3LZRA

Crystal structure analysis of manganese treated p19 protein from campylobacter jejuni at 2.73 a at ph 9 and manganese peak wavelength (1.893 a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
158
Chain Sequence
GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
molecule keywords P19 protein
total genus 28
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzrA00
5I0VA 3PJLA 2O6EA 3LZQA 5I0YA 3LZPA 3NRQA 5I0WA 3PJNA 3LZOA 3LZRA 5I0XA 3LZLA 3LZNA 2O6DA 3NRPA 2O6FA 2O6CA
chains in the Genus database with same CATH superfamily
2JELL 4GKNB 4FHKA 2ZWLT 4M1DL 5FYLH 3O9WC 1LYQA 4WFED 5IB4B 1CLZH 1K72A 2DF3A 2B15A 4OB5H 1J7VR 2EIZA 3I75A 4I77L 4QUOA 5AYQA 3Q8CA 4Z7VB 2EVGA 1RIHH 3PGCB 2XWTA 2HUHA 4KKQA 2DH3A 4OF5A 5B8CA 5FUOH 1U58A 1XF4B 2CLZA 2A6IA 2DLFL 1QNZL 1MW2A 4XCCH 4R26H 1ZCRA 4G9DA 3NABL 2VAJA 2C3VA 4UANA 4O4YL 1SXSA 1J8SA 3G5VA 4UM9B 4RX4D 4JDEB 4AJYV 5DO2C 1P9MC 2F7QA 2HFGL 3ZZLA 2XLLA 1TR7A 1M7IA 4HEPG 3S3PA 3V52H 1F4XL 4NSKB 4R2GD 1AO7B 1KPVB 3FU7A 4V33A 2WXFA 3P40A 3LKQA 4KK6C 4OAWB 5B3SB 5EIVA 2VSKB 4JLRB 2PO6C 5LWYL 4L29B 3RI5F 3ARDB 4DN3L 3EOAB 3ESVF 4G6KL 3W82A 1EXHA 4AZUA 2IG2H 5LDSA 1VERA 2R4RL 5FS5A 4HUKB 3VO0A 5D4QA 4JFQA 5C7XH 5E2UH 4XP5H 5CR1A 4FXGB 5FO7B 2XPGB 5GRYA 2ODIA 3KWTA 5LGHH 5BRPA 2NXZD 5ID0B 1A7RL 3EGXB 3SN6N 4Z1PA 5DMYA 5DJ6B 3RJDA 1QVOB 2W07A 1LDPL 3BP6A 3RHWF 2XI9A 4NQEB 3SE3C 1YC8A 2DLIA 1B0WA 1MVYA 4MMYB 2Z31C 4PJ8A 2ICWI 1CMOA 4ZO7A 3K2IA 4YSCA 2VR5A 1E5CA 1F97A 3QEGL 5EOCJ 4ADIA 3S8FB 4JVWA 5LN4A 2P5PA 2ZWZA 4GLRI 3HR6A 4H44C 2HRPH 3FRPG 4V1DB 4P2QD 4IJTA 4ONGH 1F41A 5CKAA 2BSBA 1T21B 3P77A 1OWWA 4XVJH 1DL7H 2ZSWA 2AXJA 1R3HB 5PCYA 3T6QC 3BESR 3HNTL 5BW7C 1UD4A 3QO0A 4NKMA 3SGKC 5HYJB 1SLXA 4BFJA 1FYTA 4X7SL 1YEKH 1IO4C 1A1OB 4IKNA 1QA9A 5J13B 3BPNB 3R06B 4OJCA 4NQSB 2Q1EA 4ZUUB 2Q5BA 4LMQI 1YCSA 5LAXA 2EQDA 3NIFE 1ZLVH 4CADA 1AHMA 4YHYB 4XCNB 5C07E 1I4FA 4MDRA 3RY5A 4KKBD 3FRPB 3WCYA 2HKFL 2QFRA 4BKTC 2CCWA 4RLDA 1JXKA 3UBHA 1ORQA 4LT7A 3FOMA 1XF3B 3O4LA 3FFOA 1NCIA 3EO9H 3VMOA 4R5TA 1IEBA 2W95A 2PCPA 1XSJA 4M56A 1LHZA 5CEXB 4RGNB 1MXDA 3LH8A 4X9HA 4XN8A 1WH0A 3OKDB 3QP3A 3ZOAA 4RA3A 3FH7A 4KHXH 1ZLUH 4FFZA 2K4AA 4OZFA 2W94A 4JRYE 2H26A 3SCMB 1ZVNA 2ZP8A 1SF5A 4AQZA 1ADWA 1JHTB 4MJ5A 4G6JL 5F8QC 1XEDA 4AENB 3UJIH 2CBQA 4Y8AA 1FGNL 3RVXD 1RZJH 1WBYB 4KO5A 1WVZA 3QXAB 4XO3A 3GBNH 3F85A 4J5VA 3GUFA 2ARJA 3U36A 3ZZQA 2XN9E 4OLZL 3ARQA 1I3VA 4K71B 3QUYA 4WU7A 4X8JA 1F8TH 1FL6B 3M1CA 3LZPA 3GXUB 1IC4L 1TLKA 1YZZA 3G9AB 3OZ9H 5KBDA 2GUOB 2BSDA 2DDQL 4PJHE 4CGTA 5CU9A 4P9MH 1MJUH 5HHVH 1O75A 2VXUL 3BUDA 2ZKXA 4QKXB 3QDJE 2VITB 1NUDA 2RCSH 1KGUA 2G4GA 3CLWA 3IJEB 4G8IB 3N6YA 4GS7C 1KSRA 1WS8A 4IBUA 1D9KC 3UO8B 5TPWH 1E8WA 4MJJA 1AZCA 2AJ3B 3DVNA 2PYEA 5FR3A 3T0VA 1KN2H 5L4MA 2VZTA 3KJ6H 3LV3A 1KBGH 4JDZA 1S9YB 1DQDL 4LEEA 1ID5I 4X6FA 4CDGC 3S2AA 4ZMNA 3OKLB 3MLXH 4H8QA 1H15A 3HLKA 5I1CH 3BZEA 3QDGA 4QHLA 3ATEA 2I7SA 5JPMB 3S35H 5E2WH 4WUUE 2RQ8A 2R8SH 2DQ6A 2IH1B 3D85B 4J3OH 4LARL 4QHPA 5AZEL 2XVKA 1SXAA 1N59A 1UB5A 1XGZA 1ETZB 3EJZC 3MZTA 5FCSH 1CT8B 1VADB 1HWWA 1F1GA 4HT1H 4WZ9A 4I3GA 3K6NA 2HPOA 4OV6F 1D5BB 3IMUA 3NTCL 4I48A 3MNZA 4Y19A 3ZMRA 2RACA 4ZX4A 4X5XA 3B2XA 2YZ1A 1Y18B 4B50A 2JKSA 2UUDH 1IGTB 4NPYA 3DJZA 3AAZB 2J7LA 1LO3H 5C0JB 5FKAA 2YQGA 2LTQB 1TQUA 1M4KA 2OCCB 3EG9B 4KX8A 4WI4A 5KJ7E 4KUCD 2Z31A 1DVQA 4IOFC 5CCHE 5E9DD 4G3YL 3QUXA 5IQLA 4N86A 2ZAIA 1N18A 3C6LD 4EBQH 1E42A 4OBSA 4BWTA 1HZKA 2OYKA 3WFCH 4OKVB 3P3SA 1NLBL 4O02L 5A2FA 4AJ0A 1QACA 4FE9A 5FO9B 4PRDA 1P4UA 2G3ZA 3B2VL 1Z5YD 4RSYA 2EDOA 3VB9A 3NFNB 3DURB 4M1DH 1TJHH 1QZNA 2WJ7A 5E7FA 1DLFL 4JQIH 5FYLL 1KIRB 1BQHG 2PN5A 2GITB 3WLBB 1GGBL 4J4PD 4OB5L 1KGYE 1OEZW 4C55A 1VGKA 3NIGE 4MMXA 4BD4A 4I48B 2Y6SC 2XQYK 4Y19B 5TK4A 4JKPL 4J6IA 2X0UA 3AXLA 4JB9L 2ICEA 3MRFA 4MA1C 3VNYA 1P7KB 3CVIH 1FFNA 3T3PF 1P69B 3V5HA 1JZFA 1BFSA 1I8UA 2I26N 4Q0XH 1HSBB 1DVYA 3SOBL 3DETC 4PJGB 3LIZH 3BLPX 4S0SD 2FH6A 2IVFC 4K23H 4LCCB 1XD0A 4NO3B 5I17B 4GLRH 3WE6A 1V3JA 2EDFA 2L8AA 1E4JA 3MBWB 3DUHA 5T1DH 2VDNH 4L0YA 1F4XH 2VLMD 3PV7A 5F7YC 3I3DA 3AFLA 4RAVA 1RZKC 2AQQA 3BN3B 3OKLA 1UURA 4L3EE 1ZLSH 3UYRL 1HH9A 3L13A 3UTZA 1T5WB 1EANA 1NEZA 1XH3B 4BCXA 1FYTD 2AJSL 4YNYB 4GRLA 5GGTL 4HWEL 4HS6A 1XCTA 2IALB 2YAQA 3Q5OA 3CG8A 1TVHB 4XP5L 1E9OA 35C8H 4ANWA 4HUXB 4E5XB 4KUCF 5JXEA 1BDYA 1G6RH 2A6JA 2EKSA 3VU1A 4XOAA 5F7BA 4YSSA 3C5SA 5LGHL 2EJ1A 4Q9RH 4DSYA 4ZUUA 1PZ3A 1H0DB 3FCBA 5F6HJ 3UIYA 3LVEA 4ZTPH 2O6EA 3FU9A 5KVEH 1H6FA 1TPXB 2AZUA 3P0YL 4L8SB 1FYTB 5DMKA 3N91A 5TGBB 4XI5C 1BM3H 2LU3A 2XTLA 2BP8A 4AIXA 1QRNB 1E7VA 4W9HC 4B9IA 1AS7A 1E30A 1CBVL 2J72A 4FULA 3U36B 3WN6A 3AU0A 4LLDB 3EZJB 3D30A 1Z5LB 1GKEA 3QHFH 3X1NA 2A9BA 2X6BA 2OJ1A 2G60L 4O2FA 2QMJA 2E7DA 5EU7E 3TONA 4MB5A 5EU6B 3NCCB 4Z5RB 3FCSA 3CFMA 4I4WB 5F6HI 1TQBB 5TFSH 2BVOA 6TAAA 4BSJA 5FB8B 2H3KA 5T1KA 3BIKB 4HLZH 5D1XA 4F8QA 2EKSB 2NY0B 5CP3A 5I15L 3C75A 2H3NA 4HDIA 3OKDA 2VZUA 1A2YA 4LVNC 5I1IL 4M7LH 1XCTB 4MASA 2DYPB 2YAMA 3L4ZA 4PBXA 1KXVA 3SDCC 3VTTA 4JZOA 2GJRA 1SM3L 4IM8A 3X2QB 4EQ2A 3U1SL 3AREB 1LVEA 4KI5D 5FXCH 1IKNA 1A7QH 2JCWA 3N44F 2Y7QA 4EI5A 2UXGA 2O5ZL 1IBDA 3RI5K 4TNFA 4EF3A 1DVFA 3L1EA 2CO4A 2ENJA 3ATFA 4QRSA 4X9YA 3CFJB 4LCIL 1RHFA 1ZE3H 4U1MA 5H8DA 2FGZA 1QTSA 2IXQB 4AQAA 1QTPA 1F90L 4DP9X 3AXLB 4MA3B 3RPKA 1RFDH 3BFOA 3KPOB 3DI3B 1EV2E 1PCXA 1AO7E 4G6JH 4NO5B 2CKBL 4KDTA 5CHNB 5LGKA 4XVUC 3UJIL 4L5FE 4WFGD 3KLLA 3T4AB 4G82A 4G1MB 2P42B 1S7TB 2MPVA 5K69A 1GS8A 1RI8A 2GJ6E 4FXKC 4K4KA 5IB1B 1Q0XH 3AY4C 4KQ4H 4P48A 2OXGB 1IVLA 3W9DB 2R1YB 2F08A 1IC4H 4FLSA 4W9DC 4AG4L 3WNLA 1M05A 2H8PA 5T33H 4XHJD 1QSZA 3LPPA 4G7YH 4WEEA 2CKBA 3V0EA 4BFGA 2HRLA 1XMEB 1EK3A 1CD8A 1GGCL 4Q89A 2XA8L 2ZUSA 1KTBA 3MOAH 5I1JL 1ZT7A 2BVPB 2YD1A 1L9NA 4LSPL 3PWLA 4PLOB 5D93B 3PYCA 2X3CA 4GP5B 5EEZA 3HE7C 1BAWA 3QZWG 3ZY7A 1MXGA 1P7QA 2F53B 1A3RL 3FNKA 4YVNA 3SY6A 1N6QL 1UCTA 3IGFA 4L3CA 4ZS6D 4PYGA 4A7QA 1KZQA 2ZG2A 3QUHA 5GHWL 1YY8B 4WO0A 5JIPA 3JSSA 4QRAA 4Z8FL 3UTSE 3CXHK 2H2SC 1FUNA 2GJ6B 3HS0B 43CAA 2B5IB 4W9FC 5D5MB 1ES0B 3SDDC 5EF1A 3IGKA 3D09A 4FLRA 4LGPB 2WVTA 2X2IA 2A0LD 1I9RL 5IVXF 5KJRH 3BN9D 2NYYD 4WJ5A 3K0YA 4BV1A 3MRLB 2O5XH 4MJ4A 4WW1A 4NRXA 3WFDH 4H1LG 1GGUA 3ALWA 1L9PA 3RY6C 2DL2A 1RAMA 3MI6A 4PJIB 3HAEB 4XNBA 3S37X 3NTCH 2H32B 1EGJA 4Z7OF 3D06A 1HQRB 1S5HA 1SLUA 2F8IA 2YOAA 3NZSA 1CR9H 4X0KA 3F3HA 5A1AA 4HPOH 2G75A 4R7VA 1AKPA 1UD8A 2F74B 2C4XA 4PJ7E 1HJCA 3EYOB 3VFUA 3BCFA 2XOTA 3V0FA 3IJYA 3DKHA 5HHOE 3T1FA 3NMEA 1CGXA 3NZHL 3THMH 5LNDA 2BIOA 1MRCH 2QVIA 1UD6A 1B4TA 4Y7MA 3EBGA 1NC2D 2NT0A 3F6JA 5AOKA 3BEWB 2YUVA 3LZQA 2DM3A 3D0VB 2IV8A 3U7AA 5ANMA 2JK5B 5JW4Q 1MCPL 1PZ5B 2O1AA 1N4XL 3QULB 1RLBA 4LLUA 3SO3C 4Z7VF 3TT3L 2VISB 4QXTA 1RL1A 4WKXA 1D6EA 1GY1A 3DNKA 4KAQH 2Y07L 4W6XB 4LPWA 4YO0A 4IU3B 5D70H 3FKUS 4EZJA 1X44A 3QDGE 2VIRA 4XNQA 3D9AL 2JCCB 2XA3A 3P73A 4L4JA 1TPXC 3EBAA 2E6JA 2GK2A 3T2OA 3RYMA 5DURB 4Z3GA 5KVGE 5EU3B 1IEAB 1B90A 3QWNA 1G7HA 4XBGA 4JQIA 1PNCA 1EEYB 1I31A 5E6RB 4ANKA 1HESA 1KTDA 1BJ8A 3Q6GL 2Z93B 5F3BA 5HHOB 3IFNH 4FG6C 4PJBB 1XMWA 5IHUH 5DD1H 5CJOL 3MRNB 3WJJC 1ZV9A 2W80C 2AANA 1IB5A 1K8IB 3O6LH 5H37A 2MOGA 3T2PA 3FOMB 1RP9A 3D0LA 4LPUA 4GAAA 3RUGE 1I82A 2P9RA 3QFJA 3PHOA 5D1XE 5K59F 4XMVA 4JHWL 3HR5A 5IIEB 1DE4A 1MHCB 3AWEA 4P46B 1QKZH 5DQDL 1E67A 3K6DA 3IE9A 4JFPB 4RFEB 2ZUQB 1TYRA 5J3HC 5KYXB 4H88L 4LCCC 2NSXA 3F7YB 3LRMA 5GGVL 3IWVA 1H3PH 4UM8B 1URZA 4LKCB 4RGMC 4FQCL 5EU7C 4Y1TA 2LVCA 4H8UA 4IOIA 1RULH 1OT2A 4XODA 2NY2D 1RLWA 2KERA 4X80L 1CFNB 3QEHA 5C97A 2W8CA 4PLKC 3B2MA 1T21A 1YYLL 2AQ1A 1Z9PA 3RU8H 2OJZL 1BCIA 1JNNH 4H8PA 2HB0A 4PJ8C 1YNKL 3DVIA 3QHFL 1AR2A 5KVDE 1E65A 2WKGA 5DC9B 2R0KH 3TJEH 5FPIA 2ZAHA 1TDQA 4X9IA 5T1KB 3B1UA 4M1CC 5IR1A 2ZONA 4NQEA 2D0GA 3JV5A 2X0WA 3PWNA 4KUZH 5AW2B 4E9WA 2BNRB 2WXLA 5D7JA 3CVHB 3BUIA 5JHDD 2W9LA 4JRYA 3V4VB 4ZTEA 4P4KD 5FYJE 1LXMA 1VPOH 2AJZB 3GM8A 4FXTA 4L3EA 4NOBA 4XMKH 5I1IH 1V55B 2QV2A 3RA7L 4RMQA 1FBIH 4UTBA 3L2NA 4NUGH 4NAJA 1OV8A 5DK2A 5MHSE 4NB7A 3ZGIA 2QGEA 2Y5TA 3ABZA 3TA3B 4W9CC 2FJGA 1LNUA 4EE2A 4L9LC 2JKNA 1N26A 5CP3H 5AB0A 5KN5A 4Z7OB 1AFVL 3ABKB 1OP3H 3GZOA 1MNUL 4Z7QB 4K7PX 3ZE2B 3AT8A 4NKOA 3WNJA 4DCQA 3S97C 3OG6B 3PWVA 4JE4B 4LMQE 4NZUL 15C8H 1FFPA 1GH7A 3I9IA 4D0DB 4KRPD 4E5XA 4EN3C 4WEBH 2ETWA 3G5VB 4UM9A 1H3XA 4CU6A 3GXPA 4LHQB 4UTBL 1BIIA 3D4ZA 2OK0H 3BFQG 3OXRB 4JPVH 1TTAA 3DHPA 2ZUQC 5I18L 5FM8A 5HTSA 4FQIH 2WN2A 4PJXE 1XGPA 2O72A 5I66A 1F1AA 2GVYA 3DIDA 2WZ0A 3VFWB 2R56L 3HG1B 4NLAA 1XGQA 4ZOBA 3EJTA 2DI8A 5GS0D 5DJXA 3RIKA 4FG2A 3VW3H 1UM5H 5I6OA 4LHJB 4XVSH 3QIUA 2IBGA 2VDOL 3NCEB 4CMMA 4CAGA 3PQYB 4QT5B 3DK2A 5I0DA 4C4KO 3CK0L 1NCJA 1TZGH 4APQC 2JXMA 4XPFL 3ZR6A 1KJ2A 2XA8H 4IMKA 2DB8A 1YNTB 5BUAA 4OV5B 5L0QB 4N6RA 1FZMA 1U2HA 4PRNA 3RDTC 1A4JB 3VGAB 4HETA 1RPKA 4XO9A 2XJKA 3DJ9A 1MCFA 5D1ZB 3TGXA 1E4WH 4EZKA 3D39A 4KKAD 1YN6A 4PUBH 5IQ9A 4NJ9L 4XB7A 3LVTA 5TDOA 1J9QA 2EE3A 4XTRD 1W8OA 2D7NA 2J8OA 3RWCB 4H2AA 3FXIC 2H2PC 2QZQA 3MRBB 3TV8A 1AD0B 4PJXA 4D7PA 1HYSC 4IQHA 2YKKA 4NN5C 1G9NH 4GMTL 1C12A 2WC7A 4QTIH 4WI9A 3NEXA 1CDJA 4NFCA 4G43B 2WNXA 3WUWG 3TEWA 1A1NB 3TEYA 4LLWA 5F6IC 3A6CL 1MHPH 2YJQA 3ESPA 4PJ5B 5E94A 1NEPA 4F7KA 2IPTH 5DHDA 3H42H 5IF0A 1HHKA 2WBJC 1T6WA 4I9XA 4DTGL 3SIKA 1IKNC 1RJCA 4N2EA 1WIUA 2BNQE 4HAKA 4ZG1A 3MRQB 4YDLC 2GJZA 3TPUB 3X3FL 5BUPA 4BDVA 5T3ZE 1U91B 2GIYA 3L3IB 5JW5B 1MWAB 4KMTH 3L6FA 4N9GB 4WI6A 1HXKA 3MJ9A 2HJKB 4XR8C 3ZKXB 1MRDL 1LE5A 2Q7YA 4FG0A 3VRIA 1C5BL 4QHLB 2BSCA 1FNEA 1G7LA 1VSCA 3O2WL 4AWJC 1X5MA 4CKVX 3ROLB 4PS3A 3D05A 3QUMH 2B7DT 1A9EA 1S4IA 4MXWL 3QRBA 2XV3A 4JM2F 4AL8C 4D0BB 1YDPA 4WAFA 1A7PH 3IJ9A 3Q7JA 5T5NG 5JNYA 3TIDB 3T2LA 3FN0H 3HC4H 2XYBA 2JTYA 4KC3B 3MJ9L 5C0IB 4ELMA 2Y07H 4DQOL 3CPLB 3FB6A 3DYPA 5D70L 3SE4A 1QQDB 2XTJD 2XY2A 4BGLA 3DXAA 1MEXL 2XN0A 4HG4J 4Z7NB 4X4YA 3WMPA 4X9GA 3A47A 3LNHA 4MDIB 4D3CL 2O6FA 4R97C 3OJDB 2EH8H 3A22A 2GABA 3MV9E 3QIWD 1NC4D 4OUUA 5LG1A 4RNRB 4Y2DD 1HXYA 1ZD6A 4MMXC 2OXHA 2WXRA 3WJLA 4A55A 3C2AL 2WVVB 3HHMA 4U3SA 4JDVB 4EUPA 1I1AD 3P30H 3GBML 3IFNL 5E1AA 1CF8H 4EDXB 3LKPA 2AKRA 3HG0A 4H26A 3AACA 3NZ8A 4XCEB 5BW7A 3MCLH 4LSUL 4I0PD 3M07A 1FN4A 4GAYB 3MV7A 2AEQL 2B5IC 4GKLA 4L9LA 4UINL 3BO8B 2B3IA 4WFFE 4Z0XB 1BMWA 1JHKL 3MR9B 5AUMB 4M5SA 3D18A 4LSTH 5E2VH 4KKLD 4BE5A 2ZWSA 5T1MB 5L7XH 1AQDB 3WS3A 1OAQL 2WSPA 3BP7B 5IVOA 4ZAKA 3QQ9D 1MAJA 3B1TA 5F3HB 4LEOA 4CU8A 5HYJD 5LGJA 3TV3L 3O6FD 3JV0A 5D7KE 3N40P 3RL2A 2VAAB 4GRLC 3SKUD 5GGVH 5IOPA 5DLLA 2EEFA 2YRZA 4YDKH 2DKSA 5EEWA 4DHLA 3LSOA 2J1KA 2J55A 1U2CA 1YYCA 1WAPA 1I7TA 1T1XA 5D1QA 3OLGA 3WDIA 3WTSA 4HVBA 3MO1A 4RIRA 5TJWK 4XPHL 32C2A 1KJ2B 5AW3B 5CBEA 3CUPB 3PE9A 4ZFZB 1T03H 3HMWL 2R2EB 3LPGA 4DGVH 3O9WB 3OR7A 1QR1A 2JKTM 1KTLB 2FD6H 2RFXB 4OJEH 1X5YA 3ARBC 3QH3A 1DN2A 3EHBD 4J3UA 4YN3A 3X13B 3HMXL 4UNVA 2VKWA 1SJMA 2IMNA 3T0BA 4Z7AA 1WBZB 3SYCA 3GXNA 1S8DB 1BVOA 3QJTB 3ARGC 1FORH 3TZVD 3Q5YA 2A9NL 2CH8A 1JPGB 4NWTH 2IDSA 4Q74A 4ZS7L 5BRQA 4ZXBA 1D5RA 4UDUB 4UILL 3BGMA 1B88A 1UXSB 5SWQA 5IQNA 1DUZB 3SBQA 4BXSV 2PTTB 2WIIB 1ZA3B 4N8PA 3RA7H 2YLHA 3KH4A 4L8DA 1U42A 2ZNWA 3G5ZA 5IJBC 1XCQA 3OKKB 5A7BA 4P9HH 5I76A 3JWOH 1DSYA 1I7ZB 4FFWD 5HGAB 1NMBH 1NMCC 3RL1B 2GK0B 4DUXA 1MH5A 2ZX6A 3FN9A 3ARDC 4OLWH 1U8LA 2GBAA 2OSLA 1MNUH 2MNUA 4L8SC 2A0LC 1MRFL 1LNUB 5SWSB 1DBJL 2Y0SA 2VLRE 1CFSB 2NQCA 4QNPF 3IKCA 4XC3H 2YPLB 3V4UL 1MW1A 3F58L 4WEBL 1RJZA 4UTBH 5KZCB 1RZ8B 4JFFD 4QGTA 2VE6B 2ZUWA 1JPSL 4ZW8A 1UM6L 2R2HB 4FQIL 4K5MA 3BCDA 3VAEA 3G04A 1OO2A 5B7FA 4ODTH 4N87A 4R2GB 2R56H 4L1LA 5D4HA 3KM2A 4O5LL 2D0FA 1MIEL 2IDQA 1J8HD 1RJYB 3L5XH 4MB1A 2YK1L 3K2UL 4CUCA 2JKJA 2XCMC 3CXHJ 4CN1A 2P24B 4FQ1L 3SPVA 5EUKA 2H1LM 4KDVA 2X7LB 2VDLH 3M7FB 2YD2A 1MCHA 3RWIA 3VXMB 3TFKD 1X4XA 2GK0A 4APXA 1OGAE 1CK0H 1QG3A 4E9QA 2V5SA 4XOCA 4ISVB 1TZGL 3NIFB 3TEUA 4L8DB 5DHYA 4UIKH 4J28A 2EYSA 3Q9PA 3RVVD 2F54D 4D8PB 5GGSY 1DZBA 1JZGA 1EUUA 4BZYA 5F88A 1U41A 1JNLL 3N2JA 2BSSA 4JRXE 2K70A 4Z77B 2GFBA 2VDRB 4X7TB 3VG0L 5IEHB 3HRZB 2HCZX 1UOLA 1G9EA 3VI4B 2I25N 5MEPA 1FH5L 1OARH 4CA4A 3RDJA 4XP1L 4OZGA 4LFHG 5FW7A 4ONOA 3LQAC 2Z31D 3RWDA 3B8SA 1FZOB 3N1QC 2X4QA 4H8WH 3FL7A 4I77H 4LLMB 3EJRA 2FIKA 3RKDD 4K8RC 2V8LA 4UIMA 2GTWB 4YQXL 1OTUD 3OL2A 4IEFB 1T66D 1J8HE 2DLFH 2VKXA 4B9CA 3RGVC 3Q2WA 3NJFA 4M61B 4XCCL 3VI3F 1ESOA 2H0EA 4YPJA 1RIUL 5CO1A 1AGBB 4O4YH 1BLNB 4MCYA 2D7PA 5E1IA 2MCMA 3X1EA 2HFGH 2IPKB 5B38G 1XAUA 3INUH 1E9PA 3B9KA 3DHUA 3HI5L 4AYFB 4L8CB 4HJSA 3V52L 2XN9B 4AMXA 5ICYA 5IJKA 4HFUL 1EEYA 3BUYB 3WHXA 4HLEA 4WO4A 3V0WH 3UEZA 4H0LC 1UGKA 1ECYA 2OBGA 4WW2F 2WLNA 4ODWB 4HHAB 4DN3H 3ZK0A 5DYOB 3TIEB 4JZJB 5IJKC 5ALCL 2IG2L 2F1EA 1TVDA 3KNBB 3S0PA 4KMQA 3UBXI 1NEUA 4O9HH 5JMOC 1D6EB 1MRDH 1DQLH 3IDUA 1C5BH 5IB5A 4U1NA 3L7FB 1A7RH 4TL4A 4UQCA 2JK5A 4PTUB 2PW1A 3S96A 3KPRA 1LDPH 5LBGA 5K39A 4TVPE 3F6IA 1BXAA 2OL3B 4YXHH 2HXAA 3WLWD 5HGHB 4WK4B 4IMLB 1N12A 1NBYB 1OL0A 1U3JA 2CDFB 3B3IA 5T1LB 4MSWA 3MJ9H 3DOIA 5ECJE 1XTLA 2CMRL 4ONGL 3F00A 4J3VA 4D3CH 3CN4A 4XVJL 4Y16C 3D39D 5EBLA 1GKOA 1S9VB 1EVTC 3AROA 2KLTA 3FQYA 1JXFA 3BDYH 4ZBJA 2X2JA 4I8DA 4ZW3A 3NIGF 1HXMB 2WB1A 2WMPA 4QD2E 1A8JH 2CD0A 2KZBA 1AKJA 4N8CH 4RGMB 4GKZA 1KUMA 3O4LE 4RAUA 5E8PA 3KMDA 2DQIH 1L5GA 4QXUH 2C9RA 5TE7H 4M62L 4C54A 4J3OD 1MWAA 3L4XA 3K71A 1MLBA 4BCZA 4K7FA 5L7XL 1HHGB 2Y7SA 3WKML 5B39B 2PLTA 3MUJA 1NCDH 2X4TB 1SDAB 1J5OH 3D12B 1AZZC 2CA4A 4ADGA 1X6NA 4ODVH 3NCXA 4HF5L 5BZWA 4PREB 1HHKB 2A99A 1AO7D 3RJQB 4F5CA 1HNGA 3P4MB 5K9JH 5ESQB 5J4MA 1J18A 3VXME 5JMRA 4KHXL 4MCYB 1DN0A 1OB1A 5EZJB 3EBIA 4HKXB 2CK0L 3IKCB 2NW3A 3SPHA 1OLZA 1QBMH 1CC3A 1OPOA 2TRHA 5C09D 3PWPE 1KB5A 4MNQA 5B39G 3HMWH 1FGNH 1CGSL 2VUOA 3KPLA 3N9GL 3QAZB 5IW6A 5ADOL 3VQLA 4HS8H 1C9SA 2G9HB 7FABL 3RBSA 3SKNA 1LEIA 1G1KA 3L16A 1CE6A 3FQTA 4OLZH 1HTYA 4JO2H 2PUQT 1RJLB 5CGYD 3GS4A 3FW6A 5CD5C 5GSRA 4OKDA 3P2TA 5JQHC 3OZ9L 3TP4A 2DDQH 3AB0B 4H0HB 1CE1L 1Z9LA 3BUBA 3KDMB 4PRNB 3SYAA 1BZEA 2UX6A 4BZ2H 2QHLA 5DUJA 5G2NA 5K93A 4R5XA 5F9OL 2IFFL 4AMKH 2AQ2A 4R97B 2JXMB 2RCSL 1XF2B 4U4BA 3QEUB 5GS1B 2YC1A 3MLVL 4HWZB 3FT2A 2AXHA 2H0JA 1WBZA 1W0WA 3UCRA 2HT3D 1MHEA 2FO8A 5EUKB 4XNYH 3RG1C 2FWSA 2V2TA 4QT5A 3FO0H 2CO6B 1AG0A 5E9NA 4YHKL 1RHHA 3JTSA 3C8KA 1FIGL 2HPTA 1RJYA 5CUSL 5GS0H 1A9BA 2YPLE 5IQMA 3KEHA 2XRAH 1J05B 1DBJH 4LPVA 3MXVL 4PJFF 3GTNA 1ZK9A 1J10A 3F58H 3APMA 4OCLC 2WPGA 4UT7L 2N7SA 4MJIE 1XR8B 1NBQA 3NEEA 4FXGC 4EI6A 3ILDA 5BQ7B 1CDUA 5J13C 3WTYA 4CW1A 1XH0A 4XMZA 5KSAA 4HT1L 5EO0A 1KNOB 5E6IB 5C07B 3MV8E 1JVOA 1OGTA 4FYRA 5A6LA 5TH2A 2NX5D 1LEGB 5C07A 3WNPA 1JGEB 2JJTC 1AQDA 4Z7UF 1FNAA 4XBEL 3SYPA 4FKKA 3TA3A 5I1LA 2FIRT 3QBTB 4W6WB 4HW6A 5CM1A 4NZRL 2W65B 2WIIA 3HPJA 3MHZA 2KZKA 5AW9B 2WN3A 3NIDF 4ZXBB 2CG9X 4G3YH 3F83A 4FNSA 4ZW6A 1JNLH 1BQRA 4S1QL 3D4CA 4JRYB 4Y5VA 4EBQL 4XN2A 3K8MA 4PLJD 5K9KA 2BC4A 4QRUA 3VG0H 3FYEB 1I8LC 4RNRA 1VKXB 2PTVA 4RWYL 1XCXA 3DOSA 3O11B 2OTUB 3DIFA 4QRPB 4QO1B 2VABB 2L04A 1TJHL 2EYRB 2EINB 2OMXA 2BVYA 4IOFD 3A3YB 1W0WB 4WWID 1GTNA 3PIQA 1E5YA 5HHMB 3WUWB 3BVTA 2DD8L 4EIBA 2CAKA 1TTCA 5EUOF 5G4OA 3UPRB 1S7UB 3VXQB 1T0MA 3PFQA 4JKPH 1Q1JL 2FNBA 2JQMA 5EU6D 2J8UF 3IFLL 1UQSB 1S9XB 1OAXL 4PJ7B 4CN6A 2WLYA 4Y1AD 5GIRA 4ZXBC 1ZWIB 1A3LH 4Z7NE 1D7BA 5GSRB 1EO8H 4LVEA 4U7KA 3SDYL 3IRPX 1KGJA 4BH7B 4JFDE 2P5WE 1QRND 2DMHA 3KAAA 5CFAA 1FLRL 2YD7A 3QORB 5E99L 2FJUB 1QZ1A 3HE6D 3CSGA 4ZAKB 3T09A 5GRZA 3PUCA 3WS3B 5ETUB 2AV7A 3BMWA 1FE8H 4Y4HC 3GMPA 4J27A 4DGYH 1BAFH 4M3KB 2P52A 4BZ1H 2HVJB 4CVXB 4DGWC 3Q8FA 5T3XE 3QVAA 1JRHH 2OZ4H 1E5BA 4G80B 5BZDB 2FJFA 1SHSA 4PJXF 1CLCA 3C60C 4NPJA 1G6RL 2B2XL 2XQBL 4WI7A 2CBPA 4Q9RL 2TRYA 5LBSA 4ZPVB 1A6ZB 1KBVA 2Z34A 4FHBD 1OKEA 3UPAA 3M6DA 4K0OA 1Q0YL 5DZVA 2PR4L 3C60A 4AEEA 3VU2A 2CBMA 3CN0A 1JV2A 3TIEA 5GZNC 3QG6B 1F4YH 4K7FB 4OCRH 2IIJA 3KHQA 4ORGB 4WHTA 3P73B 3QJQB 1EJOH 1NAKL 4LBEA 1V8HA 4XMTA 1H6TA 1L5GB 3WIFA 3TYGH 2DM7A 3A5VA 4BM7A 3IAQA 3QUZD 3MUHL 5C9JB 1KYUA 1XDTT 2IPKA 3IT8D 5D7LE 3O3DA 2EVFA 3F84A 3VRLE 1S7XA 3IE4A 3TN0A 4PJ7A 3RPIB 4DZ8B 2KT6A 4LLVA 4YEFA 4YBHA 5A40E 3R0NA 4JFEE 4LSSH 3HHRB 1O5DT 1J9SA 4Q56A 3WD5L 1IAOB 1QD0A 4M5ZH 5T3XD 3KBPA 5JIQA 1QSFE 4FFWC 3FTWA 3GSUB 5D2NB 4LCVA 4UT6H 3QCVL 4J2XA 2EC8A 3WO4C 1HL9A 2VABA 2VSMB 4R8WH 2FJHB 2OTUA 3DIFB 4QRPA 4Z7UA 1B3JA 4LIQH 1YYMH 5HDLA 3WKMH 1JWMA 4LF3B 1NCDL 4Y5VB 5E5LA 3RWHB 5B38A 2HN7B 3W2DL 1J5OL 1XF1A 2F6AA 1J1XL 4ZK8A 4UB0H 5CJBA 3K2KA 2HT4C 5ESVA 4A7VA 1ZTMA 3K81A 1OQXA 4HJ0C 3O8XB 5I0VA 3ZHFA 5T3XH 4M00A 3HG3A 3OR6B 4AQ1A 2PR9A 5IB5B 4P2AA 4TN9A 1JYVA 3C6SA 3EADA 2IAMD 3IPFA 1S7WB 3MA7A 4N2KA 4UOW0 5I1AB 3GK8L 2EILB 1VENA 2D2OA 3CN1A 3NABH 3HBZA 4M8RA 1EEQA 1F90H 1H3VA 1FNGA 4CC1A 4MD4B 1RFDL 1IIIA 4GJTB 1OGTB 1TETH 2ITFA 4Q6KA 4I7ZC 3CVHH 3WHXB 3K72B 4KKCD 3KL5A 2J1YA 5C0AA 3IDIB 4M7KH 1IBFA 4LHUA 2CALA 5HDRA 4OI8A 3B9KB 2ZXEB 4F91B 1UOKA 3U0TB 4AV5A 2FT8A 1VESA 4WWKA 2Y7NA 1CXFA 3EGSB 3VFNA 4P2QE 3UX9B 5T33L 3L3KB 5ICXB 3VNZA 3ZKND 5HGBA 1ED3A 1OGAB 1SXCA 3WG7B 3DYOA 4QXVA 4U2YA 4BZ2L 3SBPA 2JCCE 2CGRL 1TQTA 3H9ZA 3ILEA 4Y16B 2V2TB 2H26B 4OZFB 2ENQA 3B43A 2Z7YA 2AV1B 1AI1H 1DFBL 2CO7B 4YJZL 1E4KC 3HRZA 3Q2CA 5HXMA 3DJRA 5GHWH 3QEGH 4EVNB 5GS0L 5I26A 1SJHB 3T4AA 5HD8D 5KSBE 2XRAL 3MYZA 3ZKSD 2HLAB 3FUFA 3EH4B 1DFXA 1IEBB 1ROWA 4ODUB 4Z7OE 3P54A 3O3BA 3GSQB 1U6AL 2FJSA 3FUDA 4UT7H 4EI5B 2K1MA 4HWBA 1DL7L 1JN6A 2OMZA 5DK0B 3DX9B 3RWEB 5GQBA 1F2QA 4A1RA 1RU9H 4K3DH 1NH6A 2C9SA 4EEEA 3WFDL 3F62A 3IXAB 1P7HL 3SPVB 2OFQA 3FT0A 5FYKD 1RP8A 4JFPA 1J5CA 3UYPB 1MCIA 1BF2A 1S78C 5L2KA 1WAEA 4JRYD 5CBEB 4TLTA 3FQUB 1D9KD 2HFEB 1BG9A 4L2LA 1A21A 3ULSA 3APCA 3TO4B 5C0ND 5E51A 1K8IA 1AG6A 4NZRH 4U1GB 5MENB 3MLUL 1EJFA 3HFFA 3VE0B 1IE5A 1RZPA 2ESVE 2JMRA 2F61A 3GS0A 2BNUA 3TCXA 1HK6A 3LNEA 1AS6A 2Z93A 2DBJA 5F1KC 5C0AB 2X4TA 1ZHKB 2EVJA 3SDXB 4H0GA 1KEML 1SQMA 4HUUA 3ECUA 3H9YA 5CKGA 4Z7NF 5MI0B 3KLDA 3V4PL 1OP4A 4U1KA 1JRHI 2X4SA 1I7ZA 2OX5B 3PU7A 1N4XH 5FW6A 3OLDA 2DD8H 3TBSA 4TUJB 1AKJB 4QLWA 2ZUVA 3EFFA 4DEUA 2ISDA 2ATAA 3CLEH 4MXQC 4OCSH 1SJEA 1Q1JH 3IFLH 2E3VA 1L9TA 3H56A 1KY6A 3K5SA 4KPHH 4TLUA 4PJ8D 1OP5H 3U4AA 2DQCH 5DJYA 5HJBA 4JDVA 3BEWA 4N4YB 3WXVH 3BSZH 3GB7A 3NCMA 2J4WH 2UXTA 2V8MA 1L9OA 3FQRB 3VDBA 1IM9D 2WWKT 2EIEA 3MJ7B 4LESA 2G9KA 2EIJB 1KMGA 4YBQC 4FA7B 2VXTL 2VB5A 4WW2C 3PHQA 4IKJA 2OSWA 4N90D 4P5SA 3FTUA 1SJVA 4YUEL 2ITDA 4P2OD 2FAUA 4DO6A 4DGYL 4GRWH 4M6AA 4WW2A 1UASA 3K8LA 5AEAA 2O61A 1KCRH 2K9FB 1QW9A 3EYVB 4DNLA 4QRRD 2ED9A 4PGJA 1UZ8B 1Q9KA 4XMUA 1URIA 2Q76B 4HHWA 1R17A 1DQDH 4U1HB 3WU1A 3HBGA 3O0LA 4QDGA 5CAYB 1LE5B 4G2AA 4KDWA 4GKNA 4TNVK 4BK8A 1KCBA 2BW5A 1RQ5A 2UVEA 3B8YA 1UA6L 2WCPA 5D7EA 3LQZA 1RULL 2Y06L 1JZIA 2PR4H 3QRLA 1Y6MR 1AHWB 1P7KA 5AAWC 1IM3A 3QUYC 1AHWC 2CJUH 5D6CA 3KYKH 4YZFF 3NGBC 3SDCD 1R5IA 4PRPD 3TYGL 3CFBA 3V5DB 4LLUB 1PG7L 3QULA 1M9WA 4MJ6B 5LBSH 2X4OA 2PWEA 2G30A 4ZMOA 3EYSH 2W5PA 5GS0C 2DH2A 4TULL 2AERT 3EH2A 2P43B 1JP5A 3FQXB 2WINA 1NCAH 5A2KH 3S35X 4HBQA 3WY1A 5IREA 1A9VA 4JG1L 3S3CB 1KXTA 1HXYB 2HVKA 2VN7A 3VFSB 5DZOA 4U6VL 1HKFA 1LO3L 2W59A 2B39A 4S10A 4MQXC 3ZIMA 1NANI 1D3CA 5ALBL 4F92B 4M5ZL 3MUUA 2LGNA 4POZD 1FFOB 3QCVH 4XMKL 5T3ZL 4NOFA 3Q3GB 2WYIA 2Y5QA 4HWUA 1UUNA 3H8NA 1MQKL 2HTKD 4APQA 5DI8B 2E76C 3C9NB 4OF7A 3GTTA 3LMJL 3QXWA 2KS0A 4TF4A 1NICA 5JDSA 1E7UA 2EECA 5CN1A 2DMGA 4U4IA 5CGMA 1NGQL 1GGBH 2UWEF 3HAEA 4JDTH 5MEND 3GYRA 5FYLE 2PWDA 5C0CD 3RZCD 1FLTX 4QYOA 2TAAA 3G6JB 4ODXB 2XWBB 5T3XL 2X87A 4PJCB 4JY4A 3L3OC 2VQ1B 5DWPA 4DGUA 4WJ5B 5GRVK 1NSNH 1I8IB 5I8CB 4HJJL 2OMYB 8PAZA 3D34A 2ZCKL 1TT6A 4M7LT 2VDMB 2X2YA 1BX2A 4FDWA 2VRAA 3GXDA 4PJHB 4Q4EA 3W57A 2EDBA 5JPNC 1OP9A 4MB3A 3K46A 4AQEA 1IU1A 3PUUA 5FGCE 2JB6A 2NY7L 3CVHL 3UTQA 4O58H 1KG0B 2VDNL 4FLHA 1IKOP 4JFZL 4M7KL 3SDXF 2N01B 4CRPA 4XC1H 5KYWA 3S37H 4YHML 2FSEB 3VFWA 1T0NB 1DBKH 2Z4QA 3TBBA 5JW4R 1PX3A 4RMWA 1CDCA 4DWHA 4JRXD 4JY5H 1HHJA 3OXRA 4YSUA 3HOGA 4M43L 5CCGE 4YZFE 5DCCA 4IJ3B 4HUNB 3M1BB 2RMNA 5D2LA 4XPFH 3S3JA 2VITA 3Q43A 1W9XA 1XGRA 5AOJA 5C0BA 5CMAA 35C8L 3REVA 4MZ2A 2NYYC 3QZOA 4GO6B 2R29H 3DX7A 5AOZA 4H25A 3AU1B 4JPQA 3TVMA 3CHPA 1VDGA 4APQD 5KVEL 4N2AA 4RZCB 4EI6B 2NTSP 3L3JA 5D1QE 3ULUE 4HZLB 4S1SL 4LL4A 2ZCLH 1DQQB 1TCRB 3ZLQC 5JHDB 2D03L 4GG8B 2NUTA 4PRIB 3ZTNL 2ZSVB 2WWMD 3QQDA 4PJEA 3BGMB 2XN2A 1ADQH 5HHME 2XWJA 5JIKA 1C1EL 3ULVE 3ZE2E 1I8KA 4H7VA 3UJJL 1MCLA 1JGVH 1GC1L 1CD1B 2VDLB 4K3EL 5E8DL 1MHEB 3A6CH 3GKWH 5CLYA 3QH3B 4XN4A 3SE4C 1GS6X 3X13A 4DO4A 4Y2DC 2EDXA 5CINL 1BYNA 1UH2A 2PP7A 3P9LB 2WAHA 4Z3HA 1NFDE 2OMVA 1KGWA 4KFZC 4X0NA 2XTSA 3DOHA 5D2LE 4AW4A 3S4SG 2WKOA 3NPZB 5J6HB 1JGIA 4JO3H 3UTSB 3VXTB 1XB3A 2APSA 2OW6A 1XF3A 2P28B 4FJ6A 5DUML 2XQ0A 1TQVA 2W38A 2CHXA 1CFNA 1BMZA 5J6HA 2M1KA 3D4GA 3PDDA 5IQ7H 3MLUH 4KMTL 1Z9SB 1VACA 3S88H 1KBKA 2NY6C 3MBWA 4HCGA 5JIMA 1OD9A 4KNTA 2AABL 1F2XK 3KBEA 3P4LA 1DEEA 3BH9B 5I0XA 4YLBA 2D3JA 2VYRE 5TF1H 5F9JB 4MXWH 4ZO9A 3Q2NA 1YMMD 5GGUA 2Y2YA 4LCIH 5IFHL 4HJ1A 3L54A 1BF8A 3B7RL 4OLXH 3FN0L 4XAWH 1FL3B 3JUZA 1U8IA 5F44A 3VQMA 1G9HA 1T7VA 2OCJA 3NZ8B 2AEPH 4NUJB 4XCEA 4F8LA 5MEQB 1CXKA 3UYOD 5JHDA 4IRSB 4N2DA 1MEXH 1AIFB 2DIJA 4KKNA 2BP8B 2DQFA 1EQWA 1Q9WB 3ZVVA 3WDJA 2DQCL 4PJAA 3TBYB 2QADD 3ARBD 3GO1H 2FR4A 2YRLA 1Q0XL 4KQ4L 4Y1AB 4LL1A 2D7QA 3FC8A 4PJ8B 4XMWA 2E7MA 3OGCA 5HHXL 3VFTB 4AZ8B 5ID1A 4U1IB 3T0WA 2CWRA 3APFA 2YSSB 1E3FA 4NN6B 5L88H 3EGXA 5HPMA 5AW5B 1BZ8A 1VCBC 2A38A 1BOGA 1XGTA 3ARGA 5C3IA 3CDYA 2OMNA 5EHFA 3MNMA 4UTAA 4LSPH 4YSOA 4MHHI 2OCFD 4G8AC 2VJXA 4LE8A 5JOPE 4DKTA 2DWYA 4NIYE 3S5YA 1BPLB 3QEHB 2W9EH 3F7VA 3S34L 1N6QH 2IC2A 4MX7A 4OFYD 1ACCA 5GRUH 2CHWA 2EO9A 4PY7A 2CE6A 1H3TA 2IV9A 1I7RA 2E9GA 5JPNA 1FFTB 2BHFA 4HZAA 4PJHA 4YDKL 2GSIA 4UBDD 4YC2B 5T1LA 4JDEA 5FLUA 2NQ3A 4DP6X 2Y06H 5JQ6H 3QNYB 3O6FC 3O3EA 1OPGL 4PJCA 5K9QG 1E6JH 3NJKA 4KX7A 1J1PH 5DHVH 3VFGH 4QJ5B 4KXDA 4R4NC 2WLIA 2A6IB 4GXVL 1J0ZA 5KYUB 4UNUA 3W9EA 2Y7OA 3LN4A 3KWUA 4AEHH 1F5WA 3QNZA 3MROB 4NQUA 3IPEA 4K94C 2VLKD 1PKQB 2QVKA 2ZXAA 4HPOL 5D5MF 5FO9A 2H3XC 3BW9A 1CGYA 2VRKA 1XB8A 3GLDA 1R5VA 2ZOLB 4L9DA 4YXKH 3TCLB 1T1ZB 2ROYA 2YAFA 3SQBA 4NWTL 4MBRA 4WNJA 3TBTA 2ALAA 2NR6C 3OKOA 3CDZA 4UUJA 3MRBA 1NCNA 2UWEE 1JD7A 1PS3A 2YRBA 4J4PA 4J8RA 4Y4HB 5I8OH 4G42A 4GKSB 5B1JC 4ZPTB 3NZHH 3THML 5CNHA 3CX2A 2BNQD 3B56A 1R33A 1MRCL 3PRZA 3GSOB 4PGDA 1F13A 5BZXA 9PCYA 3FSZA 4GRWB 1NC2A 3L3DA 4DGIL 4H1LA 4PGDB 4C56D 2M2DA 4J3WA 1MCPH 3LPWA 4N22A 3ARYA 4XPAL 2YQ3A 1P4BH 1OCWL 4GAJH 1ZDQA 2WV3A 2UZPA 1KJ2L 2VDPL 3ILPA 4AGLA 4HX1A 4P3WA 3I02A 4X6BA 3NFSL 4WTQA 1SVBA 5FGRA 2JI2A 4LLYA 4AKPA 3GHEL 1NSNL 2IADA 5BJTB 1NZRA 1FFRA 4K8RD 5AW0B 3FU3A 2ZOLA 3TCLA 2NY3C 1Q9LB 3EYOA 3B2PA 4XT1C 1L6PA 3VFUB 1PEZA 3V6FA 1ZV5A 3T08A 4C56B 2XNAB 1JZ2A 3VSUA 2EIMB 3Q6GH 1Z1WA 3JWDC 3MDJA 5FA4A 1N6VA 4U33A 1NPJA 3WIIL 2CGZA 2F53E 4JNXA 2CM6A 4W68A 2BS9A 4K15A 4AV4A 1TEFA 2ZUTA 3AUWB 4JY5L 1FVCB 3TN0D 3QNYA 1YECH 4LB8A 4JRXA 4NZJA 1DO6A 3VVVA 4CBPA 4LAJH 5IOKA 4M43H 5M7QA 4G9FE 2NNAA 4KK5C 5LUMA 3V10A 1FVDA 5JPNB 3FQNB 3MJ7A 4RVBA 3LB6D 2ENYA 4PY8J 1OCOB 2WLLA 1H9VA 4MX7B 1H3PL 3POCA 5D93C 4IOSD 2OM5A 2EE9A 4Q4IA 1WWAX 3G04B 3MXWL 3V0DA 8FABA 1IM9B 1INEL 5EZPA 1SJXA 4S1SH 4XP1H 4MXQD 5JHLA 1HAUA 3UBXA 2YKLH 2JNZA 4H8WL 1AQHA 1NFKA 4MNQD 3HS9A 1HWGB 1JNNL 4QPEA 1BVKA 2OX5A 2BW4A 3CFCL 5CEZL 5C8JB 2QT6A 1B2WL 5AAPA 2HMIC 2RH0A 3FAWA 2EDTA 2NPLX 3WKQA 4TSCL 3LRGA 5DTFB 1GOFA 4JPIB 2KLRA 5GGTA 2AJVL 5IG7A 2XFGB 2PETA 1FAIL 1HHHA 1YEIH 2CXKA 1YRKA 1J88A 2MOQA 4P46D 2APFA 1S9KC 5INDA 3PJNA 2IBZY 5FO7A 2IEPA 5CEXA 5D96C 3PAZA 4ZNCD 2FBOJ 4NQXA 2A3TA 1JSYA 3MGTA 5MEQA 3P11H 4YFLF 5MENA 4OW6A 4PG2A 3L48A 5IVXE 3V0WL 1I3UA 3CZLA 1XL6A 4B97A 4YDMA 2Y72A 1BQUA 3OMNB 2CLRB 4M3JA 4WWKD 3BEVA 5FX3A 1WWCA 5ALCH 1S8DA 4KOCA 2P5ED 3MKGA 3SE8L 3UZEC 4GG6A 2EADA 5CF3A 2EXSA 1YO4A 1MAKA 1U8OB 3BPLB 3FUNA 4JG9A 1U3HB 3MJ8A 1QEWA 1RZKL 4HD5A 3QFJB 4WSGA 3ETTA 1U8KA 5DRZA 3VD4A 4UCFA 2Y6SD 1WZLA 3AVEA 5FA4B 1IGCL 5E00B 4NQXB 2AEPL 4IK6A 4NQCE 2X09A 1KCSL 2QVFB 1WFMA 4U05A 5E9DB 3VXSE 4HIXH 4CILA 1WFUA 1LE9B 1UM5L 4HCRA 5EU3A 1OAYH 5J56B 3ZKMC 2PYEE 5JOFB 3WXWH 4DPAX 2QVMA 1M1XA 1OTTC 2UYLB 5IK3A 2R2CA 4MQXD 1C8PA 1ZANL 3BP7A 3A6BL 5JW4N 4WU5A 5DFAA 2WANA 5IBLD 4AJVA 3TA3D 3V7AG 2XHNA 3US1A 3KL0A 5FW8A 4QOKE 4IKLA 4JFHE 4KI1A 3TVMC 5B3NA 3KL3A 4QKTA 3VXRE 3HC0B 1H5BB 3C6EA 3L3DB 3LKPB 4DIXA 4L4VA 3D0VA 4N68A 1L0PA 3IS0X 4AK2A 3IF1A 2OMBA 4G72B 4TTDC 1YEFH 3BKCH 4MQ7B 2W9EL 4QHMB 3QC6X 3LHAA 2JELH 4OM1H 3IDXL 4FQLH 2CXGA 3HUJF 2K78A 4HPHA 2W0FB 1KYOJ 2FB4L 4MDIA 4HF5H 4DESA 3IJYB 5TDNA 4MLSA 1JZHA 1XGRB 4U6YB 2LU5A 3MJWA 5AAMA 5FUOL 3BW9B 2W92A 3BZFB 5JQ6L 2A74C 5C70A 5HBBA 2V5MA 1KTJA 4ODHL 3H9SE 3L5IA 3DX4A 1ND0B 4DK5A 4BUHA 2O5YL 1BG1A 4EXPX 1HQRA 3H2QA 5EO9A 4QCIB 5I6LA 4LPXA 4KZEL 3IFPA 4M6MH 2YA1A 1FHNA 3MNZB 2VXVH 1CGSH 1TZHB 3N9GH 4JFXB 2PKDA 1WF5A 5DJ0A 5LB1A 3ZYZA 2FWOB 3RP1A 4NRXB 2FX9H 1G7QB 4LPCA 5A3IC 3AM8A 3X3GL 5AG9A 4KGLA 5G4NA 1ES0A 5GRXG 3RY6A 2F54B 2IH1A 5KSBA 3M86A 4F7EA 2C9VA 3V5HB 2BVEA 1DJZA 3CH1A 2D4DA 3UG4A 2J5LC 3OPZH 4OD1L 3UC2A 3S3BB 5LAPA 3FONB 3W1ZA 4QLRA 5C7XL 2BOBB 1XB6A 3JVGA 5IJCC 1P4IH 1TTUA 5DJ0B 3IU4H 2ZYSA 5I8OL 4PJFE 4R0LC 4ZMVA 1MUJB 3EDFA 1KCUH 5L9DL 4MJ2A 3MNWB 3KPMA 4HUVB 4LNRA 2TSBA 3CTTA 4H4NA 1OOWA 2V5TA 1HFUA 3U9UA 1VLXA 3EJUA 3T6ZA 3X14B 1I3RB 4MJIA 3CZNA 3HC4L 5CUSH 4L5FH 5DXWA 1C12B 5IFJA 3IB4A 1E28A 3STBA 5E95B 3ARRA 1LJMA 3QT2A 2NCEA 1GY2A 5H2BA 5D1XC 1U8NA 1RH8A 4ALAH 4XVUD 5DQ9B 2EE6A 3HG5A 4NC1C 2FYYA 1AIFA 3QS2A 4H1LH 4OCWH 5EOTA 4PWFA 2ARJB 2EIDA 1BZDA 2OZ4A 3U30C 3A67L 4X5XB 3FZUC 3WKNA 5FYJL 2WLIB 4P0DA 4LCWB 4KK8C 1DDHA 5D6CB 4AENA 3PQYD 1R0AH 2DQEL 5FM4A 1IGIL 1P2CB 1AACA 3UZEA 4DP0X 4XBEH 3DDFA 4WHDA 4F37K 3T3PE 1UOWA 2XWRA 1KPRA 2K6YA 1R3LB 5LN8A 1UATA 1MZZA 4ZUVB 3FTGA 3EO0A 4OZFH 5ITFB 1MY5A 1YMMA 1OAQH 4NAMA 3C12A 4Y4HD 3BUPA 1DVFC 1OSZA 4TVPD 5FA3A 4JFOA 4BSVA 1KGXA 3FMGL 3LZFL 3BZEB 1BQHB 1NANH 3LRHA 4OGYH 4PM1A 1KT2B 3O6FA 2J6EA 3I50L 2VDKL 3GSNB 3NCFB 1QSEE 4XNUL 3VD0A 1RSFA 3VXUD 3QDHA 1YJDC 3B5TA 4KROC 4MXVE 1PTZA 3RNKB 4DF9A 2WBJD 1ND0A 2FQEA 3IPBA 3MXWH 3GJFB 4KWUA 1UT1A 1JNHB 3ZT7A 3QPKA 1AYRA 1L9QA 3AG1B 2YKLL 3DMMD 4HDIB 4BH8A 3H1ZA 1QHPA 5KSVB 1FF5A 3CFCH 2ADIB 2YEZA 1RZJL 4F8PA 3IMBA 4GBXC 2BOCB 2YUXA 3HEIB 1S2EA 1A1OA 4TSCH 3HMXH 3A0OA 1A3LL 5AVYB 2BC4B 1EO8L 3BWUC 4QRUB 1IBGH 2AQSA 4RQQA 3BJ91 4U1LA 5DJYB 3D1MC 3QJZA 5IMMB 2AJYH 4NXKA 4JO5A 2MTAA 3RGVA 3B7SA 4UDTA 3L5WA 2NUTB 1QFOA 3N0AA 1SYVA 2NY1D 4PPTA 3UTTD 2VQTA 2IWKA 4A38A 4BIKA 4XCYB 1D5MA 1FVEB 2D3NA 4YHOL 1XBRA 1M2VA 1U92A 1MCOH 3GDCA 4M7JH 3P3YA 1JZ7A 1T0OA 3AZUA 5IV2A 4F15B 1ZHNB 5TPWL 3CSPA 1X5LA 2FEJA 1P84J 1ACYL 3K80A 1WAAE 1MIMH 3C5SB 2NNXA 3CDGB 3C5JA 3MRMB 1Q9OA 3DWTA 4FRWA 3SE8H 1J1OH 7PAZA 5KSVA 4OLWL 4OZIE 1LE9A 5DS8B 3DX0A 3KYMB 1Z9SA 5DF0A 1EBPA 2LR4A 1SMAA 4FXGA 1JNHA 4XC3L 2GSGA 3UAJC 4HJ0D 1IUZA 4QRQA 5C2UB 3VWJA 1L0YA 5DUBA 3SHSA 4PG9A 3C60D 5L6YH 5KANG 4YDJA 1UM6H 3GM0A 1QHQA 3E1F1 3BUTA 1ZLWK 4NC1E 3UAJA 3TEZA 2BZ7A 4ODTL 4S2SB 5L2KB 1R3IL 3C8KB 3QXDA 1MIEH 1G1OA 1OD7A 3PCYA 3NSJA 4HOXA 1SHXA 1QFUH 3NT0A 4NI6A 2CDGA 4FZ8L 3K2UH 3U82B 4B9FA 2NT1A 3IBOA 3WXWL 4X6CF 3F7LA 1UA7A 1CGTA 4G9DB 5AVZB 3CCHA 3HTLX 4X4XA 1PNDA 2KL6A 1NDTA 2N4IA 3QB7C 4ODSL 1PZCA 2WLKA 3AC0A 1KFAH 2XDHA 4I0PB 4PJEB 2OP4L 2ZZUT 1MCEA 4N1CA 4OCNC 2F8VA 5I28A 1GZHC 2VNCA 4OZIA 2KQMA 2LU4A 1WFOA 3C9NA 4HZLA 4ETYA 3NFNA 4RDQG 3RNQB 1HOCB 4G8GB 3F5WA 3FQTB 1YYML 4MD5A 1BBDL 4HMEA 4JANA 5E8EA 2DWXA 4TQIA 4ZRGA 1JK8B 1KBWA 2MPAL 4GT7A 4OM1L 3QPQC 3OQ3B 3EYUH 3TBVA 2NXYD 4JQIL 1J1XH 2BS71 4PWEA 4UZGA 5LGYA 4JRWA 3I02B 4X6BB 3N41F 4C47A 1COBA 3OLIA 4DERA 2JJVA 4BBWA 2X89A 4KRMB 5FOJA 4EI5D 3CIAA 3BPOB 5AQ0A 3T3PB 1BYOA 1NGZB 2HTKC 4YQXH 5MHSD 4NPYB 1PL3A 4G71B 3EGSA 3RX7A 4ODHH 2L7UA 3DGCR 2GQHA 1U8MA 4L8BB 4MJ6A 4JREC 1XQ4A 1YPZE 1WWBX 3B2UD 2MKLC 4KZEH 4M6ML 1HILA 2HFFA 2VXVL 3LKQB 3P0VL 4MHHG 3U6XS 5TF0A 3VFPB 1FNHA 4AQEB 2IH9A 3HG1D 3ZHKA 2QV4A 1SBBA 1CT8A 3EYQC 3LY6A 5DJ8B 5KSBB 3VXPA 1BPVA 2ZJSL 3QQ3A 1S6NA 3KLAA 3LQZB 3ZQXA 4LDCA 4A2EA 3QDME 4X7EC 4AEIH 4A2MA 1JK9B 5LXGH 2WIMA 2Q76A 3OPZL 4OD1H 2B0SH 4PJDE 2VERN 1W0VA 5FCUL 5GJSL 1RUQH 2XWTB 3IU4L 2Q6WA 3GQFA 3GLAA 1WZMA 2H47C 3WNNA 5F96L 3PNWB 3MCKB 5L9DH 4OLUL 1NMAL 3PAYA 4HJUA 4G8GE 4XGZA 2AMGA 3ES6A 3PWJB 1T6VN 1FC2D 1XGYL 3K91A 4HH8A 5KBMA 3UC0L 1P6WA 3ZDXE 4DP5X 3JZ7A 1MN4A 2ZG3A 3HKZA 5D2NA 5ECGA 1OE2A 3RUGA 1T5XB 1UUSA 3F01A 3HUJB 4NYLA 2WUCH 5LJYH 5DRNB 3GB7B 3D2UD 1MHHB 1HCYA 3GZQA 1JYXA 4YSTA 1ZGLA 2OQJA 3KPRB 2LW3A 1EHLL 1NOFA 1RU9L 4K3DL 1A6AA 2X4OB 3BDYL 4GW1A 2I9TB 3WJMA 4OH2A 5DD6A 3MMEB 1FAKT 4FXKB 1ZRUA 2X28A 2E6PA 2MNWA 3A67H 4H40A 3UACA 3ZDYE 4E9SA 4ZNEE 3STLB 3TH2T 4NPKA 1MOEA 4IHBA 4F9PC 2QPEB 4K9EC 3KWVA 1OXYA 4N8CL 5CJXC 1R0AL 4IGBB 1JZDC 3D2UB 3QDJA 4N1HB 3OGCB 4JUTA 4QXUL 4F7PB 5FKPA 4B96A 2V7NA 5JOFA 3ZTJH 5B21A 1V3KA 1XSIA 1SM3H 5EN2A 4I5BA 2L7JA 3U1SH 5IB1A 4EUPG 2QSCH 1UWFA 2YBRA 3RNQA 3EUDA 1TQWA 3TO2A 2C1OB 3FMGH 1E9PB 3LZFH 4JFUA 2VLJD 4HUCA 1S9WB 3MRDB 5GRWA 1JPST 4OGYL 1GVIA 3KE0A 5AVRB 1LWJA 3UJTL 4AC4A 2VDKH 1DJIA 1KEMH 2E7LC 1IJ9A 1PY4A 1KWKA 3V2AR 2AMUA 2XV0A 2EVHA 3UCQA 2FQFA 2UZXA 3QFDA 5DVMA 1KPUA 5KS9A 3QR0A 4R96B 5DU7A 4NQDB 2CK0H 4HIEB 2E86A 1MFEH 1IVTA 3AMKA 3QI9B 4FNTA 4Y5YA 4YSEA 1QBML 1WTGT 2CKBH 5K1NA 1OTTD 2D73A 4GG6B 3AS2A 2FZ3A 5KS9F 3BQUB 1OF2B 4HS8L 4O2EA 4BH7A 7FABH 4GXUN 4ZQKB 4Y5YC 3PG2A 1TU2A 5D1ZD 5IBUG 4GP8B 1W72A 3V0HA 3PGDA 3QIWB 5CXPA 3K6IA 3KYNB 4AG4H 1A4BA 4NFDA 2YXWA 3PABB 2W91A 3CQQA 1SGKA 1AGFB 2VXTH 2XG4A 3WIHH 1JS4A 4ERSH 4OJYA 1PZDA 1NGWB 3WGUB 2VSCA 3LKRA 5D1XB 4NQCA 5I9QC 3O81A 3CVBA 2ENPA 4GW4A 5AKRA 1N2RA 2P24A 4Z3TA 3ISRA 4NRZB 4YBQD 3WJJA 4BFKA 3FCSB 2J2ZA 3FO0L 3V9FA 1BVKB 2UXFA 3D6GA 1J1OL 1U3ZA 3OF6D 4HJGA 5HHQA 1FIGH 2DI7A 1R3KA 3H4HA 1JJUA 1AH1A 2WQ8A 1HQ4A 3T6WA 1J0KA 3FS9A 4QRBA 2F58H 5IT2L 1U8IB 1H19A 3ARDA 4HCIA 4GUPA 4EDWH 4TPRH 1DLHA 1TFPA 1W91A 3VYNA 2YPLA 1I9RH 4AW7A 1IAKB 1YUHA 1M42A 5GGUB 5KJRL 4L8SA 2JQAA 4P5RA 4ZZKA 3U6RA 4PJIF 4ABVA 3K6OA 3HLAA 4CVWA 5A3ID 3BWAB 3UTPD 5HSFA 4NNXA 5JOEA 1VGEH 4UBDC 4XCFL 4ZUWA 5A43C 4AOFA 1X3DA 4M02A 2VXQH 2JKWA 5FF6B 2FUQA 3QUYD 1NCAL 5E6SB 3ECVA 4WUUB 2FYVA 5C86A 5B22A 1ACZA 1CIDA 1BM7A 3UTSA 4NHUB 3VXTA 4KZDL 1THCA 2JE8A 4Z7VA 2FL5B 2RALA 4WNQA 2CBOA 4TSBL 3MLZL 2R2BB 4YAQB 3W5NA 4IDLA 5BS0B 4M8QB 2X1QA 4LF3A 4QNPE 1GXEA 4PHXA 1S3RA 4BK4A 1UWYA 3NRQA 4PD4K 1BBDH 3L3GB 1UH4A 43C9B 3A4DA 3KJ4B 5INCA 2YC1B 3P69A 1S7QA 3MRKA 4FEMA 3V0JA 1OGAA 2JCCF 4XBPB 3NIDB 3HI1B 4R7NB 4HH9A 1UJ3A 4PRIA 3U4KA 1G9MH 1FJ1B 2P8PB 3KS0J 5I1DA 2XN1A 4KXBA 3WY4A 3W5MA 4IBLT 5HYSB 1HH6B 3CHSA 4LP8A 4UT9H 4JFWA 4LHUB 3SDYH 4FG4A 2G9HA 1DEDA 1H3GA 2NY7H 1PIGA 2FEDD 3HZVA 2N0KA 1TNMA 2ZXDA 8CGTA 2GJJA 5T3ZD 1FLRH 2BIMA 3QUXB 5CIPA 1UTDA 1EWHA 4OZGE 4XC1L 3LXBA 3WTWA 5CJOH 4X4MA 3WMQA 3K8KA 2HRHA 3MRRB 4UMSA 5LBVA 3ULVC 5G55A 2HVKB 2JI1A 4OCYL 1OHQA 2P45B 4NQDE 4PTTA 1VAHA 5CZKA 1F11A 4ETQB 4BK5C 1TZIB 5LXGL 3SSGA 1BD2D 3Q05A 1MW3A 3O8XA 4UQEA 5EEXA 3RTQD 4QHKI 1QKZL 1MVFA 2F7RA 5KYUA 5IB2A 2B9AA 2WP3T 4HLJA 1I3GH 3IDJB 4W70A 3QEQE 1KG0A 5DMIH 1UWXH 4ZUTB 5E0QA 2XQBH 4CVXA 3OX8B 5F96H 1H8LA 1U8QB 3KGRA 2VRQA 4RETB 3VI3E 4U3XA 3SKMA 1AHWA 4M7ZC 5KG9B 3CD4A 4JMNA 2X6CA 2CJTA 4U31A 3P3UA 1WLHA 1KTCA 4JM4L 3I6LD 3BWUF 2E47A 3UC0H 5CZRA 2BHYA 1IAOA 3FN3A 1G7QA 3ZE1F 3KGTA 1LWRA 3T77B 1XV8A 1YNKH 1XZ0B 2WBKA 3BZ5A 4IGBD 2OL3L 4LCYB 2R0KL 4LOVA 1GC1H 1PY9A 2WWMC 2UV3A 4K3EH 1P7BA 2NY1C 3DROB 4XOEA 5E8DH 4WF7A 2C7UA 2CJ3A 4KUZL 1AZRA 4W9GC 5EBLB 2X89D 2R51A 4MQSB 1F3RB 3VRIB 2ITEA 1N10A 1DQJA 2JJUA 3B34A 3LKNB 1ORSB 4OGXL 1WC7B 4DOHE 3WD5H 1NPUA 4BA0A 1D5IH 1I8MA 5E1QA 4CBZA 5B7EA 4BDVB 4RCAA 1CXEA 1U8HA 3C60B 5DGRA 5F21B 1FBIL 1JWUA 4NUGL 4LIQL 4S1DD 4F80A 1KTKE 3NGBB 3FQXA 2E9JA 2ZG1A 3P3TA 5IW1B 3ELAT 3W2DH 5DJAB 2EUZA 3ECQA 5F1NB 1XGUA 1HNFA 1OCCB 3QXAA 4Z7UE 5I5IA 2WXQA 3MRCB 3UJTH 4F57H 4PJDB 4JHZA 1F3DH 1BGXL 1YLBB 1KYOK 4JE0A 1LD9A 4Q8BA 3L7EA 3BT0A 4ZFQA 1CYWA 2K8MA 3IJ7A 3SE9H 5I1GH 1GL4B 3HN5A 4KKRA 3AS0A 4OLXL 3HIZA 5I18H 5IESL 2WBJB 3K2MC 4HBCL 2VWEE 3KXFB 4TQ8A 2GTZB 2CO3A 2H1XA 2VXSH 1T3FB 3E6HB 2AGJH 5E00A 2WHVA 1INQB 1GSKA 4V11A 2P8MB 3DSNA 3GO1L 1UJ3B 4WW2B 5KYNA 1QWHA 2C5DC 4XNAA 3MNVA 3LRLA 1PD0A 1MFAL 5EUOE 1PLCA 5I8EA 5A2AA 1ZXQA 2DWDA 2OMTB 4UNIA 4F1ZA 1A9BB 4XCNA 5EU4B 1U8JB 1YNTF 4LK4A 1LO0L 1TTFA 1QFPA 4FQQA 2APTA 4N5UA 4XNMB 3GEWB 2CGRH 5HPOA 5EBMB 4J3SA 5IB3B 4WWNA 4NQSA 5FYKL 1LILA 3TYFA 4HXBL 5F89A 3H55A 2JTDA 2DYSB 3QIUB 5L0QC 1LL1A 3RWEA 4M8QA 4G5ZH 1AI1L 4V1DD 4FG6D 5AAMC 4P4RA 2CHZA 4Z3EA 4NJ9H 3FHQA 4OTXH 3O3BB 1SN0A 3GMOA 5DS1A 3VX1A 4P23B 4WO4D 3GC3A 4D8PA 1DQQA 5TQ2H 1YC7A 4DT2A 5IUCA 3D3VA 3IJSB 2WXMA 1RJLA 5HHPA 4DZBB 1U6AH 2WQVA 3LDBC 4EDWL 3DX7B 4OI9A 2DIEA 3K4ZA 4XZUA 3MA9H 4D0DA 4YK4B 2Z92B 2RHEA 4U6HA 3N44B 1MHPL 3VA6A 4HYTB 2J3SA 3NYKA 4GXVH 5AD0A 3B4NA 4AGOA 3SDDA 3AITA 1AXIB 3KXFE 3FU5A 3ARTA 5DEFB 2GY5A 2CHDA 3H54A 1TJIL 1Z3GH 2C1PB 1VGEL 3DBSA 1M2OA 1MNNA 4FQJH 2AVGA 1HX0A 3ARED 2XACC 1QI5A 5C92A 3ZDZE 4GEJA 1CL7L 4XP4H 3HG4A 3ZXAC 2QZ5A 3D85D 2UXVA 3NCJL 3PHSA 3EIFA 4LEBA 4QRTB 2VE6A 4YXKL 3WTUA 3KW8A 1HHIA 3X3FH 2A6KB 3KPPA 3ZYOA 3EFDH 2A1WH 3PDGA 4J12A 2D7OA 2XBZA 4PREA 4JLRA 5F1IB 2HFEA 2BY0A 2O6DA 1IBZA 5BZWB 5CILL 3VTAA 4TNWF 2WLLB 5LKNA 5K9QI 1J0IA 1N3NB 1FO0B 1RK1A 3D39E 4TSBH 3CVHA 3K72A 4JW3A 4NRZA 1AD9B 1EIBA 2LV4A 2OMYA 4KVCL 1QX1A 1MWOA 3ROOA 3LKRB 4AQOA 1ZOXA 1HL4A 1O6VA 5J89A 1AQKL 1A7PL 1EAOA 3H2PA 2XWBA 3AXHA 5L8KB 1BAGA 4PRBB 4LQFH 4XPAH 1P4BL 3CC1A 5ANHA 1MFVA 2MHAB 2ZOKA 3KGSA 4GAJL 4EOWH 4BQ6A 3O4OB 1I8LA 5JDSB 5SWQB 3QUZB 2R1WB 2DYPD 2YPVL 3ZDXB 1MCJA 4ONFH 4GSRA 5CZVL 5BRZE 5ILTL 3X11B 2KBGA 2WJ5A 2AQ3A 4WFEE 4NQEE 3FH5A 1G7IB 4DP2X 5FDWA 2AV1A 4HEPA 3OD3A 4FL4C 1QYGH 3L3OA 4WIQA 2J4WL 4NN6C 2VR7A 1MVUB 4RBPK 5T5FA 3FJTA 3DUUA 1KXVC 3P30L 4P2CG 1JDDA 1EEZB 1CF8L 4HUWA 1TKWB 2FO1A 1MCWM 1WCBB 5CGYC 3MCLL 1KXTB 1SXBA 2X40A 3KPSE 5DJCA 5E23A 2E9WA 5ICXA 3ZE2F 3QAQA 1ZT1A 3MV9B 4FCAA 3PP3K 3T8XB 3VXMD 1ODUA 2XZAH 1MI5E 2YFOA 2NUPA 4W4NA 1S9WA 3MRDA 3FFCE 4W4OA 4G6AD 3I84A 2ERJB 4FZEH 3IVKA 2GTZA 3IDIA 2X4NA 3KNBA 3LD8C 4UUJB 4LEOB 5HGGS 2IF7A 2J57A 2PTUA 4KTYA 1AOZA 3B9AA 4I9WE 4MFHA 3ZHNA 2NY6B 4MAUL 1S78D 5GSVB 3K71B 2D3LA 3OHMB 1D5ZB 5BRZA 1F6AB 4HFWA 2BM3A 3D18B 3OM3B 1LWHA 5DDHA 5IHZA 5SX5H 1GCYA 4HU8A 1S7WA 1G6RB 1X7QB 2AITA 5DVNA 2LLNA 3QNZB 5C0NC 3AY4A 3FAXA 1IV8A 4F93B 3C09C 1LQSR 3RZCA 1T03L 1XGUB 2FJFB 4DGVL 1PF3A 5EFIB 2B8OT 3B9KD 4OD3L 4OFYA 1A6PA 4FADA 1MFMA 1R9FA 2NY6D 4TULH 4DN4H 2AJVH 3S7GA 2V9UA 4FOMA 4JG1H 3PHQB 2XG5A 5E5MA 5KWYC 1TJXA 4FTDA 3V9EA 3RWDB 4NCDA 1HE8A 1WO2A 2UY7B 5HVGB 1NEZG 1CDIA 4ELMB 1NIBA 3SBWA 3UMTA 3VM5A 5C08B 5EA0H 4UQ3A 1DUYA 4AUYA 5F97E 3NZUA 1UVQB 2F8XC 4P9HL 2DIBA 3H9HB 1W72L 5F88B 5DZ9A 5BO0D 3B7UX 1F6FB 4PI2A 5I75C 4OJFL 3NIDE 1O7DC 1EXGA 4TTDD 2HX7A 3ROLA 5EC1A 2UZIL 4GKOA 1N8ZB 3QDMD 1EXUA 1M7DB 2BY1A 2HJKA 5CSZB 3A24A 4J2QA 3V4UH 3MV8D 3N1PC 4KTEL 4AYEC 3KLAB 4UTAL 5KSAC 2FEEI 1RZKH 5IHLB 2LOEA 4Y1AA 2IGFH 2BHUA 1II4E 1QLRB 5AW1B 3VFPA 1IGCH 3BAKA 1CVRA 4XP9L 5F7DB 1N3NA 2JJTA 2R1XA 1WBXA 1KCSH 4B0MM 3VWJC 1GZQB 3UTSD 4O5LH 1NJ9A 4ZXBD 2VLKB 2VXSL 1ZDSA 4O58L 2YD3A 1CXLA 4JFZH 4QRTA 5CZXC 3QO1A 4UZSA 4BK5A 2HG5A 4QHKJ 4PJ5A 1BQKA 1CWVA 2Q10A 5GZOD 1DBKL 2HVJA 1ZANH 4DK3A 2VDLL 2E8YA 3I74A 3GMRB 1ICTA 2ENSA 5C6WH 5C0GA 4L3AA 5C9KA 5EZOL 1ET7A 1LEGA 2AZAA 5K1VA 4YZWA 3WN5B 1SEBB 3N55A 4UIKL 2X4QB 3DV6A 4PJXB 3ZDXF 5EOCH 2ATPB 2BXZA 3UIZA 2ADJB 5FYKH 4JANB 5E8EB 3ZSTA 2A2QT 2X4RA 5AWNH 2R29L 1Q94A 1XR8A 4L4TB 3HCVB 5EU6E 1J9RA 3AG3B 3QZPA 3UZQA 3IDXH 2EDJA 1IQWL 1SYSA 4Y1AE 1BEXA 4H13C 5DZNA 1RZIB 4YHLL 3HI1A 3AJ7A 3ZGHA 1T22B 3ZTNH 5DHYB 5DRXA 1PD1A 4U1MB 3DI2B 1ADQL 3PWUA 4ZAKD 3TWCL 1E4KA 3PV6A 4LU5H 4X9BA 2WXOA 5CBAB 3ARPA 4DAGL 4NO0A 1G87A 3T4AC 5FUZH 3MA9L 4UQIM 3OKNA 3PV6B 1LP9F 3QXDB 1I8AA 3IN2A 3GKWL 4PG2C 4F8TA 3TF4A 4N6QA 3OB8A 3VH8G 4R3SB 5CINH 4PWHA 1CUOA 1IGFH 5CD3B 1OOAA 3MO1B 4OFVA 1RZQA 4WEMB 2F5BL 3QQDB 4PWJA 3VRLF 3GJEB 3N04A 3JYBA 4O02A 4JZOB 3X3GH 3LZOA 1N67A 4JO3L 2MWCA 5SWZB 1JZEA 1RZ8A 2BCMA 3HCVA 1BF5A 2E75C 5JTWA 4S1RL 1J87A 4CKQA 2A1WL 1QFWI 5IQ7L 1DJHA 4HD9A 2BWQA 4F8OA 4O9HL 3S88L 1J5IA 5IVXA 2BWDA 4G9FB 4OZGF 5IEKA 2M26A 5GZNA 1UD2A 3CXDL 3VH8B 5D2LB 1BYPA 4KXZH 2NR6A 1IAKA 1GRWA 1F18A 1ASQA 2GEEA 4X4ME 1MJ7L 3T04D 1ZA6B 3DV4A 2Y1VA 5IFHH 3G08B 4YPGA 1RZ7L 2ZX5A 4ABWA 4XAWL 2DM4A 2BSTA 2YA2A 4TNGA 4L5FL 1I85A 2BERA 1GAFH 4NZDA 4Z7WA 3OG4B 1ZVHA 4AMWA 2YGQA 4QOKD 3HW7A 4ONFL 5D7JC 5F7DA 1NM9A 5CZVH 3MBXL 4MJHA 3DO4A 4WRLA 2XC8A 2P26A 3QYNA 1I8MB 1ROCA 4OCWL 5GRJH 3X1BA 4I2XA 1DJGA 3GSUA 4QI3A 3WAKA 3HZ3A 5JHLL 1E9OB 1O0VA 3MOQA 4JG0L 2PO6D 1C16A 3MTRA 3AMLA 1EVUA 5L88L 4LSVH 4PV9B 3F65A 4AH2B 2E6QA 2XPZA 3M7OA 3N5AA 3RPIA 1ADQA 3OZKA 4GRLB 5DJZA 4GUQA 5TE7L 4KTGA 3KDMA 5I82A 2F7PA 2CRZA 4D9RD 4ZFFB 4MXVF 3ZKNC 3FZUD 1N64H 1TU2B 1IL1B 2MNJB 4KI5F 3KWWA 4BGDA 4JAMA 3BZDA 3C5ZD 1K9TA 2ORBL 3MRPB 4KHTL 4WI5A 2VOTA 2CSPA 4FZEL 4PY8I 4L3ED 3R18A 2A74A 3F2LA 5JW5A 2DMBA 2NTFA 4MZ3A 1SEBA 1IGYB 1Q8MA 2ROXA 3L81A 4L3FA 5CN3A 5K9JL 4OUOA 2EEXA 2X4PA 1JV2B 4G6FB 2NXZB 4OLEA 1JNJA 5AVUB 1BVZA 3MBEB 4WI3A 5I1HL 4PRAB 2JVUA 4ZFGL 1ZT4A 3PHOB 3V8OA 3MCYA 1LGVA 1OPGH 2FWUA 1E6JL 3NJHA 3LRKA 3VFGL 2EDDA 3QO1B 2DYRB 1HAWA 1EGJH 3FB7A 4MYWB 1QUNA 1Z6JT 2YUWA 4FABL 2VMCA 3TH4T 5F7MC 3ZT6A 1YAZA 1KIRA 4DUVA 4LP5A 1R47A 2OI9B 5I1EH 1X7QA 4A6YB 4U3SB 2Y3NA 1D7FA 4QRRA 4D94A 1G7HB 4XBGB 2R9HD 4EZLA 3TOPA 2XWCA 1DBMH 4P2YA 1W80A 5L2JB 2I9LA 4F15C 1T5KA 4WV1A 3LKSB 3FU8A 4N1EA 1OGPA 3RWCA 3JXAA 4KKBC 1FL5A 2A6DB 2IDFA 3NPSC 1BBJB 1AXTH 1NCTA 3IDYB 5GGVY 5HP5A 4ATWA 5KOMC 4WV1C 2HSIA 2XTJB 5AOIA 1HXMA 3L4CA 3HI6L 1YDPB 1MCOL 2ZWKA 4M7JL 1CVSC 5ANMB 2AQPA 3CHRA 4Z76B 2CLVA 1DQKA 2LFEA 1ACYH 4UQDA 4OGQC 5CSGA 4YHKH 4FQ2H 3C2SA 1S7UA 2WXPA 4M7ZB 1K5WA 3ZKMD 2DQDL 1OCWH 4PRPB 3E38A 1XL4A 1GW0A 3AS3A 4KKPA 4NLHA 5ADPL 3MXVH 3VQ2C 3T5WA 3FQWB 4UTAH 1O9ZA 5E6ZA 3MFFA 1ET5A 3JV4A 3BPCA 2Z8WC 4KQ3H 2Y1YA 3PQYE 5L6YL 4XI5D 5EWIL 1J8KA 4GRWE 1HS6A 5K39B 1OTSC 4TL5A 4MYPA 4NC0B 1GOGA 4PIRF 4XOBA 1KJMA 1R5WA 1QFUL 2YAPA 4FZ8H 3TBSB 3RVTD 1E5UI 4UAOC 4POUB 4Z95H 3CZSA 4FF9A 3FB5A 3FO9A 1IQDA 5B1JA 3R8QA 5TH2B 2IBBA 5E08L 3QQ3B 5IEKB 5T1LD 1L6XA 5HI4C 3PGFL 1AD9A 3H6JA 1KFAL 2P1YA 3GTVA 5EPMA 3PXLA 4TNWK 1OANA 2HT2D 5KSAB 3VGAC 1T20A 3V6OC 1HILB 2HFFB 5ICZA 2DLHA 4AYFA 4L8CA 2CIKB 3I6GB 4KXAA 3D39B 1GYAA 1MFNA 1HDMA 2YWYA 3QJVB 1MI5D 2R2HA 2EH7H 3PY9A 5DWUL 4RWYH 2IO5A 5M95B 1ZT1B 4G11A 3ZRFC 1IQWH 1LP9E 2JKIS 1FCGA 4TLSA 3GRWH 4YHLH 3RWFB 1CURA 1BFOB 2CUAA 5KW9H 5DEFA 2GKIA 2HA1A 2J8UB 2X2UA 3AADB 2FBRA 3BKML 5ITBH 1BECA 1U8LB 1PKQE 4I9WD 4ACTA 1B2WH 4U6HB 4XPGH 2BCKA 1EZSA 4AVIA 3L3OB 4OF3A 5IR1B 3QRFM 3B6SB 3LN5B 4YDVB 2IPUK 5F7KC 3GKZA 2WXGA 3MLTA 4JFFA 1BZ9B 1Y6NR 4HWZA 5CWSA 3UDWC 4GIPD 3F5WB 3BKYH 5IHBA 5D2NC 5LQBL 3LCYA 5D72H 4BZ1A 1FAIH 3WTTA 4C83A 1MCSA 5C0CE 3L45A 1SMOA 4WNQB 7TAAA 2C4FU 2OMUA 2PTTA 5E70A 3P0VH 1IGFL 4TMPA 4MRCA 4MRBA 4OM0L 1XGPB 3UDWA 3QHZL 4PAZA 1CFQB 5DSCA 5E99H 2XWDA 3QDMB 3QUMA 3SOTA 4KV5E 5K9OB 5ILTH 3QUKA 2Q20A 3IGAA 1W15A 3II3A 4NGHH 4R9HA 2ICWB 4IOIB 4MS6A 2A83A 2ITCA 2W0KA 3UO1L 4B6ZA 1TEGA 1UYWL 2DPKA 2ATPA 2X7LA 4BZ1L 1TSRA 2YS4A 3H9SB 3VFMA 1QLFA 1QOKA 4Q2ZA 4XHJC 5SWSD 4HA1A 2OZ4L 3GGWB 1KB5B 1JGDA 1T89C 1BJ1J 2ZCZA 3HLAB 4HKJB 1K3ZA 4MNQB 1WV7T 1WTLA 5E2JA 1DE4B 1MHCA 2B2XH 3OF6A 2DWDB 3L9YA 2YQBA 3CXDH 3DJSA 4R96A 1U95A 4UOW1 4Y5XB 4DP8X 4HKXA 2A4ZA 5AAWA 1ZSHA 5F0MB 3S2CA 4E0RB 1WUNT 4DVRL 4I0KA 4JHVA 2IMMA 4FMVA 4EUPH 4IS6A 1XGYH 2NMSA 1F4YL 1GZQA 3NJVA 1FFQA 3E6HA 3IJHA 4QXWA 4PJBA 4XHQA 4AKOA 1W6WA 1E9QB 2YBRB 2NY5C 4NBXB 4JPSA 4CSTA 1IC1A 1TJMA 5HHNB 1D9KB 6FABH 2PWGA 3SZ6A 3MLSL 5J6SA 4AUUA 3AQXA 3B9EA 3UBFA 2W07B 3A4AA 3LX9A 3X1GA 1GJWA 1EHLH 3B7TA 5HGAA 4XNQB 5I1AA 4YDZA 5DA4A 5IKCB 2YOCA 2FSDA 2XPGA 5JHLH 3DRQB 1FN4B 2WZPD 1MCDA 4NNYB 3KCPA 4I18B 5H94A 2YD4A 4LSVL 2IOOA 4GW1B 4IGBC 2DEXX 4JGJA 1F58L 4TVSa 3V4PB 4E9VA 2ZD0A 3EH5B 2HN7A 2I5YL 4AIZB 4HKBA 2EP6A 4H8VA 1N64L 3BKCL 4I85A 1L7IL 1U8HB 3ZYJA 4B7LA 2FUTA 3JWOC 1H0DA 3C6LB 4FQLL 3V5KB 3II1A 4C4KT 1SQ2N 4N2GA 3GWJA 2FB4H 1ORSA 2CBTA 3NPSB 3LEXB 5B1BB 3FYIB 1T4WA 1TVHA 1KACB 2E59A 3LEYH 2P5WD 1HI6B 4XPBL 5D1XD 3RGHA 3SY0A 2WUBH 1WE5A 1X9RA 3L4TA 1AP2B 2DOCA 4JFEA 4OF0A 3PNWA 2JJSC 3GK8H 5C2BH 1KIUB 2PW1B 4NENB 4PIBA 4QAWA 1A9EB 3QG7L 1QATA