3M0PA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 4.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'ELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0pA00
1E7OA 1YCSB 2PTKA 3EG3A 4RTUA 2FRWA 2ED0A 2CUBA 3THKA 1NG2A 2EGAA 1E6GA 3SEMA 1QWFA 4KRTA 3EHQA 1WXBA 3VS2A 1NYFA 4CC7A 3VS0A 3VRYA 2RNAA 4AG1C 2YUOA 4AFQC 1ZUYA 1K1ZA 4RTXA 2AZSA 1QCFA 2LP5A 4LNPA 4F14A 2K3BA 2PZ1A 2SRCA 2H8HA 2YUQA 2RQTA 4Z88A 1SRLA 3REBB 1KIKA 2CT4A 2EQIA 2ED1A 1K0XA 2L3QA 1W1FA 2LQWA 2KT1A 4ORZA 1MV3A 1T3SA 2LJ3A 2F2VA 2JM8A 1UJYA 2RQUA 1RLPC 2DRMA 2KXCA 4OMOA 2HSPA 1PKTA 3I9QA 4LUDA 4HVVA 2L2PA 1NLPC 1Y0MA 4HVUA 2A37A 1MV0B 2DLPA 2CSIA 1X69A 4EIKA 2OI3A 4IIMA 4GBQA 1X2QA 2FPFA 2DL7A 1KJWA 3VS6A 1AWJA 3ZL7C 1N5ZA 3U23A 1X6GA 2C0OA 1OPKA 1OOTA 1WI7A 2RQVA 1UTIA 1TUDA 3EG0A 3IQLA 1W70A 1JXOA 1A0NB 2V1QA 2JW4A 2IIMA 2EGEA 1JEGA 1WX6A 1UDLA 3H0IA 1HSQA 2A36A 2ENMA 4QT7A 4DEXA 5FWCA 4D8DA 4CC4B 4OMMA 2K79A 2LZ6B 1U3OA 3VS3A 1MUZA 4AG2C 3JV3A 1HJDA 2KT8A 1M8MA 3QWXX 2LMJA 2O31A 1WXTA 2YUNA 2MIOA 1K76A 2DRKA 2V1RA 4J9HA 3H41A 3UA6A 3LH5A 4RUGA 2LJ0A 4JPBW 1K9AA 2RQRA 2SEMA 3EG2A 3M0RA 2KRSA 2DL3A 3EG1A 1QWEA 1PKSA 2P4RA 2D8HA 1QLYA 1AD5A 1OEBA 2LX7A 2YDLA 2K2MA 1FYNA 1QKXA 2GGRA 2DM1A 1GRIA 2ROTA 3ULRB 2JMAA 1X2KA 2DL4A 1ZLMA 3PVQA 4J9FA 1Z9QA 1YN8A 1VYTA 1WA7A 1CKAA 1VA7A 2DYBA 2FG0A 5ECAA 2DNUA 4J9IA 1AOJA 1GCQA 4OMPA 3VS4A 1ZSGA 3M0TA 2EVRA 2VVKA 2O2OA 2CSQA 2O9SA 1G2BA 5IHKA 1GFDA 1H3HA 3VS5A 3PE0A 2JM9A 3M0SA 2W0ZA 1ABQA 2AZVA 2CREA 2KEAA 2L3PA 2K9GA 5GJVB 2DE0X 2L3SA 3TSWA 1M3AA 1UFFA 4D8KA 2HEQA 5L23A 2DX1A 4HCKA 4OMLA 3NGPA 4IIOA 1AWOA 1PWTA 1FMKA 1CKBA 2A28A 1WIEA 1LCKA 2BZ8A 4J9GA 2VWFA 2NWMA 1PNJA 2BTTA 2W10A 1GL5A 2DILA 2OJ2A 3R6NA 2YT6A 3M0PA 3VS1A 3TVTA 1AVZC 2K7AA 2J6OA 5IHIA 1VYVA 1M3BA 4ESRA 2BZXA 2K6DA 2CT3A 2J7IA 2YSQA 3M0UA 2NUZA 2RMOA 4Z8AA 2B86A 4K11A 1Z9ZA 4HXJA 2X3XD 1TUCA 1RLQC 2OAWA 3NHNA 2D8JA 4RTYA 1GFCA 1M3CA 2DJQA 2MCNA 3EHRA 3I5SA 4Z89A 3FJ5A 1KFZA 2KRNA 1JU5C 2HBWA 1QKWA 1SPKA 1UGVA 2G6FX 1PRLC 3CQTA 2JS0A 1K4US 2D1XA 3REAB 1X6BA 2KYBA 2EYZA 1ZX6A 3H0HA 2EGCA 2EYYA 2F2XA 2X3WD 1WFWA 4RTVA 2FPEA 2O9VA 1BK2A 4M4ZA 1XOVA 3VRZA 2CH4A 2GTJA 1ABOA 2JMCA 4X1VA 1TG0A 4GLMA 2CH4W 2FEIA 2M51A 4HVWA 3I35A 1T0HA 2AKLA 2BZYA 1YP5A 1YWPA 4JJCA 2VKNA 5IXFA 1GBQA 1CSKA 4DEYA 1WLPB 4R0KA 1S1NA 3EGUA 1NEBA 3RBBB 1B07A 2KBTA 1U06A 2A08A 2DBKA 1GBRA 1V1CA 4J9EA 2AK5A 1PRMC 2JS2A 2ESWA 1U5SA 1RUWA 1AWWA 1KSWA 2RPNA 1NEGA 1AEYA 2JXBA 4E6RA 1PHTA 1H92A 5HCKA 2O88A 2DVJA 1H8KA 2L0AA 1UE9A 2CUDA 4J9DA 3SHWA 1AZEA 5EC7A 4F16A 2DL8A 1OPLA 3GBQA 1E6HA 4J9BA 1RI9A 1UJ0A 1ZUKA 4LUEA 2JT4A 5FW9A 4RTWA 4CC2A 2KYMA 3H0FA 2F2WA 2JTEA 1I1JA 4LE9A 1SHGA 1UECA 3UA7A 2LCSA 2QDLA 2E5KA 2EBPA 2PNIA 1ZUUA 1B3QA 2KNBB 1T3LA 1ARKA 2DA9A 1GCQC 1WYXA 2HDAA 2KRMA 1AWXA 4WCIA 2J6FA 2DL5A 2XMFA 2FRYA 5GJWB 1UHFA 2GBQA 1BB9A 2J6KA 4F17A 1VYUA 2LQNA 1G83A 2EYXA 2ROLA 1EFNA 1GCPA 1X27A 2AKKA 1SHFA 2RN8A 2GTOA 2LJ1A 3RNJA 2FPDA 2D0NA 2RF0A 3NMZC 4LN2A 2KE9A 1JQQA 5FWBA 1BBZA 2FO0A 1SEMA 2KR3A 2ECZA 1I0CA 4J9CA 4CC3A 2EKHA 3TSZA 2DMOA 5I11A 4ZNXA 3KFVA 2KGTA 1AZGB 1SRMA 5I22A 1W6XA 3NPFA 1Y57A 2YUPA 4OMNA 2LNHB 4AFUC 3QWYA 2DF6A 3PVLA 1ZBJA 3A98A 2C0IA 1UUEA 2I0NA 4RTTA 1NLOC 1K0SA 3C0CA 1OV3A 1M27C 4JJBA 1JXMA 1M30A 1IO6A 2HCKA 2GQIA 1NM7A 2GNCA 4JJDA 1WDXA 2J05A 5IH2A 1X43A 5IXBA 3VS7A 1YNZA 2RQWA 1WXUA 2C0TA 1JO8A 3O5ZA 2EPDA 2KXDA 3I5RA 4Y92A 2KROA 2CDTA 1T0JA 4JZ4A 1NYGA 4RTZA 4OMQA 1I07A 1UHCA 3UATA 2MOXA 2J06A 4FSSA 3UF4A 1J3TA 4JZ3A 4AFSC 5IHNA 1UG1A 3M0QA 2DBMA 2M0YA 2EW3A 1HD3A 4AFZC 4A63B 1BU1A 1SSHA 1YWOA 2ABLA 2EYWA
chains in the Genus database with same CATH superfamily
1E7OA 4C5IA 1YCSB 3M53A 4M75G 1OX8A 4M78E 2HZYA 3CCJQ 1NG2A 3ER0A 3L2UA 2YWWA 2OTLT 5CO7A 1VQ4Q 2DEUA 1WNLA 2EJ9A 1NYFA 3I56Q 4CC7A 3VS0A 2RH2A 2FHDA 2RNAA 2YUOA 4II1A 3H8ZA 4AFQC 4M7DG 1X75C 4RTXA 3BY7A 4M75C 3C4SA 1QMCA 4M7AD 2K3BA 1YI2T 4Z88A 4FYYB 2CT4A 4FYWB 1D0XA 2ED1A 4LXCA 2L3QA 1W1FA 4ZGJB 2LCCA 2F2VA 3JB9F 2JM8A 1UJYA 1R0BG 2RQUA 1K9MC 1FWZA 4OMOA 1WHMA 4J5YA 5GAMf 2FYKA 1NLPC 2A3LA 2DLPA 1YJWT 2RK2A 4EIKA 1K9MR 4IIMA 2R5AA 4HCBA 2VV5A 3NTHA 3DLMA 3JRZA 1VQ6T 2FZCB 3BE3A 2QG9B 1UTIA 3MEWA 4FIBA 3IQLA 3OYBA 1JXOA 3CMAQ 2JW4A 5KCOA 2EGEA 3HRTA 4Y28E 3H0IA 1OX9A 4B6MA 2CGHA 3CCRQ 2A36A 1YITA 2WSEE 4QT7A 4DEXA 2DERA 2DVEA 3JB9H 2GCXA 4OMMA 3MKDA 2R58A 3Q1JA 3VJPA 4C5EA 5LJ5j 1HJDA 5GANe 5GAN3 1VQNA 1WXTA 3NTIA 5A2QE 2MWOA 2MIOA 3EAEA 2V1RA 3H41A 5DY9A 3CD6Q 3VUZA 2AIRB 2HAXA 4RUGA 2LJ0A 3OSSC 2RQRA 1Q86C 1VQ8A 1YJNA 4X9DA 5KE2A 5HK3A 2DL3A 2P0KA 5D6WA 1Y71A 1QLYA 4J7FA 5D7UA 3QO3A 2LX7A 1QKXA 3CCQA 2GGRA 4ELZC 1GRIA 1XNIA 1X2KA 2QXFA 3PVQA 4J9FA 2K3YA 2LTOA 1WA7A 1UGQB 2X4XA 3RR6A 2DYBA 4KH0B 1VQLQ 3GOXA 2DNUA 4DOVA 4M7AE 1ZA2B 2CP2A 5FU7B 2XD0A 3VS4A 4FU6A 2PVOB 2O9SA 2ZPBB 3VS5A 5GAMh 4IKFA 3OYJA 4A53A 5GAOm 2LC4A 2JM9A 4N0AC 1MGQA 2XDDA 4QQ6A 2AZVA 5CAIA 1S72Q 3VYGA 3UPUA 1R77A 1B34B 2XI9A 4M77F 3L2QA 4M75D 4B9WA 2DX1A 4ELYC 5GAMg 1WQWA 4QW2A 1FMKA 1G3TA 1PSFA 2A28A 3JCMW 2E41A 2BZ8A 5GMKm 1RAHB 2YLBA 2VWFA 4XAXB 2NWMA 2K5IA 1PNJA 2BTTA 2W10A 3PIPA 2RHUA 2E5QA 2DILA 2YT6A 2HQHA 1TU0B 3M0PA 1BKBA 3VS1A 3TVTA 2K7AA 2J6OA 5IHIA 4C8QB 3OYDA 3OS0A 3RERA 2DZCA 2JJ9A 1OQKA 3M0UA 2RMOA 3CCMT 1BI2A 2XK0A 4EMGA 5IAYA 2K4YA 2X3XD 1RLQC 2QQ9A 4JLGA 1OU9A 1BI0A 2I2LA 1VQ5Q 2D8JA 5FU7C 3NTKA 2DJQA 1OYXA 1VQKA 3CCEQ 3I5SA 4Z89A 3P8DA 3FJ5A 2FZGB 2KRNA 3A8HB 3V8KA 1Y07A 3HFOA 1K73C 1KQ1A 2D1XA 5CCAA 1OZ2A 1VQ4A 2KYBA 2RI3A 3JB9I 2EYYA 2O4XB 4C8QG 2F2XA 2QA4Q 5L8RE 1KHIA 2O9VA 4XTWA 4BDYA 4N4GA 2DFUA 1JRIA 1IXDA 1BK2A 3WXMB 1G3YA 2CH4A 2DO3A 2GTJA 4Q5WA 5LJ5e 4M78B 4X1VA 5KYNA 3QDFA 1RAAB 4LDXA 2FEIA 4HVWA 1VIEA 3I35A 4F7UF 3E9GA 4C8QC 1RAIB 2D6FA 1NPRA 1FX7A 1GBQA 1CSKA 4FL6A 1OI1A 1WLPB 2PUOB 1S1NA 4C92E 3EGUA 2YHTA 3RBBB 3JCMf 2P4TA 2KBTA 2DBKA 2OAUA 1GBRA 3CC2Q 3CCLQ 1TOVA 4DQ2A 3CCVQ 3RESA 3GIBA 1RI0A 4JUVA 1UB4A 3RIRA 3G71Q 4E6RA 4PJOG 3G4SQ 2JOYA 4OB0B 5HCKA 4J8OA 2O88A 3QUIA 2ZPEB 3OYHA 2DVJA 3CMAA 4M78G 2DETA 1LNXA 1AZEA 3TREA 3AHUA 1D3BA 3VUBA 1YIJT 2LRQA 1E6HA 4J9BA 1RI9A 1UJ0A 1ZUKA 5FW9A 1WJSA 2JT4A 1M1KU 3GP8A 3CCSQ 4MZTA 2COYA 2JTEA 3A5ZB 2E70A 4LE9A 1SHGA 2HL5C 2OTJT 3CC7T 2XDPA 1WQ7A 1C0MA 2EBPA 2PNIA 3EGXA 3VV0A 1N9SA 2DA9A 3CCRT 2MYSA 2Y90A 1M8VA 4NS5A 3JCMX 1KC8C 3OW2A 4E7KA 3BDLA 1UHFA 2GBQA 2J6KA 1G83A 2EYXA 2WSCE 2ROLA 3CXCA 1EFNA 4J7IA 4XU3A 2RN8A 3OYFA 1D1BA 3MO8A 4KUIA 3RNJA 5FWBA 3CMEQ 2KK4A 1BBZA 2FO0A 2Z0WA 1VQLA 2KR3A 2ECZA 3OSVA 1F1BB 1WHHA 4J6YA 2KGTA 1AZGB 2M0OA 1C1AA 3NPFA 4M77A 2E4HA 2YUPA 3E2UA 3CMEA 3JCMh 3DB3A 4AFUC 1PSEA 1U8RA 3PVLA 4BUGA 2A7YA 1S72A 4RTTA 4J6XA 1MMDA 5KYYB 1M30A 1IO6A 4M7AB 4M7DF 3JCMQ 3CC4Q 1WDXA 2P84A 3MPUB 4X34A 5IXBA 2OX7A 3FRNA 1Q7YU 3JCMg 4OB3B 1YNZA 2Y4YA 4EDUA 2XHCA 3VU3C 1VQ7A 1JO8A 5KH6A 3M9QA 4LD6A 1U1TA 4QQDA 3O5ZA 2BUDA 4QVCA 2HKQB 2ZPGB 3MP6A 4Y92A 4C8QD 1T0JA 3S6WA 3S3MA 4UC4A 4MZMA 1UHCA 1K8AC 1QVPA 2D0QB 1UG1A 1YJ9T 4OB1B 1JJ2A 2V8KA 1VQ9T 1HD3A 5CKDA 2IPOB 4PLIA 4M7AG 2ATCB 4A4GA 2DTIA 1YCYA 3HRSA 2MPXC 4FT2A 4JRIA 1VQPA 2RD1A 4RMOA 4WF2A 1YITQ 2JTFA 3SEMA 5GANd 4KRTA 5DLOA 5FRNA 4GLKA 4F7UA 3EH2A 4AT1B 3OYIA 1ZUYA 3ME9A 1MMAA 1VQNQ 4LDUA 1KQSP 2H8HA 8AT1B 1RL2A 2DIGA 2KY9A 1VQ8Q 2HMAA 1K0XA 4IUVA 4BACA 3QYGB 1KD1C 3OYAA 3CPWP 4ZTJA 1Q95G 3QBYA 4E7ZA 2RK1A 4XTVA 1N8RC 3CCQQ 2DRMA 2LT1A 4PJNA 5GMKi 2L2PA 1VIFA 4HVUA 3CC2A 1N8RR 3BFMA 2OI3A 3OYCA 3CCVA 3G71A 3VS6A 2CYZB 3ZL7C 1SSFA 2LNVA 1X6GA 1OPKA 1C6VX 3M54A 1MHNA 1TUDA 2BE7D 1TH7A 1W70A 1A0NB 3M5AA 4A4HA 4C92B 2COZA 2EQJA 1WX6A 2RHXA 4TVRA 3CCLT 2XU8A 1HSQA 4EMKA 5GANj 1KHCA 2VXFA 5FWCA 4CC4B 4IURA 2RHYA 5KYUB 3EGDA 4B9XA 2AT1B 3JV3A 3QWXX 5HY6A 2YUNA 4JS5A 3V7RA 3M4GA 2DTHA 4KBMB 4JPBW 1K9AA 1M2VB 4BE1A 1PD1A 3VYHB 2HQEA 4KT0E 1VQOA 4L59A 5D6YA 1NJIR 3EG1A 1QWEA 3CCST 1PKSA 1TUGB 3I55A 1OEBA 2K2MA 3QKJA 5CK9A 1Q86U 3VKIA 3X28B 3ULRB 2EYQA 2D9TA 1YN8A 2FG0A 1VQKQ 3TEEA 4XTZA 1AOJA 1GCQA 1WHGA 3PIOA 2EVRA 4C0DB 3MJXA 3KUFA 4C92C 1H3HA 1G2BA 4NOYA 4J83A 4M7DA 5HK0A 3PE0A 4IUPA 5LJ3h 4D6WA 3OS5A 4BI8B 5LJ5d 2DXUA 1YI2A 5KYWB 2KEAA 2L3PA 2DE0X 2L3SA 4E7HA 3TSWA 1M90R 1UFFA 4D8KA 4HCKA 3CC4A 1YHQT 2X51A 1AWOA 1PWTA 5LJ3g 1CKBA 1LCKA 1Q82C 4R56A 2NUPB 4DBQA 3D7SB 3HFNA 2CP0A 3LW5E 3R6NA 5GAOr 1Q82R 1OULA 4NL3A 3MP1A 2J7IA 2HQXA 2R5MA 4Z8AA 5DM7R 2B86A 4C0ZA 4PFOA 2CKKA 4FW2A 1Z9ZA 1LPLA 3NHNA 1JB0E 1WHJA 1QVGP 2PQWA 4C0DC 2MCNA 3FC3A 3EHRA 3CPWA 1KFZA 2FL7A 2RJDA 4PJOF 3HHTB 1QKWA 4JJNK 4FCYA 1SPKA 1WZOA 1I81A 1MMGA 5GAOn 2G6FX 1M9SA 3CQTA 1ZSZA 2E3HA 4M78F 5AYFA 2K5FA 2QQSA 2XIDA 3TU4K 1X6BA 2YXYA 2EYZA 4RKUE 1BYMA 3H0HA 1WGSA 1OZ3A 1K73U 3JCMV 1QW1A 2F5KA 4M77E 1Q81R 2NUTA 4WTOB 1XOVA 3VRZA 2RO0A 1PM3A 1ABOA 3SWNA 2X4WA 3PFSA 3AT1B 4GLMA 1T0HA 2AKLA 5I2MA 2MAMA 1AT1B 1QQJA 4DBHA 2RJFA 1QVFA 2VXEA 4DEYA 4RCCA 1LVKA 3HL8A 1NEBA 5GAN4 5FLXE 1B07A 2EJFA 2V8IA 2YRDA 3S3OA 4QQGA 1U06A 1RAEB 4J9EA 1PRMC 2F5TX 2E12A 2XKOC 3RDVA 1XJWB 1YJNT 5KYXA 1KSWA 1NEGA 3OW2S 1LJOA 2E65A 3GLXA 4C5GA 4C92D 3CXCS 3P8BB 1WJQA 1UE9A 2CUDA 3CCUQ 2K57A 3GBQA 4BE0A 5GAN8 4V2SA 2CP3A 4CC2A 3OYLA 2KYMA 3L2VA 1G3WA 3X20B 4O5VA 1VUBA 3UA7A 1UECA 3SD4A 1VQ7Q 3DLLA 3QIIA 1UGPB 1B3QA 4N4IA 2DZ9A 3F70A 2KRMA 4F7UE 5GAMj 4EMHA 3OYEA 4FM4B 4PL6A 2DL5A 3JB9J 2FRYA 1B34A 1BB9A 1VYUA 2LQNA 3C95A 4IUTA 4IUUA 2X4YA 1GCPA 2O01E 1KC8U 1IHVA 4KULA 3SDZA 2D0NA 3G6EQ 2KE9A 1JQQA 2F1LA 3PT9A 1TSFA 2ZCFB 1I0CA 4MMLA 4OB2B 4EPCA 3FDRA 3KFVA 1TXQA 2IVWA 1VQPQ 2E10A 3CBPA 3E1SA 2H3JA 3LH0A 2X4JA 2DF6A 1JJ2S 3A98A 5J39A 4PLLA 3C0CA 2RI2A 5GMKh 1Y96A 2BIVA 2MI6A 1M27C 1JXMA 3A8MB 4KGZB 2E64A 1FMWA 1QVGA 3A8LB 4JJDA 1W2BP 3CCJT 5IH2A 2HL3A 1XTDA 2RQWA 2M02A 1MNEA 1VQMQ 1I5LA 1VQ4T 3HTRA 3I56T 3ZBDA 1SF9A 3PTAA 2KROA 3ASKA 1D1AA 2JNGA 2LCLA 4ZTFA 4KUDK 2LT4A 1RAFB 5KCHA 4PJOA 4HT8A 2RJCA 1J3TA 2QTVA 2DJZA 2EQKA 1D3BB 4M78A 2EW3A 2M0YA 4FYXB 4AFZC 1K8AU 1SSHA 2EYWA 2V26A 3CEYA 2PTKA 2QQRA 4DOWA 1TTHB 4RTUA 5A0LA 1N6AA 2ED0A 2CUBA 3FB9A 2EGAA 4LDWA 4QVZA 4ZGDB 7AT1B 5I21A 4JRPA 2QEXQ 1K1ZA 4E47A 2AZSA 5A0GA 2XDBA 4A4EA 1QCFA 2LP5A 1NZ9A 4DBRA 3CMAT 4F14A 3N5BB 4M7DE 3OS1A 4A4KA 1SRLA 2QDYB 3REBB 1KIKA 4BB7A 2EQIA 1P92A 1NPPA 2LQWA 1VQOQ 1MV3A 1T3SA 2DTOA 2EAYA 2V8JA 3I55Q 2QTXA 3OYKA 1G5VA 1RLPC 5CKEA 2KXCA 4PJLA 5GAMe 1PKTA 2DK3A 3I9QA 2KVQG 1KD1U 4LUDA 2KQWA 2ZGWA 3BW1A 1IZ6A 3RMQA 3X25B 1Y0MA 4L6V5 3EH1A 2CSIA 4P5NA 3CD6T 1X69A 4YTLA 4GBQA 5A0DA 1UGSB 1X2QA 1RACB 2DL7A 1M4ZA 4IUQA 1RADB 2BKDN 4M75F 3U23A 2C0OA 2KDSA 2RQVA 1YBYA 3EG0A 4VUBA 5GAOq 1YFNA 3CCUA 1YI2Q 1JEGA 1UDLA 1VQLT 2M9UA 5C6SA 2ENMA 4AMCA 2RM4A 4D8DA 3MEVA 4PFZA 3GPLA 3OMCA 2K79A 3OYYA 2LZ6B 3VS3A 5IT9E 4AG2C 3HPWA 3EG9B 2LMJA 3MEUA 1X01A 3R6OA 5GANf 3TQ7P 1DJ7B 1S72T 2GQVA 1YJWQ 2DRKA 4J9HA 4FT4A 2GFUA 3EG2A 1N27A 3QG1A 1EX4A 3M57A 2D8HA 1ZHIA 4M77C 1AD5A 1VQ6Q 1VQ9A 4BY6B 1FYNA 4M7AA 2LQKA 1D0ZA 1LOJA 1RABB 2ROTA 4HCZA 2DL4A 3UDCA 1ZLMA 5IN1A 1Z9QA 1W2BA 1VYTA 5CKFA 3G6EA 1VA7A 2CZ7B 5ECAA 3OA6A 3JB9D 1QCNA 4F7UB 1ZSGA 2CSQA 3UWNA 3J7AF 3HKSA 2XICA 3A8OB 2MK5A 1KQSS 1VQ5T 2RB6A 2W0ZA 4HCCA 2DYIA 3CCET 5HKCA 5GJVB 3PMTA 4R55A 4E7SA 3CPWS 4OMLA 2L5QA 1VQPT 3E19A 2DD5A 4C0FA 3OB9A 1VQMA 1V29B 2QQAA 3CPFA 4QVDA 3V8LA 4F7UG 2OJ2A 2QA4T 2C06A 4BY6C 1VYVA 1M3BA 1K9MU 4ESRA 2K6DA 2R57A 4HXJA 5GANh 2EQUA 2OAWA 3X26B 4RTYA 1GFCA 4OGEA 2PVGB 4EMKB 2VC8A 4HA8A 2X9HA 4XU2A 1QVFS 6AT1B 2X35A 3EFOA 2LDMA 1N9RA 2Y4XA 3EGDB 1JU5C 3CC2T 4A54A 1PRLC 3CCVT 4GY5A 1BI1A 2ZAEA 3G71T 4ANJA 5GAN7 4BDZA 2RI5A 3G4ST 2QEXA 1ZX6A 2EGCA 2ZPHB 3MEAA 4HKEA 1WFWA 4RTVA 2FPEA 3OYGA 1NJIC 3GNFB 4M4ZA 2VUBA 3JAME 2A0FB 4ZGEB 5CR2A 4PJMA 4PFPA 5LJ5f 3CCMQ 3LYIA 1Q7YR 1YWPA 3LX7A 4JJCA 5CQYA 1R8OB 4C92G 2G3RA 2VKNA 3NFCA 4OVAA 3OMGA 4M77D 1WJRA 3JCMJ 4ME7A 3C94A 4M75A 4R0KA 3JCMe 2VYTA 2A08A 4M7DB 1IREB 4XTXA 4BI3A 2AK5A 1PC0A 4EMKC 2ESWA 2E6NA 3L2RA 3L2WA 4CI0C 4DBFA 2OTLA 1AEYA 2JXBA 3G7ZA 1PHTA 3HP9A 4JRKA 1M90C 5LL6S 5CKBA 4PJOE 1H8KA 4J9DA 1HXDA 3SHWA 3CMET 3L1AA 1YHQA 4F16A 2DL8A 1OPLA 1QP2A 4BE2A 3O8VA 4C8QF 2VGMA 4RTWA 2QASA 3H0FA 2EIFA 2E3IA 1I1JA 2QK0A 2F69A 3META 2PVDB 1BCMA 2RHIA 3M4YA 2E5KA 2JZ2A 4FSXA 5GAN6 1YJWA 4E7JA 4E7IA 2AHJB 1GCQC 5J3BA 1AWXA 4WCIA 1KQ2A 2QQBA 5KYWA 5LJ3j 3CC4T 2CP7A 1QVGS 1QCOA 5GJWB 1JBMA 1VQ6A 2FB7A 4M7DC 2EFIA 1KQSA 1HYOA 1SHFA 4MMKA 2GTOA 2LJ1A 2YRVA 3TCJA 2EQMA 1ZSZB 2KSSA 2LVMA 4LN2A 4RG2A 2BE9B 5LJ5h 2NUPA 3OY9A 2P0QA 1YIJQ 4C0GA 4CC3A 4J9CA 2EWNA 3CBMA 3TSZA 2DMOA 4ZNXA 1SRMA 2HBPA 2HNIA 1NBEB 1Y57A 3SFMA 3PGGA 2NUTB 2RA2A 1Q81C 1IRXA 5M9OA 4OMNA 2OTJQ 2LNHB 3SWNB 5LJ5g 3CC7Q 3QWYA 1ZBJA 2I0NA 3G1JA 4JDSA 1OV3A 2HCKA 1NM7A 4E2FB 2GNCA 3OYNA 4RCBA 2J05A 1YITT 5GAMd 2K3XA 1WXUA 2QAZA 4OF1A 1VOMA 2C0TA 3OS2A 1X6OA 1IHWA 4N0AA 2EPDA 2DXCA 1QP3A 3I5RA 3QPHA 2K2VA 1EZZB 5KYXB 1NYGA 1VQNT 2EJGA 1UEBA 1I07A 1UGRB 1D1CA 3PMIA 4XU0A 3UATA 5GAN5 4FSSA 2L89A 1R0CB 1VQ8T 1ZSZC 4JZ3A 1G8XA 3C12A 3RMSA 4O6JA 4AFSC 1PCXA 2DKGA 8ATCB 4N4HA 1Q86R 3M0QA 1HK9A 3GNGA 1BIAA 3CCQT 3JSCA 1BIBA 3DKMA 3EG3A 2CZ1B 1SKUB 3QJYA 3SWNC 3H9NA 4L5GA 2FRWA 3M55A 4PK4A 4C5HA 3THKA 4XU1A 3S3NA 1E6GA 1D0YA 1QWFA 3LGFA 2MF2A 3EHQA 1WXBA 3VS2A 3ZFJA 2DXBA 3VRYA 5GAN2 4MZPA 4AG1C 5EG2A 3OW2P 3LWIA 2L8DA 2ZPIB 4LNPA 2PZ1A 2SRCA 3CXCP 2YUQA 1Y7XA 2PUKB 2RQTA 3FLGA 3QSUA 3CCMA 1ZQ1A 4ORZA 2KT1A 1B7TA 2LJ3A 1YJ9Q 1VQ9Q 2HSPA 4M7DD 5LJ3e 4HVVA 5CQXA 2A37A 1MV0B 1I8FA 4E7LA 1WHKA 2FPFA 4M7AF 1KJWA 3RKXA 3HSBA 1AWJA 3FEOA 1N5ZA 1Y96B 4C8QA 5FRMA 1OOTA 1WI7A 4F04B 1AHJB 5CKHA 2V1QA 2IIMA 2NYSA 5DLQE 1W2BS 2JVVA 1FXXA 1VQKT 3ZEHA 4KGVB 1M1GA 2GFAA 3CCJA 1I5OB 2RJEA 2KAFA 3I56A 2DAQA 1U3OA 1MUZA 3HRUA 5FROA 3SB2A 2KT8A 1M8MA 2O31A 2LQ8A 1K73R 4PJOB 1ACMB 1TS9A 1K76A 1JJ2P 3UA6A 4BI4A 3JB9G 3LH5A 2O4XA 2SEMA 3M0RA 2KRSA 1IGQA 1WHLA 2P4RA 2YLCA 2YDLA 2DM1A 3UT1A 5GMKj 2JMAA 3CBOA 3J80E 4PKCC 1CKAA 3P8HA 1YIJA 4NL2A 4XK8E 4J9IA 3A1PA 4OMPA 3M0TA 2VVKA 2O2OA 4M75E 1WPYA 5IHKA 1GFDA 2OTJA 2ZZDA 3EGXB 3CC7A 3M0SA 1ABQA 3V7SA 3QJ6A 3QZ9B 2CREA 2QGFB 5AT1B 2K9GA 1GXIE 3CCRA 1M3AA 2KMTA 2HEQA 5L23A 2FVUA 4OP0A 4LDVA 3NGPA 4IIOA 4PJOC 2M1HA 3FIFA 2DD4A 1WIEA 3JCMd 4J9GA 3LWHA 3EFSA 4M78C 1XQHA 5I2SA 9ATCB 3V8JA 2COWA 1GL5A 1G3SA 3L2ZA 3CD6A 1OU8A 2WACA 5J26A 4M77B 2MWPA 1AVZC 1N8RU 4C92F 2BZXA 2K5LA 2CT3A 2YSQA 2NUZA 4Y91A 2WSFE 3A8GB 4K11A 2RHZA 2OTLQ 3BDUA 1TUCA 3WVEB 1M3CA 1ZBXA 1KC8R 4PNOA 2NLUA 2HKNA 3J81E 4JLIA 3V7CA 2HBWA 3RUXA 2LX9A 3QHSA 2E6ZA 1UGVA 4CRIA 1YHQQ 2JS0A 1K4US 2H3EB 3REAB 3GF5A 2CP6A 4X9CA 5GAOl 3OQ5A 3KBGA 4M77G 2HD0A 4XTYA 1I4K1 4XTUA 2XG8D 2X3WD 3CCUT 3QXEB 2JMCA 1TG0A 2L3RA 2CH4W 1NJIU 1PG5B 2M51A 1TWBA 5KYYA 2BZYA 1YP5A 5GMKl 1YJ9A 4OGCA 4LDYA 3OYMA 4FW1A 5IXFA 2CZ6B 2PU9B 4ZN3A 1VQ7T 1NE8A 2CP5A 1BCOA 3L42A 4ZN1A 1KK7A 1RAGB 4RG8A 3EG9A 1V1CA 5CVIA 2JS2A 3MP8A 5GMKe 1U5SA 1RUWA 4A4FA 1AWWA 3OBWA 2QYZA 2FZKB 2RPNA 3INZA 4LD9K 1VQ5A 1H92A 1ZA1B 2JUFA 3JCMP 1K8AR 1W4SA 3CCEA 3QDRB 3QZ5B 2L0AA 1M1KC 3G6ET 5GAOp 5EC7A 3MHXA 1M90U 3JCMb 2QI2A 2HSEB 1V76A 4LUEA 1M1KR 5C0MA 2F2WA 2JN0A 4KGXB 4M7AC 5FU6B 2M16A 4DA4A 4PJOD 3MCAB 2QA4A 2LCSA 1MNDA 2QDLA 2DXTA 4M78D 1Q82U 2EKOA 1ZUUA 2KNBB 4FYVB 1T3LA 1ARKA 3H6ZA 1WYXA 2HDAA 5CIUA 1H3ZA 3PNWC 1U1SA 2J6FA 2XMFA 1YJNQ 4MDWA 4JRQA 2VGNA 1MMNA 1PD0A 3EFOB 4F17A 1VQMT 4BD3A 3LGLA 1X27A 2AKKA 1O9SA 3WVDB 4JS4A 3EFRA 1KD1R 2FPDA 2RF0A 3NMZC 3T9NA 5LJ3f 3DB4A 2YRCA 3CCLA 1IGUA 1SEMA 1BI3A 2E1HA 2EKHA 5I11A 4MDXA 3KXTA 4J6WA 5GANg 5I22A 2KI7A 1W6XA 4ATOA 3QYHB 4PJJA 3G4SA 4KH1B 4OMFB 2VB6A 4XQ3A 1FMVA 1H641 2C0IA 2MMPA 3OBYA 1UUEA 1O75A 3JCMc 5KE3A 2JTMA 1NLOC 1K0SA 2ZPFB 1Q81U 1Q7YC 3M56A 4JJBA 2DEQA 4C8QE 1SG5A 2DIQA 5FU6C 2GQIA 1QVFP 2B8AA 1M5Q1 3CCSA 4C92A 1X43A 4M75B 2CZ0B 2QGGA 3VS7A 4Z02A 5LJ3d 1D09B 2CS7A 3E9FA 2DPPB 2VASA 2QEXT 1M1FA 2KXDA 1M2OA 4HT9A 2CDTA 5KYUA 5D6XA 4JZ4A 4RTZA 1IB8A 4QKUA 4OMQA 1KG1A 3RKYA 3URGA 2MOXA 2J06A 2P0PA 3LLRA 3UF4A 3X24B 2GF7A 3M59A 1VQOT 5IHNA 3FJPA 2DBMA 1M2VA 1EIFA 3I55T 2IG0A 4A63B 1BU1A 3M58A 3RKWA 1YWOA 2ABLA
chains in the Genus database with same CATH topology
1E7OA 1YCSB 2PTKA 3EG3A 4RTUA 2FRWA 2ED0A 2CUBA 3THKA 1NG2A 2EGAA 1E6GA 3SEMA 1QWFA 4KRTA 3EHQA 1WXBA 3VS2A 1NYFA 4CC7A 3VS0A 3VRYA 2RNAA 4AG1C 2YUOA 4AFQC 1ZUYA 1K1ZA 4RTXA 2AZSA 1QCFA 2LP5A 4LNPA 4F14A 2K3BA 2PZ1A 2SRCA 2H8HA 2YUQA 2RQTA 4Z88A 1SRLA 3REBB 1KIKA 2CT4A 2EQIA 2ED1A 1K0XA 2L3QA 1W1FA 2LQWA 2KT1A 4ORZA 1MV3A 1T3SA 2LJ3A 2F2VA 2JM8A 1UJYA 2RQUA 1RLPC 2DRMA 2KXCA 4OMOA 2HSPA 1PKTA 3I9QA 4LUDA 4HVVA 2L2PA 1NLPC 1Y0MA 4HVUA 2A37A 1MV0B 2DLPA 2CSIA 1X69A 4EIKA 2OI3A 4IIMA 4GBQA 1X2QA 2FPFA 2DL7A 1KJWA 3VS6A 1AWJA 3ZL7C 1N5ZA 3U23A 1X6GA 2C0OA 1OPKA 1OOTA 1WI7A 2RQVA 1UTIA 1TUDA 3EG0A 3IQLA 1W70A 1JXOA 1A0NB 2V1QA 2JW4A 2IIMA 2EGEA 1JEGA 1WX6A 1UDLA 3H0IA 1HSQA 2A36A 2ENMA 4QT7A 4DEXA 5FWCA 4D8DA 4CC4B 4OMMA 2K79A 2LZ6B 1U3OA 3VS3A 1MUZA 4AG2C 3JV3A 1HJDA 2KT8A 1M8MA 3QWXX 2LMJA 2O31A 1WXTA 2YUNA 2MIOA 1K76A 2DRKA 2V1RA 4J9HA 3H41A 3UA6A 3LH5A 4RUGA 2LJ0A 4JPBW 1K9AA 2RQRA 2SEMA 3EG2A 3M0RA 2KRSA 2DL3A 3EG1A 1QWEA 1PKSA 2P4RA 2D8HA 1QLYA 1AD5A 1OEBA 2LX7A 2YDLA 2K2MA 1FYNA 1QKXA 2GGRA 2DM1A 1GRIA 2ROTA 3ULRB 2JMAA 1X2KA 2DL4A 1ZLMA 3PVQA 4J9FA 1Z9QA 1YN8A 1VYTA 1WA7A 1CKAA 1VA7A 2DYBA 2FG0A 5ECAA 2DNUA 4J9IA 1AOJA 1GCQA 4OMPA 3VS4A 1ZSGA 3M0TA 2EVRA 2VVKA 2O2OA 2CSQA 2O9SA 1G2BA 5IHKA 1GFDA 1H3HA 3VS5A 3PE0A 2JM9A 3M0SA 2W0ZA 1ABQA 2AZVA 2CREA 2KEAA 2L3PA 2K9GA 5GJVB 2DE0X 2L3SA 3TSWA 1M3AA 1UFFA 4D8KA 2HEQA 5L23A 2DX1A 4HCKA 4OMLA 3NGPA 4IIOA 1AWOA 1PWTA 1FMKA 1CKBA 2A28A 1WIEA 1LCKA 2BZ8A 4J9GA 2VWFA 2NWMA 1PNJA 2BTTA 2W10A 1GL5A 2DILA 2OJ2A 3R6NA 2YT6A 3M0PA 3VS1A 3TVTA 1AVZC 2K7AA 2J6OA 5IHIA 1VYVA 1M3BA 4ESRA 2BZXA 2K6DA 2CT3A 2J7IA 2YSQA 3M0UA 2NUZA 2RMOA 4Z8AA 2B86A 4K11A 1Z9ZA 4HXJA 2X3XD 1TUCA 1RLQC 2OAWA 3NHNA 2D8JA 4RTYA 1GFCA 1M3CA 2DJQA 2MCNA 3EHRA 3I5SA 4Z89A 3FJ5A 1KFZA 2KRNA 1JU5C 2HBWA 1QKWA 1SPKA 1UGVA 2G6FX 1PRLC 3CQTA 2JS0A 1K4US 2D1XA 3REAB 1X6BA 2KYBA 2EYZA 1ZX6A 3H0HA 2EGCA 2EYYA 2F2XA 2X3WD 1WFWA 4RTVA 2FPEA 2O9VA 1BK2A 4M4ZA 1XOVA 3VRZA 2CH4A 2GTJA 1ABOA 2JMCA 4X1VA 1TG0A 4GLMA 2CH4W 2FEIA 2M51A 4HVWA 3I35A 1T0HA 2AKLA 2BZYA 1YP5A 1YWPA 4JJCA 2VKNA 5IXFA 1GBQA 1CSKA 4DEYA 1WLPB 4R0KA 1S1NA 3EGUA 1NEBA 3RBBB 1B07A 2KBTA 1U06A 2A08A 2DBKA 1GBRA 1V1CA 4J9EA 2AK5A 1PRMC 2JS2A 2ESWA 1U5SA 1RUWA 1AWWA 1KSWA 2RPNA 1NEGA 1AEYA 2JXBA 4E6RA 1PHTA 1H92A 5HCKA 2O88A 2DVJA 1H8KA 2L0AA 1UE9A 2CUDA 4J9DA 3SHWA 1AZEA 5EC7A 4F16A 2DL8A 1OPLA 3GBQA 1E6HA 4J9BA 1RI9A 1UJ0A 1ZUKA 4LUEA 2JT4A 5FW9A 4RTWA 4CC2A 2KYMA 3H0FA 2F2WA 2JTEA 1I1JA 4LE9A 1SHGA 1UECA 3UA7A 2LCSA 2QDLA 2E5KA 2EBPA 2PNIA 1ZUUA 1B3QA 2KNBB 1T3LA 1ARKA 2DA9A 1GCQC 1WYXA 2HDAA 2KRMA 1AWXA 4WCIA 2J6FA 2DL5A 2XMFA 2FRYA 5GJWB 1UHFA 2GBQA 1BB9A 2J6KA 4F17A 1VYUA 2LQNA 1G83A 2EYXA 2ROLA 1EFNA 1GCPA 1X27A 2AKKA 1SHFA 2RN8A 2GTOA 2LJ1A 3RNJA 2FPDA 2D0NA 2RF0A 3NMZC 4LN2A 2KE9A 1JQQA 5FWBA 1BBZA 2FO0A 1SEMA 2KR3A 2ECZA 1I0CA 4J9CA 4CC3A 2EKHA 3TSZA 2DMOA 5I11A 4ZNXA 3KFVA 2KGTA 1AZGB 1SRMA 5I22A 1W6XA 3NPFA 1Y57A 2YUPA 4OMNA 2LNHB 4AFUC 3QWYA 2DF6A 3PVLA 1ZBJA 3A98A 2C0IA 1UUEA 2I0NA 4RTTA 1NLOC 1K0SA 3C0CA 1OV3A 1M27C 4JJBA 1JXMA 1M30A 1IO6A 2HCKA 2GQIA 1NM7A 2GNCA 4JJDA 1WDXA 2J05A 5IH2A 1X43A 5IXBA 3VS7A 1YNZA 2RQWA 1WXUA 2C0TA 1JO8A 3O5ZA 2EPDA 2KXDA 3I5RA 4Y92A 2KROA 2CDTA 1T0JA 4JZ4A 1NYGA 4RTZA 4OMQA 1I07A 1UHCA 3UATA 2MOXA 2J06A 4FSSA 3UF4A 1J3TA 4JZ3A 4AFSC 5IHNA 1UG1A 3M0QA 2DBMA 2M0YA 2EW3A 1HD3A 4AFZC 4A63B 1BU1A 1SSHA 1YWOA 2ABLA 2EYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7O A;  1YCS B;  2PTK A;  3EG3 A;  4RTU A;  2FRW A;  2ED0 A;  2CUB A;  3THK A;  1NG2 A;  2EGA A;  1E6G A;  3SEM A;  1QWF A;  4KRT A;  3EHQ A;  1WXB A;  3VS2 A;  1NYF A;  4CC7 A;  3VS0 A;  3VRY A;  2RNA A;  4AG1 C;  2YUO A;  4AFQ C;  1ZUY A;  1K1Z A;  4RTX A;  2AZS A;  1QCF A;  2LP5 A;  4LNP A;  4F14 A;  2K3B A;  2PZ1 A;  2SRC A;  2H8H A;  2YUQ A;  2RQT A;  4Z88 A;  1SRL A;  3REB B;  1KIK A;  2CT4 A;  2EQI A;  2ED1 A;  1K0X A;  2L3Q A;  1W1F A;  2LQW A;  2KT1 A;  4ORZ A;  1MV3 A;  1T3S A;  2LJ3 A;  2F2V A;  2JM8 A;  1UJY A;  2RQU A;  1RLP C;  2DRM A;  2KXC A;  4OMO A;  2HSP A;  1PKT A;  3I9Q A;  4LUD A;  4HVV A;  2L2P A;  1NLP C;  1Y0M A;  4HVU A;  2A37 A;  1MV0 B;  2DLP A;  2CSI A;  1X69 A;  4EIK A;  2OI3 A;  4IIM A;  4GBQ A;  1X2Q A;  2FPF A;  2DL7 A;  1KJW A;  3VS6 A;  1AWJ A;  3ZL7 C;  1N5Z A;  3U23 A;  1X6G A;  2C0O A;  1OPK A;  1OOT A;  1WI7 A;  2RQV A;  1UTI A;  1TUD A;  3EG0 A;  3IQL A;  1W70 A;  1JXO A;  1A0N B;  2V1Q A;  2JW4 A;  2IIM A;  2EGE A;  1JEG A;  1WX6 A;  1UDL A;  3H0I A;  1HSQ A;  2A36 A;  2ENM A;  4QT7 A;  4DEX A;  5FWC A;  4D8D A;  4CC4 B;  4OMM A;  2K79 A;  2LZ6 B;  1U3O A;  3VS3 A;  1MUZ A;  4AG2 C;  3JV3 A;  1HJD A;  2KT8 A;  1M8M A;  3QWX X;  2LMJ A;  2O31 A;  1WXT A;  2YUN A;  2MIO A;  1K76 A;  2DRK A;  2V1R A;  4J9H A;  3H41 A;  3UA6 A;  3LH5 A;  4RUG A;  2LJ0 A;  4JPB W;  1K9A A;  2RQR A;  2SEM A;  3EG2 A;  3M0R A;  2KRS A;  2DL3 A;  3EG1 A;  1QWE A;  1PKS A;  2P4R A;  2D8H A;  1QLY A;  1AD5 A;  1OEB A;  2LX7 A;  2YDL A;  2K2M A;  1FYN A;  1QKX A;  2GGR A;  2DM1 A;  1GRI A;  2ROT A;  3ULR B;  2JMA A;  1X2K A;  2DL4 A;  1ZLM A;  3PVQ A;  4J9F A;  1Z9Q A;  1YN8 A;  1VYT A;  1WA7 A;  1CKA A;  1VA7 A;  2DYB A;  2FG0 A;  5ECA A;  2DNU A;  4J9I A;  1AOJ A;  1GCQ A;  4OMP A;  3VS4 A;  1ZSG A;  3M0T A;  2EVR A;  2VVK A;  2O2O A;  2CSQ A;  2O9S A;  1G2B A;  5IHK A;  1GFD A;  1H3H A;  3VS5 A;  3PE0 A;  2JM9 A;  3M0S A;  2W0Z A;  1ABQ A;  2AZV A;  2CRE A;  2KEA A;  2L3P A;  2K9G A;  5GJV B;  2DE0 X;  2L3S A;  3TSW A;  1M3A A;  1UFF A;  4D8K A;  2HEQ A;  5L23 A;  2DX1 A;  4HCK A;  4OML A;  3NGP A;  4IIO A;  1AWO A;  1PWT A;  1FMK A;  1CKB A;  2A28 A;  1WIE A;  1LCK A;  2BZ8 A;  4J9G A;  2VWF A;  2NWM A;  1PNJ A;  2BTT A;  2W10 A;  1GL5 A;  2DIL A;  2OJ2 A;  3R6N A;  2YT6 A;  3M0P A;  3VS1 A;  3TVT A;  1AVZ C;  2K7A A;  2J6O A;  5IHI A;  1VYV A;  1M3B A;  4ESR A;  2BZX A;  2K6D A;  2CT3 A;  2J7I A;  2YSQ A;  3M0U A;  2NUZ A;  2RMO A;  4Z8A A;  2B86 A;  4K11 A;  1Z9Z A;  4HXJ A;  2X3X D;  1TUC A;  1RLQ C;  2OAW A;  3NHN A;  2D8J A;  4RTY A;  1GFC A;  1M3C A;  2DJQ A;  2MCN A;  3EHR A;  3I5S A;  4Z89 A;  3FJ5 A;  1KFZ A;  2KRN A;  1JU5 C;  2HBW A;  1QKW A;  1SPK A;  1UGV A;  2G6F X;  1PRL C;  3CQT A;  2JS0 A;  1K4U S;  2D1X A;  3REA B;  1X6B A;  2KYB A;  2EYZ A;  1ZX6 A;  3H0H A;  2EGC A;  2EYY A;  2F2X A;  2X3W D;  1WFW A;  4RTV A;  2FPE A;  2O9V A;  1BK2 A;  4M4Z A;  1XOV A;  3VRZ A;  2CH4 A;  2GTJ A;  1ABO A;  2JMC A;  4X1V A;  1TG0 A;  4GLM A;  2CH4 W;  2FEI A;  2M51 A;  4HVW A;  3I35 A;  1T0H A;  2AKL A;  2BZY A;  1YP5 A;  1YWP A;  4JJC A;  2VKN A;  5IXF A;  1GBQ A;  1CSK A;  4DEY A;  1WLP B;  4R0K A;  1S1N A;  3EGU A;  1NEB A;  3RBB B;  1B07 A;  2KBT A;  1U06 A;  2A08 A;  2DBK A;  1GBR A;  1V1C A;  4J9E A;  2AK5 A;  1PRM C;  2JS2 A;  2ESW A;  1U5S A;  1RUW A;  1AWW A;  1KSW A;  2RPN A;  1NEG A;  1AEY A;  2JXB A;  4E6R A;  1PHT A;  1H92 A;  5HCK A;  2O88 A;  2DVJ A;  1H8K A;  2L0A A;  1UE9 A;  2CUD A;  4J9D A;  3SHW A;  1AZE A;  5EC7 A;  4F16 A;  2DL8 A;  1OPL A;  3GBQ A;  1E6H A;  4J9B A;  1RI9 A;  1UJ0 A;  1ZUK A;  4LUE A;  2JT4 A;  5FW9 A;  4RTW A;  4CC2 A;  2KYM A;  3H0F A;  2F2W A;  2JTE A;  1I1J A;  4LE9 A;  1SHG A;  1UEC A;  3UA7 A;  2LCS A;  2QDL A;  2E5K A;  2EBP A;  2PNI A;  1ZUU A;  1B3Q A;  2KNB B;  1T3L A;  1ARK A;  2DA9 A;  1GCQ C;  1WYX A;  2HDA A;  2KRM A;  1AWX A;  4WCI A;  2J6F A;  2DL5 A;  2XMF A;  2FRY A;  5GJW B;  1UHF A;  2GBQ A;  1BB9 A;  2J6K A;  4F17 A;  1VYU A;  2LQN A;  1G83 A;  2EYX A;  2ROL A;  1EFN A;  1GCP A;  1X27 A;  2AKK A;  1SHF A;  2RN8 A;  2GTO A;  2LJ1 A;  3RNJ A;  2FPD A;  2D0N A;  2RF0 A;  3NMZ C;  4LN2 A;  2KE9 A;  1JQQ A;  5FWB A;  1BBZ A;  2FO0 A;  1SEM A;  2KR3 A;  2ECZ A;  1I0C A;  4J9C A;  4CC3 A;  2EKH A;  3TSZ A;  2DMO A;  5I11 A;  4ZNX A;  3KFV A;  2KGT A;  1AZG B;  1SRM A;  5I22 A;  1W6X A;  3NPF A;  1Y57 A;  2YUP A;  4OMN A;  2LNH B;  4AFU C;  3QWY A;  2DF6 A;  3PVL A;  1ZBJ A;  3A98 A;  2C0I A;  1UUE A;  2I0N A;  4RTT A;  1NLO C;  1K0S A;  3C0C A;  1OV3 A;  1M27 C;  4JJB A;  1JXM A;  1M30 A;  1IO6 A;  2HCK A;  2GQI A;  1NM7 A;  2GNC A;  4JJD A;  1WDX A;  2J05 A;  5IH2 A;  1X43 A;  5IXB A;  3VS7 A;  1YNZ A;  2RQW A;  1WXU A;  2C0T A;  1JO8 A;  3O5Z A;  2EPD A;  2KXD A;  3I5R A;  4Y92 A;  2KRO A;  2CDT A;  1T0J A;  4JZ4 A;  1NYG A;  4RTZ A;  4OMQ A;  1I07 A;  1UHC A;  3UAT A;  2MOX A;  2J06 A;  4FSS A;  3UF4 A;  1J3T A;  4JZ3 A;  4AFS C;  5IHN A;  1UG1 A;  3M0Q A;  2DBM A;  2M0Y A;  2EW3 A;  1HD3 A;  4AFZ C;  4A63 B;  1BU1 A;  1SSH A;  1YWO A;  2ABL A;  2EYW A; 
#chains in the Genus database with same CATH topology
 1E7O A;  4C5I A;  1YCS B;  3M53 A;  4M75 G;  1OX8 A;  4M78 E;  2HZY A;  3CCJ Q;  1NG2 A;  3ER0 A;  3L2U A;  2YWW A;  2OTL T;  5CO7 A;  1VQ4 Q;  2DEU A;  1WNL A;  2EJ9 A;  1NYF A;  3I56 Q;  4CC7 A;  3VS0 A;  2RH2 A;  2FHD A;  2RNA A;  2YUO A;  4II1 A;  3H8Z A;  4AFQ C;  4M7D G;  1X75 C;  4RTX A;  3BY7 A;  4M75 C;  3C4S A;  1QMC A;  4M7A D;  2K3B A;  1YI2 T;  4Z88 A;  4FYY B;  2CT4 A;  4FYW B;  1D0X A;  2ED1 A;  4LXC A;  2L3Q A;  1W1F A;  4ZGJ B;  2LCC A;  2F2V A;  3JB9 F;  2JM8 A;  1UJY A;  1R0B G;  2RQU A;  1K9M C;  1FWZ A;  4OMO A;  1WHM A;  4J5Y A;  5GAM f;  2FYK A;  1NLP C;  2A3L A;  2DLP A;  1YJW T;  2RK2 A;  4EIK A;  1K9M R;  4IIM A;  2R5A A;  4HCB A;  2VV5 A;  3NTH A;  3DLM A;  3JRZ A;  1VQ6 T;  2FZC B;  3BE3 A;  2QG9 B;  1UTI A;  3MEW A;  4FIB A;  3IQL A;  3OYB A;  1JXO A;  3CMA Q;  2JW4 A;  5KCO A;  2EGE A;  3HRT A;  4Y28 E;  3H0I A;  1OX9 A;  4B6M A;  2CGH A;  3CCR Q;  2A36 A;  1YIT A;  2WSE E;  4QT7 A;  4DEX A;  2DER A;  2DVE A;  3JB9 H;  2GCX A;  4OMM A;  3MKD A;  2R58 A;  3Q1J A;  3VJP A;  4C5E A;  5LJ5 j;  1HJD A;  5GAN e;  5GAN 3;  1VQN A;  1WXT A;  3NTI A;  5A2Q E;  2MWO A;  2MIO A;  3EAE A;  2V1R A;  3H41 A;  5DY9 A;  3CD6 Q;  3VUZ A;  2AIR B;  2HAX A;  4RUG A;  2LJ0 A;  3OSS C;  2RQR A;  1Q86 C;  1VQ8 A;  1YJN A;  4X9D A;  5KE2 A;  5HK3 A;  2DL3 A;  2P0K A;  5D6W A;  1Y71 A;  1QLY A;  4J7F A;  5D7U A;  3QO3 A;  2LX7 A;  1QKX A;  3CCQ A;  2GGR A;  4ELZ C;  1GRI A;  1XNI A;  1X2K A;  2QXF A;  3PVQ A;  4J9F A;  2K3Y A;  2LTO A;  1WA7 A;  1UGQ B;  2X4X A;  3RR6 A;  2DYB A;  4KH0 B;  1VQL Q;  3GOX A;  2DNU A;  4DOV A;  4M7A E;  1ZA2 B;  2CP2 A;  5FU7 B;  2XD0 A;  3VS4 A;  4FU6 A;  2PVO B;  2O9S A;  2ZPB B;  3VS5 A;  5GAM h;  4IKF A;  3OYJ A;  4A53 A;  5GAO m;  2LC4 A;  2JM9 A;  4N0A C;  1MGQ A;  2XDD A;  4QQ6 A;  2AZV A;  5CAI A;  1S72 Q;  3VYG A;  3UPU A;  1R77 A;  1B34 B;  2XI9 A;  4M77 F;  3L2Q A;  4M75 D;  4B9W A;  2DX1 A;  4ELY C;  5GAM g;  1WQW A;  4QW2 A;  1FMK A;  1G3T A;  1PSF A;  2A28 A;  3JCM W;  2E41 A;  2BZ8 A;  5GMK m;  1RAH B;  2YLB A;  2VWF A;  4XAX B;  2NWM A;  2K5I A;  1PNJ A;  2BTT A;  2W10 A;  3PIP A;  2RHU A;  2E5Q A;  2DIL A;  2YT6 A;  2HQH A;  1TU0 B;  3M0P A;  1BKB A;  3VS1 A;  3TVT A;  2K7A A;  2J6O A;  5IHI A;  4C8Q B;  3OYD A;  3OS0 A;  3RER A;  2DZC A;  2JJ9 A;  1OQK A;  3M0U A;  2RMO A;  3CCM T;  1BI2 A;  2XK0 A;  4EMG A;  5IAY A;  2K4Y A;  2X3X D;  1RLQ C;  2QQ9 A;  4JLG A;  1OU9 A;  1BI0 A;  2I2L A;  1VQ5 Q;  2D8J A;  5FU7 C;  3NTK A;  2DJQ A;  1OYX A;  1VQK A;  3CCE Q;  3I5S A;  4Z89 A;  3P8D A;  3FJ5 A;  2FZG B;  2KRN A;  3A8H B;  3V8K A;  1Y07 A;  3HFO A;  1K73 C;  1KQ1 A;  2D1X A;  5CCA A;  1OZ2 A;  1VQ4 A;  2KYB A;  2RI3 A;  3JB9 I;  2EYY A;  2O4X B;  4C8Q G;  2F2X A;  2QA4 Q;  5L8R E;  1KHI A;  2O9V A;  4XTW A;  4BDY A;  4N4G A;  2DFU A;  1JRI A;  1IXD A;  1BK2 A;  3WXM B;  1G3Y A;  2CH4 A;  2DO3 A;  2GTJ A;  4Q5W A;  5LJ5 e;  4M78 B;  4X1V A;  5KYN A;  3QDF A;  1RAA B;  4LDX A;  2FEI A;  4HVW A;  1VIE A;  3I35 A;  4F7U F;  3E9G A;  4C8Q C;  1RAI B;  2D6F A;  1NPR A;  1FX7 A;  1GBQ A;  1CSK A;  4FL6 A;  1OI1 A;  1WLP B;  2PUO B;  1S1N A;  4C92 E;  3EGU A;  2YHT A;  3RBB B;  3JCM f;  2P4T A;  2KBT A;  2DBK A;  2OAU A;  1GBR A;  3CC2 Q;  3CCL Q;  1TOV A;  4DQ2 A;  3CCV Q;  3RES A;  3GIB A;  1RI0 A;  4JUV A;  1UB4 A;  3RIR A;  3G71 Q;  4E6R A;  4PJO G;  3G4S Q;  2JOY A;  4OB0 B;  5HCK A;  4J8O A;  2O88 A;  3QUI A;  2ZPE B;  3OYH A;  2DVJ A;  3CMA A;  4M78 G;  2DET A;  1LNX A;  1AZE A;  3TRE A;  3AHU A;  1D3B A;  3VUB A;  1YIJ T;  2LRQ A;  1E6H A;  4J9B A;  1RI9 A;  1UJ0 A;  1ZUK A;  5FW9 A;  1WJS A;  2JT4 A;  1M1K U;  3GP8 A;  3CCS Q;  4MZT A;  2COY A;  2JTE A;  3A5Z B;  2E70 A;  4LE9 A;  1SHG A;  2HL5 C;  2OTJ T;  3CC7 T;  2XDP A;  1WQ7 A;  1C0M A;  2EBP A;  2PNI A;  3EGX A;  3VV0 A;  1N9S A;  2DA9 A;  3CCR T;  2MYS A;  2Y90 A;  1M8V A;  4NS5 A;  3JCM X;  1KC8 C;  3OW2 A;  4E7K A;  3BDL A;  1UHF A;  2GBQ A;  2J6K A;  1G83 A;  2EYX A;  2WSC E;  2ROL A;  3CXC A;  1EFN A;  4J7I A;  4XU3 A;  2RN8 A;  3OYF A;  1D1B A;  3MO8 A;  4KUI A;  3RNJ A;  5FWB A;  3CME Q;  2KK4 A;  1BBZ A;  2FO0 A;  2Z0W A;  1VQL A;  2KR3 A;  2ECZ A;  3OSV A;  1F1B B;  1WHH A;  4J6Y A;  2KGT A;  1AZG B;  2M0O A;  1C1A A;  3NPF A;  4M77 A;  2E4H A;  2YUP A;  3E2U A;  3CME A;  3JCM h;  3DB3 A;  4AFU C;  1PSE A;  1U8R A;  3PVL A;  4BUG A;  2A7Y A;  1S72 A;  4RTT A;  4J6X A;  1MMD A;  5KYY B;  1M30 A;  1IO6 A;  4M7A B;  4M7D F;  3JCM Q;  3CC4 Q;  1WDX A;  2P84 A;  3MPU B;  4X34 A;  5IXB A;  2OX7 A;  3FRN A;  1Q7Y U;  3JCM g;  4OB3 B;  1YNZ A;  2Y4Y A;  4EDU A;  2XHC A;  3VU3 C;  1VQ7 A;  1JO8 A;  5KH6 A;  3M9Q A;  4LD6 A;  1U1T A;  4QQD A;  3O5Z A;  2BUD A;  4QVC A;  2HKQ B;  2ZPG B;  3MP6 A;  4Y92 A;  4C8Q D;  1T0J A;  3S6W A;  3S3M A;  4UC4 A;  4MZM A;  1UHC A;  1K8A C;  1QVP A;  2D0Q B;  1UG1 A;  1YJ9 T;  4OB1 B;  1JJ2 A;  2V8K A;  1VQ9 T;  1HD3 A;  5CKD A;  2IPO B;  4PLI A;  4M7A G;  2ATC B;  4A4G A;  2DTI A;  1YCY A;  3HRS A;  2MPX C;  4FT2 A;  4JRI A;  1VQP A;  2RD1 A;  4RMO A;  4WF2 A;  1YIT Q;  2JTF A;  3SEM A;  5GAN d;  4KRT A;  5DLO A;  5FRN A;  4GLK A;  4F7U A;  3EH2 A;  4AT1 B;  3OYI A;  1ZUY A;  3ME9 A;  1MMA A;  1VQN Q;  4LDU A;  1KQS P;  2H8H A;  8AT1 B;  1RL2 A;  2DIG A;  2KY9 A;  1VQ8 Q;  2HMA A;  1K0X A;  4IUV A;  4BAC A;  3QYG B;  1KD1 C;  3OYA A;  3CPW P;  4ZTJ A;  1Q95 G;  3QBY A;  4E7Z A;  2RK1 A;  4XTV A;  1N8R C;  3CCQ Q;  2DRM A;  2LT1 A;  4PJN A;  5GMK i;  2L2P A;  1VIF A;  4HVU A;  3CC2 A;  1N8R R;  3BFM A;  2OI3 A;  3OYC A;  3CCV A;  3G71 A;  3VS6 A;  2CYZ B;  3ZL7 C;  1SSF A;  2LNV A;  1X6G A;  1OPK A;  1C6V X;  3M54 A;  1MHN A;  1TUD A;  2BE7 D;  1TH7 A;  1W70 A;  1A0N B;  3M5A A;  4A4H A;  4C92 B;  2COZ A;  2EQJ A;  1WX6 A;  2RHX A;  4TVR A;  3CCL T;  2XU8 A;  1HSQ A;  4EMK A;  5GAN j;  1KHC A;  2VXF A;  5FWC A;  4CC4 B;  4IUR A;  2RHY A;  5KYU B;  3EGD A;  4B9X A;  2AT1 B;  3JV3 A;  3QWX X;  5HY6 A;  2YUN A;  4JS5 A;  3V7R A;  3M4G A;  2DTH A;  4KBM B;  4JPB W;  1K9A A;  1M2V B;  4BE1 A;  1PD1 A;  3VYH B;  2HQE A;  4KT0 E;  1VQO A;  4L59 A;  5D6Y A;  1NJI R;  3EG1 A;  1QWE A;  3CCS T;  1PKS A;  1TUG B;  3I55 A;  1OEB A;  2K2M A;  3QKJ A;  5CK9 A;  1Q86 U;  3VKI A;  3X28 B;  3ULR B;  2EYQ A;  2D9T A;  1YN8 A;  2FG0 A;  1VQK Q;  3TEE A;  4XTZ A;  1AOJ A;  1GCQ A;  1WHG A;  3PIO A;  2EVR A;  4C0D B;  3MJX A;  3KUF A;  4C92 C;  1H3H A;  1G2B A;  4NOY A;  4J83 A;  4M7D A;  5HK0 A;  3PE0 A;  4IUP A;  5LJ3 h;  4D6W A;  3OS5 A;  4BI8 B;  5LJ5 d;  2DXU A;  1YI2 A;  5KYW B;  2KEA A;  2L3P A;  2DE0 X;  2L3S A;  4E7H A;  3TSW A;  1M90 R;  1UFF A;  4D8K A;  4HCK A;  3CC4 A;  1YHQ T;  2X51 A;  1AWO A;  1PWT A;  5LJ3 g;  1CKB A;  1LCK A;  1Q82 C;  4R56 A;  2NUP B;  4DBQ A;  3D7S B;  3HFN A;  2CP0 A;  3LW5 E;  3R6N A;  5GAO r;  1Q82 R;  1OUL A;  4NL3 A;  3MP1 A;  2J7I A;  2HQX A;  2R5M A;  4Z8A A;  5DM7 R;  2B86 A;  4C0Z A;  4PFO A;  2CKK A;  4FW2 A;  1Z9Z A;  1LPL A;  3NHN A;  1JB0 E;  1WHJ A;  1QVG P;  2PQW A;  4C0D C;  2MCN A;  3FC3 A;  3EHR A;  3CPW A;  1KFZ A;  2FL7 A;  2RJD A;  4PJO F;  3HHT B;  1QKW A;  4JJN K;  4FCY A;  1SPK A;  1WZO A;  1I81 A;  1MMG A;  5GAO n;  2G6F X;  1M9S A;  3CQT A;  1ZSZ A;  2E3H A;  4M78 F;  5AYF A;  2K5F A;  2QQS A;  2XID A;  3TU4 K;  1X6B A;  2YXY A;  2EYZ A;  4RKU E;  1BYM A;  3H0H A;  1WGS A;  1OZ3 A;  1K73 U;  3JCM V;  1QW1 A;  2F5K A;  4M77 E;  1Q81 R;  2NUT A;  4WTO B;  1XOV A;  3VRZ A;  2RO0 A;  1PM3 A;  1ABO A;  3SWN A;  2X4W A;  3PFS A;  3AT1 B;  4GLM A;  1T0H A;  2AKL A;  5I2M A;  2MAM A;  1AT1 B;  1QQJ A;  4DBH A;  2RJF A;  1QVF A;  2VXE A;  4DEY A;  4RCC A;  1LVK A;  3HL8 A;  1NEB A;  5GAN 4;  5FLX E;  1B07 A;  2EJF A;  2V8I A;  2YRD A;  3S3O A;  4QQG A;  1U06 A;  1RAE B;  4J9E A;  1PRM C;  2F5T X;  2E12 A;  2XKO C;  3RDV A;  1XJW B;  1YJN T;  5KYX A;  1KSW A;  1NEG A;  3OW2 S;  1LJO A;  2E65 A;  3GLX A;  4C5G A;  4C92 D;  3CXC S;  3P8B B;  1WJQ A;  1UE9 A;  2CUD A;  3CCU Q;  2K57 A;  3GBQ A;  4BE0 A;  5GAN 8;  4V2S A;  2CP3 A;  4CC2 A;  3OYL A;  2KYM A;  3L2V A;  1G3W A;  3X20 B;  4O5V A;  1VUB A;  3UA7 A;  1UEC A;  3SD4 A;  1VQ7 Q;  3DLL A;  3QII A;  1UGP B;  1B3Q A;  4N4I A;  2DZ9 A;  3F70 A;  2KRM A;  4F7U E;  5GAM j;  4EMH A;  3OYE A;  4FM4 B;  4PL6 A;  2DL5 A;  3JB9 J;  2FRY A;  1B34 A;  1BB9 A;  1VYU A;  2LQN A;  3C95 A;  4IUT A;  4IUU A;  2X4Y A;  1GCP A;  2O01 E;  1KC8 U;  1IHV A;  4KUL A;  3SDZ A;  2D0N A;  3G6E Q;  2KE9 A;  1JQQ A;  2F1L A;  3PT9 A;  1TSF A;  2ZCF B;  1I0C A;  4MML A;  4OB2 B;  4EPC A;  3FDR A;  3KFV A;  1TXQ A;  2IVW A;  1VQP Q;  2E10 A;  3CBP A;  3E1S A;  2H3J A;  3LH0 A;  2X4J A;  2DF6 A;  1JJ2 S;  3A98 A;  5J39 A;  4PLL A;  3C0C A;  2RI2 A;  5GMK h;  1Y96 A;  2BIV A;  2MI6 A;  1M27 C;  1JXM A;  3A8M B;  4KGZ B;  2E64 A;  1FMW A;  1QVG A;  3A8L B;  4JJD A;  1W2B P;  3CCJ T;  5IH2 A;  2HL3 A;  1XTD A;  2RQW A;  2M02 A;  1MNE A;  1VQM Q;  1I5L A;  1VQ4 T;  3HTR A;  3I56 T;  3ZBD A;  1SF9 A;  3PTA A;  2KRO A;  3ASK A;  1D1A A;  2JNG A;  2LCL A;  4ZTF A;  4KUD K;  2LT4 A;  1RAF B;  5KCH A;  4PJO A;  4HT8 A;  2RJC A;  1J3T A;  2QTV A;  2DJZ A;  2EQK A;  1D3B B;  4M78 A;  2EW3 A;  2M0Y A;  4FYX B;  4AFZ C;  1K8A U;  1SSH A;  2EYW A;  2V26 A;  3CEY A;  2PTK A;  2QQR A;  4DOW A;  1TTH B;  4RTU A;  5A0L A;  1N6A A;  2ED0 A;  2CUB A;  3FB9 A;  2EGA A;  4LDW A;  4QVZ A;  4ZGD B;  7AT1 B;  5I21 A;  4JRP A;  2QEX Q;  1K1Z A;  4E47 A;  2AZS A;  5A0G A;  2XDB A;  4A4E A;  1QCF A;  2LP5 A;  1NZ9 A;  4DBR A;  3CMA T;  4F14 A;  3N5B B;  4M7D E;  3OS1 A;  4A4K A;  1SRL A;  2QDY B;  3REB B;  1KIK A;  4BB7 A;  2EQI A;  1P92 A;  1NPP A;  2LQW A;  1VQO Q;  1MV3 A;  1T3S A;  2DTO A;  2EAY A;  2V8J A;  3I55 Q;  2QTX A;  3OYK A;  1G5V A;  1RLP C;  5CKE A;  2KXC A;  4PJL A;  5GAM e;  1PKT A;  2DK3 A;  3I9Q A;  2KVQ G;  1KD1 U;  4LUD A;  2KQW A;  2ZGW A;  3BW1 A;  1IZ6 A;  3RMQ A;  3X25 B;  1Y0M A;  4L6V 5;  3EH1 A;  2CSI A;  4P5N A;  3CD6 T;  1X69 A;  4YTL A;  4GBQ A;  5A0D A;  1UGS B;  1X2Q A;  1RAC B;  2DL7 A;  1M4Z A;  4IUQ A;  1RAD B;  2BKD N;  4M75 F;  3U23 A;  2C0O A;  2KDS A;  2RQV A;  1YBY A;  3EG0 A;  4VUB A;  5GAO q;  1YFN A;  3CCU A;  1YI2 Q;  1JEG A;  1UDL A;  1VQL T;  2M9U A;  5C6S A;  2ENM A;  4AMC A;  2RM4 A;  4D8D A;  3MEV A;  4PFZ A;  3GPL A;  3OMC A;  2K79 A;  3OYY A;  2LZ6 B;  3VS3 A;  5IT9 E;  4AG2 C;  3HPW A;  3EG9 B;  2LMJ A;  3MEU A;  1X01 A;  3R6O A;  5GAN f;  3TQ7 P;  1DJ7 B;  1S72 T;  2GQV A;  1YJW Q;  2DRK A;  4J9H A;  4FT4 A;  2GFU A;  3EG2 A;  1N27 A;  3QG1 A;  1EX4 A;  3M57 A;  2D8H A;  1ZHI A;  4M77 C;  1AD5 A;  1VQ6 Q;  1VQ9 A;  4BY6 B;  1FYN A;  4M7A A;  2LQK A;  1D0Z A;  1LOJ A;  1RAB B;  2ROT A;  4HCZ A;  2DL4 A;  3UDC A;  1ZLM A;  5IN1 A;  1Z9Q A;  1W2B A;  1VYT A;  5CKF A;  3G6E A;  1VA7 A;  2CZ7 B;  5ECA A;  3OA6 A;  3JB9 D;  1QCN A;  4F7U B;  1ZSG A;  2CSQ A;  3UWN A;  3J7A F;  3HKS A;  2XIC A;  3A8O B;  2MK5 A;  1KQS S;  1VQ5 T;  2RB6 A;  2W0Z A;  4HCC A;  2DYI A;  3CCE T;  5HKC A;  5GJV B;  3PMT A;  4R55 A;  4E7S A;  3CPW S;  4OML A;  2L5Q A;  1VQP T;  3E19 A;  2DD5 A;  4C0F A;  3OB9 A;  1VQM A;  1V29 B;  2QQA A;  3CPF A;  4QVD A;  3V8L A;  4F7U G;  2OJ2 A;  2QA4 T;  2C06 A;  4BY6 C;  1VYV A;  1M3B A;  1K9M U;  4ESR A;  2K6D A;  2R57 A;  4HXJ A;  5GAN h;  2EQU A;  2OAW A;  3X26 B;  4RTY A;  1GFC A;  4OGE A;  2PVG B;  4EMK B;  2VC8 A;  4HA8 A;  2X9H A;  4XU2 A;  1QVF S;  6AT1 B;  2X35 A;  3EFO A;  2LDM A;  1N9R A;  2Y4X A;  3EGD B;  1JU5 C;  3CC2 T;  4A54 A;  1PRL C;  3CCV T;  4GY5 A;  1BI1 A;  2ZAE A;  3G71 T;  4ANJ A;  5GAN 7;  4BDZ A;  2RI5 A;  3G4S T;  2QEX A;  1ZX6 A;  2EGC A;  2ZPH B;  3MEA A;  4HKE A;  1WFW A;  4RTV A;  2FPE A;  3OYG A;  1NJI C;  3GNF B;  4M4Z A;  2VUB A;  3JAM E;  2A0F B;  4ZGE B;  5CR2 A;  4PJM A;  4PFP A;  5LJ5 f;  3CCM Q;  3LYI A;  1Q7Y R;  1YWP A;  3LX7 A;  4JJC A;  5CQY A;  1R8O B;  4C92 G;  2G3R A;  2VKN A;  3NFC A;  4OVA A;  3OMG A;  4M77 D;  1WJR A;  3JCM J;  4ME7 A;  3C94 A;  4M75 A;  4R0K A;  3JCM e;  2VYT A;  2A08 A;  4M7D B;  1IRE B;  4XTX A;  4BI3 A;  2AK5 A;  1PC0 A;  4EMK C;  2ESW A;  2E6N A;  3L2R A;  3L2W A;  4CI0 C;  4DBF A;  2OTL A;  1AEY A;  2JXB A;  3G7Z A;  1PHT A;  3HP9 A;  4JRK A;  1M90 C;  5LL6 S;  5CKB A;  4PJO E;  1H8K A;  4J9D A;  1HXD A;  3SHW A;  3CME T;  3L1A A;  1YHQ A;  4F16 A;  2DL8 A;  1OPL A;  1QP2 A;  4BE2 A;  3O8V A;  4C8Q F;  2VGM A;  4RTW A;  2QAS A;  3H0F A;  2EIF A;  2E3I A;  1I1J A;  2QK0 A;  2F69 A;  3MET A;  2PVD B;  1BCM A;  2RHI A;  3M4Y A;  2E5K A;  2JZ2 A;  4FSX A;  5GAN 6;  1YJW A;  4E7J A;  4E7I A;  2AHJ B;  1GCQ C;  5J3B A;  1AWX A;  4WCI A;  1KQ2 A;  2QQB A;  5KYW A;  5LJ3 j;  3CC4 T;  2CP7 A;  1QVG S;  1QCO A;  5GJW B;  1JBM A;  1VQ6 A;  2FB7 A;  4M7D C;  2EFI A;  1KQS A;  1HYO A;  1SHF A;  4MMK A;  2GTO A;  2LJ1 A;  2YRV A;  3TCJ A;  2EQM A;  1ZSZ B;  2KSS A;  2LVM A;  4LN2 A;  4RG2 A;  2BE9 B;  5LJ5 h;  2NUP A;  3OY9 A;  2P0Q A;  1YIJ Q;  4C0G A;  4CC3 A;  4J9C A;  2EWN A;  3CBM A;  3TSZ A;  2DMO A;  4ZNX A;  1SRM A;  2HBP A;  2HNI A;  1NBE B;  1Y57 A;  3SFM A;  3PGG A;  2NUT B;  2RA2 A;  1Q81 C;  1IRX A;  5M9O A;  4OMN A;  2OTJ Q;  2LNH B;  3SWN B;  5LJ5 g;  3CC7 Q;  3QWY A;  1ZBJ A;  2I0N A;  3G1J A;  4JDS A;  1OV3 A;  2HCK A;  1NM7 A;  4E2F B;  2GNC A;  3OYN A;  4RCB A;  2J05 A;  1YIT T;  5GAM d;  2K3X A;  1WXU A;  2QAZ A;  4OF1 A;  1VOM A;  2C0T A;  3OS2 A;  1X6O A;  1IHW A;  4N0A A;  2EPD A;  2DXC A;  1QP3 A;  3I5R A;  3QPH A;  2K2V A;  1EZZ B;  5KYX B;  1NYG A;  1VQN T;  2EJG A;  1UEB A;  1I07 A;  1UGR B;  1D1C A;  3PMI A;  4XU0 A;  3UAT A;  5GAN 5;  4FSS A;  2L89 A;  1R0C B;  1VQ8 T;  1ZSZ C;  4JZ3 A;  1G8X A;  3C12 A;  3RMS A;  4O6J A;  4AFS C;  1PCX A;  2DKG A;  8ATC B;  4N4H A;  1Q86 R;  3M0Q A;  1HK9 A;  3GNG A;  1BIA A;  3CCQ T;  3JSC A;  1BIB A;  3DKM A;  3EG3 A;  2CZ1 B;  1SKU B;  3QJY A;  3SWN C;  3H9N A;  4L5G A;  2FRW A;  3M55 A;  4PK4 A;  4C5H A;  3THK A;  4XU1 A;  3S3N A;  1E6G A;  1D0Y A;  1QWF A;  3LGF A;  2MF2 A;  3EHQ A;  1WXB A;  3VS2 A;  3ZFJ A;  2DXB A;  3VRY A;  5GAN 2;  4MZP A;  4AG1 C;  5EG2 A;  3OW2 P;  3LWI A;  2L8D A;  2ZPI B;  4LNP A;  2PZ1 A;  2SRC A;  3CXC P;  2YUQ A;  1Y7X A;  2PUK B;  2RQT A;  3FLG A;  3QSU A;  3CCM A;  1ZQ1 A;  4ORZ A;  2KT1 A;  1B7T A;  2LJ3 A;  1YJ9 Q;  1VQ9 Q;  2HSP A;  4M7D D;  5LJ3 e;  4HVV A;  5CQX A;  2A37 A;  1MV0 B;  1I8F A;  4E7L A;  1WHK A;  2FPF A;  4M7A F;  1KJW A;  3RKX A;  3HSB A;  1AWJ A;  3FEO A;  1N5Z A;  1Y96 B;  4C8Q A;  5FRM A;  1OOT A;  1WI7 A;  4F04 B;  1AHJ B;  5CKH A;  2V1Q A;  2IIM A;  2NYS A;  5DLQ E;  1W2B S;  2JVV A;  1FXX A;  1VQK T;  3ZEH A;  4KGV B;  1M1G A;  2GFA A;  3CCJ A;  1I5O B;  2RJE A;  2KAF A;  3I56 A;  2DAQ A;  1U3O A;  1MUZ A;  3HRU A;  5FRO A;  3SB2 A;  2KT8 A;  1M8M A;  2O31 A;  2LQ8 A;  1K73 R;  4PJO B;  1ACM B;  1TS9 A;  1K76 A;  1JJ2 P;  3UA6 A;  4BI4 A;  3JB9 G;  3LH5 A;  2O4X A;  2SEM A;  3M0R A;  2KRS A;  1IGQ A;  1WHL A;  2P4R A;  2YLC A;  2YDL A;  2DM1 A;  3UT1 A;  5GMK j;  2JMA A;  3CBO A;  3J80 E;  4PKC C;  1CKA A;  3P8H A;  1YIJ A;  4NL2 A;  4XK8 E;  4J9I A;  3A1P A;  4OMP A;  3M0T A;  2VVK A;  2O2O A;  4M75 E;  1WPY A;  5IHK A;  1GFD A;  2OTJ A;  2ZZD A;  3EGX B;  3CC7 A;  3M0S A;  1ABQ A;  3V7S A;  3QJ6 A;  3QZ9 B;  2CRE A;  2QGF B;  5AT1 B;  2K9G A;  1GXI E;  3CCR A;  1M3A A;  2KMT A;  2HEQ A;  5L23 A;  2FVU A;  4OP0 A;  4LDV A;  3NGP A;  4IIO A;  4PJO C;  2M1H A;  3FIF A;  2DD4 A;  1WIE A;  3JCM d;  4J9G A;  3LWH A;  3EFS A;  4M78 C;  1XQH A;  5I2S A;  9ATC B;  3V8J A;  2COW A;  1GL5 A;  1G3S A;  3L2Z A;  3CD6 A;  1OU8 A;  2WAC A;  5J26 A;  4M77 B;  2MWP A;  1AVZ C;  1N8R U;  4C92 F;  2BZX A;  2K5L A;  2CT3 A;  2YSQ A;  2NUZ A;  4Y91 A;  2WSF E;  3A8G B;  4K11 A;  2RHZ A;  2OTL Q;  3BDU A;  1TUC A;  3WVE B;  1M3C A;  1ZBX A;  1KC8 R;  4PNO A;  2NLU A;  2HKN A;  3J81 E;  4JLI A;  3V7C A;  2HBW A;  3RUX A;  2LX9 A;  3QHS A;  2E6Z A;  1UGV A;  4CRI A;  1YHQ Q;  2JS0 A;  1K4U S;  2H3E B;  3REA B;  3GF5 A;  2CP6 A;  4X9C A;  5GAO l;  3OQ5 A;  3KBG A;  4M77 G;  2HD0 A;  4XTY A;  1I4K 1;  4XTU A;  2XG8 D;  2X3W D;  3CCU T;  3QXE B;  2JMC A;  1TG0 A;  2L3R A;  2CH4 W;  1NJI U;  1PG5 B;  2M51 A;  1TWB A;  5KYY A;  2BZY A;  1YP5 A;  5GMK l;  1YJ9 A;  4OGC A;  4LDY A;  3OYM A;  4FW1 A;  5IXF A;  2CZ6 B;  2PU9 B;  4ZN3 A;  1VQ7 T;  1NE8 A;  2CP5 A;  1BCO A;  3L42 A;  4ZN1 A;  1KK7 A;  1RAG B;  4RG8 A;  3EG9 A;  1V1C A;  5CVI A;  2JS2 A;  3MP8 A;  5GMK e;  1U5S A;  1RUW A;  4A4F A;  1AWW A;  3OBW A;  2QYZ A;  2FZK B;  2RPN A;  3INZ A;  4LD9 K;  1VQ5 A;  1H92 A;  1ZA1 B;  2JUF A;  3JCM P;  1K8A R;  1W4S A;  3CCE A;  3QDR B;  3QZ5 B;  2L0A A;  1M1K C;  3G6E T;  5GAO p;  5EC7 A;  3MHX A;  1M90 U;  3JCM b;  2QI2 A;  2HSE B;  1V76 A;  4LUE A;  1M1K R;  5C0M A;  2F2W A;  2JN0 A;  4KGX B;  4M7A C;  5FU6 B;  2M16 A;  4DA4 A;  4PJO D;  3MCA B;  2QA4 A;  2LCS A;  1MND A;  2QDL A;  2DXT A;  4M78 D;  1Q82 U;  2EKO A;  1ZUU A;  2KNB B;  4FYV B;  1T3L A;  1ARK A;  3H6Z A;  1WYX A;  2HDA A;  5CIU A;  1H3Z A;  3PNW C;  1U1S A;  2J6F A;  2XMF A;  1YJN Q;  4MDW A;  4JRQ A;  2VGN A;  1MMN A;  1PD0 A;  3EFO B;  4F17 A;  1VQM T;  4BD3 A;  3LGL A;  1X27 A;  2AKK A;  1O9S A;  3WVD B;  4JS4 A;  3EFR A;  1KD1 R;  2FPD A;  2RF0 A;  3NMZ C;  3T9N A;  5LJ3 f;  3DB4 A;  2YRC A;  3CCL A;  1IGU A;  1SEM A;  1BI3 A;  2E1H A;  2EKH A;  5I11 A;  4MDX A;  3KXT A;  4J6W A;  5GAN g;  5I22 A;  2KI7 A;  1W6X A;  4ATO A;  3QYH B;  4PJJ A;  3G4S A;  4KH1 B;  4OMF B;  2VB6 A;  4XQ3 A;  1FMV A;  1H64 1;  2C0I A;  2MMP A;  3OBY A;  1UUE A;  1O75 A;  3JCM c;  5KE3 A;  2JTM A;  1NLO C;  1K0S A;  2ZPF B;  1Q81 U;  1Q7Y C;  3M56 A;  4JJB A;  2DEQ A;  4C8Q E;  1SG5 A;  2DIQ A;  5FU6 C;  2GQI A;  1QVF P;  2B8A A;  1M5Q 1;  3CCS A;  4C92 A;  1X43 A;  4M75 B;  2CZ0 B;  2QGG A;  3VS7 A;  4Z02 A;  5LJ3 d;  1D09 B;  2CS7 A;  3E9F A;  2DPP B;  2VAS A;  2QEX T;  1M1F A;  2KXD A;  1M2O A;  4HT9 A;  2CDT A;  5KYU A;  5D6X A;  4JZ4 A;  4RTZ A;  1IB8 A;  4QKU A;  4OMQ A;  1KG1 A;  3RKY A;  3URG A;  2MOX A;  2J06 A;  2P0P A;  3LLR A;  3UF4 A;  3X24 B;  2GF7 A;  3M59 A;  1VQO T;  5IHN A;  3FJP A;  2DBM A;  1M2V A;  1EIF A;  3I55 T;  2IG0 A;  4A63 B;  1BU1 A;  3M58 A;  3RKW A;  1YWO A;  2ABL A; 
#chains in the Genus database with same CATH homology
 1E7O A;  1YCS B;  2PTK A;  3EG3 A;  4RTU A;  2FRW A;  2ED0 A;  2CUB A;  3THK A;  1NG2 A;  2EGA A;  1E6G A;  3SEM A;  1QWF A;  4KRT A;  3EHQ A;  1WXB A;  3VS2 A;  1NYF A;  4CC7 A;  3VS0 A;  3VRY A;  2RNA A;  4AG1 C;  2YUO A;  4AFQ C;  1ZUY A;  1K1Z A;  4RTX A;  2AZS A;  1QCF A;  2LP5 A;  4LNP A;  4F14 A;  2K3B A;  2PZ1 A;  2SRC A;  2H8H A;  2YUQ A;  2RQT A;  4Z88 A;  1SRL A;  3REB B;  1KIK A;  2CT4 A;  2EQI A;  2ED1 A;  1K0X A;  2L3Q A;  1W1F A;  2LQW A;  2KT1 A;  4ORZ A;  1MV3 A;  1T3S A;  2LJ3 A;  2F2V A;  2JM8 A;  1UJY A;  2RQU A;  1RLP C;  2DRM A;  2KXC A;  4OMO A;  2HSP A;  1PKT A;  3I9Q A;  4LUD A;  4HVV A;  2L2P A;  1NLP C;  1Y0M A;  4HVU A;  2A37 A;  1MV0 B;  2DLP A;  2CSI A;  1X69 A;  4EIK A;  2OI3 A;  4IIM A;  4GBQ A;  1X2Q A;  2FPF A;  2DL7 A;  1KJW A;  3VS6 A;  1AWJ A;  3ZL7 C;  1N5Z A;  3U23 A;  1X6G A;  2C0O A;  1OPK A;  1OOT A;  1WI7 A;  2RQV A;  1UTI A;  1TUD A;  3EG0 A;  3IQL A;  1W70 A;  1JXO A;  1A0N B;  2V1Q A;  2JW4 A;  2IIM A;  2EGE A;  1JEG A;  1WX6 A;  1UDL A;  3H0I A;  1HSQ A;  2A36 A;  2ENM A;  4QT7 A;  4DEX A;  5FWC A;  4D8D A;  4CC4 B;  4OMM A;  2K79 A;  2LZ6 B;  1U3O A;  3VS3 A;  1MUZ A;  4AG2 C;  3JV3 A;  1HJD A;  2KT8 A;  1M8M A;  3QWX X;  2LMJ A;  2O31 A;  1WXT A;  2YUN A;  2MIO A;  1K76 A;  2DRK A;  2V1R A;  4J9H A;  3H41 A;  3UA6 A;  3LH5 A;  4RUG A;  2LJ0 A;  4JPB W;  1K9A A;  2RQR A;  2SEM A;  3EG2 A;  3M0R A;  2KRS A;  2DL3 A;  3EG1 A;  1QWE A;  1PKS A;  2P4R A;  2D8H A;  1QLY A;  1AD5 A;  1OEB A;  2LX7 A;  2YDL A;  2K2M A;  1FYN A;  1QKX A;  2GGR A;  2DM1 A;  1GRI A;  2ROT A;  3ULR B;  2JMA A;  1X2K A;  2DL4 A;  1ZLM A;  3PVQ A;  4J9F A;  1Z9Q A;  1YN8 A;  1VYT A;  1WA7 A;  1CKA A;  1VA7 A;  2DYB A;  2FG0 A;  5ECA A;  2DNU A;  4J9I A;  1AOJ A;  1GCQ A;  4OMP A;  3VS4 A;  1ZSG A;  3M0T A;  2EVR A;  2VVK A;  2O2O A;  2CSQ A;  2O9S A;  1G2B A;  5IHK A;  1GFD A;  1H3H A;  3VS5 A;  3PE0 A;  2JM9 A;  3M0S A;  2W0Z A;  1ABQ A;  2AZV A;  2CRE A;  2KEA A;  2L3P A;  2K9G A;  5GJV B;  2DE0 X;  2L3S A;  3TSW A;  1M3A A;  1UFF A;  4D8K A;  2HEQ A;  5L23 A;  2DX1 A;  4HCK A;  4OML A;  3NGP A;  4IIO A;  1AWO A;  1PWT A;  1FMK A;  1CKB A;  2A28 A;  1WIE A;  1LCK A;  2BZ8 A;  4J9G A;  2VWF A;  2NWM A;  1PNJ A;  2BTT A;  2W10 A;  1GL5 A;  2DIL A;  2OJ2 A;  3R6N A;  2YT6 A;  3M0P A;  3VS1 A;  3TVT A;  1AVZ C;  2K7A A;  2J6O A;  5IHI A;  1VYV A;  1M3B A;  4ESR A;  2BZX A;  2K6D A;  2CT3 A;  2J7I A;  2YSQ A;  3M0U A;  2NUZ A;  2RMO A;  4Z8A A;  2B86 A;  4K11 A;  1Z9Z A;  4HXJ A;  2X3X D;  1TUC A;  1RLQ C;  2OAW A;  3NHN A;  2D8J A;  4RTY A;  1GFC A;  1M3C A;  2DJQ A;  2MCN A;  3EHR A;  3I5S A;  4Z89 A;  3FJ5 A;  1KFZ A;  2KRN A;  1JU5 C;  2HBW A;  1QKW A;  1SPK A;  1UGV A;  2G6F X;  1PRL C;  3CQT A;  2JS0 A;  1K4U S;  2D1X A;  3REA B;  1X6B A;  2KYB A;  2EYZ A;  1ZX6 A;  3H0H A;  2EGC A;  2EYY A;  2F2X A;  2X3W D;  1WFW A;  4RTV A;  2FPE A;  2O9V A;  1BK2 A;  4M4Z A;  1XOV A;  3VRZ A;  2CH4 A;  2GTJ A;  1ABO A;  2JMC A;  4X1V A;  1TG0 A;  4GLM A;  2CH4 W;  2FEI A;  2M51 A;  4HVW A;  3I35 A;  1T0H A;  2AKL A;  2BZY A;  1YP5 A;  1YWP A;  4JJC A;  2VKN A;  5IXF A;  1GBQ A;  1CSK A;  4DEY A;  1WLP B;  4R0K A;  1S1N A;  3EGU A;  1NEB A;  3RBB B;  1B07 A;  2KBT A;  1U06 A;  2A08 A;  2DBK A;  1GBR A;  1V1C A;  4J9E A;  2AK5 A;  1PRM C;  2JS2 A;  2ESW A;  1U5S A;  1RUW A;  1AWW A;  1KSW A;  2RPN A;  1NEG A;  1AEY A;  2JXB A;  4E6R A;  1PHT A;  1H92 A;  5HCK A;  2O88 A;  2DVJ A;  1H8K A;  2L0A A;  1UE9 A;  2CUD A;  4J9D A;  3SHW A;  1AZE A;  5EC7 A;  4F16 A;  2DL8 A;  1OPL A;  3GBQ A;  1E6H A;  4J9B A;  1RI9 A;  1UJ0 A;  1ZUK A;  4LUE A;  2JT4 A;  5FW9 A;  4RTW A;  4CC2 A;  2KYM A;  3H0F A;  2F2W A;  2JTE A;  1I1J A;  4LE9 A;  1SHG A;  1UEC A;  3UA7 A;  2LCS A;  2QDL A;  2E5K A;  2EBP A;  2PNI A;  1ZUU A;  1B3Q A;  2KNB B;  1T3L A;  1ARK A;  2DA9 A;  1GCQ C;  1WYX A;  2HDA A;  2KRM A;  1AWX A;  4WCI A;  2J6F A;  2DL5 A;  2XMF A;  2FRY A;  5GJW B;  1UHF A;  2GBQ A;  1BB9 A;  2J6K A;  4F17 A;  1VYU A;  2LQN A;  1G83 A;  2EYX A;  2ROL A;  1EFN A;  1GCP A;  1X27 A;  2AKK A;  1SHF A;  2RN8 A;  2GTO A;  2LJ1 A;  3RNJ A;  2FPD A;  2D0N A;  2RF0 A;  3NMZ C;  4LN2 A;  2KE9 A;  1JQQ A;  5FWB A;  1BBZ A;  2FO0 A;  1SEM A;  2KR3 A;  2ECZ A;  1I0C A;  4J9C A;  4CC3 A;  2EKH A;  3TSZ A;  2DMO A;  5I11 A;  4ZNX A;  3KFV A;  2KGT A;  1AZG B;  1SRM A;  5I22 A;  1W6X A;  3NPF A;  1Y57 A;  2YUP A;  4OMN A;  2LNH B;  4AFU C;  3QWY A;  2DF6 A;  3PVL A;  1ZBJ A;  3A98 A;  2C0I A;  1UUE A;  2I0N A;  4RTT A;  1NLO C;  1K0S A;  3C0C A;  1OV3 A;  1M27 C;  4JJB A;  1JXM A;  1M30 A;  1IO6 A;  2HCK A;  2GQI A;  1NM7 A;  2GNC A;  4JJD A;  1WDX A;  2J05 A;  5IH2 A;  1X43 A;  5IXB A;  3VS7 A;  1YNZ A;  2RQW A;  1WXU A;  2C0T A;  1JO8 A;  3O5Z A;  2EPD A;  2KXD A;  3I5R A;  4Y92 A;  2KRO A;  2CDT A;  1T0J A;  4JZ4 A;  1NYG A;  4RTZ A;  4OMQ A;  1I07 A;  1UHC A;  3UAT A;  2MOX A;  2J06 A;  4FSS A;  3UF4 A;  1J3T A;  4JZ3 A;  4AFS C;  5IHN A;  1UG1 A;  3M0Q A;  2DBM A;  2M0Y A;  2EW3 A;  1HD3 A;  4AFZ C;  4A63 B;  1BU1 A;  1SSH A;  1YWO A;  2ABL A;  2EYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...