3LZRA

Crystal structure analysis of manganese treated p19 protein from campylobacter jejuni at 2.73 a at ph 9 and manganese peak wavelength (1.893 a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
158
Chain Sequence
GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 28
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzrA00
3LZRA 3PJNA 3LZOA 3LZNA 5I0YA 3LZQA 5I0VA 3LZLA 2O6FA 5I0XA 2O6CA 2O6DA 3NRQA 5I0WA 2O6EA 3PJLA 3LZPA 3NRPA
chains in the Genus database with same CATH superfamily
4BE5A 4XN8A 5AOIA 4W9HC 1T66D 3HB3D 3BLBA 5FO2A 4I3GA 5CIPH 1ZLSL 3S97C 1CFTA 1FNEB 2NZ1A 1XSIA 4NP9A 3V5KA 4ONOA 3OKMA 4FQXA 4M7LH 2Z31C 2HWZL 3HC2A 4L0ZA 3RNQB 3U79A 1ZHNA 3V0VA 1E90A 1B0RA 4FQPA 1EAQA 3DX6B 4YPJA 1UWEH 3A24A 4S1DC 5I24A 1PG7H 1UH2A 2RFXB 5GSVB 3VI4A 4AH2B 3F04A 3IETA 1N19A 1T5XB 2W60B 4JFXA 4M43L 2X6VA 2HN7B 3O8XA 3TOPA 2G9HB 3VX0A 5CUSH 3ZE0F 4PJEB 1A1NB 4PJ5E 3WUZA 5JA8B 4LO9A 1S3KH 5ILTL 3WFBH 2TAAA 5HJ3A 3K8LA 3LOWA 4XE5B 4TNVK 4ODUB 3BI9X 2BHZA 1D9KD 4DK5A 1MFVA 1MVFA 3QCUL 4RA0C 3VM7A 4AEIL 1KWGA 4PLKC 1OXYA 3BQUD 4BRVA 4Z7WA 4QRQA 4U1SA 5IQMA 2IF7A 5BJTB 1JZFA 3KEHA 1HHHB 1IM3A 1MCRA 4XX1E 5C7XL 2CKBB 2VKWA 3SYPA 3PL6C 5FYJD 3C2SA 2ESVB 3CLFH 3W9DA 5LNDA 5IVZB 4N0CD 2ZUTA 2W5PA 3EIFA 2IPTL 1BZ7A 4HBCL 4IOFD 4NJAL 4W4NA 4WW2B 2J6EH 5I2IB 5BZDA 2OZNA 1BQRA 2H41A 2Y7OA 4YHLL 2IQ9L 5I16A 3MX0A 3JWOL 3K72B 4IU2B 5AZ2L 3ZO0A 1CL7L 4UT6A 4ZZFA 4TF4A 3ILPA 4HHGA 1RLBA 4XP4L 4QY8A 4WHTB 4WO4D 3HBGA 4ISVA 4APQD 2WWMC 1F6LL 1IAIM 1N7MH 3Q9PA 5I30H 3WELA 3RGVA 1E5CA 1PW3A 1QWUA 3DV6B 5C0RH 4Q4EA 2AFNA 5LGKA 5F3BB 1JYVA 1DCLA 1OSPL 2FNWA 3CIQA 1Z7JA 3DJZA 2VDOL 4R7NB 1CE1L 2C9RA 4LLUA 5T1KD 3VI3F 1LP9B 3LN5A 2NY3C 5CLZA 2V2XA 5IM7B 1V10A 5JHLH 1D6EB 1PDKA 4NN7B 3GTTA 5KZCD 1KNOA 2QELA 3FUHA 5TE6L 4WI3A 1BZ9A 1YN7B 1ID5I 4A37A 4S1SL 2NXYD 3E8UL 3JV6A 1HDMB 4N2BA 3MCKA 5JNYB 1QSFD 2BIMA 5JIHA 3EOBB 3L3HA 2ZPKH 1F90L 1AO7A 4NP4H 4UB0H 5GPRA 5KVGL 4TQEL 1FJ1A 1CD1A 5JOFA 2DOCA 4ODXB 5HDBB 1ILUA 4M4PA 1WFNA 3P4LA 4GAAA 1A3LH 4O2EA 4F91B 3BAXA 4UAHA 3MXWH 4PS7A 1A7BA 3DX2A 3L48A 4M7LT 4ILDA 3D0LB 1I8IB 5IMKB 1LO2H 2OI9C 1OT4A 2OMTB 5D96C 4G7SB 5CD5C 3G6JA 1AMXA 1FG9C 4G7YL 5EZLB 4DP7X 2FRGP 1RI8A 4JPKH 4PHXA 4OGAD 3RWEA 1BHGA 2WTRA 4ANUA 3JTSA 4XCEB 2VMCA 1GPOL 4JQIA 3ZYOA 5CEZD 4KXZH 4JRYB 4E2OA 4AV4A 3ZL4L 3PP4L 2COVD 1KLUA 1NIEA 5E8PA 4JO2L 3MLRL 1RQ5A 2X4TB 2VE6A 4L05A 1XD0A 5INDA 2E46A 4AQ8A 4Q9RL 1GY2A 2X2HA 4HS6A 3MRBA 5ID1B 5EU3A 3ARDB 5LXVA 3HZKA 3BKCL 4UTAA 4XCNB 1MLBA 5D70L 4PGCA 2TSAA 3MJ8B 2VXQL 5GRVK 4IBZA 4HJSA 1TSHA 4CC1A 1R3IL 4W9JC 4X6EB 3LZPA 4AKPA 3QUGA 2EXSA 1DSFH 2R1YB 1QZ1A 2YA0A 3GSQB 3TZVD 1KC5L 3ULUC 2ZD0A 2G75B 2XWDA 3DMMC 3SB3A 4FCHA 3WHE0 4JDZA 2P8MB 4X98B 4Y4FA 4JKLA 3LS5H 1B4JL 3HMWL 4BA0A 4EZMA 3Q43A 3MACH 3US9A 1ZSDB 2CRMA 5CF3A 2YD7A 5J6SA 3HCVA 3AU1B 4M1DH 1VZHA 4B0MB 2CIKB 5F71A 4ACPA 2ZSVA 1NH6A 3EFOA 4MQ7B 1AGDB 3QG7H 2EICA 2VT0A 4P5RA 1H3VA 5DS2A 4J5VA 5IP4A 3WFEL 3V0DA 2IQAB 2NXZD 3JQOB 4P23A 4GIAA 2HVJB 3K7UA 3L3OB 2IPUG 3BT2L 4S0TD 5CCHE 3OHXB 3SYCA 3COOA 2R51A 4H1LG 1WD8A 4ZW7A 1AHWB 4YR6A 1A6VL 3QJRB 4GG8A 4TULH 4YXHH 3PDGA 4FI7A 3VCLB 3RA7H 1S7TB 2E27H 4D2NA 4HKBA 1EVTC 4IIQC 1MRFH 4XVTH 3ZDYE 4CADA 4NQDE 1JL8A 2MCPL 4ZD3L 2ETWA 3SKUD 4PWKA 4Y2NA 1AKJD 5IBLD 4BZ1H 4G7RB 4GIOA 4HIXH 3VMNA 2WV3A 2VZVA 3CC1A 3MA7B 3FTZA 3QXAB 4WNSA 3X3FH 1HWWA 1DO6A 5AW9B 5FA3B 3G5XA 1USZA 4UOW0 2HVKB 2Z0UA 5JHDD 3OL2A 1BQHG 2KHAA 4QRSA 3STLA 3R18A 4KXZI 3RHWF 2R39A 3QWOA 1WEJH 1U6AH 4F8LA 1XBRA 1VPOH 5EMYA 5EO9A 1EEYA 3JV4B 1Z3GH 4IBSA 1CDIA 3S5LB 5KOMC 4PGZA 1WAAF 2XY1A 3ATAA 3CBRA 3OC8A 4HSCX 1BIIA 2WYZA 4ZUWB 1SOKA 1A6TB 1BF8A 2J8OA 4UQ3B 4XH2B 3LTVA 3N55A 3EBGA 4MHHI 2Y23A 1DO5A 4WF7A 1X5JA 4LPVA 4Z76B 3RAJL 2YO3A 4IQHA 5B39A 5CIPA 2AV1B 3C2AH 3CC5B 1NWOA 1K4CB 3TFKC 2NY1B 5C86A 4KJQD 4Z0XA 1U8JA 5FW6A 4HLEA 2H26B 4JFDA 3SE3C 1QRNB 2I9LA 1D5XB 2A38A 1B4LA 3RTLA 1WCBB 2HTKC 2NZIA 2P4AB 2YAFA 3FQWA 1EHLH 1LGVA 1AZRA 1I1RA 3MRCB 2YC1A 2VXVH 4HX1B 1SJVA 4P4KA 1I7UB 1UFGA 3B9AA 3GXPA 4YDVB 2PUQT 4CN4A 1IC5H 3SDXF 1MXGA 5DEGB 2WQSA 3DIDA 3U7YH 4AL8H 1I1FB 5JXED 3HZVA 1P7KB 3DO7A 1PYWB 4X8CA 3DUUB 1ZDSA 7CGTA 5DQ9A 4JN1H 4JHBA 4XVSL 3N1QC 2PP8A 5JIKA 3RVVD 5CGYD 3PIQB 2XSKA 3B9KB 4PI2A 1FAIL 4I1NB 1ASQA 4DN3L 1KB9J 5L88H 1T04B 3DOHA 4ZAKD 4Q74A 3HZ3A 1YEGH 2OTWB 1C5DA 3DRTA 4M1GL 1T0MB 3B8SA 4LGPB 4GAJH 2W88A 4EI6A 2VJXA 5TH2A 4XMVA 4B3EA 3ZKXB 5L2JA 3CJJA 1SF3A 2JQZA 2QVKA 1CICA 1XX9C 3O6LH 5BV7L 4WWKA 2R56H 1R33A 3MNWB 1DVFC 4EVNB 2CAKA 3UO8B 1KYOJ 2J6EA 4IKJA 4C56A 1F8TH 1JVOA 4GRMA 4GT0A 4YDNA 5IQ7L 3AUWB 1CDCA 1GOFA 5MHSD 2F08A 4NNYA 5I6PA 3SDYL 1A1OA 1T89A 1OAXH 3P0VH 3A6BL 4PJXA 2X4RA 2J5LB 4G1EA 1IQWH 3TV3L 3NJFA 3ZXAC 1LO4L 2EC9U 1P5UB 2D3NA 4Z3EA 1T4KB 3ZOAA 2O5ZL 2Z1KA 2QQLL 4HUVB 3QFJD 5DUPH 2WNXA 4XPBH 4MNHB 3VSUA 2HRPL 1V5JA 3QW9A 5ENWB 3OX8A 5JHLA 4M48L 5J3HC 4XP9L 3H9SB 1KLFA 5KBPA 5FCUL 2VN6A 4Q14A 4P9MH 4G6KH 1MSPA 5LDSA 2VLJB 3T8MA 4AJWA 3SGJC 3SE4A 4RZCB 3K80A 2V3FA 3O3BA 3CVIL 4OD1L 3ZE2B 4JZNB 4AYSA 2IANB 3BX7C 4CC0A 3U4KA 1HK6A 3VXRE 3HE7A 1IU1A 1CR9L 3F7QA 3VFVB 1ZVNA 1X6LA 1YAIA 4U3SA 5KG9B 3MOBH 3BUBA 3EYVA 2H8PA 2I85A 4IS6A 3WNNA 1S7XB 1KIPB 1GJUA 3FBQA 2GKIA 3I9GL 4PJBE 4XXDB 5HYJD 5JDSA 1UZ6F 3MRLA 3SKJH 4C4KO 1YECH 1THCA 4PRHE 3S48A 4F9PA 2C1OA 5TE7L 5JW4Q 3FTUA 1WFMA 2Z4QB 4G6JL 4LPYA 3ULVD 4YHOH 1C8QA 4M7KL 4R4NC 4Y16A 5A3IC 3BHBA 4MDJA 4M8QB 5EORH 4GXFA 2GI7A 4TVPD 3S98A 3HRZC 4L2LA 5A16A 2K70A 3J8F7 2EE0A 4P2RE 2BMKA 3THML 3T6VA 1PFOA 2NZ9D 1M1XA 4U1JB 2WLZA 2H2SD 2EVIA 3NZ8A 2PABA 3UDWC 1JGEA 5IOKA 2Q20A 4IEFA 2JQAA 4NZUH 1X5YA 2E74C 1XR8A 4Y2OA 4NUGL 3X1BA 3V7AE 5DGRA 3G9AB 3VH8G 1ZGLA 1HSAB 1MFMA 4M29A 4MXWH 4OM0H 4B60A 4EN3C 1MLCA 1LWRA 1TQTA 5E8EA 2NRDA 5EF1A 4Y9FA 1JZ8A 3P0YH 3Q6GH 2ADGB 5LCVL 3FQRB 4EF3A 3VWJB 4PJGF 3N9GH 3G6DL 5CEXB 3TPUA 5E08L 4L8CB 1AJ7L 4ZOAA 5JO5A 5DYFA 3O3EA 4XAKE 3GSRA 4FQ2L 2ZIDA 5SWZD 1A4AA 3CN2A 2PW1A 3VXME 2J71A 2ITFA 3GLEA 4L3CA 3F7LA 3TXAA 2GQHA 4M3HA 5ANHA 4OKVA 1AGEB 4HWZA 2YHGA 2HUHA 3G5VB 1DEEB 1EAOA 4F7TA 5I75B 5KVFL 2ERJC 3L1FA 5IROC 1NMCB 5D1XA 4Z7AA 1F3DH 2NY7L 4X0KA 5BS0E 5D8JH 2W95A 3MRJA 1GZHC 2IWGA 4HKXB 1TG8A 1S7RB 3H0TB 3BW9A 2CE6A 3CSTA 5HDLA 1CGUA 1XBDA 3Q2WA 1B0IA 1RIHH 3CDZB 4G6MH 3IVKB 3L3GB 2YEVB 2EZ0D 2DRUA 3EOTL 4C47A 1HXYB 3C87A 2ZX6A 1MZYA 1CS6A 4OZ4A 1NBZA 3ZDWA 3HS0A 4Z3GA 2SEBB 4GI8A 2FBJL 1H0DB 4LVOB 3N2JA 3FUJA 4W9DC 3LPPA 2BSED 2YXMA 5CCGE 2FIRT 4Y2DB 4BZ1A 5CM1A 3QUZD 1WFOA 1QFWH 4IMKC 3MUGA 1SYVA 4ELMB 3NUKA 2GEQA 4QO1B 2VZOA 1NKGA 4BUQA 3TM6A 1HL9A 3GM8A 4AGLA 5E1AB 4PRPE 4FFZL 1CLOH 1Y0LA 4Y7OC 1OP5K 3NFPA 1X5XA 3F5WB 3C6LB 1IMHC 1JWSB 4OV5B 2XN9E 1TSRA 3QZBA 4PJIB 4UTBL 4ZQKA 2VLRD 4G6AD 4JW3A 5IHBA 1UZ8A 5AENA 4L0YA 1H5BB 3WFCL 4UQBA 4ZFGL 5MEOA 2EDTA 1MNUH 3L1GA 4X80H 1WDAA 2XLLA 3OHMB 3RJOA 5E8NA 2JKIS 5T8IA 3OXSA 1A6WL 4ECNA 1I1AB 3H56A 3EF7A 4CKVX 3FFCB 1C5CH 3TYGH 3WJJC 3IMWA 2A9ML 3C5ZD 3Q1EA 1NC4A 1RU9L 2DM7A 4X9FA 3LH2H 1K4DA 1OSEA 4PBVC 2ICEB 4EZLA 4APXA 4YHIB 2HP4A 4LSRL 1KPVA 1DZBA 3K0WA 2Y36L 1CT8A 1IBGL 1INEH 4XI5D 4QTIH 2E0PA 3PWNA 4HVBA 2WXOA 2IPKA 2Y3AA 1BGXL 1UKQA 1N64H 5EC1B 5DHVH 1KG0B 2ICCA 3NIGB 5F0MB 2WM0A 3TJPA 3HB3B 4LOFA 4QCIB 5HXMA 1UJTA 4L3EB 2H9GA 3K6FA 4I0PD 3HI6H 5EUOF 3Q8AA 2CCWA 4H8PA 3GXIA 5F89A 2FJHA 2F7QA 5HI5D 5HD8C 4ZSOA 5IJVA 4IGBB 2H6PA 4WW2C 5SV3A 5SWSB 2ODHA 1UUNA 3WIFB 3L5WB 3RIFK 2Y7SA 4B50A 2FEJA 4JFUA 2IGFH 3UAJD 2WY3B 5I1EH 1LE5B 1XZWA 1I4FB 2VMFA 2HKAA 2K3HA 3N91A 3AACA 1S5IL 2H0JA 3IDXL 3IDJA 3NTCL 4R4BA 5AOZA 3Q05A 4AVHA 4HJ0D 3L08A 4JFHD 3UZEC 1D9KB 5DZ9A 1MH5B 4PBWD 4WUKL 3X14B 1F3JB 2F5AH 2OM5A 3IBOA 4OSUH 4GFTB 4CC4C 3BQUB 1DQDH 2ITDA 2J73A 4XB7A 2YK1L 4MMZA 2MHAA 1D7FA 3HC4H 4I3SL 5C0AE 5DHEA 1AXSB 1SJXA 3RX5A 4JJ5B 2BIHA 4HJTA 4MA3A 5E6YA 4C55A 2EKSA 2KZBA 1UYWL 3AS3A 4X7TB 4QXTA 1JS4A 5IMLB 3LXAA 4LIQE 5CHNB 3EDKA 2UWEB 1CLZH 3QNFA 1TIUA 4HPOH 1D7CA 4GKNB 3U0WL 2FO8A 1D3CA 3UZVA 3GSNL 1L7IH 1AC6A 4F9LC 4HH9B 4F7EA 3RWHB 3BZ4B 43C9B 4ODWA 4APQB 1JFHA 1RZKL 3I9PA 4P5TC 2OL3B 2DM3A 4HSQA 4HUUB 3MFGB 1I3VA 3BAEH 4LLYA 4FADA 2A0LC 4P05A 3AS2A 1IIKA 3FT3A 1U8LB 4U7MA 3PWPD 4K7FB 1TJMA 4YHYC 5T1KB 5EZOL 3VXPA 1QQDB 3FT4B 1FSKC 1Q9LB 2EDRA 3KPNA 4LFHG 4B7IA 5C9JA 4ORGB 4N8VB 5DD5L 4YHPB 1EA9C 2QQKL 4BCXA 5ADPL 4P3WA 3KYKH 2B4CL 1X5FA 5A1AA 3BRFA 2NXYB 3OKEA 1FYHB 1QSFB 5AUMA 3S96A 5EF2A 3CDGA 5ESVB 1DDTA 5DWPA 5I18L 1NGZA 4GFXA 3VD2A 1F02I 2Q7AA 4YL4A 2VJ0A 4N9OB 3ARDC 4YXKH 4LSUH 2VMDA 5FA4B 9PCYA 5D7JA 1VFBA 2O1AA 5LO7A 5I6OA 3PLYA 1ZTXE 5C0BA 1J0JA 3OZ9H 4XNUL 1CFTB 4PWFA 3SKNB 3AMKA 2AGJH 2VR7A 2XKUA 4HGMA 2P1YA 2XTJE 1DVYA 4B9GA 1W72L 1G6RH 4NQDA 2OQJA 2WQVA 5MI0B 3WKML 4XNZB 1ZHNB 2BK8A 3V0VB 1NMBL 1B0RB 2HAZA 3HOGA 4AC4A 4ZOEA 4LT7A 4J6RL 3H53A 1LK2A 1NOAA 1XGRA 5EUKA 5BUPA 2IBGA 1RKRA 4JVUA 4HWBH 3DRQA 3IETB 5KOVC 1M3IA 4PJ9D 4JPWH 4K3JL 1NFDE 2C3WA 4FJYA 2W0PA 1TENA 3SE9H 3GUTA 3O8XB 5EHFA 4IRZH 4GQQA 3KJ6H 3I50L 3CGTA 3PP3K 2JJTA 2OZ4L 4FEMA 2JH2A 4LMQE 5HJ3B 3V52H 3P3RA 3EYSL 4U6YB 5J6GA 2KDGA 2P44B 4UV4H 1PS3A 4NHCL 2PWEA 5I71B 1LE9B 1NCOA 2HLFC 5EU6A 3L3OC 1NBYB 2P49B 2FX8L 3OHXC 4MRCA 1SLUA 1X5IA 4KK6D 2DTML 2XWEA 3SCMD 3T0AA 5BQ7A 3SIKA 4TVSa 4MMYB 1I9EA 1AHWC 1OGPA 3KEDA 1V7MH 3HG5A 3IFPB 4ABQA 3IDNA 3BRDA 4G7QB 2MJWA 4LSTH 4OVUA 3FQYA 6TAAA 1F1GA 1K6QL 4PRNA 3VRLF 3V5DB 1QBBA 2DQFA 4AIEA 2VDPL 4JFOA 1BQUA 3NIFB 4JM2A 2CDGB 2YGVA 5DRWA 3WGUB 4YZFF 4AXWB 3HG4A 4J8RA 5BZDB 1IAKB 3VFNA 2XDHA 3B6SB 3ESNA 4AEFA 5I16B 3WFZA 1KXVC 1F1DA 2BOBA 2ZP9A 3ILPB 1AGCB 4NRYB 4QY8B 1FNFA 3VUAA 2ZTBA 1W8NA 2R1WA 5IREA 1CYXA 4EUPH 2NXZB 3W82A 5D7IE 4CSTA 2FJSA 3M46A 2BCKA 1FBIL 2AJVH 3MXVL 2BSCA 4G9FD 3NAAL 2V9QA 3C5SB 4WWPA 4CILA 1HZKA 2J57A 1NCCL 3I6GA 3LN5B 1AR1D 1RL1A 2YJLA 3BAJA 4N0YH 1DDHA 3TS8A 5JUEH 1PDKB 5EBWA 1QVOA 4ZUSA 5IMOA 1E5YA 3VFWB 3GQFA 1BZ9B 1KXQE 3U0PA 5T5FA 4J27A 1MAML 1RD6A 4YN3A 1UCTA 3TCLB 3WO3B 4D3CH 5HDQH 4BFKA 3MCKB 3U9UB 4BKLA 4XMUA 5GRZA 3SY0B 3QORB 3WEXA 1GAFL 4KZEL 2XBTA 1AKJB 5L7XH 5KW9L 5D7HA 3MRIA 1B6DA 3WIIL 2O6DA 1W8EA 2H4EA 2NY1C 3FO1B 1NCWL 5JOFB 4IMLA 3O2WH 3UJJH 5CEYA 2PPDA 2ZP8A 4O2EB 1NCAH 5JPMA 1QASA 1HEJC 1S7WB 4WK2B 2P47B 1R5VA 4U05A 3MV8E 1VFAA 1KB3A 1RK0B 3G6JB 4HMEA 3FMGL 5E0FA 4JRXD 4U2YA 5ID0A 4X83A 3RWEB 2WTRB 2X9XA 4K8RL 3KWWA 5GJSH 4AZ8A 1KBGL 3DA0A 3PABA 5C0CD 4TTGA 1RK1A 3C12A 4MSWA 4XVJH 1D7BA 2ITCB 1P7QA 1KJ2H 2C7UB 2XKNA 1KLUB 2V0AA 1CI3M 1H8SA 3RWCB 2XA3A 5F7LB 2VE6B 3GGWA 5DHVA 3AQDA 2VQ1A 4YFLF 4KAQL 5E6ZA 2ED8A 4YDZA 5IHZA 1M3JA 5IMMA 4HS6B 3MRBB 4HCRA 1UGKA 4RNRB 5EU3B 3WD5L 3ZKXC 2PCPA 3P73A 5GS0D 1MLBB 5HTSA 4PGCB 2XX1A 4X6BB 4GQ9L 5CD3B 1LO0L 4XWOD 1XT5A 5L2KE 4PB9L 5I1KL 2F61A 3ARZA 1QD0A 5M94B 3QIBA 3UPRA 3A47A 4BZ2H 2OYMA 3VXRA 4NENA 3DSFH 3QJZA 5AG9A 4KDTA 2JLLA 5JHDE 3TNNA 1XV8A 1NCIA 2VSMB 4PR5B 2OPCA 2EH7H 4RCAA 3CAFA 3IDIA 4UM9D 1VADB 4LPCA 2EH8L 4Y4FB 3IU3A 3QHZL 2B5IB 2J5LC 5D5MF 4LKCB 4A66A 1JUFB 1MCOL 3UXFA 4IKIA 4CDHA 4NQQA 2YD5A 4W4OC 3GSWB 4H5SA 1S8DA 4PRHA 4ZAKB 1P5UC 3HCVB 4HS8H 2P28B 5GRUH 5CSBA 1MNNA 3J2PA 1F2XK 5GRYA 5TQ0L 1RVFL 4NQEE 3ZHKA 3HG1D 5EEVA 3BEVA 3A67H 4X6DF 3MRNA 3MJGX 3UC2A 4TN9A 1JF5A 1B88A 4P2RA 1GOHA 1KT2A 5I1IL 4XCFH 4ODHH 4HT1L 4LP4A 1KTRL 2Q7YA 4PJAA 1WBZA 4GRLC 4GG8B 4BFBD 4HA1A 3E80A 5K9KB 5GS2D 1X44A 3BFOA 5F97E 1FFNA 4LLAA 1YEJH 2OMUA 2VDRH 1YNTB 3IDGB 2AK1L 3OR6A 4HKBB 5DUML 1IVTA 3FFDA 4PREA 4HAGA 5IVXE 2VDNL 5ESAA 1VJSA 2GC4C 4XPAL 1DLHA 2ZX9A 3V0FA 1W8OA 4LAJH 3UADA 4YLCA 5DJCA 4L29A 4Z77A 4YSQA 5GZND 2J44A 2X88A 3HG3A 1FWXA 4OZGA 4G1MB 3G5XB 3K91A 3MLZL 5IUSA 4PJHB 3VXMA 4QRSB 4EJ1C 4UT9H 5LXGL 3UACA 5DVLA 1CTNA 4XX1G 3STLB 3TEWA 3VXQA 5DMYA 3F65A 4OZIE 2AJYH 1FDLH 2W91A 3FB7A 3V4PL 1PLGL 3C8HA 4F7KA 5BO1H 3DJTA 4FDWA 5B7MA 5CWSA 5J13B 1PKQE 3ECQA 1A0QH 4ZMYA 3BVXA 4PRIE 4ZRGA 3QQ9D 3DI2B 3CZFB 2RJMA 3RTQD 4EQ2A 1VA9A 2CO7B 1KJMA 5A2FA 3S9DB 4LSPH 5EEZA 5HYQB 4YK4B 4NIKB 1WWCA 5LAPA 4AYDC 1OAKL 3JWDC 5B39B 3AG4B 2GI0A 4X6CF 2DJMA 5FGBA 5GGVH 1U8JB 3U7WH 3PNWA 5HYJB 1G6RA 1RERA 2G2RB 4WDIA 3C8KA 2I9LB 4HPYL 1HXMA 3ESVF 1JK8B 3MQIA 2ZCHH 3FQWB 5F72S 4LSSH 1WWWX 5DJDA 2IOMA 2GAZA 4R6UA 4HWBA 1SLXA 3QFJE 2VRAA 1CGSH 1L7TH 2L7JA 3I02A 5D7LA 4KZCA 4NQUA 3QEUB 5F21B 4N1CA 1DVSA 2P9RA 1XF3A 2H45A 1EHXA 1W0WA 4K9JA 3OM3B 5GGUB 2C4XA 3FCTA 1WFTA 1A3ZA 3IJHA 3MRFB 1YRKA 1ML0A 1NSNH 4J4PC 3RB5A 2MCAA 5I75C 2XN9A 5LG6A 1NMCC 5CFAA 4HIQA 1BF2A 1LO3H 2BY3A 3DRTB 1MFCH 2OP4L 2V3EA 2GG1A 1ULVA 3PAVA 2FH6A 4Z3IA 3ZHLA 4W68A 4FJZA 1BJ8A 2HPOA 4PYHA 2CO4A 4FNLH 5L2JB 1DBML 1UD8A 2OSLB 3PG2A 5HGDA 5E2WL 1GGTA 3U82B 3ZE0E 4L8BB 1F86A 1EHNA 4WWKB 3C08L 3ZHDA 1TYEB 1KELL 3VFTA 1UM4L 5CXPA 4DKEH 4XN9A 1MCWM 4UBDC 3RY6C 3SBWA 3MRPA 2X09A 5A6IA 1S78D 3KPQB 4KXAA 4NKIH 4FZEL 5ITBH 4Y2DC 1KY7A 4DZ8A 4RAHA 4FMKA 3LD8C 3NEOA 3VGHA 3B2UD 2Q6WA 3FQNA 4LMQI 5K59F 5DJZA 1DQQA 2R0KL 3Q5TA 4N2IA 4PJXB 3ZW3A 4N2DA 2XWJB 4NX0A 4G1EB 1OAYL 1LTXA 1M7IA 2VDKL 3IFOA 3L3IA 3S2CA 4EUPA 3TBCA 3MLUL 4ZTPL 1BP3B 5CSZA 5K9JH 1NMAL 1C7TA 4TOYL 4UMSA 3LXUX 2Z9TA 2Q8AL 4ERSL 3IT8D 4YQXH 5B1BB 1E28B 4GXUN 3WLWC 3C6LC 4RDQG 4E5XG 3I9IA 3PHQB 3OX8B 5IY5B 5A2IH 2YD8A 3U25A 3QUYB 1ZLWK 3CUPB 1NGQH 1H5BC 1KLFB 3OG4B 3MREA 2YXVA 3RFRA 4RMTA 4X5PA 4OF7A 2YRPA 1F58H 3QJXA 3QDGE 1AGFB 2C9UA 4OGXL 4R7DA 1D7DA 4EE2A 4XNDA 1I1AC 1JRHH 1T2QL 3AREA 4YPGA 5DQJB 4M62L 1U8IA 3QUZB 3CCHB 2JIXB 4HJGA 4JKKA 3QC5X 4ZPVA 1XH3A 4Q6KA 4KPHL 4Z3HA 4GKZA 2IDFA 1H3TA 1CXFA 3HE7B 3VI3E 3JYBA 2ICEC 2NCEA 2P7TB 1XGTB 1UACH 1M6UA 1RUKH 3MZGB 5SWZE 3RL2A 4U3SB 4C54A 3BDBA 5A6LA 2BSRA 3EYVB 4IS6B 3TBSA 1K85A 4JFVA 4HJIA 3N04A 4JDVA 4BZYA 2C1OB 2JI3A 5C0AA 1WD9A 1NCNA 2VLRB 2EADA 3INUH 2VAAA 3CFDA 4Y16B 1T66C 3VO0A 3PF2A 3HB3C 1N59A 1GGCL 5KVDH 4MDJB 3P0GB 1CDGA 15C8H 4NO0D 4YIQB 1WA2X 4FMVA 1EWHA 2BWDA 4LCWD 5A16B 1IL1B 3PWJB 1G5AA 1BQLL 1KZQA 5GHWL 3HVDA 1ITBB 3H3PL 4AYID 1EUUA 4UDUA 3LQAH 3BWUC 1TJIH 1JGEB 1J5DA 4FYSA 4IGBC 5DVPA 4U1GC 1N4XL 1DVZA 1RIVH 2H5UA 2EDWA 4MMXB 2Q86A 1UM6L 1XR8B 2EIDA 1YEEL 2V7HA 1P6WA 3VRIA 4LLMA 2H3NA 4BZ2A 1ZIAA 3RQ3A 2ZCLL 3HBQA 4JO3L 4W70A 5C0ND 4HJUA 2AXJA 1D9KC 1MLCB 1WIPA 5FFLA 2O5XH 4YGAB 2VW6A 3AWGA 2HJKA 2Y69B 2QPFA 3BQUC 3O0LA 5LQBL 5A2BA 1ADQH 5JO5B 2PW2A 4ABVA 3OB8A 3L1OH 1WHOA 1CFQA 3FU0A 4MCMA 4I0PB 3MRGA 2B9AA 2CDFA 3VVWA 4LSDA 3JWNE 2ZUUA 4TPRL 3ZU8A 3B9VA 5I8CB 1XTMA 4KROD 1HVXA 5DR5L 1ZLEA 1M05A 2CRZA 3TASA 1A6UL 4QRPD 4X0KB 4GO9A 3ZUCA 2P5WE 3SSGA 3WN5A 4CSPA 1ZV2A 1U3HD 3HNSH 4Q2ZA 4FLOA 1KEMH 4UDTB 2DQCH 1WZ1H 4OZFA 1JRHI 5BNXD 1WP6A 1JPST 4E9SA 1MJ7H 5AAWC 1UB6A 4JHWL 3S35X 1M2OA 1AXTH 4XAWH 4QEGA 2J43A 1NBZB 3EGSA 4TLSA 2J8UA 2C5DC 2Y0SA 4HK0B 5F0JB 5C6TL 3NCYS 4GBXD 2Q3AA 2D31B 4A38A 1Q0EA 3MYZA 4BKSC 1SYVB 3VXUA 4IW4C 3KPSA 3NJXA 3HPJB 3BVTA 3O81A 1H19A 2NXYC 3QB7C 2F6AA 2CD0A 1IO4C 5K1VA 2VDQB 2A83A 4GPVA 4LVHC 4NO5B 1QZNA 4UT9A 4FG0A 2CK0H 3P4OB 5B1AB 2R29L 1LM8V 4N24A 1L0QA 2AEOA 4KY1H 1LYQA 2DY2A 3NFPB 3U4BH 4NDMA 2CJUL 3MRDB 1H8NA 3RNKB 1GZQA 5E5MB 1J1OL 4TL5A 2NYYD 3AG3B 4HZLA 3FRUB 2ZCKH 1YNLL 2KLRA 3VXSD 1CFBA 1SDAB 3X1NA 1XWVA 1AR2A 4NQVA 1HAWA 5F1OB 3H85A 2EILB 4L5FL 3VNZA 1KACB 3BWZA 4L8SA 1YNKH 1VEPA 4FQXC 1EHAA 3QRLA 4OTXH 1U4FA 3VFPA 4XNZC 4WI7A 5MI0C 3FO2A 5IESL 3O6ML 3PWPB 5DGQA 4MZRA 1EJ8A 4LSQH 4N6QA 4D9RD 1O6SA 2QKIA 1IEBB 4KHTL 3V9CA 3PJSA 1C12A 4OLYH 3O8XC 1Z5HA 3F83A 4APXB 1KPVB 2CKNA 1MJ8L 1WAAE 1MCFA 4I0KA 4JPQA 3O9WD 3QPQC 1CT8B 4HMCA 5HHOA 3RUGF 3U9PH 1EGJH 5D7IA 2WXRA 2C3XA 2CPCA 4WTXA 3RDTA 4H0HB 4JRFA 1XB6A 2IG2H 3BCFA 2IPKB 3HPLA 4HV8A 3TVMD 3TT3L 4OFPA 3QPXL 5I71C 4GJTB 4KRLB 1NGPL 2XZAL 1R6VA 4ZMXA 4R4FH 4EI0A 2KH2B 4BSWA 1BVNP 1PQZB 4Y7MA 3HN3A 1YEIH 3O41A 2ARJA 5IW3A 4ZMWA 2AJ3B 4OT1L 3TZVA 1CXLA 1INQB 2X1XR 2VR5A 4AK1A 1KCSL 2BVTA 2FJHB 4FA6A 1TJGL 3QPKA 4YX2H 1E4JA 4ZSOB 2DL2A 3SDXE 2CUIA 4HXAL 1R34A 3DVGA 3K2IA 1AQKL 4DPRA 1SJEB 1A14L 1NICA 2OSYA 2K7QA 3V0GA 4F8OA 5KVEL 5IT2H 1F4AA 2X12A 3BUDA 3UP1A 2XN1A 4GQRA 3E3QC 4QD2E 5ESQB 3TCTA 1MCHA 3MV8A 1SBSH 4MDRA 1HOCA 5IEHB 3QHFL 4XP5H 1BJMA 2NXZC 2OMYA 2DIAA 4H44C 4KV5F 3KJ4B 1AZCA 3V0JA 2ZOLA 3WIHH 2ITDB 3GRWH 2XX0A 4MMZB 1OP5H 5AB2A 1EDYA 4PJDF 3UYOD 5EIQA 1Z9OA 3MGOA 1UB5B 2WIIB 3HAEG 3WXWL 4ZW8A 4MA3B 2ZWKA 1PF3A 2EKSB 2WXFA 3ASOB 4QXTB 4KKRA 1A9BA 2YN5A 5FGSA 2V7NB 2OX5B 3V7AG 5DMGD 1K8DB 2XG4B 3MFFB 3QORC 4M03A 4QXUL 4UQCA 5EOTB 3UZVB 2CBTA 3V6FA 3IJ8A 4XC3L 5L2KA 3H54A 5GXBB 3CQPA 3L5HA 5E8OA 4F7EB 4D8OA 4Q58C 3FU5A 1Q0XH 4ODWB 3VFRA 3H6AA 2YKKA 2VXSH 3CDFA 1T6WA 5AAMC 4DFHA 5DO2C 4UNVA 1FNGB 4QMEA 3CXHJ 3RVUC 4OR1A 2Y06L 4U7KA 4CSZA 3UMNA 4Z7QF 2EDXA 4QRRD 4F7CB 2J4WL 4G9FB 2LE9A 4U6HA 2YEZB 4HXBH 3PWVA 4K4KA 3S35H 4I85A 3LVEA 1P1VA 3LB6C 1AR1B 5H37H 3KPNB 5C9JB 4JKWA 4PGBA 2AEPL 3WNOA 1J8HD 4A2EA 3PWUA 2AK4B 2OJEB 3D9AL 3L45A 1TCRA 3LEVL 4MNGE 5E9DD 1L6ZA 3TH3T 1V7NH 4RWYH 5T3ZE 4NQEA 1MQ8A 4ZO6A 3OKEB 3LS4L 2Z65C 5EPMA 1KCUH 5J06A 3BZFA 4ZX4A 1ZS8B 3SO3B 1KTCA 4KNSA 1GJIA 2UY6B 1LDPH 3ILDA 1NGZB 5C08D 4AQ8C 2DH2A 2ADFL 2HT2D 1ZV5A 1A9EA 1KPRA 1ZA6A 2P43B 4QOKD 4TUJB 3HMXH 3QCVH 4KJQC 2WN2A 2M83A 2KERA 4AQAA 4IBVA 3IPFA 4EBQL 1JDDA 4RQQA 5D7JB 5E2VH 4JVWA 1VFBB 1A4BA 1IQDA 5C0BB 4UQAA 1E2WA 4KQ3H 3X2QB 3IE9A 1HQ4A 3TYFA 3WNJA 5J8OA 5DHXB 5IVXA 3BGMA 1UZ6E 3HLAB 4UU9B 3EUUA 4Z0BL 3QDJD 2LLLA 4TUKL 4YXLL 1ZJAA 5IFHL 5JXEC 1OPOA 4A7GA 5I6MA 2E7LC 1ODUA 4JRXB 2C9PA 1LK2B 4OLZL 3NQIA 4Y9CA 3QH3B 4Y4FC 3DRQB 3RVVC 5C0CB 3ARFA 2B5IC 3MODL 4I87A 1MCQA 3GKZA 4KK5D 5JDJA 1KDIA 1A65A 2LHAA 4FABL 3GUTB 4OFYA 5T1LD 5KSBB 2OJZL 4ZAKC 1KF9B 1QR4A 1OAZH 2VC2H 1FH5H 2YEQA 2GSIB 4FQ1H 1WISA 4MA7L 1N12A 2LQRA 1QBMH 2KZ1B 5E0QA 2DBLH 4ZXBD 4OZIA 3IFLL 1TVHA 4P23C 5AZEH 5DDHA 4TNEA 5EU6B 5J89A 1A4CA 2IH3A 4OCRL 1PKQA 4C83B 2R9HD 3VTMA 1NM4A 4PRIA 3VD1A 4YLQT 3WTTA 2HMIC 5BQ7B 1VRSA 1IGML 2GW5A 2NY6D 2HT4D 3IDNB 4F8PA 1JZ2A 1FLRH 1W0VA 2ZAGA 4J3OC 4RBPK 3GI8L 1TPXB 3II1A 4CMMB 2PWFA 2J3SA 4PJGE 5E99L 2DQFB 5HHPA 1ZA3B 5I8OL 1KB5L 3OGCA 3F7RA 2YUWA 3BUPA 3L81A 3R4DA 5M7QA 5C07D 4PH8A 5FWQA 2QGCA 4J8RB 2A9NH 1YEWA 5E8DL 4DETA 2WSKA 5DMKB 5JXAL 3R0NA 1I8LA 1AYOA 2DQUL 1SEQL 1N6QL 4WFHD 1SXBA 2JELL 2P45B 5AL8A 4EUPG 1I3UA 2Q0ZX 1RZJH 3GRGA 4MJIE 2H1XA 1EX0A 5C0GB 2R1WB 5JIPA 3NSJA 4EO5A 1E0OB 2GHWB 3HG1B 1EDHA 1G9NL 2QFRA 2CMRL 1ZAGA 4GXUM 5E5LA 2VAJA 3UBFA 4JB9L 3GIZL 2FWOB 4RSVA 1U93A 4XNAA 1ZLSH 2XFGB 1HH6B 3UC0L 3T0DA 1FUNA 1CDYA 1SDDA 1TMQA 2Z92A 3DX8A 2VUOA 3I6GB 4IKNA 1DDHB 1N0XL 4Z8FL 5CILL 5EBWB 1P6AB 1BA9A 2ZXDA 3OC5A 4ZUSB 4NQCD 3V4VL 3FUIA 1A66A 1QLFA 4M43H 2EDJA 1IKNA 5I8KL 5D6CA 1PGRB 4FN0A 4NYLA 4YK4C 4PJFF 4XRCB 3S0PA 2BVQA 2MTPA 4P06A 5C3IA 1J1PL 5ILTH 3SJVB 1HCYA 3POCA 1CIDA 3EJCA 4MRBA 1DJYA 1NUGA 4R2GD 3QCUH 4AEIH 5CEYB 1OAUL 2VYRE 4CU7A 2ZYIA 4DUWA 3D5OF 5AAPA 3PP3H 3ULVC 4MB4A 1N8OE 5C0DB 5AVQB 5FYLD 3C75A 1BAWA 5C7XH 2CPUA 3V9FA 2G5UA 3CQQA 5GGRA 5C6WH 5FO8B 1AD0B 4U3XA 4KVCL 5T3XL 4UTAL 5ERWB 1DUZA 1SHMA 1U8MA 1EGJA 1NEPA 2YFNA 3BAWA 2IOOA 3O45A 4MSWB 4RGND 1IKFH 4PAZA 2IPTH 2H2SC 2VERN 2FDBP 3CU1A 4HBCH 4NJAH 2A2QT 3RTQB 2XKNB 5ETUA 2P5EE 4YHLH 2IQ9H 2Y07L 3JWOH 3WY1A 1YMHA 5DHVB 1TJHL 3CVBA 4XP4H 2EDFA 4LZKA 5IHZB 2Z34A 3CN0A 4FXGA 1E27A 4LLDA 4MB5A 2G30A 3QDGA 5D6DC 3L4YA 3P73B 5AVYB 3UERA 1XF2A 3UO1L 2FBOJ 1NINA 3PAUA 3WU1A 1GGBH 1II4E 1YN6A 4FHJA 4WWKC 4OIIL 4BFJA 1KBWA 3UGEA 2BIPA 1P5VA 1XZ0B 2PO6A 3FT2A 4A2DA 1OSPH 2C34A 2FT7A 4MJ2A 2VDOH 3QIBB 4HIHB 1CE1H 3NCMA 1ZSHA 3F01A 3HEIB 3NFNA 3LMJL 4KKCD 4Z7UA 5CJXA 4N26A 2VUKA 1UXWA 3TT1L 5TE6H 3IDIB 1NDMB 1F2QA 1CLVA 1JWMA 4TNWF 2C26A 4S1SH 4ZUUB 1PLAA 3E8UH 3CZUB 2GC7C 2OA9A 3D06A 4BINA 1MIML 1S8DB 2K6ZA 4KK9D 1F90H 4JGJA 3U7AA 5EUOE 1CURA 2XA8L 1FGNL 4IDJL 3AQYA 3GRWA 1A8ZA 4TQEH 1F56A 1J9QA 2R1XB 1ZLVK 1PCXA 3OQRA 4QYAA 4OAWA 4Q6IA 2CO3A 1E4WL 4W9LC 3MRNB 4WI8A 4AX3A 3M17A 2NW3A 2Z8RA 1G7QB 1GW0A 3QUYC 4U6TA 1FL5A 4OZFG 4LOEA 4MS8D 1EBPA 2EZ0C 1CO1A 4NO3B 1FV1A 3OPZL 3RILA 4DEPB 1E5UI 4XMKH 4PJAB 2Q7YB 3WFDL 2JLPA 4G7YH 3MKKA 4KKLC 1E4XL 1HZHH 4TTDD 1FFNB 3QI9A 5I1LB 3ERXA 1GPOH 2XV0A 4G8EB 3JT0A 3OR6B 4DKFL 2GJ6D 2OMZB 1Q1PA 3FFDB 5GISH 1IGFL 1AFVL 4PREB 1TVDA 3ZL4H 3PP4H 3HE7C 3DX1A 4W9FC 4JO2H 5ESAB 1LEIA 3NH7L 2FECI 1BPLB 3MLRH 1DSWA 2CDEB 1CC3A 1MWAH 4MJHA 1VF5C 2BERA 5DT1L 5JLZA 1HSBA 1RHFA 1ZOXA 1MFEL 4Z77B 3V0WL 2IALA 3LKPA 4CNIA 4JCWA 1OZUA 4ICWA 3HR6A 4OZGB 3BKCH 5D70H 3U2SA 4F9PC 2E7DA 3BKML 3QDHA 5H37A 4OI8A 2VSDA 2VXQH 2ZKHL 1CLYH 4O02B 1H15B 4Y16C 2HG5B 4LE8A 3WI9A 3VXQB 1BWWA 3L7FA 4FERA 1MW2A 4NNXB 3TONA 2A1WL 2UV3A 3ECWA 4M61A 2BHFA 3KPRD 4KJPD 1FHGA 5J1AA 1JPGA 3KWXA 4JKMA 5CWSB 5EG6C 1MCKA 2V9UA 1KC5H 4HUWA 3A6OA 2P5WA 2JJSA 2X6MA 5ELIA 4I2XB 5DC4B 5IQ9B 1FC1A 4Z7NF 3C5ZA 1X5GA 3DETD 3O6FA 4RFEA 3HMXA 3HMWH 1GCYA 1UWEL 2PR9A 5LBSL 1MCEA 3LQZA 2WYTA 1QFWM 1KTJA 3EGDA 2D9QB 3FCBA 3FT1A 4MMXC 5T33L 2DJSA 2QADB 2IDQA 4Z1PA 4XI5C 1U95A 2NT0A 2Y72A 1VFOA 5F44A 3LRLA 1G6RB 5GSRA 4L1SA 3C8KB 3WFBL 3BO8A 3IJYB 3WFEH 3O3AA 3ZGIA 5ALBL 3AY4C 3O3DA 4K7PL 2ZE0A 1YO4A 3BT2H 2ZZUT 4KTYA 3FSWA 3HUJF 2GAZB 4JE0A 4B9PA 3FH8A 1FFRA 1A6VH 3I02B 1LEKB 5D7LB 3RIKA 1X7QA 2QSQA 1XF3B 3KM2A 2HXAA 1XAKA 4JN2A 3TBVA 4KVPA 3G7TA 4OF5A 4ANXA 2X6UA 3IJHB 5IJKA 3NBNA 4GRWB 2AMUA 2FLBT 3CLEL 5HI5C 1H6TA 2MCPH 3AU0A 3M1CA 4ZD3H 4PTUB 2F74B 4ELKA 2WNGA 4PRBA 3ZBMA 3CFTA 3HHRB 4ZNEA 5J12B 5DJ2A 2J6EL 4OFVA 1ASPA 2DMKA 3LQMA 4JFZL 4LL1A 4WJ5A 3UAJC 5DWUL 1YQVL 3QUML 2EKJA 3LEYH 3IDMA 4KOCA 4XVOA 2HKHH 4R7XA 1VHPA 3Q06A 4OF8A 5HGDB 2F8XC 3GZKA 4HJ0C 1XSJA 4NUMA 3C60A 2B1HL 4Q52A 5B1JA 2XYBA 5I30L 4JQVA 5LKNA 3B5TA 4HJEA 4IOSD 4UILH 2MQ3A 3MRPB 2FBRA 5F9JA 4ZMLA 4PGEB 2BP8A 3QGVA 4QHMA 2UY7A 2BZDA 1UFUA 3UTPD 5I17B 4S0HA 3N5AA 4O9HL 3QEHA 3WLBB 1R3JB 4LNVA 5JHLL 2Q2EB 3QVAA 4KROB 5HGHA 3L3IB 2E7BA 3AITA 4LCWE 4NCC1 1WF5A 1DE4B 3FQ2A 2X2UA 4PI0A 4ES8A 4OQTH 5F7MC 3RAJH 3VRLE 4PV8B 1U3HB 3BD4A 4Q6YA 1DJWA 3O4OB 1S9VA 4YZFE 4OCNC 2KC0A 4FOMA 5KEZA 2W8CA 5J11B 3MREB 3BSZL 4QGYA 3DYPA 3A4DA 4IRSD 3UBGA 1ETA1 1U8PA 1LXMA 3KLAB 4M5YL 2WKOF 3SDXA 5HGBA 1HKFA 5JW4R 5SWQA 4YPGB 2WZPA 4GBXB 1U8IB 4HJGB 4W93A 4XVSH 3ARWA 4QKXB 5KSAA 3HZMB 4GKZB 4DN3H 1G7PA 2CGYA 4KI5D 3S4SA 1S7SA 3L7EA 5C3LD 4M1GH 3ABGA 2G5BA 5B8CA 5E94A 2BSRB 4KXDA 2ZYHA 5AOKA 3TBSB 1E3FA 4AYBA 1R5IB 4NQSB 3DDGA 2X89D 3ZDXB 4FTVD 4QRPE 4KXCA 5BV7H 3QWRA 1QNZL 1PFCA 2K8QA 2Q87A 3A5VA 2VAAB 3VXSB 3CFDB 4AQ1B 3Q44A 4LPTA 4UQEA 3T3PB 4JFFD 1Z32X 1KJ2B 4IHOB 5KYNA 5IQ7H 2Y7QA 3W56A 3SO5A 2APFA 2AV7A 3F85A 2QSCL 3IRZA 3O4LD 4FRWA 4ODTL 3M7FB 1A4KB 3GM0A 3T65B 1IILE 1DSFL 3HC0A 4WU7A 4F8TA 2WXJA 3A6BH 4ZNCD 2X4UA 5EU4A 4YWGL 4PJ9A 4OQ1A 3U1QA 3TV3H 1I75A 3R19A 3NCYP 1LO4H 3DVFA 4XTRD 4N8UA 1KV7A 4NC1C 3REVA 4GW1A 2XYCA 2G3XA 2O5ZH 2QQLH 3OKNB 2V7HB 3H7BA 4W6YB 3TA4D 4LLMB 2H3NB 3ETBF 3B56A 4AGQA 3LIUA 4HKJB 1I8MB 1G7LB 2QMKA 4M48H 3S88H 4XP9H 3GSUA 5DLLA 2IPUK 3KJ4C 5JQHC 5FCUH 2AITA 2HJKB 3OKOB 5AVZB 4KK6C 1G43A 4L4VD 5E23A 4MMZC 4MNGA 2PW2B 4MZ3A 1NL0L 5D4JA 1VGKA 5CLYA 1FL6A 1CF1A 4FLSA 3RZCA 3CZNA 1NFAA 3QISA 3WS3A 1CFQB 1FFOA 4IM8A 1YQ2A 3EDDA 1ZLWH 3A22A 1I7ZA 2CDFB 3AC0A 3CVIH 3U0TA 4OD1H 4ZFQA 4JDEB 3QR2A 5I6XB 1FHNA 4KMLB 2LGNA 4YXHL 4FNQA 1CR9H 5ALCL 3L2LA 4GUPA 3CX5K 2ED7A 1DQJA 1RP8A 5GS1A 5AW7B 1E8XA 3ABZA 2EEAA 2EXTA 2MMXA 3WN6A 4XHQA 3KAAA 3KDMB 5AOJA 2UZXB 3I9GH 4Q2ZB 5D5ME 5DEFA 3VYPA 4BM7A 1A2YA 4GKSA 5TE7H 1EHKB 2DYPD 3RVWC 4G6JH 2YRLA 3IGAA 1O75A 4M7KH 3E38A 1G4MA 2F15A 5D1QE 2DIJA 2J8UB 2ICWJ 4KQ4L 1M7XA 1NCHA 1OGAD 1PG7W 1U6AL 4X6DE 4V2CB 1VPOL 3NZUA 1VEMA 3THMH 2YGQA 1AR1C 1MWAA 4OBSA 4NOBA 3EFDH 1QA9A 3AW5A 1JV2B 1CTMA 3VXUB 3KPSB 4LL4A 4XOBA 4KUCF 1BAGA 2VM4A 1E9QA 5TPWL 5AOLA 2WIMA 1LMIA 1CE6A 2ZXEB 3TIEA 4MVBD 2EUXA 3FZUD 1JDAA 5I19L 1MCSA 2WZAA 4L48A 4HZLB 5D7JC 5LCVH 4NQVB 2OW7A 3ABMB 4WQOA 1G84A 4KMQA 3VXTB 3G6DH 4PY7B 3N44F 5E08H 1MG3C 2F8VA 4KNTA 3L4ZA 1AJ7H 4GG6F 1B2WL 1USQA 4L8SB 4N0UB 4RMVA 2OMBA 2YAOA 1SYSB 4FQ2H 3FO2B 2XWZA 3P9LB 2EYTA 2WWOA 4XHJC 3LHPL 3U7YL 4AL8L 4GSRA 2H3KA 3ZMRA 5CU9A 2FYYA 2QKIB 2XNAA 3AB0B 1DR9A 2Y2WA 4AYFA 4NM4L 3P30L 2X2JA 3WY2A 2QHRL 4PJCF 1C12B 1FVDA 2NNAA 4MJIA 4Q89A 1UT9A 2NY7H 3NCWA 4EI5D 3E2HB 5JIMA 4AGNA 3ROOA 1DQIA 4YDIH 5HHOB 3FU7A 5H2BB 1M42A 5IB5A 3X12A 2WP3T 3RDTB 4HV8B 3WUWA 3TF4A 3IMRA 4QJ4B 4FYRA 4NAQA 1YZZA 3EOTH 4YC2B 1G9HA 1JTOA 4XOAA 5IB4B 1IZKA 4X6CE 3KBEA 5JYLA 3L2MA 2FBJH 2BP0A 5DFTA 1ETZA 5FM5O 4P99A 1QNIA 2XXMB 3O41B 1JJUA 2ARJB 4AYMC 3V5HA 4GAGL 3BH8B 3S3CB 1SXZA 1A6ZB 2J1ZA 3DC0A 1KTBA 4DP2X 1UQSA 3ILQD 2HRHA 5DA0B 4PMEA 3DVGB 2OXGB 4QRRE 3UABA 1PKOA 3CU7A 3P0VL 5ACLA 3NSXA 2B0SL 3E9TA 3KVQA 5EO0B 3O2DL 1JV5B 3R06A 4FFZH 4MAYD 2CK2A 4NHUB 5KAQF 4RAUA 1J8HE 1X3DA 4N90D 3IB4A 1M2VA 5D55A 2QGDA 4B9FA 5E9DE 2YPLA 2ROXA 4KVNL 4LSVL 4UTBH 2Z1PA 1OALA 2FEDC 1VKXA 1Y7VA 1G4RA 4H8WL 5DUPL 4EXPX 4ZFGH 4I89A 4Y19D 1SOSA 1WC7A 3WFCH 1G7JA 1F18A 1GOGA 3D4ZA 3L1EA 3DURA 5C08E 4QOKE 3VSVA 3CSPA 1WJ3A 3QJOA 4E41A 3MGOB 4N68A 2VZSA 1A6WH 4QJ3B 2P5EA 4G6KL 2Z31D 2ZX7A 4OQTA 2A9MH 4K15A 5AW4B 3GIVA 4AJVA 1ORSA 1RU9H 2Q9OA 3IWVA 1SQ2N 1Z6JT 4B9ZA 2YMOA 2XIIA 3NJNA 5C09D 4ACTA 4DCQA 2QKSA 3QDJE 4KZ0A 1MREL 2QBWA 4LSRH 2JTDA 3JZYA 2F5BL 5DLMH 7FABL 1KGYE 2Y36H 1IBGH 3MJWA 1LO5B 3QE5A 4HFWA 5CN3A 1P9MC 1AOZA 5K59E 1CDHA 5BRQA 5KSUA 5E8OB 1OOWA 1TO4A 3WHE1 1WA1X 4Z7OF 2CSPA 3OMZA 3FF8A 5DJ8A 1CTOA 3VFRB 3AQZA 1BGXH 1HINL 5E7BA 2YD3A 3SKJL 1KTLA 1YECL 2WXPA 3TJEL 2DS4A 4FFVC 1HI6A 4U1NB 2VNCA 5TDOA 4YHOL 4Z78B 1J9SA 4U6HB 4X5LA 3JWNG 4OUUA 2WGXA 2DDQL 2CLZB 2IDUA 4PGBB 4X5WB 5TDNA 3PL6D 5EUOA 3QQ9C 3PWUB 3BQVA 3DX9A 3CXDH 1HT6A 3BN9D 4NQCB 3RTQC 1TCRB 1FIEA 1YPZB 5EU7C 3QK0A 3NIDF 3LN4B 2EIZA 4S1QL 2F7RA 2OCCB 4HHWA 3DK0A 3T71A 2W81C 4DTGL 25C8L 4YHML 4UM8B 3RP1A 4NZUL 1S5IH 1V55B 3IDXH 1A9EB 2WQAA 5C07E 3MA9L 3CXFA 4AQAB 2JXMA 4R2GB 4H25A 3ARBA 3SD2A 4BWWA 3TH2T 1HL8A 2O5YL 4WUKH 5FHBH 4OM0L 5KYXB 1QUNB 5LBGA 5I1JL 1L3WA 2YK1H 3TYFB 4OD2B 3QIBC 4NS0A 2LVEA 4G71B 3F7YA 4I3SH 1T0OA 3CHPA 3MBEA 5EC2A 4LDLB 4UOW1 1J0ZA 2V37A 4PHZA 4Y8DC 1ZT7A 3B1UA 1UYWH 3CVHL 5BZZA 2YAPA 3CK0H 3ARFB 4RGNB 4HWEL 1A9VA 2KS0A 3OXRB 3LZOA 1YMMD 1R3HA 2Z3FA 3BZEB 3U0WH 2DICA 3Q6FA 3GSNH 3ZKNC 3BUIA 2D8KA 3EG9A 3ZSSA 2NTFA 2LFGA 2OYLA 5DU7A 5ABZA 5IFJA 3H42L 1TVHB 5AW0B 3SKMA 4HP5A 1CGYA 1RZKH 2IH3B 1PKQB 5HYIA 2WQ8A 3S3PA 6CGTA 1PZ2A 1OV8A 1YEFL 3HJ0A 4DEPC 5IHHA 4XVUC 3RY5A 4UIKL 5EZOH 1TTBA 5EU5A 5CD5D 3ZMEA 4CVXA 3GXUB 3PE9A 1ITCA 5DD5H 4YSCA 4MXQC 2HX9A 5HHPB 3B2UC 2MIZA 4AWJC 1PLBA 3QYNA 1G94A 4TYUA 1AHMA 4M7ZB 3MMEB 2I26N 4MA1B 3RBGA 5DZJA 4WCYL 4NT6A 2IWFA 1PZ3A 4YFLI 3V10A 5JOEA 4WV1B 4U6VL 1G9MC 3LKNA 1YUHA 1CLOL 5I5JA 2UZIL 1R4XA 1SHSA 1KGWA 3QDMD 5T5FL 5IB2B 4DOHB 5CZVL 1U93B 4XNUH 4WI6A 4UINL 4HW6A 2HA1A 3DX8B 1W72H 1GTFA 1CBJA 4BXSV 1QEWA 1NMBH 5AD0A 4K73A 1MFNA 4J6RH 4ABUA 1KIRA 2CQVA 1VEOA 5F93C 4U1MA 3ULUD 1QKZH 5A2JH 4F8QA 2X4SA 1C5CL 1KBPA 1QLFB 2GJ6B 2YOCA 4K3JH 5IOPA 5A2CA 3H4FA 3ISWA 4G8GA 4AJ0A 5LCVA 3I50H 4PD4K 4HYTB 3P11H 1U92B 4PJEF 2BS8A 3SYQA 2OZ4H 2QADC 1BLIA 4LHQB 1I7RA 3B2PA 1JZJA 1UC6A 1F41A 2DKMA 1VFUA 4NHCH 4QTIL 2X41A 1J10A 2DWEA 1PD6A 2XBZA 1JK9B 3QJVB 1GY1A 1QG3A 3A6CL 1GSMA 1N64L 4QRTA 3VFGL 5C2BL 5H94B 1C9SA 1KENL 2WKLA 4HCIA 3QUXA 3R0MA 4Z3TA 4HCRL 1IFGA 4HH8A 1AD9A 2FO4A 4TMPA 1DUZB 4KNQA 1U8MB 2VN5A 2VDPH 2ICWB 2A74A 2B59A 4GSUA 4HLZG 1PIGA 1Z9SA 1CFNA 2OR8A 3BH9A 2X5PA 5LAXA 2MRYA 4S2SA 3RFZA 4WW2F 4P5MB 2X4PA 5J12C 4F57L 3LH8A 3NSCA 3KYMA 5F9WB 2UXGA 2BWIA 4WTZG 2IGFL 1E27B 2C3VB 3NCFB 5EULV 3QULB 5F1IA 2F1BA 1NANH 4HFUL 1YN6B 4G11A 1NWPA 1Z66A 1KPUA 3RUGE 4GEIA 1E65A 4JKPL 1BOGA 3MXVH 3NAAH 3SBWC 2F5AL 3OAYK 1NCCH 3SBPA 1ORQB 1ZIBA 2KQMA 3UIZA 4F37F 3GMLA 3NFNB 1LP9F 2XZCL 4B3VA 4Z7UB 4FFZA 3LEXA 3HC4L 4KY2A 3T0EB 1VIWA 2C3GA 1UXMA 1XB3A 2UXTA 2M26A 4ZW5A 1MAMH 4KROC 2WB1A 4UTBA 1N5AA 2DJUA 3KPRE 3GDBA 4QRPA 1DJSA 4KZEH 1GAFH 1Z3RA 3LJ3A 2RB8A 4L37A 4ZODA 5JPNA 4U6XA 4BCZA 3WIIH 3IK2A 1KYFA 1U3HC 3ZHNA 4YS4A 2F54D 3O4OC 5JMRA 4Q97A 4Q6IB 4NO2A 5KBNC 1NEZB 1QLEL 1UVQB 2QZQA 3M17B 4D0BA 5HDBF 1JWUA 2VQ4A 2VUYA 1FL5B 4Y5XB 3GHEL 5F7BA 5J11C 5I6NA 4QXVA 5E03A 5DJXA 2EYRB 4TLUA 2ZWSA 2A6JB 5DK0B 3GYRA 4RA3A 1U8CA 3WEMA 5JIDA 3FMGH 3SYAA 1C8PA 2DWYA 2VQUA 3BAEL 3D52A 3MYJA 5HSFA 4K8RH 1QSVA 4KV5E 2FJGB 1KBGH 1FFPA 3V2AR 4QT5B 2BHUA 1MCCA 3V0EA 3B2VL 4PJDE 3ZTJH 4OZHA 5DRXB 2KQNA 2NDGA 3OVUB 4F2ME 3UIYA 2YQ3A 4K3DL 3VFOA 3VWKD 2W0KA 3FQXB 4KAQH 4J3XA 1HSBB 4OI9A 4WKZB 2V5YA 5E70A 4ZI8A 3LIZH 4P3CL 5I23A 2IALB 2BZ7A 3VD0A 3WD5H 4WWID 5DF0A 1OSZB 3G5YA 2I24N 5LNEA 1O5DT 2GEEA 4BSVA 1EO7A 1L9OA 2EO7A 1FE8L 1UD6A 3G5ZB 3FUEA 3D34A 4S11A 1JTTA 3EBAA 2VDMB 4F20A 1CFMA 1ZWIA 5I1KH 4YDKL 1A5FL 5EIIB 2LU5A 2NSMA 2RD0A 4X5XA 1ZXQA 3JWDL 4M61B 2R7EA 3VU2A 3M1BA 5J1AB 3IMSA 2GABA 3C9NA 1F4WL 2DEWX 1L9RA 2OMVB 1OTUD 3MV7A 4XB8A 2EH8H 5AVUB 3QHZH 1PEWA 3V4UH 4C58B 4RFEB 3VFSA 1SZNA 2XY2A 4Z7QE 2ZG1A 3SPVA 1NANI 3LKSB 3LQZB 5AKRA 3EGDB 3QIUA 5F70A 4J39A 4GP5B 3FCUB 3UTPE 4G42A 3GB7A 3UAAA 3FHQA 3GSOB 4DEWA 5DS8A 5LGJA 4CBPA 4DKAA 3O2VL 1A3RL 2X3BA 3O9WA 1U95B 5D1QA 4XB3A 1TLMA 1G7IA 3MUY1 5D2NE 4AQOA 4N1HB 4X6DA 4W9ZA 5ISZE 4FTVB 3O3DB 5HVFB 3WUWG 1JHTB 1X6NA 4JANB 2E75C 3F2LA 4UV4L 1FYTE 5J3HD 3QA3B 4HJ1A 1Y07A 4HT1H 1ZLVH 1SLWA 4LARH 5AKTA 1U3ZA 2XV2A 1J0HA 1QTSA 4JFFB 4YBQC 2YUXA 1Q38A 1VDGA 5J56B 3L54A 2R2CA 1ACCA 1PAZA 3P4MA 3GSNA 2ZQKA 2HFFA 4JN2B 4WW1A 3ZYZA 1TUPA 4BUHA 4PB0L 3GZOA 3QEQE 2AK1H 5I6XC 1OCOB 3QZLA 2K45A 4U0RB 2AHIA 1E43A 4DGIH 4M1CC 2JE8A 2VDNH 4ELKB 5F7HA 4HKZA 2F7OA 1ES0B 4XPAH 1TZ8A 4XCYA 1WFUA 1MI5D 4UQ2A 5FM5M 3WKPA 4WJ5B 3DYOA 3M86A 4RISL 4BFIA 2O5NA 1AC0A 5LNGA 3FKUS 2IBZX 1VESA 2XTJC 3MLZH 3K2KA 1JNJA 1GYAA 4B9IA 2APXA 3CX2A 5LXGH 4ESKA 3C60B 1MHCA 2ARWA 4U33A 2V8LA 3BMVA 4PRAA 3Q8EA 3FONA 4MD4A 3M7OA 1I3RA 1JN6B 3F58H 1L5GB 4L4VB 4RGOL 3V8CA 1PLGH 1RZPA 3BJLA 4J8QA 4ALAL 5F9JB 2BP8B 4QHMB 2UY7B 2N3JA 5AEAA 4MCYA 2DQTH 3QEHB 3UZQA 1OE3A 3BWAA 3L9YA 3ULSA 5HGHB 3WNLA 4LLQA 2Q7NA 4AQEA 2GCYA 2R69L 4NRXB 4LXFA 3O4LE 4XBPB 2R2HA 1WICA 3SGDH 4G5ZL 1OAKH 1UJ3A 4HZ1A 4JZJA 5CINH 1RUQL 2GBAA 4X6CA 1W72A 2FEEL 3NCXA 4FQHA 1S9VB 1I8AA 5E51A 4DVBA 5ADOH 2BNQE 4HULB 4EN3D 1UOLA 3UTQA 2DYPB 3AMLA 3O2WL 3D4CA 1NCAL 3FB8A 4UF7C 1U2YA 4K9EH 4L8SC 3NK3A 3GO1L 5SWQB 1E50A 3HI1B 2NR6A 1OGAB 4N86A 4XNMA 3UFIA 1F6FB 1WAPA 4EPSA 1I31A 3S36L 2Z35A 3NP3A 2ZOKA 2XPZA 2OZ4A 1OP4A 4OU3A 2QKIC 4IU3B 3AB0C 2D7TL 5D1ZD 5DZOA 2GBTA 2WINB 1KIQB 3DV4B 1G7PB 2D03L 3S4SB 1S7SB 3EGXA 5BZWB 2EO1A 3I3DA 4XVJL 1FL3B 2WVTA 2DH3A 1CXKA 3OR7B 3VG9C 5IR1B 5IROD 3E2HC 2EUVA 4E42A 2K4AA 2OP4H 5KYWB 2AABH 2G5BB 3DJRA 5K39A 4LIQL 2A7BA 1PY4A 3RDTC 4I48B 4QOKA 3SDDA 5E2WH 2QTEA 3W0WD 3REWA 3P9WB 1SXSA 2KLSA 3GRBA 3ARUA 4PJFE 4G83A 3B43A 2PYFA 3C08H 4Z7VA 2R8SH 4YC2C 3UPAA 1UM4H 3HZYB 1BM3L 1WBYB 3IRPX 2FE0A 1JP5A 4N2MA 5DK2B 2X7LA 4QR7A 3VE0A 4P3DA 2ATPA 4L4TD 2ATKA 2AV7B 4GB9A 4FZEH 3QDJA 1SF5A 3Q48A 4QRUB 5C0IA 4JMNA 1QSED 4FLRA 4WY7L 2F68X 2QPUA 5FW7A 3UBHA 3HC0B 4LOVA 4WU7B 3FPYA 2R0KH 3BEWA 5DFAA 1OAYH 4DKDC 2VDKH 4XXWA 1TZIA 1UEYA 2BDNL 1DBBL 3VD7A 4BFOA 2A4EA 4J1UA 4ZTPH 3VFMA 4GNKB 3CZKA 3I6SA 1NMAH 1YG9A 4GW1B 1KFAL 4KTDL 4EI5B 1NCBL 4TOYH 2Q8AH 2YD2A 1QMUA 4ERSH 1T3FB 2VDOB 2V17H 5FYJL 1S7QB 3RYMA 4ZXBA 5GRUL 2DWDA 3CE1A 4OCWL 3KE0A 3FAXA 3GSUB 3ELQA 2YWZA 3EYUL 2R2BB 4WUUA 1HTYA 1D5IL 4F58L 2B1AH 4OGXH 3OMNB 3C09B 4PJ8A 1VGKB 1ZTXL 1U30A 4XCFL 3JUYA 1T2QH 3O11A 3KL0A 2J72A 2UVFA 3I6LD 3U0TB 4M5SA 4KPHH 5TE4L 2APVA 4N2NA 3ZE2F 4U3CA 2OL3L 1YEJL 2VLME 3N42B 2VDRL 4V1DA 1ZLDA 4GUPB 4P04A 4Y1AE 4Y4HA 5LG1A 1EFXD 1U8NA 2WP3O 4M5ZL 3ZZSA 4IYKA 3EJRA 1T1WB 4MJ4A 3ROLA 1RLWA 2QSVA 1CMOA 5DEFB 1GXEA 1MW3A 5L4MA 3ZDZB 4GINA 3IGAB 3IJ9A 2YQBA 4Y19B 3Q2CA 4LLWA 2OYKA 2GYSA 4JY6A 1GGCH 1T7XA 4MQSB 1Q1JL 1A4JA 1Q9WB 2GTZA 5DZPA 5J7CC 1BQLH 3KLLA 1ROCA 1FDLL 5GHWH 4AKQA 2Z31B 3H3PH 4LRIA 3T77A 3LIZA 5GGSA 1IZJA 4PWIA 5B1KA 4JG0H 3RVTC 1JOIA 1E9QB 1N4XH 2FQEA 5C09B 1MQKL 5HD8D 5I0XA 2MH4A 4P07A 3N43B 1DQLL 3ALXA 3FTSA 4GS7B 3TIEB 4MQXC 1YEEH 4H2AA 1DJGA 1BBJA 2ZCLH 3KS0J 4LBEB 1GR7A 2FHFA 3UP6A 3VGDA 3MNZA 4R2GC 5FHAL 5J9PB 5GGVL 2D3LA 1S9XB 2WBJA 2X1QA 3QQ4A 4KGLA 3LQAC 5BXFA 3BUYB 4N90E 3MLSH 4NSKA 2ZCHL 3MCG1 2ADJB 4N87A 3VXNB 2XPGB 2G4GA 3L3KA 1UWFA 4K3HA 3GK8L 2GJRA 4LHUA 3CFQA 3UJIL 5AW5B 1S4IA 2FYYB 2XNAB 4H1LH 3BH4A 1HQRA 4AYFB 1G1CA 3ARFC 2VR4A 4RGNC 1KWKA 2R2EA 4GT7A 5FV1L 4QHUB 4A7TA 1FVDB 2NNAB 3FTVA 4MNQD 1A6UH 4X5RA 5FCSH 5CFHA 2CWRA 3ROOB 3ZKMC 1ZHLA 3FU7B 3S8GB 4Z7NE 4ZT1A 3G5WA 4R96B 3CN4A 5HHVL 2LW3A 4GW4B 3LXCA 3TBWB 4P46A 3NDYE 3CHQA 1JD7A 4JHWH 4BELD 4P5TD 1H3GA 1I1YA 2YMXH 2ENPA 4Y1TA 5C6TH 3QZWB 1M4KA 2A0LD 5JQIB 4KKPA 3BP5B 5CCKL 1P69B 1MWOA 3HUJE 3CN3A 3ZZQA 1XIWA 4ELMF 5K5YA 4FNPA 4NJ9H 2JNZA 3FB5A 1YMMB 4MA1C 3KXFD 1CGTA 3R06B 1I8LC 3J7HA 2R29H 4U1IA 4WV1C 3UCQA 3B5GA 4D8PA 5BVPL 4A68A 3CFBA 4XN7A 4ZW6A 5C0EA 3STZA 2YPLB 2CJUH 4A6YB 4M6AA 4O2FA 3I6KB 4YQXL 3AXLB 4PJIF 3D7PA 1WC7B 3RB7A 4FA7B 2EVFA 4L5FH 3V4LA 3VD5A 1OD7A 1U4EA 4E41B 5MEND 3O6MH 4A2HA 3UTSD 4LRNL 1F4XL 2ZNWA 2PPAA 3GIVB 1JRHL 3QIWA 4R83A 1JXFA 1U8KB 5DC2A 2I9TB 1IKNC 4QI3A 4HIIB 4JG1L 1MJ8H 3NJKA 1IC7H 4JCLA 4QUOA 1G1KA 1FN4B 1TF4A 3BAKA 1ZE3H 4OBRA 3ARGA 1A3QA 3QZOA 1TITA 1HHGA 2F1EA 4N2AA 4G80A 2UUDH 4BSJA 5AVTB 1MW0A 3S3JA 1GKOA 4G9DA 5D2LB 1JIBA 2QR0B 3QPXH 1CD9B 4NBYB 1KCWA 1Q9OA 3OKDB 1NGPH 3KLKA 2AJXL 5KSVA 4PCYA 3ZT7A 1HI6B 2BY1A 4HS3A 3VGAB 3INUL 3NIGF 5TDOB 1FRGL 1IUZA 5JW5A 3F7VB 2SODB 1TXKA 5FYKU 3RJQB 3DGGA 4OT1H 15C8L 4PY8I 4MYPA 1E6OL 1OO2A 2F53D 4BXVA 1KCSH 1XF5A 3M88A 1TJGH 4Q9QH 4FD0A 4WNQB 4GI6A 1PSKL 2ITEA 3LHAA 4HXAH 5AVXB 5I1DB 3CFEA 3DPBA 4CJ0A 1J8KA 1AQKH 3BWUF 5KUMA 1A14H 1M71B 5BV7B 5KVEH 1D6VL 2X6AA 3U2JA 4ZQTA 4HGKC 1WG3A 1AMYA 2GSGA 5F9WC 3PQYE 1X9UA 3ECBB 2FAUA 4G59C 4ZO7A 3ZT6A 1JERA 1AZNA 1PEZA 3HE6A 3K81A 3QHFH 3ARBB 5KJ7E 2W65A 1WRFA 2GJZA 3PDDA 1A8JH 1PY9A 1U8HB 3FQ4A 3L95A 1XL4A 2AI0L 2DLFL 4CVZB 2BINA 1BEXA 4NI3A 3OF6A 4QRAA 4QRBA 5B38G 2VDLL 1OCZB 3F7YB 3QJFB 4FYTA 4X4ME 1R1CA 3KZ8A 3WXWH 3DXAB 1Z5LA 3ALWA 3QDME 3MBEB 4OW6A 5EC2B 4F2MA 2B08A 4YMPA 5T3XE 3T0EC 2VRKA 3L1OL 4G3YL 3MJ6A 1J05A 2AQSA 2Y6SC 3P3YA 2Q5BA 2ZXCA 3ES6B 5IBUB 1QR1A 1EZVY 1R3HB 1UD3A 5H4ZA 5KVMC 2NQDA 1EK3A 4QXUH 3Q6FB 2UWEF 2YRBA 1VCAA 2L7QA 4K2UL 3AT0A 3JVGA 4XC3H 2NTFB 3TBBA 4EDXA 1P4IL 4KUZL 2OXHB 4Q6IC 2NY1D 3D3VA 2QQQA 2R23A 3SKMB 3T2OA 3D39D 1QRND 2EE2A 4NNPL 4MD5B 4O51A 4X9GA 1IIIA 1MF2L 3PV6A 2Y06H 2VH5L 3GS0A 3ZTCC 2RH0A 3TFBA 2G3MA 2AS5M 4XAWL 2WVVB 4PV9B 5G2NA 2JI2A 3ETSA 1JI2A 4J3TA 4M7JH 3QI9C 4N9GB 2AEPH 1T7ZA 4ZTOL 1QTYT 1ZV9A 3D9AH 2PN5A 1CU4L 3LEVH 3D05A 1S9WB 4IBQA 4BQ9A 3VGBA 2RAMA 2P80A 1KBKA 2AJSL 3LS4H 1BD2A 4O4YL 5ISZA 1YLBB 4ELDA 4NT6B 3UYPA 4G8IB 4YAQA 4PJ7B 1FYTA 1X5ZA 2ADFH 1CBVL 1YUHB 1X5HA 1H6EA 4EDWL 1PTZA 4EBQH 2O6PA 4UUJB 4KY1L 1TQBB 4MYWB 4N0FA 5FDWA 3LRKA 3U4BL 1O7DC 2BVEA 1O7VA 1OCRB 2BVOA 4ZDHB 5FO9B 3QEQA 3L9RB 1FQ9C 3UG5A 3VTTA 4RESB 1JBJA 3FHAA 4Z0BH 4TUKH 4YXLH 5KS9A 2WN3A 2MQ0A 1V3KA 4OTXL 5I5MA 4U1MB 3MRHA 1NFIB 3MLTA 4P2YA 1ONQB 1MDAA 3O6FC 5CZXC 5H4YA 1KGIA 3MODH 5D4HA 1XEUA 3AAZA 5AZUA 5GGRY 4LSQL 3VAEA 4FABH 2XJKA 4WSKA 3ULVL 3K4ZA 4G8GB 2OJZH 4PVNA 1AZVA 1RJYA 2Z91A 2PTTA 4Q9BA 5CMAB 5I0DA 4D7PA 4P2CG 3J27A 1ZPUA 3ARYA 4GP4B 2OV0A 2J2ZA 4KKNA 2VLLB 4MA7H 4TVPL 3VWKB 4H7VA 3D4GA 2VLKD 2JB6B 2XQBL 3JTTA 3POHA 3IFLH 3NQKA 3Q5YA 1UASA 3MRKA 3ZL2A 1FNSL 2YGNA 4QWWC 3U36A 4OCRH 2GBUA 3AROA 4KTGA 4H1LA 1FVEA 3H9SD 4QRTB 2Y6TE 3L4VA 1IGMH 4I3RL 5TD4A 3QWQB 1JVKA 2F54E 4J3UA 4YDJA 3OD3A 2VLJD 2Y9RT 4GRLD 1QPXA 4FQIL 4HF5L 3J07A 1VACB 4ZK8A 3LRSB 3GI8H 1I9JL 2FO4B 5E99H 4EKXA 2ZUWA 5I8OH 2A74B 1KB5H 1ZEAL 4ONFL 2V9TA 3RWGA 5D71H 5IJKC 4U0RC 2IAND 3D25A 1CFNB 4KHXL 3BH9B 3NIFF 3RFZB 5EF3A 4GG6E 1DZ0A 5E8DH 1N8ZA 5FGCB 3NJIA 2YUZA 4YLBA 2BNQA 2X4PB 3DSNB 4AW7A 4I18B 5JXAH 3KYMB 3AZUA 2DQUH 2XC8A 1SEQH 4POYA 1OD9A 5FXCH 3TURA 2JELH 3PXHA 1D5MB 3NN8A 1QATA 2DMGA 4PJCE 3EJJX 3HRPA 3QUHA 4OIBA 3TN0A 1G9NH 3TA3B 3C60C 4G8FB 4MWFA 2BS9A 3TO4A 4JB9H 3GIZH 2AQ1A 1KPUB 3T8XA 4JQVC 4QPEA 4O2CA 4S0SD 3WL9A 1ZANL 1TNMA 3GMLB 3KPOB 4FZ8L 4PP2A 1N0XH 4Z8FH 5E5UB 1GC1L 3G08A 2R29A 4NCC2 3U1SH 1HHKA 4YSDA 2X10A 7PCYA 3V4VH 3QEGL 1RZJC 3E6FA 5I8KH 1G7HA 3EO9H 5HDWA 5KBMA 2G5RA 1WTLA 4PJFA 3SN6N 1J1PH 2B2XL 4YSRA 4PV1C 4U6XB 4K7PX 1OQXA 3KLQA 4OGZA 1JZIA 5L4JA 3W9EB 3EH1A 3L4XA 3OJMB 1FZMA 5B3SB 1JWUB 1OAUH 3WTYA 1WPCA 3SYOA 5DUBA 2ATAA 1WHPA 2VXSL 2OYPA 3ZVVA 1IB5A 5DD6B 2CLRA 2X70B 3BSGA 3GBLA 3L6FB 4BK5C 4I4WB 3G6JF 4B41A 3ZTJG 2P46B 5T3XH 4UTAH 3CFIC 3CPLA 5KSAC 1FFPB 1NGYA 3V0AC 3B4NA 4NZDA 3WAJA 3ZRCC 5BOZG 4OZHB 5CLXA 2J56A 2CIIB 4J4PD 1HNFA 1JF1A 2AQRA 4ZOBA 1JPFB 2Y24A 1SJHA 4YGVA 3FCSA 1TJHH 3MNVA 3VFOB 2DL9A 2AXGA 2IDTA 2NX5D 3EJPA 2OCFD 2NMSA 2X9WA 3ILEA 1WLHA 4BUGA 2QEJA 2FR4A 1QP1A 2W92A 4BSVB 4E9RA 3UO1H 4KDVA 1BZOA 4OIIH 2DKSA 4QHNB 3HNVH 3OLGA 1XCTB 1M6OB 1MI5E 4EN3B 2IADB 1UD4A 1ZWIB 3BXNB 1BYNA 1SOQA 4X5XB 4Z7OE 1M7UA 3L9EA 1U0QA 1Y18A 4X0NA 4CGTA 2B8OT 2R7EB 4KQ3L 3L3DA 4WVRA 3LMJH 4Y1AA 4TLTA 3UEQA 3C9NB 4P2OA 3TT1H 1GGUA 2C9VA 4Y2DD 3MV7B 1BYOA 1R5WA 1AS8A 1ZTMA 5D1ZB 1SOXA 4LHUG 4AV0A 3SPVB 3AGVA 5TF1H 4LEBA 4BRJA 2Y5TB 1MIMH 3GB7B 3OJVC 2KZKA 1Z9LA 4HGWA 5LGJB 4IDJH 1FGNH 1T21A 4EI5C 1JNHA 4HPHA 3QQXA 5HYSG 1OGTB 3RE0A 4IRJD 1WV7T 4ATWA 4BH8A 1NGWB 1P84K 5AVRB 1E4WH 2DQDL 3NIDE 3UCRA 3MDJA 1BQ5A 4JFPA 4LQ1A 3WLWD 2DBLL 3W0WB 1T0NA 3GEFA 3CDCA 1DL7L 2XRAL 4ZYKB 4HOZA 2PXYA 3DARA 1DCEA 2I32A 3OPZH 5DZNA 1JZ4A 1DHKA 4W1TA 1MHEA 1CZ8L 4KX7A 5MEPA 3GXNA 4KTEH 1G7MB 3RZCC 2IXQB 1E4XH 3QJQB 2LOEA 1WGOA 4JGUA 1T5WB 2NY0C 1B9KA 1PLCA 2HFFB 3GSNB 3FFCD 1PJ9A 4J3OF 4PN6A 3D85A 1AFVH 1YNTF 4UNTA 1CG9A 2ZP0T 3NH7H 4CL7A 4R8WH 2BC4A 1VGEL 4P57B 4M6OL 1ND0A 2A9NL 2ZSWA 3LPGA 5DT1H 1MFEH 4QTHB 3CMOH 3V0WH 4BFIB 1KLGA 3D1MC 2E7HA 2BNRA 3QFDB 2LU4A 4WI4A 4WWNA 3UTTE 1BVZA 4K3GA 4I1RA 2GFBB 1TYJA 3GSVA 4WU5B 4NQXB 1GW6A 1T20A 3BKMH 4DP5X 2ZKHH 2QPDB 2ZWZA 4R7VA 3ENEA 1MHCB 4BK4A 4ZMPA 3CSBA 3MU3A 4KZDH 4PJHF 4PRAB 2HFGH 3FONB 2VDQL 2E4TA 2EECA 2A1WH 2YRZA 2VWEC 4HUCA 1MJJA 4L3ED 2OMXA 2IH8A 5IJCC 2GIXA 4IJ3C 2JI1A 5KYYB 3WDHA 2XOTA 2WMPA 3BWAB 5IFAL 2XN2A 5LBSH 1WWBX 2MQGA 2AQTA 4L4TE 4AQEB 4IGBD 4PTTA 5SWSD 2PTVA 2R2HB 3HS8A 4XMPL 2PYEB 5T33H 1QSEE 4GS7C 1EFXB 3RPIA 1OCWL 4JZJB 5CP7A 3VRJB 1TZHB 3NRQA 3VH8A 2TRYA 1W72B 3QUKB 2AW2A 3Q5OA 3BPCA 3TJHC 4DFIA 4DVBB 4QXGL 3M07A 1YC7A 5ALBH 5K93A 2AXFA 4K7PH 4MB3A 5CLTA 4ZFFA 2AZAA 1YAZA 2FECL 1GYCA 5CBAA 3ULVF 1KULA 3GUFA 5CN2A 3TO2B 3GMRA 3P3UA 1IEAA 1CDBA 1KOAA 1DN0B 3IKCB 1Y6KR 2ZOKB 4I5BB 5IIEA 4EAEA 3T3MB 1PPIA 3P2DA 2EC8A 3CLEH 1CFVH 3BN9C 5DFVC 4N8PA 1E8ZA 2X53A 5JW4N 1IKFL 3BZ5A 3I6LE 4JFZH 4K55A 5DWUH 1YQVH 3QUMH 3FTGA 3UBXI 1UM5L 2YSSA 4Z5RB 3MUHL 3SDDB 1E4XI 2X4NB 3RL1A 5AWNH 5FF6B 3REWB 2CU9A 4Y4KA 2B1HH 4Z7VB 3NGBB 4G72B 4NKDB 2NNFA 1KYUA 5EO1A 4YSPA 4PJEE 3WJMA 1J87A 2CBPA 1KB5A 5KTEL 2B16A 1GGBL 5FW8A 3X3GL 2X7LB 3PPSA 4P2QA 1RPUA 4P3DB 1MCPH 2HB0A 2ATKB 4LCUB 2UZYA 4F92B 1DUYB 3TBYA 2H47C 4LOUC 4XXCA 3LNFA 3MRMB 4O9HH 2W07B 1AZZC 3GMOA 1JI1A 4GAYA 5E24E 3H3BC 2BY2A 2W1NA 5C0JA 4A7UA 4TNGA 3QG6B 4WI0B 2G60L 2N1KA 3GLAA 1MRCL 4JO1H 4PJXF 2BRRL 3MTXA 1F6AA 2QLVB 4MNQB 5HVHB 4J1UB 5IBTL 1KCKA 2DLIA 4GMSL 3VFMB 1DLFL 1LD9B 3FU9A 3CVCA 5DRNA 4E9YA 5T3ZL 4DAGL 2PNDA 1QHOA 3FC8A 1W2KT 2DF3A 2ESVE 1O0VA 4D9LL 3SDAA 4G82A 5BMFL 4YE0A 5J6HB 2W0FA 1VZIA 2NLJB 2DWDB 1AXIB 3K8MA 32C2B 3WG7B 3BSZH 1ZVSB 1HC1A 2V6HA 4OH2A 4WUUB 3V4VA 3C6SA 4C57C 4CGUB 1T7WA 4GW5B 4P5TB 4M5YH 1EV2E 2MPAL 3WTUA 3O11B 1U3YA 4XMKL 4FQXD 3RWJA 4E9QA 3OKLB 4NKOB 4YHYB 5I82A 3WFHA 2XPYA 3PQYA 1FSKB 4WAFA 1HZHL 4PSRA 1CFSA 4HIEA 3E1F1 4V1DB 5EOCH 2X4OB 1WS7A 5LGHL 1DYZA 2OCJA 5GISL 3IJSB 5I1AB 1LP9E 2VXTL 2WLNA 3O8XD 4R7LA 5B22A 4BA8A 1U8NB 4FQLH 3KXFB 3PYCA 5M95B 2B39A 1MJUL 3AQXA 1IAIH 3SQOH 3QPQD 1EVUA 4AUUA 5A2LH 1F4HA 5CGBA 1MWAL 5TGBA 4D9QE 5LHDA 3V6OC 4X4MA 1EUTA 4F24A 3M8OH 1QNZH 2ENYA 4JLRA 4DP6X 3I75A 4LLWB 2FGWL 5FO7B 3SKOA 2ZUYA 4JY6B 3VGAC 3LKOA 1CLYL 1F5WA 3VGEA 2Z93B 2QSCH 3CX5J 1IM3D 1MRDL 2ZF9A 3M45A 1DP0A 3FULA 4IBTA 1XGQA 2BNUB 4ODTH 5HDBE 3RKPA 5BW7C 5MENB 3HVNA 3T77B 3UTSB 5BRPA 5JR1L 3CZEA 2FYVA 5HGAA 4PVMA 4ZS6C 3DMMA 3R8QA 4YWGH 5B3JF 3MO1A 4GUQA 1HYRC 5BV7C 2NQCA 4FGMA 3T4YA 1LQBC 5F9OH 5IKCB 1E42A 3KYOB 2QVMA 3PFQA 4NGHH 1BBJB 2G3NA 2ZAIA 2XETA 3LY6A 4JRYE 3KYNB 3ARBC 3P1VA 1V54B 1ASOA