5K9OB 3VGGA 1PG7X 1N68A 4RMRA 5C09B 5HY9B 4ADIA 4P46C 3L4TA 1ODUA 4QRAA 3FN9A 4X6BA 3IJEB 3TBYB 3VXTB 5F3HA 2P5EE 4HS3A 5TF1H 3TURA 4JFFD 2Q3XA 5DD1H 4X98B 1IX2A 1U3YA 1K8IA 2GAZA 2VMJA 4DTGH 3QQ3B 2G75B 5C1MB 1ZA6A 2DOCA 3F8UB 3FF7A 1ETA1 2A0LD 2JIXB 3UYPA 3UTTD 4H40A 4AITA 4MA1B 3K6FA 1F3RB 1KZQA 4L2LA 4LL4A 5TK2A 1AD9B 3K6DA 3ZTEA 2OPCA 2YD5A 1RZFH 4XP1L 3LPFA 4X9GA 4DSYA 3GSNA 1OE3A 4JFDD 1EBAA 1FYTB 3IMWA 3DX9A 1SN0A 2HJLA 2F5BH 2HKHL 3AFLA 4F7MB 4N2HA 4R96B 5IQ7H 1QWUA 2AJ3A 1IM3B 3PP4H 2ZX8A 3BQUC 3GSNH 4L8BB 4TVPH 1VJSA 3F7LA 3PY9A 4J4PA 3LXUX 2AV7B 3BPLB 3N44F 3O6KH 1QEWA 3VFGL 4ZK8A 3QORC 3VGAC 2WSKA 3GMOA 1OWWA 5D4JA 1DEDA 1JPST 1OT1A 1TKWA 3P2TA 4ODWB 2VDLB 5BQDA 1BOGA 2WZAA 3AWGA 3FAXA 1G7LA 2YSTA 4RFEA 4U1NA 3U2JA 1G5AA 1UTDA 3H56A 2HWZH 2OZ4L 4U1MB 3HZMB 3R18A 3BFWA 4U1KA 3VRJB 5ADOL 3H9YA 2QSTA 4M6OH 3AW5A 2YWZA 1XT5A 3RUGA 5LN8A 4NUQA 3EO0A 1NFDF 2DQUH 5MENE 4DKDC 1DSFH 3AU1A 3BVNB 3GMRA 4P9HH 4YPGB 1MZYA 2EEXA 4NDMA 3AITA 1LM8V 2YD4A 4XPHH 1FLRL 5EWIL 4QTHB 2UZYA 4ZMTA 4GUPB 4RISH 3MOAH 4Y9EA 4L8SA 1MF2L 4QTIH 4OD1L 1S7QB 2XX0A 3EYUH 3DXAD 3PF2A 2NQDA 2D7MA 4KKAC 4U1LB 3QK0A 5GRWA 1FORL 1WTLA 5FO8B 2BVPB 4C4UA 3V6ZA 3LD8C 1I1AC 1FZMA 3VTMA 1OGTA 3T0XA 1YO4A 1J8HD 3EDEA 1DZBA 1BQHA 4JEGB 2C9XA 3PV7A 5I23A 4LL1A 3NCXA 1QVOA 2E8ZA 3WMSA 3VVWA 2MQ0A 4ZAKB 5DRNA 2ZTBA 2AQRA 4WFED 2BNQB 3KNBB 2DWSA 5AW4B 1NH6A 3AU0A 4HFWA 4XP9L 3SPHA 3VACA 4LCWD 2D2OA 1SJEA 3APMA 3JWOC 3S36H 1LK3L 1CF8L 2YQBA 5IWLA 2YRPA 4I18A 4QRTA 3ZE2E 3CPLA 1ED3B 1B88A 5E4OA 1JHKH 4FMVA 1OK8A 2NX5D 1WZKA 5MEPA 1XEDA 4DERA 1G7MA 1KCBA 1QSFE 3O4LE 1KPUB 4QXVA 5I1LA 1U2HA 1T66C 4WWKA 3HNVH 3FT3B 5T8IA 4AE1A 1IVLA 3UPCA 4Z9KB 4FMFA 4FQ2H 1RVFH 5L88L 5F9JB 1TETL 4PJGB 1N2RA 1HIMH 1OCCB 3M7FB 2MQCA 1H5BC 3GK8H 4FFZL 3KPTA 3A24A 2J21A 2DLIA 4M8UA 2OK0H 3S37X 4HUVB 2QTEA 4H8WH 1N8ZA 3NVQA 1SXNA 3SE6A 3VCLB 1EEUA 4YHML 1Z32X 5J11B 3ZT5A 4YDKH 4FYTA 3LOWA 4KRMB 1M71B 1BZOA 2IDSA 2ZKHL 3O45B 4JQVA 4X80L 5ETUA 3TBTB 5I9QB 5FYJD 4XVSL 2ISDA 5E1QA 4IHOB 1K4DB 2F53B 1RFDL 3QA3B 2B4CH 3C60A 2YHGA 3KYOB 4RQQB 5IFAL 4I48A 4DKTA 2OTWB 3OX8B 4JMXA 2CRIA 5DHVA 2KLRA 1T03H 1U92A 4PJDA 1NPJA 3BAJA 1H19A 2DQHH 4IU2A 1GGCH 4FQQA 3HE7C 4F8LA 1IBGH 4F7EA 4YSCA 4OF0A 5E4EC 5DHVH 3BEWA 3QUZD 3C75A 5HVHB 5HYEA 2EVJA 5AOMA 2GFBB 1KPVA 4M3KB 1LQBC 1NIAA 2FHFA 4QWWC 1TUPA 1R3HB 4L3AA 3CDGB 2GY5A 2HVJB 4U6HB 3RPKA 2VERN 5BUPA 1H8OA 4QRPE 1DO6A 3QWRA 2H6UA 4TSBH 4S1SL 1AHWC 2FO8A 3NCEB 3Q5OA 5TTRA 4MXQD 3MXWL 4D9QE 2CR6A 2F15A 5CILH 1SDDB 4XNDA 2VJXA 3ARDD 2ZAGA 2F19L 3LPOA 4G71B 1BVOA 4I9WD 2D7PA 4X6EA 5I1EH 4B7IA 4W6YB 2Z35A 5TDOB 2B39A 3AS2A 4JM2B 5H94A 1KELL 1MUJA 1UH4A 4TVSa 4ZT1A 1WISA 2Y1YA 4W9HC 2VDPL 5IM7A 3S0PA 1Q1PA 4MVBD 4FABH 5E8NA 4LPTA 4DP6X 1HJBC 5DMJB 5AW3B 5E8PB 4YFLI 1NCAL 3LZPA 3X2QB 2ADIA 4MTMA 4CN4A 4POYA 4UQIM 1IT9H 1H6UA 3UJTL 2H1LM 2OFQA 3SGKA 2YQ2A 4R4NC 3DHMA 2ARJB 4MZRA 1O5DT 4MX7B 2X09A 2ZOTA 3CFBA 1T5KA 5F1NB 1G9NL 4N85A 1IKFH 2QHRL 1YG9A 1O7VA 3GS0A 1CD0A 5BMFH 1PG7W 5DVPA 3ULVC 5AVWB 2NTFB 4MNQB 2YMTA 4AMKL 1S5IH 3DX8A 1HL4A 3EO9H 2VYRE 4TLKA 2LFEA 3CSPA 4PJ8D 4KMTL 4IIQC 1X7QA 2NW2B 4JG0L 4JQIL 5JNYA 3UZQA 1P9MA 4YWGH 2V9RA 6PCYA 3EUUA 2WV3A 3ARFD 1QKZH 3MBEC 5KBKA 3DX6A 1UCBH 2JJTC 2XWTA 5E8DL 4EXPX 3NJGA 3TWCH 2E46A 5DO2C 1L7IL 1E43A 2FUQA 4AEHL 3V6FB 1HNYA 4OV6F 4A7VA 4CU7A 4DF9A 3B7RL 2VL5B 2FEEI 4LE8A 4UYQA 4J3WA 1IGMH 1EEZB 1O0VA 1D3CA 3EBHA 4JFHD 1AGBA 2FX8L 2AKRB 4KH9A 2Y2TA 1E28B 1U95A 2X7LA 4WUKH 2G0LA 3ATAA 4GYBA 4XBMA 8FABA 2YD9A 4GUCA 4TN9A 1A4JA 4LLQB 3SCMB 1BPLB 5IF0A 3ABGA 1JMXA 4TUUA 4YVUA 3QXWA 5A6IA 2J6EL 4LLWA 3BH9A 3FU3A 4PJ5A 4XXDA 2VDKL 5B1BB 3H2WA 5MI0C 1QTPA 3IS0X 1DVZA 2V5YA 4UILL 3LQMA 2GG1A 3Q2LA 1QUPA 4AENA 4XHJD 5KN5B 4QR7A 3QJFB 4TULL 2IPKA 4HIQA 5B39B 4MZIA 3U0WL 1WBXA 4L1SA 2RACA 4HU2A 4X4XB 5I75C 2PW2B 5EFIA 2ODIA 3GSQB 2EDNA 2GEQA 4M4RB 4XN2A 3A6OA 3GI9H 3QDJA 4WU5A 1E8XA 3MUZ1 4YHZH 5E1AB 3SDCD 4Q9QH 5CN2A 1OV8A 4CMHB 4ORZC 5CD5C 2C7FA 3HZVB 1HH9B 4OU3A 1FV1B 1DR9A 4DPAX 3B3IB 5D71L 1TZOA 3HIZA 2WKOA 2P80A 1NCTA 1G7HB 5MEQA 1KB3A 3U25A 4DK3A 3Q9PA 4PRPA 3K6SB 2A6DA 4P99A 1FH5L 2NY5H 3DX3A 3WN6A 1O9WA 2VC2B 1CBVH 2C9UA 2FHCA 1E4KC 4FFYL 2LAAA 4OUUB 3UC0L 3Q1SL 3RX7A 4HWEH 1VIWA 3EGXB 1MFDL 4WKXA 1CLZH 2HUHA 4ZFOB 1GIGL 4AJVA 1ZA3A 1WZAA 2BC4A 3GGWB 4FRWA 4AEFA 1C9SA 5A1AA 4PJEB 4RBPK 3OKMB 4JDEA 5I73B 4W9JC 1JERA 1AKJB 1L3NA 1M42A 1QASA 3GLZA 1OM9A 5KYUA 3FQNB 4BDVA 2VTFA 4YVNA 3EFDL 4A37A 4JE4B 2HSIA 3CK0H 4NSKB 3QNYA 5AW6B 3RWHA 5A2IH 2JELL 1YYLH 4TL4A 4XWGL 2IANE 4GSDL 5CF3A 1TCMA 4E5XB 3FN0H 4AYBA 4Y7OC 4ISVA 2G0KA 2NY2B 2O93L 2K4WA 2CLRA 4EMZA 5FECA 4IIZA 1HL8A 2Y06L 4PY8J 5B1JC 1D5XA 4G7YL 4PRNA 2P8LB 5ERWB 2G4EA 1A7BA 4PGDA 1YEKL 3Q5YA 3UO1L 4R0LB 3ZHDA 1A1OB 2OR9H 3KXFA 1IAKB 2XQYG 3WO4B 1NEPA 1UJ3B 4EZMA 2FO4A 2A77H 3KPRA 1YMHB 1HI6B 1T5XA 5A6LA 3KM2A 1UWGL 1DLHB 4PRAB 3JV0A 3NAAL 3ROOA 1VPOL 5FYLE 5E99H 4YDLB 4O51B 2XLLA 1UZ8B 2AEQH 2I9LA 3IAGC 1VFBA 4UOW1 1XO8A 2CALA 4X4KA 3U9PL 3U79A 1ONQA 1PZ2A 4WUUD 3MO1A 3O2WH 2C4FU 2G2NA 2NSQA 3LEXB 1V8HA 3DC0A 4NWUH 4Y5XB 4FNSA 4N3UA 5D1XE 4D0DA 4PJCA 3BZFB 2AK1L 3IJSA 5KJ4A 1BJ8A 2CA4A 4KWUA 3FFCD 1Q9LA 4JL1A 3QIWD 3MA9H 5G5DA 1WHOA 4L3CB 5I8OL 3VMOA 1OP4A 3BP5A 4IOIB 5DRWB 1MPAL 3OSKA 1OQXA 4R4BA 2FX9L 1OLLA 1QNIA 3TO2B 4LGPB 4XBGA 5E8EA 2XWJB 1XQ4A 5AB9A 4PJIA 1D9KB 1OCOB 1TG8A 2MWCA 4PTUB 2PWFA 4XWOC 4HCRA 2DPKA 4ELMB 2H47C 3U4EB 1ZJBA 3NP3A 1J1OH 3VFPA 4R7DA 2N3JA 2DMGA 2C3VA 4KRPB 3CCHA 3TBSB 4MS6A 4KPHL 1LILA 3S3BB 3MRFA 1UCTA 1JYNA 1ASOA 1P6WA 3ZE0E 4HCRH 1LEKB 2X9YA 3GIVA 3GO1L 4XB8A 2CDGB 3V5HA 3C9NA 3G7TA 5D55A 3AG3B 2EDEA 3BAEH 5EA0L 5EIQA 2A4EA 3UIZA 4CRPA 5ACLA 1Q1JL 2JLLA 4JRXE 4MD0A 4DVRH 1BEYL 3WU1A 2HRHA 4UM9D 3CZJA 4G7VL 4HBCH 3U30C 1GMIA 3OHXC 4LVHB 4XR8C 2R1XA 2LU7A 1TJMA 2BSBA 1IE5A 5L6YH 1EAPB 1N70A 1KFAL 3GWJA 3NZ8B 3NIDE 3IDIB 2VE6A 2YZ1A 3ZX1A 1TJIH 4NN6C 5I6OA 2GJ6D 1F4XL 2Y4SA 5E24E 5KVDL 2XQYK 4KROD 5E6ID 1CT8B 3TIEA 4AM0B 3KDMB 3VM5A 5HHMB 1CXHA 4KJWD 4DOHE 5E6RB 3W39A 3CLEH 3WENA 3HE6A 4MNGB 1AANA 4OFKA 1QQDA 1RZGB 1TU2A 2BP8A 2XG4B 3N91A 4GRLC 4JZOB 4OGQC 1S3RA 1T1XA 3T8XA 4PIRF 4DUVA 5HDWA 4F2EA 1ZANH 4XAKD 1REIA 5BO1L 2P5ED 3NZUA 3L4XA 3RVTC 3V9FA 3S35X 2PO6C 2X4NB 4HQQL 4LHJB 2GTWA 1W15A 4JPQA 4XVTL 3ECBA 5A3ID 1AO7B 4XN4A 5DQDL 4BXSV 3H3PH 3K4ZA 3O8XC 2WCPA 3RP1A 1JAEA 4NQEE 1YY9C 4NOFA 4MA8H 4AGOA 3OKDB 1V3LA 1YECL 5DK0B 3CX5K 2K9FB 2JFCA 4PJHE 1HWGB 3FCTA 4M5TA 4Z7VA 1NC4D 2DJUA 4N0CD 1AIFB 3EHBD 3VQLA 1IEAB 2J7LA 1D2PA 5AUMB 4OCRL 2Y36H 1MIMH 3HZYA 2Y69B 4L8CA 1JHTB 5CEYA 5JUEH 1FG2A 3N0AA 3D30A 5DHMC 1CFMA 1QFUL 3GSRA 4Y89A 3V0HA 3IN2A 1CURA 3MJ6A 4KVNH 1CXIA 3QQNA 2NZ9C 3HHSB 5CZXC 1TYJA 2FH6A 3W37A 1AD0A 1DVYA 5CEZE 4N2EA 2ALAA 5JHLL 2GW5A 2P24A 1RIUH 4YUEL 2ITCB 1CD1A 4ODSH 5DMGC 1F6AA 2QJDA 2R2EA 4Q56A 1DANU 1KCLA 3UG4A 2X4PB 3U0PA 4NQQA 4B9YA 2OP4H 1NDGA 3H4HA 5I1CH 3JUZA 4DZBA 3R8BB 1JYXA 3K7UA 1U8HB 3QO1B 3SBPA 3GXPA 4Q97A 2VLLA 3LQAH 4YL9A 2DS4A 3HPLB 3I75B 1IO4C 4Y1AB 2WN2A 4IBVA 1EPFA 3AQYA 1X44A 4IRSB 3HMXA 2OSXA 3X17A 1B6DA 3K8LA 1INDH 4GFTB 3JWNH 1BQSA 1OE2A 4JCMA 1TEGA 1A0QL 4MBOA 2VUKA 4FTDA 1KXTA 1C16A 3HCVA 3SPGA 2ERJB 3KGTA 1LO4L 3QG6A 5DZLA 3UAJD 3AY2A 4B6ZA 3HMXH 5I66A 2IGLA 3C6SA 4P3DA 4MDIB 1EBPA 2H2SC 5D2LB 4RNRA 4KY1H 5FKAB 5CJQL 1EMTL 1G7IA 4NM8L 1OHZA 5IBLC 1X4ZA 4XCCL 1CE1H 3O4LD 4MBRA 5F7LB 3WIAA 4UINH 3QUGA 4JO4H 5F0MB 1C5DB 2YA2A 4IRZA 5HYSB 4NQVA 1CQYA 1V7MH 3F7PC 3I9AA 2OYKA 1IC5L 1XAUA 2CCLA 4R3SB 2P5WD 5CMAB 4HWUA 3S4SG 4DKAA 3IETB 3VDAA 1OY3B 4EN3A 3V52H 4UAHA 2V33A 2YAQA 3GBDA 1S5HB 4Q4IA 3DVIA 3MNVA 5C08D 2EDMA 4IRZH 4PP1C 1XF2B 4WW2C 3I3BA 5ALBH 2VW4A 4PJHF 4D3CL 2HT2D 5HYJA 4D0CB 1W2KT 3WFCL 3B5HA 2CIIA 3B1TA 5EU4A 2B1AL 5HGHB 2I27N 4NJAH 2VQ1B 3L5XL 4CBZA 4N0UB 3ZQ9A 3NRPA 4F57L 1RK0B 4P46D 3L45A 2DWXA 2OR8A 3S34H 4Z8FL 2EUVA 3RVVC 1ZS8A 4X6BB 1AZCA 4OZHB 4HLZG 5F3HB 2BFVL 1EFXA 4RMUA 1DCLA 1M6OA 4ODUA 1OEZW 4HS8L 1D5IH 2GAZB 2X88A 4HIIB 2WQUA 1WH0A 3K6IA 3P1VA 2F54E 3UYPB 3REVB 2BO0A 4XO4A 1BFSA 2RGSA 1CN4A 2VLRE 4P2AA 4W9LC 3G5XA 1RZFL 1S78C 4YHIA 4G80B 2EACA 4DK6A 1QZNA 3NSYA 5E70A 4WWNA 1ZVYA 2JE8A 4QHLB 3FQWB 4QKXB 3PRZA 3KL5A 3V4PL 4E9QA 5GRXG 5F6IB 2XFXA 4F33B 4KJYA 2F5BL 3BQUD 2DQJL 2DIAA 5TH2A 2WXQA 5D1QA 4TQEH 5DJZB 2CK2A 4AKQA 5IQ7L 2AJ3B 3NMEA 5JW3L 1YEDA 4J6IA 1SOSA 1FO0L 3QORD 5KSVA 1IFHL 1Z0NA 2BVOA 4LQ1A 1RH8A 3MYJA 5B8CB 3QDAA 1XF3A 3TEYA 3GMOB 2CRMA 4I3SH 1TKWB 4M7JL 1BOGB 1G7LB 2FB4H 1SY6A 2GI7A 4WJ5A 4ZFGH 5I1IL 1RQ5A 2VLJD 3OG6B 4M6OL 3ZMNA 2J25A 1U8PA 2XPGB 4GSXA 2IV8A 4L37A 1WFIA 2X89D 3O3AB 2MCPH 5JHAA 1A6VH 1NBZA 1EGJA 5CLYA 2PYEA 5DI8A 3S5LB 1KWKA 3CDFA 1FRGH 4NDMB 4KKAD 4LL9A 4WY7L 4X99B 3MOAL 2UZYB 1FH2A 1SQMA 2AGJL 3VX1A 5I71C 1J86A 1EGJH 1I1AD 3L48A 4Y4KC 5JOPE 4NO0D 3V6ZB 3GUTA 3ECVA 2A74B 1FZMB 1P69B 4P2QB 2WXKA 4JQXA 1BQHB 4PJBA 15C8H 4WKZA 5DJDB 4KITB 1BVKA 1MHEA 2OCFD 3RZCA 5DRNB 2C7UB 3HOGA 2ICWJ 3BYTA 5A7EA 2W81C 5T1KB 2GITA 1SDAB 3SOBH 1XGQB 1XZ0A 3L6FA 3Q44A 4J2QA 4HFWB 5AVYB 4OV5B 2W92A 3EDKA 4U6XB 3WELA 4JPWH 1SJEB 5DD0H 1C7SA 4QTFA 4QRTB 3NCFB 4RAUA 5KVFE 4XI5C 1YQVL 4MLIA 1CUOA 4S1QL 1T66D 2R2HB 1G7MB 2JSFA 5KJ7E 2X6BA 1XF4A 2FGWH 3OB8A 4WWKB 2CHXA 2BWDA 4FQ2L 1RVFL 5IVXA 1OZTG 1H3VA 5HHOB 3C6EA 3TT3L 1E7VA 1N2RB 3DMMB 3QNZB 5IUSA 4FXGC 1AZNA 2Y5TA 2WZ0A 4OF7A 5M95B 1L9PA 1I85A 3A67L 2QPSA 3FRPG 5ID0A 2GHZA 2G5BA 1IGIL 4PJ9A 4WDIA 4H8WL 3I3EA 2YBRA 1N8ZB 4JRYD 3BPCB 3EZJB 5EU6D 4XC1L 2XBZA 1JPGA 4Y9CA 3ARRA 4I4WA 4X8JA 3GTNA 4YDKL 3FS9A 1BEXA 2V3DA 2QQLL 4MJ6A 5B21A 3P0GB 3LXBA 4F58H 4E9XA 5AVQB 4OGYL 4Q58C 2UYLB 1NWPA 1FCCA 1W80A 1USQA 2B4CL 2OCCB 4A2GA 2EDOA 3VXUA 2ICEB 4LCIL 5EV7A 5JQIB 1KEGH 2ADFL 3FU8A 1DEEA 4M4PA 5EZLA 1NA8A 1U92B 4PJDB 1M7DB 4PCTA 3HE7D 4O4YH 4BFGA 1VEPA 3V5DB 4IU2B 4BKLA 2NDFA 3R4DA 3QUHA 1DBAH 3HUJB 1E6OH 1DFBL 3QEUA 4F7EB 4ZMNA 4QWWD 3UO8B 2P8PA 4DETA 5JXAH 1OHQA 5FA4A 3CN4A 3CZFB 3FH5A 2ZX6A 3KYMB 4JG5A 3UIYA 4M7LL 1MSPA 2WZPD 3EH5B 3RWGB 1AFVL 1HXMB 2DJSA 4XXWA 3DO3A 2ESVE 4CKQA 4L0YA 1W8OA 4C56E 5F71A 1KBKA 1MW0A 2IVFC 2FBOJ 4GXFA 3K72B 4EF3A 5I1EL 4X6EB 3T0EC 5K69A 2Z35B 4G3YL 4H1LG 1AY1L 2Y3NA 2QVFB 3T2NH 5J1SC 5H94B 2Q0ZX 1G87A 2IAND 4JN1H 1NTDA 1TF4A 4YSSA 1SEQL 2MQGA 4NC1C 1KCVL 4XMUA 5IM7B 3GBLA 5AAPA 3PWPA 5E8NB 3QCTH 5SWZA 3MXVL 2I9TA 2CCWA 1ZVHA 4Q6IA 2AK4E 3QUYC 2XN9D 1B2WH 3IKCB 4WFHD 5A2AA 4ZW7A 5AAWA 4XNMB 1PLBA 5IHBA 3N40F 4HIEA 4GKSA 3K1KC 4AH2A 3D0VB 4J1UA 2HLAB 4ONOA 1B0GA 3H9SA 2VW6A 3EZ8A 1JE6A 3M8OH 4PW3A 4Y4HD 3W11C 2UWEF 5FXCH 1RJYA 4KRNA 3ULVD 4YEEA 2J8OA 4DGIH 4TTGA 5BMFL 4KV5E 5FYLD 1LP9A 2ZPKL 3BWAB 3N1FC 5FA3A 3K91A 1RZKH 2D9QB 4YX2L 4Q6YA 4GQRA 1CBJA 1E5YA 1NWOA 1S5IL 1YPZA 5EO9A 5KSBA 3DX8B 2OULB 1A8ZA 5DFVC 4HAFA 1RSYA 3MBED 4JGJA 3J8F7 1JV5A 5JNYB 3UZQB 3T6VA 3U7WH 1GYWA 2UXTA 5C0NC 5CINL 3LB6C 5DO2D 5EC2B 4WV1A 1ZSHA 2XWTB 3K3QA 3TWCL 1JZIA 4N1EA 4RGNB 4TSCH 2IFFH 3IF1B 5E51A 1XIWC 1AH1A 4L8DA 2D0GA 1AR1B 3MLYH 3MV8D 2G3NA 3VX0A 5K9JH 1HZHH 4MGXA 1AGBB 4P9ML 4N6RA 3BVVA 4RMQA 4FEIA 3PIQA 2PPEA 4P5TA 1MIEL 2EXYC 1RZQA 4NBYB 4PYHA 4X6FA 2DTML 1FJ1A 4UT6A 3WNPA 3FN3A 3EYFA 4LLWB 5T1DL 2Y7LA 2Q8BH 4JFXB 4XXDB 5I5RA 5KVDE 2A4CA 2JKRM 4ZTOL 1SLWA 2FNBA 3LNDA 3VE0A 2XQ0A 1Q9OA 2B5IC 2WLYA 2YA1A 4PR5A 1V10A 3IB4A 4AENB 4UT6H 2VIRB 1TVBB 4GP4B 4F8TA 5E2TL 2HPOA 3ARBA 4M5ZH 1DDHA 4ZQTA 5K9QG 3VGBA 5CZKA 3JTTB 4GPVA 1ID5I 4A38A 3A6BH 2MCG1 4UWQB 5EEZA 5BJTA 3C09B 2HYMA 1FFNA 3KJ6L 1DUYB 3QDJB 4HP5A 5AWNL 5F96H 4ZODA 4WU5B 4YHZL 1YEGH 2ZAIA 1DQDL 3QI9C 3HR6A 3F83A 4CN1A 5CD5D 4I87A 5EZOH 1OAZL 3KLHC 4OI7A 5BRPA 2XWBA 1MWAB 4PRIA 1MCWW 2CK0H 4DT2A 3ULSA 5ILTH 1QWNA 2VB5A 2XZCL 4NNXA 4UT9L 1T2XA 1AACA 2A6DB 3SJVA 3QJOA 1SVCP 1YUHA 1WZMA 3OXRB 1J9RA 5I30L 3APDA 4H8QA 1LD9B 2AABH 3E6HA 2E4TA 1CLZL 4F80A 5F6HI 3N1GC 4PB0H 3JTSB 4FZ8H 4NERA 4KV5F 3TBWA 1ZA3B 4PLOB 4V2BA 1RP8A 3AS0A 2BC4B 3OJMB 2V2XA 2ZYIA 1MFBH 3RGVC 1CVRA 3VD7A 4A7SA 1I8KA 3T0EE 4BDVB 2YK1H 3CK0L 4MMZC 1N0XL 3QNYB 3RWHB 4OFDA 4E9TA 1BLNB 1JZ2A 2BSSA 1TQVA 5HD8C 2XZAL 2DEXX 1YJDH 4NC1E 1U8MA 3DUUA 4QKTA 2BZCA 2NLJA 2Q3ZA 2CO6B 3R7QA 3VTAA 2DYRB 4TUOA 1RJZA 1W91A 2CLRB 2OI9C 3MRDA 1CL7L 3B8YA 4GINA 4N0FB 4Y8DC 5FECB 3FUFA 1GTNA 1D5XB 4R90L 3EJQA 4C57C 5J13B 3MLTA 2OR9L 1DVFA 3QGVA 2N56A 3NGBC 2CLZB 3KXFB 1J8HB 3BAXA 1SN2A 2A77L 2FO4B 3KPRB 3K71B 3G3LA 4NUGH 3GZQA 4ZXBB 1F6FB 3ROOB 1A4BA 5E99L 3OAUL 5FIEA 2IQ9L 3OR6A 4QAWA 1WYJA 4YSQA 4MMXB 4R6UA 1VFBB 2BNRA 4LCWB 1ONQB 3BIBX 1NCUA 3C5SA 3MO1B 2O4EA 2NX5B 3STBA 1MCLA 1TSRA 1KJ2A 4BINA 5I1JH 4IDJL 4AL8C 1U33A 4NQSA 2YD2A 3PFUA 3L54A 1W8EA 4P4KC 3MA9L 3S96B 1BZ8A 2WNXA 1E4XH 3LDBB 1IKOP 1XB8A 3QQ9C 2WLHA 3W0WE 5G5DB 3S8FB 1RLBA 1KJ2H 3ULAB 5DURD 4J3OF 5C9JA 4HLEA 1T2QL 3V5KB 2QSQA 4LU5H 1JDAA 4Z7WA 4QRRA 3P9WB 5J3HC 1AE6H 3IGAB 5DJCA 4PJIB 1QTYT 3TVMB 43C9A 1NUFA 1JPEA 4HDIA 4OVUA 5INDB 1RP9A 1QI4A 5C3IA 1IQDB 5B3NA 3T71A 4GKNA 2XN1A 4A39A 5SWQB 2G30A 4IMKA 4JFEE 2MCAA 5FUOH 3KWVA 3LKSA 3CCHB 3KCPA 2BVEA 5FK9A 1F4WH 1M9WA 2W0KA 2X4UA 3HRZC 2YUWA 3PAZA 4ONGH 3FT2A 3GIVB 4HXBH 3C9NB 4IBYA 4CJ0A 5F7HA 1JS4A 4YXLL 2YD8A 2FYYA 4MD0B 3GMMB 4DVRL 1GAFH 4QEGA 1T22A 5CGYC 5FCUL 1ECYA 4LCCA 1TJXA 5CR8A 5F3BB 1TCRA 3GS4A 4IYKA 4YBLB 4V33A 4FTVE 2BOLA 1GOGA 2R1XB 2R15A 4LMQI 4OB5H 3CQFA 4U1HB 1Y1DA 2EDDA 5J12C 2QADC 2F0CA 3E6FA 3FT9A 4EUPA 4NKQB 3FTXA 5DJ6A 2X3CA 2RTTA 3WY4A 2VE6B 3HG5A 3QUZB 3NIFE 3EJJX 4OLEA 5C86A 4Q7DA 3MLZH 2WBXA 4UMGA 3MOBH 2VDML 2NQ3A 3FRUA 5HHNA 2A9NL 4GRLD 1PKQE 5CLZA 2XIBA 4Z18A 2AJZA 4EUPH 1KNOB 1JWMA 1X5IA 4NZFA 3B5GA 1TU2B 1TTAA 1T1XB 2YXVA 3T8XB 5IFJA 3T0BA 1T0NA 3WN5B 5T5FA 3UCRA 5EN3A 3RVTD 1MN4A 1JJUA 2Q87A 2A6JB 3G6JA 2J8UF 2XWRA 4PB9H 2DAVA 4WI8A 2H1PH 5A2CA 5CEXA 2F54D 3H7BA 1T5WA 5T5FH 3GMNB 3O8XD 5HVWA 1A6ZB 3ARQA 1BV8A 3ECBB 1YY9D 3FHEA 1MKFA 1XGYL 1DBML 2QGDA 3H3PL 5I6LA 1QX1A 1FPTL 5KVEH 1Y1UA 5FDYA 1K5WA 4JFOA 5C0JA 2E75C 4ELDA 3FOMB 1CR9H 4MCZA 2KZWA 1AS8A 1FQ9C 4WEBH 4Q74A 4XC3H 1D6EA 4MJ2A 3FCTB 4Z7VB 4WHYG 2YGQA 1UZ6E 4ZO7A 3ZDXB 1XL4A 1NMCB 3NSXA 4O2EB 3F62A 5IT2H 4PV9B 4QOKA 1YRKA 1TOXA 5EBLB 1EVTC 3HZYB 1P4IH 2H32A 3FQXA 4R26H 1S4IA 5JUEL 3OLEA 5CEYB 5CGBA 3QDME 2OTPA 4KY2A 1CG9B 1BJ1J 2OMZA 3QARA 5I1DA 3GJFA 2EO1A 3D08A 1NC2D 2W60B 1GKEA 3BXNB 4Y19D 4AQAA 2NZ9D 2X9WA 4U1IA 5CZXD 2BY1A 3PDOA 2H32H 4XCFL 3NCJL 5EF3A 1JG9A 1B4JH 3RKDC 1DVUA 1ACYH 2YQ3A 3EYVA 5CP7A 1ETJA 1A3LH 1AD0B 1GGTA 1WD9A 2IPUG 3KH3A 5D7IE 1AI1H 3GJFH 3OMAB 5DMGD 4OCSH 2P24B 4M6NL 4B60A 3HG4A 1F6AB 3D7PA 1UFGA 1AGFA 4HS6A 3SDXE 4P23C 2JVUA 3QHZL 4PJ7E 4NQDE 3U0PB 1TT6A 3UBXI 1NDGB 1V05A 3MRCA 3P2BA 4EIGB 4DZBB 5DQJB 4OBRA 1J10A 1AHKA 2R2BB 5AYUL 1TQBC 1W0WB 2VXSL 1NJ9A 3HKFA 5D5MF 1HWWA 2WUCH 2XTSA 3WEXB 2ZWZA 4MB4A 1U9KA 2A4ZA 4P59H 3VYOA 2AJXH 1KXTB 1C16B 3TESA 2G2RA 3ZTJG 4J3VA 2H2SD 5I66B 6TAAA 2XWCA 3BVDB 2FQFA 4EVNA 3C6SB 2WQ8A 4P3DB 5GS1A 4FLSA 1JN6A 5IBLD 3PGCB 3KYAA 4DIXA 1XTMA 4RSVA 4WGVB 2OMXB 1BBDH 3LN9A 4X9BA 1CE1L 5FO9A 1MCOL 2C5DC 4MQXC 4EO5A 4Q0XL 4UINL 4XOAA 3HC0A 3F85A 3DROA 4L0ZA 2BZ7A 1UD6A 1PD0A 3MX0A 2J1YA 2FUTA 2B16A 4MCMA 1U0QA 5BVJA 1XB6A 5I8EB 4EN3B 2HVBA 4P57A 4PP1D 5E5RB 1H3UA 1DJIA 4IQHA 5LDUA 1G1OA 4IRZL 3MDJA 3DK2A 5KG9A 1A6PA 1HE7A 2XTJE 1C5BH 3EOYG 4LSUH 4LLUA 3MBXH 2CIIB 4HZLA 3X3GH 1HZKA 3KWTA 3B9KA 3I6GB 4F2MB 2H9GA 4OLWH 4KNSA 3OKNA 3KVPA 1MFAH 2R0ZH 2Q7YA 3T3MB 3RB5A 1ZTXL 4YL4A 1KYUA 5H35A 3S34L 1AQMA 4JKWA 3RVVD 4H2CA 4LARL 3QDGE 3UAFA 4JG1L 5TQ0L 1HTYA 3KPSA 1EFXB 2EXWC 1M6OB 2CO7A 4ODUB 4Z7OE 3WGVB 5L2KA 1IAIL 4OKDA 4C8XA 1L6XA 2NY0C 2LGNA 3ZRSA 3ZKQD 1PZUB 5TJWK 2D7OA 1S78D 1K6QL 3CUPB 1KG0A 4XMLL 4XNXL 4MQSB 3RWCB 2VOTA 1HT6A 1KC5H 4V11A 4H8HA 5AENA 3D39E 1C5CH 2Z8VC 4NB7A 4WK4B 2DEWX 2YPLE 4K5LA 4HKJA 4R2GC 1JZ8A 2IWEA 4TQEL 2PPAA 4MCNA 5D1QB 5TH2B 3MREB 4QRFA 3RNKA 2JKJA 1RHHB 1IEBA 4FCAA 4H44C 4PWIA 5KSVB 2BSCA 3MJ8A 4YXHL 1AGCA 3QRGL 4FG0A 2HA1A 3FB8A 5F7FA 1DQLH 1FZKA 1F90H 3O9WC 1Q90A 4C56D 3H6AA 4K3EH 4HV8B 2L3BA 3BSGA 4KK5C 5FS5A 1NAML 4DPCX 1UFUA 2FJGB 1U8PB 2FT7A 1MFCH 4KK6C 3P11H 3WIIL 1V7NL 2BOBA 5F72S 1SY6L 5GISH 4HEMA 2MPVA 4HF5L 1OAQH 1A7OH 1XAKA 4KUZL 5DI8B 5BZDA 4YOKA 3ZIYA 2I5YL 1FRGL 3QUXA 4RZCB 4NM4H 4Y4KD 2CHZA 1XSJA 3F58L 4UQ2A 1TR7A 4DWHA 3S5ZA 4APXA 1PFCA 5CZRA 1EGJL 5G4OA 1I1YA 4PY7A 2APXA 2R4RH 3VG9B 4BZ1L 2R8SH 3TO4A 4UI2A 3GUTB 1OSZA 1OLZA 2DN7A 3MVSA 2FTAA 3VXNA 1B2YA 4PJBB 4CSSA 4HXAL 5AVXB 4H4NA 4JN2B 1F3JA 3RZCB 2VR6A 2GKIA 5M7QA 4JKPH 3SOBL 1JZ5A 3CXHK 3BP4B 3AT9A 4LKXA 3NCCB 2HFTA 2ZJSH 4NLAA 1ID2A 2YGVA 4HPOL 5DD0L 3LRHA 4XXCC 1I7TA 4XI5D 1SNRA 1KXQA 2DD8H 2IC2A 3GHEL 1KYDA 4HZ1A 1KGXA 4FQCH 1NANI 4Z7OF 1PCXA 1ERNA 2DYSB 4XO9A 2EICA 5H8DA 4UM9B 2Y07L 32C2A 5AYTA 2FGWL 1XF4B 3HC4H 1JGVL 1A6WH 3MQIA 4ABWA 2WLKA 5L9DL 5KVGE 3VFVA 5CBEA 1CTMA 3QBTB 4OGXH 2RA1A 3EXJA 2OMWB 2LFGA 2ZE0A 4KX7A 4XPTL 4H13C 4WI3A 2X05A 3PABB 2AJUH 4G7RB 1VENA 2GJ6B 3NN8A 1HVXA 6FABL 2R0WH 3LN4A 3LXCA 3CHXA 2X6VA 3A6CL 5ID0B 1AG6A 4PJ9B 1AAJA 2YBRB 4ZPTA 1BMWA 2AJVL 2GEEA 2VDQL 1JPGB 4PI2A 3N6YA 3PQYB 3N06B 4PS8A 3UEQA 2AQTA 1AGDA 1MDAA 4U3CA 4MJ6B 3CZKA 3IFLH 3P4MA 1IE4A 4CNIA 1VHPA 5H4YA 3R1GL 4NHCH 4PVNA 1UWFA 4LOFA 3WMPA 1N59A 1NUDA 1AG0A 1XH3B 3ESPA 4V1DE 4JRWA 1J0ZA 2YR3A 1FL3A 1GOHA 3ESMA 1OOWA 3F01A 3MV7E 2E6QA 4I89A 5KYYA 3N43B 2YLHA 5L7XH 2BH0A 1DEEB 1T20B 4O4YL 1A6UH 4F7PA 2G60H 2XPZA 3LN5B 3E1ZA 5LNEA 3EHBB 3Q01A 4H0IA 3L3DA 4EXKA 3QEUB 2IPTL 2PCXA 3U6XA 2MHAB 5IB4B 1J8KA 5DMIH 5JXAL 4PVBA 1BVNT 1CFVL 4AW7A 4NZUH 5HJBA 5DHEA 5F2FA 5KSAA 4L18A 3LEVL 4BFFA 5HDBB 1N26A 4UAOB 3FSVA 4DN4H 3H53A 1G7JA 3D3VD 3S8WA 4M1GL 1I8UA 3RU8H 3W3BA 4HG4K 3HR5A 3AY4C 4W6WB 3T0ED 3SDDD 4NP4L 1R6VA 2A83A 2MOGA 3UBXA 3VWJA 2Q9OA 3BDYL 3FQUA 3Q13A 5DQ9A 2Z7WA 2ZCLH 3E8UH 5LG1A 4ZMPA 4PBWD 1UENA 4JJOA 2X6MA 3HTLX 2O5XH 3O4OC 1P6FA 2OXGA 4OLVH 1O9ZA 3NACL 3CSBA 4BD4A 2WXRA 3QUYD 1IUZA 2EXSA 2X4QB 3PWPB 3Q8BA 3P73A 5SWZB 1KV3A 2I9TB 5HYQA 4K71C 2WMPA 5D6CB 5LBGA 4ZUSB 1AOHA 3F65A 1KBGH 4HIEB 4QHUA 4CMMB 4J1UB 2WHVA 4N9GA 3W11D 1YVLA 4JR9H 5IQMA 3H9SB 2F18A 1R5WA 5FYKH 3EOTL 3PDGA 3WTTA 1Y0LA 4UV7H 4AQ8C 4DAGH 3KYNA 4HJGB 3SQBA 5LDSA 2C3WA 2IH8A 4PG9A 4DGIL 3BPOB 1YDPA 3FBKA 4BRJA 1LP9B 1RZKL 1YY8B 4JFFA 5FA3B 5DFVD 1QSEE 1YPZB 3SYQA 3V6BR 4AYDC 5FGCB 1I8MA 4ESKA 5FHBL 2R7EA 5C0ND 3LB6D 1KCKA 3VO0A 1I8IB 2XICA 4RX4D 3MNWB 1JVOA 3ZKXB 4KXCA 3AAZA 4PS7A 1H0DA 1XIWD 3BN3B 3COOA 3MMEA 3M86A 2J1ZA 3LRSA 3WNMA 2AXFA 5D7SH 3MLYL 2Z1PA 3O3BB 4WNQB 1QSZA 4X8CA 3VFOB 5K9JL 3VI4B 1QOKA 3VJ6A 4MA1C 1HFUA 2RD0A 5PAZA 1IFGA 1I7ZA 2EXYD 4ZSOA 2AQQA 2DWYA 3UGEA 3M88A 2VXUL 4NO2A 3PIQB 4AZ8A 5C08B 5G2NA 3FNKA 4FKKA 4GQ9H 2WPGA 3IS1X 4X6FB 1QI3A 1FJ1B 4WI4A 4YHYB 1MJ8H 1YMMB 4G6FB 3EYFB 1U21A 2R0LL 2ZYSA 2VABA 1XR8A 2OMYB 4MA3B 5DEFB 2WBWB 4UNIA 5BZWB 4NCDA 3ZUCA 3NESA 4M8QA 1Q9OB 3HG1E 1MZZA 2COQA 2UZXA 1PCSA 2L04A 4N25A 4UT6L 4KTYA 3T9WA 1ZGLA 1I9IH 5F7BA 4KZEH 2AITA 4K9JA 5EF2A 4UTAA 1DDHB 2D0FA 2NDGA 1ILSA 5B1KA 5LXGL 1OAKL 3DWTA 3VXRE 5AAMC 1HK6A 2VT0A 3B9DA 1WDAA 5ESAA 4B96A 5HI3C 5I8CB 3WKPA 3H7LA 1YEGL 4IRJA 1UACL 2Y6SC 3KLHD 4UTAH 1XSIA 5EZOL 4ACTA 2O6DA 2X6UA 4B53A 2AJYH 3TOPA 4X2UA 1PMYA 2OR7A 1PBYA 1IEHA 2WKGA 3EGDA 2WIIA 4XOBA 5ILTL 5B38G 3ULSB 1GL4B 4OI9A 4NNXB 2W9DH 5L0QC 4PRDB 4PJCF 3SJVB 2X4SA 1MVUB 1LO3H 3WAKA 1YUHB 3QE5A 1DBKL 3BC9A 1A65A 5GHWL 1NCCL 3I50L 5KYWA 4HHAA 2FX7H 1I1FB 4IJ3B 3UBHA 3E6HB 3QR1A 4OJDH 3PXLA 1BFVH 1CDYA 1BFOA 1MCWM 3HS9A 4ZAKC 2VN6A 3RGVD 3WO3B 2P5PA 3K5RA 2R9HD 5C0RH 3FTGA 4D8PA 2NR6A 1CICA 1QEXA 1RU9H 5I0DA 1C8QA 2ZYHA 2JLPA 1I8KB 2YK1L 5DLLA 2W65B 3CHPA 3IYLW 4ZTEA 1F11B 1SJVA 4M7LT 2BSSB 1BQ5A 2PPFA 4ES9A 1YJDL 5GGTA 4EPSA 1ZGLP 1A5FH 2NXYC 2MQ3A 2VM9A 3DGGA 1H9DA 4P2RB 1FAIH 5SWSE 2X38A 1VGEH 3Q05A 5EEUA 3NPSC 1NUNB 2CO3A 1CS6A 2SEBA 3GQFA 5GGVL 4G5ZH 3SE4A 1ZDQA 5KYXB 4GMSL 1IB5A 5GGTH 4DGUA 1YYCA 4HUUB 1DQIA 4GG6E 1J5HA 5KOMC 3IRCA 1DQVA 1DSYA 2A6KB 2XHNA 4HK0B 2BCKA 4FQXA 2A5UA 2LTQC 5DT1H 1LNUB 2J6WA 1KTLB 2V3FA 2CU9A 2X1PA 3KWUA 5IOPA 1SQ2N 4NEHB 3QEQA 1FNSL 3TV3H 4O02A 5C09E 5C0CE 3EJPA 3FSWA 3GRBA 3C5SB 3O2DA 5J11C 5I6KA 5ISZA 4P2OA 2PTVA 1EFQA 2IAMC 4AGPA 1N6QL 1CLVA 3D9AH 1ZY9A 1SHXA 4P2CG 1E5AA 5FF6A 1NANH 5T3ZH 2X0WA 2HMIC 4DEUA 2Q1EA 2W95A 5I1JL 2W8CA 4P4KD 4NQDD 4BELD 1I9JH 3O2DH 4WTZA 1V27A 3QQ9D 4JZNB 1NOAA 5DRZB 5I0ZA 1NGPL 4K94C 4ZBJA 3QUMA 1NPUA 2D7NA 3AQXA 5I19H 3KR3L 1KJ2L 3NA9H 4FHJA 1H5BB 1HCZA 2J1WA 3DPBA 4XN5A 3EH2A 4AOFA 2KBGA 5E2WL 5J3HD 3TU6A 3WIHA 1UJTA 1FYTE 3MRPA 1WCBA 4LU5L 1IMHC 1U3HC 4JZJA 1FGNH 1ZXQA 3KCWA 4NUJB 4Z7WB 2X2UA 4JY4A 4ZFZB 3RL2B 3QUMH 4IEFB 3RGBA 1VSCA 3ZJAA 1CLOL 3WY1A 1AC6A 4HDIB 43C9B 5HVHC 2LLGA 4FZEL 3ARDA 4AKOA 4UT7H 3WIHH 3N9GH 1PQZA 4GKNB 4XMZA 2MKWA 5EU6B 4ZUUB 1PX3A 1ZTXE 4EDWH 3WG7B 5IGXL 3AREA 3H4FA 4XO8A 3O2VH 2E9WA 4FLHA 3U36B 3LKSB 3SPIA 3MRLB 3L5IA 3KPLA 3L3OC 4TYUA 1I9RL 5T33H 2FWUA 4ONGL 1WC7A 5C0IB 4LXFA 4IGBA 4PJAA 4Y1SA 5JMOC 4FJZA 1AXTL 3LZOA 2GJZB 5CGYD 4ZO9A 2OYMA 3DVGB 1GAFL 5IVZA 3TX4A 2I85A 5HHQB 3DJTA 4Q4EA 1AKPA 1T22B 1QG3A 3KLSA 4XP5L 1ZD6A 3DYMA 1UB5B 1YNKH 1ZLEA 2QADD 2IAAC 2XWZA 3GD1C 4OB5L 4ZO8A 1DJYA 2MOQA 4FQJH 1TZHA 4X6CB 1ZLUK 4XRCA 2AANA 4EUPB 1TZ8A 3HI1A 3VU1A 1FNLA 2CLVA 2IH1B 2F74A 2HFGL 3OLIA 3T6WA 3UG5A 3MOBL 4ZFQA 4PJ8A 4GAYA 4GG6F 1ZHBB 5DJ0B 3KLQA 3FRUB 5FKPA 5HHNB 3VMPA 4OGZA 1AHWB 2QQNH 2HRPH 3ARFA 4QGYA 3T09A 1JF6A 3II3A 4GBXC 4U2YA 3SO3C 3A3YB 4EEEA 3PHOA 1M7XA 4PLKC 3QDGD 4PD4J 5DD5H 4AI7A 2BNQE 5IFJB 5EOCJ 2E6PA 4W4OC 4B5ZA 5KJRH 1A9BA 4H0LC 5E00A 3VNZA 3BT0A 4PB9L 1FVEB 3FXIC 3G6JB 3VXMA 4ZOEA 4OD3L 5E7BA 5CEXB 3G6DL 2NPLX 5T5FL 2VAAA 1VACA 4I2XE 5E6YA 1W6LA 1KB5B 3G5ZA 4FG2A 4Q2ZA 3STLA 3H0TA 3ZR6A 1U8CB 3RRQA 3VYNA 3BE1H 2J4WL 3F84A 1P2CB 4G7QB 2XN9B 4HUMB 4JFOB 3KBPA 1HX0A 4CVWA 4PV8A 1KN4L 1AQDB 3E2HB 4F7TA 1QO3A 3C5ZD 2IWFA 4X0KA 4CC4C 4JPVH 3SE9H 1K3ZA 4WU7A 5IHHA 5T1LA 5FGRA 3SCMC 5D1ZC 5HDQH 5MEOA 4QOKB 2EUZA 1WE5A 3PHQB 2ZZUT 1P4IL 4MZ3A 4OZIA 2H32B 3FQXB 2FRGP 2D7TH 3OC5A 3BRDA 4D9RD 3KGUA 2E7CA 2YFOA 1UXMA 3VXSB 3QJXA 4IIQB 3SKNA 5L8KB 2OMZB 4JFTA 1JD7A 4KMLB 3GJFB 3NTCH 4LDLB 3RKDD 4M6ML 4A66A 3BDXA 4U1IB 3ATBA 1B4JL 3ARPA 4MXWL 3QEGH 4RBPH 5CP7B 5TE4H 3L3JA 3PU7A 1GYVA 4H1LB 5GZOA 1H9VA 2WUBL 3UPAA 4P23D 2APFA 1LVEA 2F53E 4IOSD 4CL7A 2DMBA 4G9FA 1AGFB 4HS6B 2TAAA 4L4VA 4XMVA 5HHPB 4K2UL 3M1CA 1MHHA 3X12A 1JXKA 5EBWB 3ROLA 1MCNA 1GA2A 1SJMA 1WFNA 3NCMA 4K23H 1IM9A 3P3RA 3MV9D 4OT1L 5E8OB 2IH3A 3G04A 1OPOA 5J6SA 4BFRA 5MI0B 3NEXA 4ORGA 2EE2A 5F9OH 4OFVA 2DI7A 1BHGA 3B56A 1H3TA 2CMRL 4YH6A 1YEIH 4P59L 1NGQH 1DJSA 1EA9C 4OTXH 4IKKA 1CXFA 2EDBA 2G2RB 2EKSA 1LWHA 2XXMB 5DTFA 3OLDA 2V9UA 1NGYB 4E68A 1PD1A 4ALAC 2AEPL 3WUWA 2RMNA 5EN2B 1Z9MA 1FVDA 3DIDA 4EVNB 5GS1B 4U1JA 3VD0A 4PBDA 4F8QA 3AG4B 1JN6B 3QZOA 4MQXD 3HHMA 2EKJA 1QUNA 3UG3A 4NKDA 1PY4A 1MW1A 3FDWA 1TLMA 1CLCA 3LS5H 4L29B 2WB7A 3L3KA 5FO9B 4YK4B 2DQCH 2NNRA 3EBGA 3HC0B 3WI9A 1DTUA 1Q9WA 2GB2A 4LAJH 4XNQA 1EEYA 2Z31A 1R19A 1QRKA 2EDXA 3L7EA 3QC5X 3S2AA 4IS6A 1NCBH 1WZ1H 1XCXA 1YEHH 3DNKA 4RMWA 3WE6A 2F1EA 5G55A 3IXAA 4P57B 5IQLA 1DJWA 3IDXL 3QXDB 3WY3A 1BWMA 1MAML 2ORBH 1HAUA 2PW1A 4FFWC 4PGJA 3V0WH 4LLUB 1KT2A 3X3GL 4HZLB 4HJSA 1N10A 4OLWL 1WT5C 2H9GB 4L4TE 2R0ZL 3OKNB 5CJXA 2L7EA 1P1VA 4AQOA 1OL0A 5H35B 4NO3A 3VAEA 1MNNA 1NAKH 1P5UA 3MLUH 4HIXL 5D2NA 2YRLA 1G9ML 2EXWD 5KS9F 4MAUL 3MRGB 4XBEH 2E9JA 2CO7B 5HHXL 3WS3A 2NY0D 1HH6A 1NGXA 1O5PA 2IQAB 3MNDA 2GBAA 4JRFA 4HUWB 3SPCA 1J8SA 1UQSB 4N87A 2P45B 3J27A 5EDSA 5IJKC 5F7NC 3FKUS 4U6YB 4PCYA 4Y1TA 5DFWH 1XR9B 2K9UA 3S7GA 5DUPL 1NL0L 1IGJA 2XQYA 1RUQH 1E4WH 1C5CL 4R2GD 1E65A 3ZBMA 3EYSH 1JK8A 4GIAA 2K7PA 1JUFA 5FLUA 5BPPA 1P4UA 1MQKH 4HKJB 4HWNA 5SX5K 4M1DL 1ADQA 3BQVA 1QNZL 2DV6A 4GXVL 4JGUA 1NEZA 3RNKB 5JORA 3P3TA 4UYPA 5CUSH 4O5LL 4A7UA 5EEWA 1WF5A 1NFDA 1QYGH 2V2WB 2ZG2A 1ORQB 3O9WD 5AKTA 1AGCB 3BWUF 5C07D 1SFHA 3FB8B 1UD4A 1ADQH 3OKEB 4KK5D 3SPJA 3ARGA 4OQ1A 5CU9A 4QJ4B 5ENWA 1KGCE 4KRPC 4B9ZA 3DBXB 3KJ4B 4O2FA 4KK6D 2YUXA 2V6HA 4LAQL 1U8OA 1VF5C 4JL2A 5GGRY 1UT9A 2ZCHH 2GY7B 4ZW5A 1LK2A 3F7YA 3SY6A 1JNHA 1ZLSH 4Y5VA 5E6IA 3FQ1A 4NM4L 2EUWA 4AVHA 3TL5A 5DURB 5CIPB 4AUYA 3WKQA 4M43L 4APXB 2NW3A 3KM1A 1FL6A 3I84A 1TENA 2EDYA 2IG2H 3ALPA 4N22A 5DZOA 3TO4B 2MCMA 3MFFA 1OSZB 3OAZH 2F58H 3GB7B 2P5EA 3D85D 1U93B 3JXAA 4U31A 1GGYA 1ROCA 2CKBA 3UJJL 3W5NA 4ZO6A 3W2DH 5I2IB 3DOIA 1FNAA 3X1BA 2ZJSL 5ABZA 1RCYA 25C8H 5BVPH 2IWGA 4PJEE 2QV4A 4AVJA 1I7TB 1ND0A 3HNTL 3BDBA 1XD0A 4K5MA 2CKBH 4K07A 3ZZQA 5T3XL 3ZTNH 3TEXA 2YD6A 3D5OF 3I9GL 32C2B 1NC4A 1A21A 3NABH 3T6QC 2K7QA 2AEWA 2OX5A 1A4CA 3VFVB 5CBEB 4Z78A 4RLDA 2HT4C 2J8HA 3GRGA 3QJRB 3CZLA 4ZMVA 4NN6B 3ZDWA 4H2AA 1BW8A 2B1HL 3ZDYB 1S9WA 5DK2A 5I76A 3QXAA 2W9EH 4BFJA 1RUKL 3RTQA 1A7QL 3GRWH 35C8L 5JW4Q 4JK0D 2OXHB 3AM8A 1YQ2A 1ZRUA 4HX1A 4QRBA 1EIBA 3HG1D 3BT2H 1GW6A 2YD7A 2JQAA 1JBJA 1EZUA 2EH7H 1NLBL 1I4FB 4IK7A 4KO7A 4P5SA 1OGPA 1OIOA 4ZPTB 4HCIA 4ABUA 1NIBA 3ZY7A 2DMKA 2VRAA 4QXWA 5MENA 1QTSA 3II1A 3SDYL 1E42A 2PO6B 5J1AA 1IJNA 1QI5A 2HAZA 1FFPA 2YC1A 3OPZH 4NHCL 5INCB 2BSEA 3GKZA 3PL6C 1SVBA 4JO1L 5KANG 1N59B 3IJHB 5DJYA 5EEVA 3I6KB 4JM0A 1N12A 1FL3B 2H6PB 2FATL 5CJ8A 1UD3A 1YN7A 2FQEA 1JZ4A 4I3RL 4OCNC 5IB1B 1MW2A 1MQ8A 5T5NG 2D31A 4JBSA 1A6UL 5FOBA 4MYPA 2AQSA 2WO4A 3RY4A 1X9RA 3PGDB 3L3DB 5BRZD 3ISYA 4QRUB 3UAJA 3DKHA 3KPMB 4IRSC 1WIUA 2HFFA 1DLFH 1OARH 3D4YA 4PMEA 2HFEB 4G8EA 4KZ0A 5KSAB 3C2AL 3ML9A 2ATPA 4NKIH 4HKZA 4DN4L 1NC2B 1QFWI 3AABA 5EO1A 1QSFA 1G7JB 5JPNC 5DD3H 3RU8L 1WLHA 3UTSB 3V6OC 4HGWB 4G1EA 1GGBH 5FM8A 1A6TA 5F7DA 3MUY1 1UHVA 4BZ2A 4M3JA 3BKCH 1TSHA 2A83B 4YZFE 2NYKA 1S9YA 2QL1A 4PJEF 3FQUB 2LOEA 1QHPA 2QEJA 4JHWH 5DQ9B 1I3UA 4OIIH 1OTTC 3BGFC 2NNAA 3CFEB 4RGOL 3CNKA 2OXGB 3MCLH 3MROB 3IWVA 4G8GE 3LZLA 4HIJA 3BISA 4BZ2H 5AVVB 2Q5BA 5HYQB 1GGIH 1SF3A 2WMPB 3BZEA 1X4YA 3VGHA 1KBGL 4G11A 1A14H 1HKLH 2FBJL 2CBTA 2XKSA 4JR9L 5FYKL 2XY2A 2KT6A 4YDVA 2ZNWA 3G5WA 5DGQA 4AY0A 3LTVA 3TONA 3V4VL 2C1PB 2OM5A 2MH4A 1YDPB 3U83A 1MXDA 4MNGE 3U1QA 5GS0H 1A3RL 5AB1A 1QFHA 2CKNA 5K93A 5L2JB 4X9HA 3T08A 3TEWA 2JXMA 2X10A 2QFPA 5EZIL 3EYOA 4H20H 2XNAB 1KTCA 3DX7B 3O6FA 3UTZA 3MRBA 5GJSH 3KGSA 4GKLA 5I6NA 1NGZA 1H0DB 2GBTA 4PWKA 4I0PA 4A6YA 3S4SA 1KZYA 3LPGA 3O81A 5D7SL 1NBCA 5I1HH 3D0LA 5C6TH 2MKLC 3HJ0A 1ZHLA 1AO7E 3WEMA 4XNUH 4K7PL 1TYRA 3OGCB 2F08A 2FEDC 4JHZA 4ZPVA 2AZAA 4NO2B 1I3GL 1QBBA 1FYTD 1OAXL 5FB8A 4QRPA 3D2UB 1HCVA 4YHKL 5KZCB 1IM3D 1O6SA 1VGKB 3VFNB 1IARB 1NLDL 4MJID 2Z3FA 4AIEA 1VZIA 2OA9A 2UZXB 1MAJA 3RI5F 3THML 1JYWA 1I9IL 1ZGLB 1XGRA 5LAPA 4UV4H 2X89A 1XXDC 3MGOA 1BDYA 3MODH 5HI3D 5K9QI 4OFYD 4DP7X 4XTRC 4YFEA 3N50A 3KZ8A 5ESAB 2X1XR 2Y6SD 4P9HC 1XDTT 3IFNH 4XCEA 4IRJB 4AKPA 5E6ZA 4G8IA 4YZFF 3IBEA 4MNHA 3AS3A 1USZA 1XFPA 2UUDK 3EJSA 4IBLT 2AJYL 3LKQA 2XRAL 1Z9SA 4L9LA 4GP5B 2E27H 4C4KT 1Q94B 1JPFA 2WIIB 1JNNH 4UOZA 2XA8L 1AP2A 5HDRA 4GFXA 1CWVA 1KEML 5D72H 1PEWA 3BMWA 4L8SC 4HSAC 5DU7A 1LO3L 2X4SB 3FT4A 4NENB 1I3VA 1FZJB 4QRQA 4Y1AE 4P07A 1BX2A 5DJAA 5IHWA 4AGMA 1PTZA 2ZWYA 4Y4FA 5AG8A 5KYWB 4HHAB 1QR1A 3KVQA 3WMQA 4ZAKD 4U3SA 2FEJA 5C2BL 1BFOB 4MZ2A 3IDMA 3RPIB 2GC4C 3KW7A 2E0PA 2G9KA 1VESA 2QQKH 3QJTB 3VFSB 3WNLA 5C0RL 1FE8L 3FTGB 1PY0A 1RU9L 5D2LE 4NBXB 3VI3B 5ADPL 4RRPM 5IWLC 5JA9A 4I18C 2NXYD 5K5YA 1LXMA 4X8GA 4AIOA 2FD6L 1WRFA 2I69A 5IV2A 1UATA 3DGGB 3T1FA 4JNXA 1FAIL 1TJHH 3AXHA 5AD0B 3ZZ1A 5CN1A 3KGRA 4FQ1L 4E42B 4WWKC 3CMOH 3IFPB 3PWJA 1HINL 1V3MA 2IBZX 1ZT4A 5GGTL 4AXWA 3RG1C 1L0PA 2DQGH 2RJMA 3GI8L 4H8WC 4LF3A 4XVJL 4Z0BH 3HI5H 1BBJA 1JGDA 1D7DA 4X4YB 3QJHA 1DQML 1EJ6A 1Z3GH 1DVTA 2BCKB 2F1BA 2IALB 3ABKB 2LR4A 4WTWA 1GPOH 5DT1L 1KLUB 3DETC 1VDGA 3CVIH 3QAQA 4N0UE 4QCIA 5FAAA 3FB6A 3FOLA 2IBZY 3QZNA 3MLSH 4PS4L 1IGFL 3QEQB 4K7FA 5A7BA 2WP3O 5D7EA 2FO1A 3CD4A 1JCKA 4DGWC 2OMBA 1ET5A 1MJ7L 2IAMD 3Q2VA 4OZHE 2B4CC 2G5RA 1JGUH 1GXEA 1LE5A 2HMID 2B9AA 1Z5LB 5FYJL 4E9WA 4JQVC 3X3FH 2F53D 4O02L 5FF6B 2WLJA 3QPKA 1RZIB 5C0BB 3OKYA 4KTGA 2AVFA 4GP8B 4R5XA 1BAFL 3V0IA 2AJSH 3I02B 1FF5A 3MRNB 3C60C 3FUKA 4UF7C 2BIPA 4FA6A 4K3JH 1BAWA 1S7UA 2BIMA 5AW5B 3QISA 1J5CA 3FB5A 3NA9L 3NJXA 3FRPA 4KI5E 1JPSL 4NN5B 3AADB 2ZAHA 5EBMA 1U3HD 3VFWA 3QFJD 5F88A 1OZUA 1K5NB 2WZPA 3GXTA 4OY9A 1FGNL 4JZJB 1OGAE 4JY4B 3QUML 1K9TA 1CD8A 4HPYL 1QLEH 1QPKA 4TUKL 1NM9A 3JV4A 4LNVA 5AZEL 4JHAL 4UT7L 2FWSA 3WIHL 4CADA 1PQZB 2R4SH 4OLUH 2BOCA 1FZOA 3SDAB 2B15A 5IMKA 1AXIB 4PRHD 2XPYA 3GNMH 3ETTA 1DVQA 3L16A 2VZOA 1WC7B 4IGBB 1WUNT 4EIZC 4JM2D 1A9VA 4N8UA 3ENEA 1BXXA 5DEJA 2W1NA 1VA9A 5IVZB 5EOQH 3WOVA 4U1GB 3ES6B 4ONFH 3VWKB 1CXLA 4UCFA 3R8QA 5L8JB 3UBFA 2CM6A 4Y4HA 3CZNA 4Y2DA 4DCQA 1N64H 3Q6GL 3GM0A 1F58L 4XRCB 2EYRB 5GRJL 3MLWL 1BZDA 1ZXKA 2WVUA 3UYOD 3I2CL 2CR0A 2VN3A 1N19A 5AZUA 5HJ3A 3E7JA 3EOBA 3WEOA 1Z9PA 5LAXB 5J6HA 3SGKC 3QIUA 3BD4A 3TBBA 4BBWA 7FABL 4GAYB 4P2QE 2RALA 4CVZB 3DDGA 4DW2H 4GBXD 3CZEA 2QQNL 2HRPL 43CAA 4PLKD 3N04A 4MNQD 5B39G 4AJWA 1M9SA 5D1XA 2ZSVA 3D3VB 5HGDA 4NRZB 4N20A 2ENYA 1JZ3A 3BO8B 1QFWH 5DD5L 3MAWA 3HI6H 4OCYH 3U2SA 1I8LA 2BVUA 3HS0A 1A9BB 4QDGA 5E00B 4RFOH 2YEZA 3VXMB 4EZJA 1D5ZA 3ZKMC 1P9MC 5JA8B 3OZ9L 4MCYA 2NY7H 2PP7A 5EOTA 5GGQL 4BA8A 4XB3A 1AIZA 1VACB 4RGNC 3G5ZB 3EDDA 4GS7C 5F9DC 2ADGA 3JYCA 4JPKH 1S2EA 3STLB 4NAJA 3HLAA 3INOA 5EUOB 4BZYA 4EI5A 1KYOK 1T1ZA 1Q0YH 5HHOE 5F93C 5E4IA 4PV8B 4JRLA 4F7TB 4BFBD 3SCMD 4JDZA 5D1ZD 3MLVH 5KBLA 1P4LA 4JPVL 3SE9L 1BF8A 1PAZA 5BUAA 5T1LB 1EUTA 3GXIA 1SRDA 4QXUH 4S10A 2EIZA 1D6VH 5BXFA 1QD0A 1ZHNB 2R69A 4QHNA 2D7TL 1MCPH 2HN7A 4A7GA 5EC1A 2BK8A 2DW5A 2AMUA 1FGVH 1M1XB 3RVXC 1JDDA 3FU6A 1FFQA 2BRRH 4X7FC 3SKNB 2VR3A 4JRXA 1A6AB 3FUJA 3S36X 4GW1B 4OZFB 4AYFA 2HX8A 4MB5A 4F91B 5K39A 1S8DA 5B7MA 5TE4L 4KO9A 4ODBD 1Q9KB 2OMUA 3VFRA 2R51A 3C09C 4ILDA 5T3XE 5AVSB 3VH8A 1KOAA 1CGVA 5DEGA 5EZJB 2FZ3A 2PWDA 2XACC 4LEBA 3K74B 4L4VB 4LPVA 1E4KA 4XP1H 4MDJB 2NY5C 2EC9T 5DSCA 1Q72H 3ROLB 2X4TA 4CILA 2IFGA 1A1MA 1IM9B 4JY6B 5EPMB 2HKHH 3BZDA 2IH3B 4LPWA 1AZVA 5D7KE 3UCQA 3HUJE 1H8SA 2B5IB 4CUCA 1KBPA 3NFSH 1MI5E 1AZBA 1DN0B 1T83A 1X4XA 2C9PA 1NGQL 2VSKB 4LIQL 5BS0D 3VFGH 1TNNA 1SXBA 2CHDA 1JK9A 3JTBA 2M83A 3K80A 4ODVL 5I26A 4P3CL 3DTXA 1FVDB 5FM5O 4C83A 2OZ4H 4AQ1A 4NQEA 3QI9B 3RWIA 5ADOH 4J8RA 1QPPA 1V54B 2ICWB 3ILEA 3LS5L 3L5JA 1X5YA 4PJHA 2DQCL 4U1SA 3RWDB 3WNIA 4FERA 4OQTL 3TBVB 2QTVA 2AXWA 3C6LA 3VD4A 5EWIH 4XNQB 4X7CC 1EEYB 2Z31B 5J06A 3F6JA 3L7EB 3PJSB 1EDHA 1MF2H 3QNXB 4OD1H 1B0WA 1WWBX 3AMLA 3SGEI 2WWKT 1FORH 2CIKA 4FFWD 1T0PB 3DJ9A 2ORBL 1T3FA 4QI3A 4W9CC 4B50A 2PW1B 3V0WL 5IKCA 5B7FA 2MPAL 5J13C 2IGTA 5CSBA 3LQZB 2FAUA 4JANB 5GZNC 5BQ7B 4IU3A 1J7VR 5EORL 3QQDA 2D4DA 4HD9A 3RGVB 3BVWA 3MLUL 1GZHA 5K1VA 3O11B 5B22A 1J0IA 1CF8H 1CFSA 4MMXC 4MMZB 2KPNA 5CEZH 3FCBA 1CYGA 1RZ8B 3SQOL 4YQXL 5KBDA 3WS3B 4F20A 2UV3A 4Q52A 1KXVA 5AQ0A 1JWSB 1SYVA 3H85A 1EXHA 3C5JA 2OI9B 5GS2D 2A6IB 5C0DA 3BIKA 3FO9A 4DP1X 5L88H 4JO8A 3N44B 3ZT7A 1BLIA 2F7RA 1TETH 3VG0H 1IGJB 2DRUA 4Z3FA 5E94A 3FHAA 5CZVL 1JF1A 1U41A 1EJOL 2Y7QA 1WBZA 3LRLA 3LDBC 3NGBB 5C0AB 5DDHA 5LWYL 4XX1G 1SHMA 5CHNB 2NCMA 1JUFB 3UTQA 3WTVA 3BGMA 1D9KD 3KH4A 2OJEA 3HUJF 1KJ3L 3ZE1E 3QZBA 3W56A 1PG7L 2CHWA 4ZUTA 1HAWA 1PLCA 1QYGL 2YAOA 3BZ4B 5JW5A 3N85H 4DN3L 4KRPD 4YHMH 3ARGB 5I1GL 1CFNB 3OD3A 3W9EB 1R24A 1E9OA 1TVHB 2BHZA 2ZKHH 4X80H 1TFPA 4O2FB 1GW0A 4XVSH 1KYFA 4HPHA 3CVCA 4LLDA 1RFDH 5DA0B 5EIIA 5IZ7A 4M93C 3LIZL 3UTTE 4AG4L 5EU7E 4OF6A 5DUBA 1MREL 4F8PA 5IFAH 3FQRB 4Z7UE 4HJTA 1P6AB 1KIRA 1LK2B 5F70A 2AQPA 1P7QD 1ZLSL 1KTJA 1JNHB 4PCSA 4YBLC 5AL0A 2EVIA 5FFLA 2R1YA 4BE5A 3RURA 3T04D 4BQCA 3M17A 3X11B 2NW3B 1FL6B 5KWYC 2PTTB 1WFJA 2DQDL 4UDUB 1ADWA 1QLFA 3DURB 4Z7AA 4KVPA 3RI5K 2PWHA 2XCMC 5HHMD 3WEBA 1E9PA 1TQUA 4ZUWB 1FP5A 1F8TL 4A1RA 4N5EC 3RAJL 1FVCA 2CKBB 3ZKSD 2F54A 3WEAA 1J8RA 4L1TA 25C8L 1A9EA 2F19H 4AIZB 4EOWL 2VLRA 4DUWA 1E30A 5JHDD 2OL3B 1KLGB 5BZZA 4FJYA 3E1F1 3US1A 3TZVA 1KELH 3HB3C 3MYZA 2CO4A 3ZTNL 4XCYA 1K4CB 3DTUB 1WCQA 3L7FA 2VDPH 3EFOA 4IBUA 4NHUA 4PN6A 2HT4D 2QADB 4H8VA 2JK5A 3FB7B 4AUUA 4JPIA 4OI8A 2A3TA 2OX5B 4LFHG 4APQA 4Z78B 5FW7A 5EB9A 4YDJB 2K45A 3L8QA 5F89B 3DXAE 3UJTH 2WZ6A 2YLKA 5I76B 3OJVC 1OCZB 1XSKA 5I82A 4DVBA 3N1QC 4XHQA 2TSAA 3PWLA 1J8HE 1NMCC 1G9NH 3ZE1F 4ANKA 4HJJL 4AMKH 2APVA 3MHZA 4WFEE 1HDMA 3ESOA 4KMTH 3TC9A 3VXPB 5DZAA 4JG0H 4JQIH 3ULUE 4PGBA 4LCWE 5EEXA 4L3EB 4HZAA 3OPZL 1HL9A 3ML8A 4BH8B 2HB0A 5E8DH 2ATKA 4GNKB 4FL4C 3WS6A 2XX1A 2NX5E 4BK8A 3REWB 3FTUA 3QZLA 5IB3B 4GAGH 1SLXA 1Z9LA 1PZ5A 2J6EA 4WI0A 3LQAC 5CAYB 1Q38A 4Z7UF 4ZMWA 1LTXA 4LFHD 1GCFA 4HOZA 4X7TB 7PCYA 3L1GA 3JWNC 5FV1L 5KYNA 3S37L 2J6EH 1OM3H 1NINA 4IRSD 1DCEA 4ZOAA 2VDKH 5ACMA 4W70A 1DLFL 4PJIE 1G84A 4DP4X 4UILH 1RUML 4NYLA 4TULH 2JKWA 3TN0A 4N68A 2VQUA 1W72B 2DBLL 1QSFB 3L13A 2DKSA 4G1EB 4BQ8A 3ECUA 2X2YA 1LO5A 4QHMA 2E9BA 5IR1B 5FYJE 1OTTD 4P23B 4JHWL 1UOWA 4M8VA 3V0AC 4ECNA 2HRGA 3ZGHA 2UWEA 3RJDA 2GC7C 3FO0L 2H1XA 4BZ2L 1BA9A 2VL4A 1MJUL 2F6AA 3TM6A 1ZT1A 4FFYA 5FOJA 1GGIL 1IIKA 2XBDA 2HG5A 3TCLA 1FH5H 4EN3C 2BSTA 1H3GA 3NJLA 3QZPA 5I6PA 4EI6A 4G42A 3DI2B 3LV3A 2NZIA 1F5WA 2YOCA 3CTTA 4YDVB 4R4FL 3ELAT 2C9SA 3LHAA 4FFYH 3GXNA 3Q1SH 1S7XB 2XIDA 4RDQG 1KWGA 1T1YA 1GIGH 2ENPA 4MD5B 2EIDA 1LYQA 1CZ8H 2ZXWB 2R2CA 5KAQG 4XPBL 2YAMA 1JVLA 1PLGL 2JXMB 5K59F 4H20L 4LLVB 1X5MA 4Y5YA 1NSNL 3HFML 2XKUA 1RZJH 3MRBB 4RAVB 2JELH 2Z6FA 4B3VA 4I0PB 4XWGH 5C6TL 4JKNA 2FJFB 3D0LB 1AQ8A 5F3FA 1H3PL 1ZHLB 2FEDD 2YOAA 1DFXA 2DWDA 4KI5D 2CNYA 2DWTA 1BMZA 4A6YL 4ZPVB 4G7YH 4TVPD 4XAWL 3N40P 3GSXA 3SGEH 1YEKH 1A1NB 2X2HA 2A9AA 1OKEA 4M3HA 4QRPB 1BXAA 2ESVA 3B6SB 3ZDXE 5I8KL 1BQHG 2FIKA 4C56A 4BUQA 3D4CA 5D1QC 4PSRA 1UWGH 5HHVH 4A55A 1VPOH 4PI0A 3D05A 1INQA 3DV6A 3KBHE 1IQWH 2ITFA 3HRPA 3U9PH 3H55A 3KWWA 4F7CA 1J1PL 4RA0C 4XTRD 2BSRB 3MODL 4UUJB 3K2UH 2DM2A 4ERSH 1OTUC 2E86A 4PU2A 4X5LA 5J8OA 4NRXB 5T1MB 1JXDA 1SFDA 3TF4A 5AVRB 2UVEA 1GJIA 2AK4A 4G8FA 4KO6A 3IFNL 4GEIA 4H7VA 4LASL 3SGDH 2AK1H 3QZMA 1LWRA 1XWVA 4G8IB 4MNHB 4X8XA 2BY3A 1BG9A 3H54A 3ZRFC 4BKTC 3T0VA 4KHXL 2CG9X 1KGIA 4LVNC 3OL2A 1JVKA 3ARUA 4BFOA 2OKMA 4R2GB 1MPAH 3VSUA 4WO4A 2FX9H 1FFRA 4A2HA 4OF8A 1T7XA 4LSVH 3DVFA 4MQ7B 2ZP9A 4P2QD 3VG9C 5EMYA 2GBVA 4EN2A 1DUZA 1TQCB 3PHSA 2E3VA 4JQXC 5C07B 2BW4A 1HZLA 2ZCKH 2LE9A 2OLDA 1AOZA 4KPHH 1MLBA 1DQJA 3EGSA 2Q20A 2CBMA 2W07B 3IDMB 3JWOL 4IHBA 3RZCC 2DDQH 5CFAA 3GMQA 5HGBB 3BLBA 4ODXA 4FCHA 4KAQL 4B9KC 3GO1H 4ZMXA 2EO7A 2GUOA 1BYNA 2BIIA 5I1KL 3D50A 4XODA 1L5GA 5EA0H 3VFTA 5GSRA 1Q1JH 5IEHA 1M4KA 1IBZA 4NT6B 1A22B 1BEYH 1MHPL 4K73A 2BMKB 1BAGA 4G7VH 2VXVL 3VXOA 4YHNA 3T1FB 4WWKD 2IXQA 1ZSDA 1NCJA 1T21A 1UOLA 3CMOL 3PWJB 1KFAH 5HHOD 4PJAF 3GBEA 4N2CA 3E3QC 3AQDA 2DQTL 4MWFB 4BFKA 1XMWA 2VZTA 2WSDA 4LF3B 1F4XH 1TDQA 4UQ9A 5KVDH 3WNJA 3A4AA 4JFYA 1BBJB 3MACL 2ADYA 3DETD 3D85B 1I85C 3QJHB 3ZDXF 1GPOL 4F2ME 4LIQE 3CVIL 4XO5A 2QKIB 4PJ9C 3QDHA 3ZZLA 2R23A 3FB6B 3AROA 4OD2B 1DQQA 5GGUA 4WK2B 2ZUSA 3INUL 4LEOA 1F1GA 5DRXA 4NCC1 5BO1H 5E56A 3EDFA 4X5WB 3T5WA 1G5GA 3NQKA 2ZXEB 2VITA 3CFQA 5AW7B 2F1AA 4OKVB 1HJCA 4LOVA 3L2LA 1UG9A 5HI4C 3MRRB 1LE5B 3M45A 3UFIA 2H41A 7CGTA 4XVTH 2KZBA 4WZ9A 4X4ME 5DQDH 4YAQA 1U8NB 5A2JH 1BD2A 2AJSL 5IHZB 3KEDA 1YC8A 4WHDA 3BUTA 3SEPA 4K3JL 3D34A 2O61A 4J3OH 3WFDL 1S7UB 3GSUB 2ODHA 1YECH 1U8LA 3FB5B 2L0DA 1JFHA 5BO0D 2WINA 1K2DB 2NOYA 5D7KD 2Z8RA 3BSHA 4H88H 5F88B 4TQ8A 5H4ZA 2Z92A 5G4NA 4BHUI 1IGCH 1S7VA 3IDJA 2ZUQB 2GSMB 3JV4B 1JWUB 1P5VA 4G43A 3SDDA 5AZ2L 3JVGA 3RL1A 2XFGB 1MJJA 1W6WA 1X9UA 1WIOA 1HHHB 1QFUH 1T7YA 1Z5HA 3QWRD 4J3TA 4E41A 3RA7L 2BOCB 3L5WA 1BQUA 1FZOB 4XXWC 5IMKB 4WUUE 3WLBA 4U7KA 2NY6B 4FNLL 4FXKA 1M3JA 5CD3A 3R06B 4LNRA 2CHNA 3FH8A 4OCLC 4A7TA 3MR9A 4LRNH 4YUEH 3NG5A 2L7QA 4W93A 5EOQL 2V5SA 3B9EA 4ONFL 5EUKB 3MPCA 1YN6A 4UB0L 3IMBA 4E2OA 4A63A 2QVTA 1N5YH 8PAZA 1DBBL 4Y2DB 2YPVA 4DCQB 1T2JA 3I74A 5K9KA 4Q6IC 5AAWC 3PAYA 1NBVL 5BRZB 4G1MA 1CF1A 1Z6JT 3NJJA 1WO2A 1THCA 3OAWA 1HXYA 1RZKC 5DF0A 2Y3AA 5BW7A 2YPVH 3DGCR 1A0QH 3ULVL 4DW2L 3OXSA 2EADA 1HEHC 4XO3A 5FYLL 2XXFA 43CAB 1KSRA 1LO4H 2Y7NA 3BPOC 4NC2B 5D1XB 5HGDB 3O6ML 3WSQH 1QFWL 4OCYL 1AXSA 1ZWIA 2QBWA 4H0HB 1AGEB 2YMOA 5I6MA 3GMPA 3HS0B 1UWEL 4XE5B 3AG2B 2M2DA 3ZKMD 5CJQH 1FNHA 1EMTH 2YEZB 4NM8H 2FE0A 3MBWA 4XCCH 4YE0A 3W0WA 4P04A 3ZKXC 4O58L 4RGND 1S7WA 5EOTB 2XV6B 2NSMA 1B3IA 4WV1C 5TE7L 1FIEA 4I1NB 2N01B 4JPKL 2ADGB 5FO7A 3TFBA 1CFTB 1IC5H 4HOMA 3P4OA 2W88A 2Z7YA 3VDBA 1KBVA 3PG2A 2GK0B 3TPKA 4EI5B 4LPUA 3QO0A 3CC1A 4YE4L 1QBLL 1T1ZB 4LSDA 4TQIA 5EDXA 3VFUA 4DPRA 2R29L 1IVTA 2VO8A 4MXVE 4JFEA 4JDZB 5E1HB 1IBHA 4P5TC 1P4LB 4V2CB 5DVNA 4D3CH 2OTUB 1HEZB 4BSJA 1DQKA 3IJ7A 4L3FA 2F8OA 2GJ6E 5CU5A 3ZU8A 2B1AH 4PJ5D 4QXUL 4YHYC 1D6VL 2VZSA 5ECGA 1AR2A 2EIZB 5BXFB 4AC4A 4U33A 3L5XH 3RVXD 3STZA 2J57A 2ZWKA 4QHNB 2HN7B 3DPDA 1KULA 3P9LB 5EC1B 4BUGA 2V7NB 4F92B 5DWPA 2YXMA 3N3EA 4Z8FH 3F7KA 2KMWA 4JRXB 3ZK0A 3D25A 2XKNA 3S35L 3CC5A 3CVHL 2R69L 4XAKE 2YD0A 1T1WB 3ARBC 3PQYE 4LT7A 2BFVH 1B4LA 4FTVA 4NN7C 4HS8H 3B9VA 4RIRA 4TV3A 2FNWA 2KDGA 3QDJD 4ENEC 4N2MA 1F4YL 3VFRB 5D4HA 2FJSA 2XVKA 3WTYA 3V4PA 3VH8B 2N0MA 1ORSB 5D5MA 1THAA 3T4AA 4DQOL 1M05A 5DEGB 5GXBB 1FFOB 2BP0A 2FZ3B 4FQIL 2GTZB 5EF1A 1Q72L 1N3NA 1PKQA 2P80D 1FO0A 1AJ7L 2DBJA 4OIFA 3V4PH 2OSYA 4O9HL 4PRPD 2X4TB 2YD3A 4PWFA 4F8NA 2ENJA 2PWEA 3VXQB 2DQJH 4HEPA 5JMRA 3F12A 1SPDA 5DMKB 4YSDA 5JW3H 3RWJA 1PU0A 3NFSL 4MJIB 1FO0H 4P4RB 4JKLA 1KYAA 1IFHH 3OWEA 2BHUA 3DHUA 2YN3A 4IJ3C 3V0DA 4W9IC 1JK9B 2CUAA 2JTDA 4R7LA 4M7JH 1U8JA 5HDBE 2V9QA 3QPQC 1YUKB 1K8DB 1A7RH 3L08A 4LSSH 1EZVY 2VM3A 3DTXB 4PEEA 4C83B 5I1IH 4AQ1B 4NQEB 3MCG1 2X44D 5BV7H 5DC0A 1YJDC 2Y7MA 1GCYA 4TMPA 3RWIB 3QCUL 3VW3H 4HSCX 2DQIH 3L4YA 2J5LB 5GIRA 4G6MH 5B38A 4DKEL 4ZD3L 2BNUA 2WXLA 3TNNA 4Y2NA 5JIKA 3C6LB 4WY7H 1CL7I 1RZ7L 3FZUC 5L0QB 4XOCA 1BVNP 2AGJH 3PWPE 4JY5H 3QNFA 5EU5B 3RGHA 1ZDSA 1ZJAA 3QDMA 3CIQA 4K8RH 1S9VB 1EAQA 1X5AA 2CIKB 3DUSB 1FNEA 3SB3A 4JDTL 5CR1A 2GSGA 3KXFD 4OBSA 4MXVF 4XH2A 2HKFL 2J55A 3H9SE 5GZND 1S9XB 3PNWB 2O30A 3ARXA 4LSPL 4NUMA 1DVFC 1CYXA 1NIDA 2ZP0T 3KPRD 4G6JL 3VB9A 4U6TA 4HBQA 4WWPA 4IBQA 1U58A 4R84A 3M46A 2FJHB 4IU3B 4ZXBD 1ZAGA 3RJOA 5D7IA 1LP9E 1FIGH 2J2ZA 2GK2A 5DZJA 3D6GA 3P0YL 3ULUD 3ZKNC 4KK8C 3SDXA 4P4KA 4NQDA 4PJ7A 5F1IA 5CEZL 3HZKA 2VDNL 4I3GA 3U46A 1YQVH 4S1QH 2NXYB 4GG8A 3B1UA 1JYVA 3RB7A 4IOFC 3C5JB 1HCYA 5F6HJ 1CDCA 3NPSB 1ACXA 2WIMA 5E1IA 4WWID 1JRHL 4ZYKB 5C0DB 2PR4H 3FO9B 2P5WE 2ED7A 3AT0A 4XPGL 3SE3C 1WSST 3ILDA 3VG0L 3VI4E 2ZF9A 3EJTA 1WAEA 3TT3H 4D9LH 3N43F 5AFAA 1JGEB 1R3JB 1ZLUH 5D4QA 4ZMLA 1FN4A 5C08E 4B9GA 3FO2A 1GYCA 1YAIA 4JGMA 2Q7NA 1PZAA 1XGZA 3A67H 3ATFA 4GKZA 4MJ5B 3UTQB 2B77A 4OZGE 2WVVA 1YMME 2LTQB 2Z64C 3BGMB 4IMLB 3TTSA 4H8PA 1IGIH 3TVMD 4CVUA 3X13B 1U4FA 1JTTA 3HAEA 3FMGL 4DP5X 1AYRA 2GVYA 2ZICA 2JB5L 3G5YB 4XC1H 2EIJB 3CDYA 3N85L 1MRDL 1B3JA 2CCVA 4NBZB 1EZLA 4FX5A 2VZ1A 1B0RA 2QQLH 3GIZL 5HDBF 2IAMB 3EJYC 3HAEH 4TPRH 3GKWL 5TD4A 4PP2B 4OGYH 2VMFA 1CXKA 2K1MA 3DX2A 1G6RB 1KB9K 2WXJA 2SODB 2DM7A 1EEQA 4BFIA 5DUBB 1XTLA 2I60H 2QR0A 4LCIH 2ADFH 2Q86A 4ZDHA 1IGTB 2EDQA 4LOEA 4BHUA 3LRGA