3M0PA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 4.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'ELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
molecule tags Signaling protein
source organism Gallus gallus
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0pA00
2BZXA 1PWTA 3EG2A 1AZEA 3CQTA 2CT3A 4Y92A 2PNIA 4RTTA 2J6FA 1JO8A 1GBRA 4HVWA 2K7AA 2ECZA 1KIKA 3VS1A 2GGRA 3TVTA 4AFZC 2JW4A 1NEBA 2KROA 2NWMA 1YWOA 1E7OA 1VA7A 5IXFA 3VS7A 1WXTA 1S1NA 4LN2A 2AKKA 3UA7A 2I0NA 3EG3A 4J9HA 1QWEA 4HVVA 2NUZA 2QDLA 1TG0A 2L3SA 4QT7A 3VS2A 1AD5A 1Y0MA 2C0IA 1M3BA 1WA7A 1UUEA 2F2VA 3C0CA 2OAWA 3TSWA 1WFWA 1YP5A 2YUNA 2YT6A 2MCNA 3VS4A 4D8DA 2DF6A 2YSQA 3NGPA 1OOTA 2AZSA 1GCQC 1ABQA 2EVRA 3VS3A 2FPFA 3FJ5A 4RUGA 4RTUA 2M51A 2DRKA 2RPNA 4K11A 2P4RA 3H0HA 2D1XA 2EYZA 2XMFA 2DL3A 1FYNA 1M3CA 4CC3A 2DILA 1WYXA 2KRSA 4LUEA 1QWFA 1H92A 2YUOA 1UE9A 4RTVA 2K9GA 1M27C 2H8HA 1SSHA 1B07A 1W1FA 2SRCA 1V1CA 2GTJA 2X3XD 2ESWA 4A63B 1AOJA 2V1QA 5ECAA 2KRMA 4OMOA 1ARKA 4CC2A 1YCSB 2SEMA 1CSKA 2M0YA 1YWPA 1PKSA 2W10A 2CUDA 2KRNA 2DL8A 1X69A 2DL7A 1NYGA 2LQNA 4DEYA 2DM1A 2FRWA 5FW9A 3U23A 3H41A 4AFUC 2DJQA 3NPFA 1ZBJA 1E6HA 1CKAA 1WI7A 3IQLA 1K9AA 1X6BA 1OPLA 4KRTA 3PE0A 4RTWA 4Z89A 2RQWA 3I5SA 4CC4B 2OJ2A 4JZ4A 2DBMA 2ENMA 2LMJA 5L23A 1G83A 4F14A 2G6FX 2KNBB 1QLYA 2CUBA 3VRZA 4AFQC 1RLQC 2VWFA 4D8KA 2EGCA 2A36A 1Z9QA 5IH2A 3VS5A 2EQIA 3NMZC 3O5ZA 1K76A 2HSPA 3I9QA 1GFCA 1UJYA 1H8KA 1WXUA 4DEXA 1NG2A 1NLPC 2L2PA 1YN8A 2D8JA 2CREA 4JJCA 1SEMA 3M0PA 1ZX6A 2K3BA 1A0NB 1WXBA 3QWYA 2O9VA 2EPDA 2RMOA 1WX6A 3UATA 4ORZA 1U5SA 3I5RA 1GRIA 2L3PA 4AFSC 1WDXA 2GQIA 1PRMC 2VVKA 2JT4A 2CSIA 2IIMA 3KFVA 4OMQA 2HEQA 2DYBA 4RTXA 3PVQA 4J9DA 1RUWA 5HCKA 3UA6A 1UJ0A 1W70A 1I0CA 1VYUA 2AK5A 1HD3A 3M0RA 2A28A 4OMPA 2LCSA 1M3AA 2KGTA 1ZUUA 2OI3A 1T3SA 2F2XA 2KT1A 1Z9ZA 1TUCA 2KYMA 1X2QA 1GL5A 1GBQA 1M30A 3RBBB 3A98A 5IHNA 2O88A 1W6XA 2JM8A 1OV3A 1UTIA 2RF0A 2FG0A 1K1ZA 4OMMA 2LJ1A 4Z8AA 2J06A 1UHFA 2DL5A 3EHQA 1SRLA 2J7IA 1RI9A 1YNZA 1B3QA 4J9GA 1GCPA 4JJDA 1K4US 2YUQA 3REAB 1I1JA 2JMCA 2ROTA 4R0KA 2KXCA 1X6GA 2L3QA 2KEAA 3H0IA 2KYBA 1PHTA 2KR3A 3EG0A 5GJVB 1SHGA 2BTTA 5FWBA 1T0HA 2EGEA 4Z88A 5GJWB 2GNCA 4FSSA 3R6NA 2DMOA 1KJWA 1BB9A 1E6GA 4OMLA 1ABOA 3RNJA 4JPBW 2HBWA 1ZSGA 1AWJA 3M0QA 2EBPA 1GCQA 1QKXA 1SRMA 3EGUA 4J9FA 2KE9A 1KSWA 2AZVA 2PTKA 4RTYA 2B86A 2FPDA 2LQWA 1UECA 3ULRB 3M0SA 1JXOA 1AWWA 2F2WA 2CT4A 1SHFA 2HDAA 1U06A 1QCFA 1AWXA 1PKTA 4F17A 1GFDA 4F16A 2CSQA 2JMAA 2C0OA 2DNUA 3QWXX 1U3OA 1X27A 1TUDA 1AVZC 3H0FA 2FRYA 2VKNA 3LH5A 4LUDA 3SEMA 2X3WD 3VS6A 2BZYA 1PRLC 2L0AA 1AEYA 1CKBA 1G2BA 4HVUA 2A37A 2JTEA 2EKHA 2O2OA 1FMKA 2ROLA 2DE0X 2FO0A 4GLMA 4J9CA 3UF4A 4LNPA 2LJ0A 1IO6A 4WCIA 2K6DA 1X43A 2ABLA 4AG2C 2MOXA 2W0ZA 2DA9A 2O31A 1J3TA 2J6KA 1NM7A 2LX7A 3VS0A 1HSQA 3REBB 4J9IA 4J9EA 2KT8A 1QKWA 2EW3A 2JS2A 4EIKA 2RQRA 1XOVA 3ZL7C 3I35A 1JEGA 4J9BA 1VYTA 4IIOA 2RN8A 1T0JA 2J05A 1T3LA 4ZNXA 1I07A 1NLOC 2YUPA 2RQVA 2EYXA 3EHRA 2ED0A 2CH4A 1K0XA 1M8MA 1PNJA 2EYWA 1UHCA 1LCKA 3PVLA 2GTOA 1JU5C 4X1VA 4ESRA 2DX1A 2K79A 2DVJA 2DL4A 1ZLMA 1AWOA 4OMNA 2JS0A 4AG1C 4M4ZA 2DRMA 2C0TA 2RQTA 5FWCA 2LP5A 4JJBA 3NHNA 4IIMA 1EFNA 3THKA 1ZUKA 1AZGB 2ED1A 2E5KA 1H3HA 5IHKA 1UDLA 2LNHB 4E6RA 1K0SA 4CC7A 1OPKA 1WLPB 1X2KA 2K2MA 2YDLA 2RQUA 2CDTA 5I22A 4LE9A 2JM9A 2LZ6B 1BK2A 2CH4W 3SHWA 3TSZA 2PZ1A 1NEGA 3EG1A 2DBKA 1MUZA 1RLPC 2HCKA 2EGAA 5I11A 1UFFA 2O9SA 1OEBA 4GBQA 3GBQA 2J6OA 2JXBA 2V1RA 2KBTA 2RNAA 1N5ZA 4JZ3A 4RTZA 1HJDA 3JV3A 5IXBA 1NYFA 2FPEA 1BU1A 1MV0B 2BZ8A 1SPKA 3M0TA 2AKLA 2LJ3A 2GBQA 3VRYA 1VYVA 2D8HA 1MV3A 5EC7A 4HXJA 2EYYA 2FEIA 1UG1A 1BBZA 1JQQA 5IHIA 2A08A 1KFZA 2KXDA 3M0UA 1UGVA 2MIOA 1JXMA 1Y57A 2DLPA 1ZUYA 4HCKA 2D0NA 1WIEA
chains in the Genus database with same CATH superfamily
1NJIU 1PWTA 1ZBXA 3VYGA 4IUPA 1AZEA 3CQTA 2CT3A 1JO8A 2K7AA 2P4TA 3FEOA 1GXIE 2JW4A 3I56T 3CCLT 1O9SA 2NUPA 2NWMA 1YWOA 1E7OA 2QASA 1WJSA 4FW2A 3SD4A 2E12A 3HRUA 2VGNA 5C0MA 4QQGA 1G5VA 2LC4A 3VS7A 5GMKh 1S1NA 2HL3A 1M90R 3MJXA 3M9QA 2QDLA 2XG8D 1YJWQ 4QT7A 1WHJA 4IUVA 3OYAA 2M9UA 2DEUA 2F2VA 3C0CA 3RERA 1VQ4Q 3TSWA 1WFWA 1YP5A 2YUNA 3TREA 2MCNA 2E3HA 1K8AR 1GCQC 5CKFA 3JCMJ 1W2BA 4PJMA 3FJ5A 4RUGA 1Y7XA 3OSVA 2HNIA 1Q82C 3FDRA 4K11A 2DKGA 2CP2A 1VQLA 2DXCA 4HKEA 2P4RA 1WHGA 2XMFA 4J8OA 1FYNA 3H8ZA 1KHCA 2KI7A 2VGMA 4CC3A 2DILA 4D6WA 2KMTA 4J83A 4BD3A 2DIQA 2YUOA 4AT1B 2EYQA 1G3YA 4C92A 2H8HA 4GY5A 3L2QA 1SSHA 3JB9G 1I4K1 2X3XD 2PUKB 3P8DA 1G8XA 2RHZA 2ZPIB 3MO8A 1K9MC 4C92E 1C0MA 4ZTJA 2SEMA 1CSKA 1FMWA 2M0YA 4KH0B 1YIJA 1YWPA 1Y96A 2LQNA 4DEYA 4AFUC 2DJQA 3OYGA 1E6HA 1CKAA 3CPFA 4OP0A 1OI1A 1X6BA 1OPLA 3EGDB 3EFRA 4KRTA 1WJQA 4RTWA 2RQWA 5A2QE 2OJ2A 4JZ4A 3LGFA 2LMJA 2ZZDA 2RHIA 4J6YA 4F7UE 2CUBA 4AFQC 4QKUA 4C8QG 4BDZA 2KSSA 4PJOG 2EGCA 3MEAA 1Z9QA 3CCMT 3EFSA 2VV5A 2D6FA 2MMPA 3I9QA 1V76A 3V8LA 4DBRA 1C1AA 2JN0A 5D7UA 3CCUA 3JAME 2DO3A 5GAN6 2HMAA 5KYYA 1NLPC 2L2PA 1TU0B 1BYMA 2ATCB 2D8JA 2DTHA 1ZX6A 2K3BA 1I5LA 4C8QA 1WXBA 3CCLA 5CKBA 1WX6A 4ORZA 1U5SA 1FX7A 5GAOm 1GRIA 3R6OA 1LOJA 2K57A 1PRMC 2VVKA 5KYUB 2JT4A 3RKXA 1VUBA 2IIMA 3KFVA 4C8QC 2DYBA 4QVDA 1QQJA 3X25B 4J9DA 2RJEA 1RUWA 1VQLT 3CXCP 2LNVA 1M1FA 1W70A 1I0CA 4PJOE 2AK5A 1WQ7A 2RI5A 3G71T 3RMSA 1Q82U 4C0DC 2RJFA 4F7UG 2HL5C 2F2XA 2KT1A 2JNGA 1Z9ZA 4FW1A 4O6JA 1GL5A 2FZCB 4MDWA 5HY6A 3A98A 5IHNA 2ZPFB 2PVGB 1W6XA 3LX7A 3X24B 4BUGA 5GAMd 1VQ6Q 1NZ9A 5J26A 4KGZB 2L3RA 2LQKA 1M1GA 1M2VA 4OVAA 5LJ3e 4Z8AA 3MP1A 1UHFA 3NTHA 3MP8A 1RI9A 1S72A 4C5HA 3G1JA 1WZOA 4KGXB 5LJ5j 2YUQA 3M57A 1I1JA 2JMCA 2ROTA 1MMAA 4J7IA 4MMLA 2L3QA 2ZPHB 3H0IA 2KYBA 1X6OA 3EG0A 4C92G 3JB9F 2X4WA 3EGXA 4L6V5 5KCHA 4BE0A 4RKUE 4OF1A 3SWNC 4PJOD 2DETA 3G4SA 3UT1A 5KYXA 2RA2A 2MAMA 4FSSA 1EX4A 2Y4XA 4X9CA 3R6NA 1KJWA 1BB9A 4M75A 4OMLA 3C94A 1Q7YC 2QDYB 1TOVA 3M0QA 5GANe 2VB6A 2QXFA 1SRMA 4LDVA 2DD5A 3EGUA 4J9FA 2KE9A 3AT1B 3QJ6A 1JXOA 2RO0A 4B9XA 3OSSC 2QK0A 1SHFA 2HDAA 1KC8R 1RABB 3CC2T 4GLKA 1AWXA 1PKTA 4II1A 4A4GA 1D1AA 2DNUA 4M77B 3H0FA 2FRYA 2X35A 2CGHA 2JVVA 1U1SA 1RAEB 2L0AA 4C92F 3L2ZA 4HVUA 2A37A 3JCMf 1TWBA 1ZSZB 3SFMA 3L1AA 2O2OA 2DXBA 4J9CA 2DE0X 4ANJA 2QA4T 1HXDA 1AHJB 1OU9A 3CCSA 4LNPA 5CR2A 2LJ0A 2H3EB 2RM4A 4NL3A 1IO6A 1W2BS 2K5IA 5I2MA 1VQ7A 3OYBA 2LX7A 3REBB 1RL2A 3BE3A 3CEYA 4J9IA 5GAMe 1G3TA 2YHTA 1QKWA 2EW3A 4FM4B 3CC2A 5KYNA 2G3RA 3I35A 2D9TA 4L5GA 2M02A 4J9BA 3D7SB 2RN8A 1Q7YU 4ZNXA 2E6NA 2YUPA 1NLOC 3GLXA 2RQVA 1VQ8A 3M4YA 1K0XA 2KK4A 1N8RU 1PNJA 2EYWA 2C06A 1KK7A 1LCKA 4M77G 1JJ2P 2GTOA 4C92D 3HPWA 1M4ZA 2XKOC 4ESRA 4HT8A 4ZN3A 1W2BP 4JLGA 3G4ST 4M75G 2YWWA 3L42A 2E6ZA 1M90C 2AHJB 2RQTA 4JDSA 4Z02A 5FWCA 3RKWA 1VQ4A 9ATCB 4B9WA 2GF7A 1AZGB 2DYIA 1H3HA 1VIFA 3A8MB 4BY6C 3CCSQ 3I55T 3CCET 4CC7A 1OX9A 1WLPB 2K2MA 2DJZA 4E7SA 5GMKe 4A54A 2WSEE 4F7UB 1V29B 2CP0A 4A4FA 1RLPC 4PJOF 2EGAA 5I11A 1UFFA 4FYXB 4M75E 2JXBA 1VIEA 4JZ3A 4OGEA 2HKNA 3JV3A 2FPEA 3GIBA 2AKLA 2LJ3A 3F70A 4ZN1A 4CRIA 1YHQQ 2D8HA 1MV3A 2JTFA 4PKCC 3CCEA 2E70A 1JQQA 4F04B 4X34A 2QQBA 5IN1A 2KXDA 2COZA 3CC7Q 3MP6A 4FL6A 1WGSA 1VQ9Q 4KBMB 4E7JA 1EIFA 3EH2A 3MPUB 3VU3C 5GMKl 3CCEQ 3QHSA 2BZXA 2WACA 4M78B 4Y92A 2PNIA 4RTTA 3UWNA 3HSBA 4HVWA 2ECZA 1KIKA 3TVTA 4AFZC 1TUGB 2KY9A 1VA7A 4RG8A 1YI2T 4BI3A 1S72Q 5DM7R 2QEXQ 2KVQG 2A3LA 4LDYA 2AKKA 4J9HA 3QJYA 1QWEA 2NUZA 5DY9A 1AD5A 3ASKA 3SWNA 4WF2A 1Y0MA 2C0IA 4V2SA 1UUEA 1QVGS 5GMKj 5I21A 3CCRT 2OAWA 3LWHA 3JCMg 3VS4A 4L59A 2DF6A 3CXCS 1OOTA 2L5QA 2EVRA 4C0FA 2DPPB 5FU6B 2OTLQ 2EQMA 4M7AD 1Y96B 4CI0C 2RPNA 3V7SA 2V8JA 3PIOA 3OS0A 4KUDK 3EGXB 4M77F 2DL3A 3PIPA 1KD1U 2EAYA 4QVCA 1WYXA 2XDBA 1BIAA 3TQ7P 4PJOA 3LWIA 1KC8U 1X75C 3V8KA 3CPWP 1M27C 1M8VA 1IGQA 1IZ6A 3URGA 1W1FA 3PMIA 3HHTB 4A63B 1AOJA 4M78G 3CMAA 1YI2Q 2E3IA 3JCMb 4OMOA 1B7TA 3QDFA 6AT1B 1YCSB 1O75A 2RHYA 5D6YA 3CC2Q 2CUDA 2M16A 2FZKB 1ACMB 4N0AA 1NYGA 3HRTA 3OS5A 5CKHA 3U23A 3H41A 3HL8A 3OMGA 8AT1B 1WI7A 2RJCA 1K9AA 4KUIA 2OTJA 2QA4A 4VUBA 3PE0A 4N0AC 5C6SA 3P8BB 1SKUB 4QQDA 5IT9E 3JSCA 4C0GA 2KNBB 1QLYA 4FIBA 5LJ3d 5A0DA 3VRZA 1RLQC 1I8FA 2L8DA 3WVEB 4HCCA 3S6WA 2VASA 3VUZA 1Y07A 3DLLA 2Z0WA 3CPWA 1H8KA 3M54A 1EZZB 2OX7A 1WXUA 3LW5E 4DEXA 2QQAA 5GAMg 3OYHA 3CC4Q 4B6MA 1Q7YR 3I56A 2RJDA 4IURA 5HK3A 2DVEA 4JJCA 2OTLT 1UGPB 3JB9H 4A53A 1QW1A 3OYEA 1A0NB 1JJ2A 4JRQA 3I55Q 2RHXA 3OQ5A 3M55A 1XQHA 3I5RA 2P0QA 3KUFA 1NJIR 1K9MU 1VQOA 2CSIA 3JRZA 4M7AE 4OMQA 3JB9J 4ZGJB 4RTXA 3GPLA 1SF9A 3G71Q 1OZ2A 3RDVA 5HCKA 1I5OB 1SSFA 3UA6A 1UJ0A 1VQLQ 3A8OB 1VYUA 2NUTA 4RG2A 2A28A 4KGVB 1M3AA 2KGTA 2DZCA 3OA6A 1KD1R 2KYMA 4A4KA 1BI2A 5GANg 4HT9A 1GBQA 3RBBB 3GF5A 1Q86U 5LJ3j 3RR6A 1OV3A 1W4SA 2R5MA 3VJPA 2FG0A 2K5FA 3BY7A 3EGDA 4OMMA 2LJ1A 5CVIA 2DL5A 1YI2A 3EHQA 1FXXA 1VQOT 1YNZA 2ZGWA 5IAYA 3M59A 2KEAA 2EFIA 2BTTA 3OYNA 1IREB 3N5BB 3ZFJA 4M7AB 4J7FA 4MZMA 5FWBA 5A0LA 5GAOq 4HCBA 1VQ7T 4XTZA 2GNCA 4M78D 1HK9A 3M58A 2DMOA 1K73U 1E6GA 2HBWA 4C92B 2EBPA 1QKXA 3LLRA 1G3WA 3GNFB 3CCUT 4M7DG 1KSWA 1PSFA 1WHLA 1YJWA 2B86A 5CKEA 1N8RR 2CT4A 4BI4A 3OYDA 4KT0E 1U06A 2RK1A 1MGQA 4F17A 2VC8A 1GFDA 3JB9I 3ZEHA 2CSQA 2JMAA 2HD0A 3G4SQ 2YLBA 3QWXX 1Q81C 1U3OA 1X27A 2VXFA 2VKNA 3PT9A 2X3WD 1PG5B 1D1CA 2FVUA 2QTXA 1PRLC 1ZSZA 1G2BA 1M1KC 5CIUA 2JTEA 2ROLA 4GLMA 3UF4A 2R57A 2KDSA 5GAN7 4PLIA 4JRIA 1OYXA 5KH6A 1ZSZC 1X43A 2ABLA 2DA9A 3GOXA 2EJGA 3MEUA 1NM7A 2CZ6B 4JS4A 2BIVA 3SB2A 1RAAB 2KT8A 5GANd 3CPWS 3FRNA 4C8QD 5FLXE 1KG1A 2XICA 3ZL7C 3JCMh 3VYHB 1MMGA 1K73C 1VQMT 3BDLA 4IIOA 1R0BG 1T3LA 3RKYA 2QQSA 2VUBA 3E2UA 5KE3A 1R0CB 2EYXA 3EAEA 2DTOA 3CBOA 2EJ9A 2RI2A 4TVRA 1JU5C 2M1HA 2P0PA 2A0FB 1K8AC 2DEQA 2ZPEB 2BKDN 2K79A 4LDUA 1ZLMA 2V8KA 1S72T 4XQ3A 1WHKA 1JRIA 2QQ9A 5FU6C 4J6XA 4M4ZA 2C0TA 3CCLQ 3OYLA 3SWNB 4M75C 5LJ3g 1ZUKA 5GAOr 2ED1A 2E5KA 3QXEB 5LJ5d 2WSCE 3V8JA 4E6RA 4M7DD 3CCUQ 1MNDA 2YDLA 3CC7T 5FROA 4M75D 4OB2B 2JM9A 3RESA 2CH4W 3SHWA 2PZ1A 3J7AF 3EG1A 3JCMe 1PD1A 3A8HB 4FT2A 1VQ7Q 2FB7A 1RADB 2DBKA 4YTLA 1PC0A 3M5AA 3FB9A 3AHUA 1SG5A 4DBFA 3ER0A 2V1RA 2KBTA 1N5ZA 1H3ZA 1KD1C 5GAN5 4ATOA 3DKMA 1WPYA 1YFNA 5GAMf 2K5LA 3HRSA 1PM3A 1VQOQ 3PMTA 1G3SA 5FRMA 5CQYA 4HXJA 3UPUA 2EYYA 3G7ZA 2XIDA 4F7UF 1WNLA 2MWPA 4WTOB 4C8QB 1JXMA 4XTYA 4Y28E 2DLPA 3P8HA 4HCKA 3G6EQ 1IXDA 4PJJA 3EG2A 3CCRQ 2NYSA 4KULA 2E10A 2J6FA 3MEVA 3VS1A 2DK3A 4JRKA 3QZ9B 2KROA 2QEXT 3RMQA 5IXFA 3NFCA 1WQWA 1NPPA 1WXTA 3LYIA 3FJPA 2I0NA 3EG3A 3OYCA 4HVVA 3VS2A 2L3SA 2PUOB 4C5IA 1M3BA 1WA7A 1VQMA 4BY6B 2XK0A 1N27A 5LJ5f 4ELZC 2YT6A 3FIFA 1Q86R 2O4XA 1OU8A 3NGPA 4PJNA 3VS3A 1Q95G 3JCMd 4BDYA 3V7CA 3A8LB 3NTIA 3CCVA 4RTUA 3M56A 4QVZA 2MF2A 5GANh 4ZGDB 3CC4T 1TH7A 1FWZA 3OY9A 4N4IA 2QG9B 2RK2A 1QVPA 5AT1B 3KXTA 2E41A 2KRSA 4LUEA 1H92A 1UE9A 1VQ4T 4RTVA 1X01A 3OS2A 1LVKA 1NJIC 4LD6A 2SRCA 1V1CA 2ESWA 3S3NA 2MYSA 2E5QA 2OTJT 1K9MR 2V1QA 2JJ9A 5ECAA 4ZGEB 2KRMA 2QGGA 2HBPA 1MNEA 1ARKA 2CP6A 2NUTB 4IKFA 3EFOA 1PKSA 3HFNA 2W10A 3CCST 1PCXA 4RCBA 1VQ8T 1RAGB 1X69A 2PVDB 3NPFA 1ZBJA 4BB7A 3CMAT 1UGQB 3IQLA 2AT1B 1KC8C 1NE8A 4OB0B 4CC4B 3UDCA 2DBMA 4HCZA 1G83A 4F14A 1K8AU 3RIRA 4DOVA 4BACA 3HFOA 2VWFA 4IUUA 4ME7A 4D8KA 2A36A 4PFZA 3WVDB 2RI3A 2B8AA 3JCMQ 5IH2A 3VS5A 1IGUA 2EQIA 3DB4A 3NMZC 2LCCA 1K76A 1UJYA 1VQMQ 2EQJA 1D0ZA 3V7RA 2QYZA 3EH1A 1M90U 2FYKA 4PFOA 1NG2A 2CREA 1F1BB 2IVWA 1VQKQ 3QWYA 5DLOA 3JCMX 5GAMh 2O9VA 2EPDA 1IB8A 2FHDA 4XU0A 4M78E 4M77A 4NOYA 2LQ8A 1NBEB 2QA4Q 4BE1A 3KBGA 3OYKA 4AFSC 1WDXA 2V26A 4DOWA 2HEQA 1KQSP 2F1LA 3E1SA 3CC4A 4PJLA 1ZQ1A 3JCMV 1JBMA 2LDMA 1HD3A 1VOMA 4OMPA 2LCSA 3QDRB 2LVMA 1M1KR 3GP8A 2K2VA 2OI3A 3FLGA 1TUCA 1X2QA 5LJ5g 1M30A 1QP3A 4LDWA 1KQ2A 2RB6A 2JM8A 1XJWB 2I2LA 5M9OA 2RF0A 4J6WA 4C0DB 1K1ZA 2O01E 1VQ9T 4FYYB 4BI8B 2DXTA 1VQ5T 5A0GA 4FSXA 2J06A 2QI2A 3EFOB 1SRLA 2J7IA 4J9GA 4JJDA 2CZ7B 3OW2S 4QW2A 4R0KA 2KXCA 4PL6A 3A1PA 1B34A 1RACB 4E7HA 1PHTA 1OQKA 1SHGA 4M7AC 4FT4A 3QIIA 1YITT 1M2OA 5CQXA 4PJOB 3RNJA 4JPBW 2QGFB 3CCQA 3J80E 4M75F 1ZSGA 4M7DC 1AWJA 2QAZA 4C8QE 2XDPA 4X9DA 2DTIA 1VQ6T 2JTMA 2AZVA 2PTKA 1R77A 2NLUA 2FPDA 7AT1B 5J3BA 3M0SA 1AWWA 2F2WA 1D0XA 5FRNA 2EQUA 5GMKi 2COWA 3QG1A 1QCFA 1WHMA 2M0OA 1Y71A 1PSEA 3PTAA 4F16A 3JCMP 4M7DB 1QVFP 3Q1JA 1QCOA 2CS7A 5KYWB 2VXEA 3SEMA 2RD1A 4LUDA 3VS6A 4PJOC 2BZYA 3S3OA 1CKBA 4A4EA 4PNOA 2EKHA 1FMKA 1YITQ 2FO0A 3LH0A 5D6WA 3ME9A 3L2WA 4WCIA 1YIJT 2K6DA 4AG2C 2W0ZA 3TU4K 2O31A 2J6KA 2Y4YA 1XTDA 2HKQB 1HSQA 4OGCA 4J9EA 3O8VA 4C8QF 1QVGP 4EIKA 2RQRA 1XOVA 2YRCA 4Y91A 1VQ5Q 3PNWC 1JEGA 3META 1T0JA 2J05A 4C5EA 5KYWA 5GAOn 1N8RC 1I07A 4FCYA 3CCMQ 1VQPA 2D0QB 2ED0A 3CD6A 2CH4A 4HA8A 3JCMW 1M8MA 2HZYA 1UHCA 3PVLA 5GAMj 1YJWT 2DXUA 4M77E 4M78A 5J39A 3GNGA 1XNIA 2DL4A 1IRXA 4OMNA 4MZTA 1B34B 1YHQA 2JS0A 4F7UA 2XU8A 4AG1C 3CMEQ 5LL6S 4EPCA 2LP5A 4JJBA 3NHNA 4IIMA 3TCJA 4QQ6A 3THKA 4UC4A 1YJ9T 5CK9A 5IHKA 1UDLA 3QUIA 2LNHB 2XI9A 3OYFA 1YITA 1QVFS 3CCQT 1X2KA 5LJ3h 2X9HA 2WSFE 1D3BB 5KYXB 3OW2P 3CCVT 1MMDA 2VYTA 1VQ6A 3CCJQ 4FU6A 1OZ3A 2K4YA 4XTXA 2XDDA 1NEGA 4JUVA 1JB0E 5GANj 2OAUA 4XAXB 1OEBA 3GBQA 3OBYA 4J5YA 2RNAA 5GAOl 5GAOp 1BIBA 5FU7C 4R56A 2E4HA 4PFPA 1HJDA 2YXYA 3QSUA 1BU1A 1MV0B 1SPKA 2F69A 5LJ3f 3M0TA 4JRPA 3QYHB 1UEBA 2QTVA 3VRYA 5D6XA 2BE9B 3CCJT 2HQEA 1UG1A 1BBZA 5IHIA 2A08A 2JUFA 4ELYC 5GAN4 1LJOA 2MIOA 1MHNA 1Y57A 3G71A 2L89A 3M53A 3VV0A 4MDXA 4N4HA 4M7DF 2MI6A 1WIEA 3QYGB 5LJ5e 4LDXA 1GBRA 1YJ9Q 3DLMA 2GGRA 3MHXA 2COYA 4RCCA 1AT1B 2NUPB 2HSEB 2CZ0B 1NEBA 4FYVB 1LPLA 2DIGA 5L8RE 3OW2A 1YJNQ 4LN2A 3UA7A 1VQPT 2E64A 2DERA 1Q81U 1TG0A 4XTUA 4EMKB 1UGRB 2F5KA 3C95A 2EJFA 4M78C 3RUXA 3DB3A 3EG9A 3MEWA 4D8DA 2YSQA 2AZSA 1ABQA 3X26B 2FPFA 5AYFA 5EG2A 2M51A 2DRKA 3H0HA 3CMEA 4M7DE 1YHQT 2A7YA 2D1XA 2EYZA 1JJ2S 1M3CA 2P84A 1YIJQ 5DLQE 1QWFA 5KE2A 1LNXA 2V8IA 2MWOA 2GFAA 2K9GA 4E7IA 3S3MA 2EWNA 3BDUA 1U1TA 1QP2A 2HQXA 2HQHA 1NPRA 4M7AG 1B07A 1VQKA 1YCYA 2GTJA 4XU1A 2R5AA 2E1HA 3CCMA 1VQPQ 4NL2A 1D1BA 3INZA 1BI1A 4KH1B 4C0ZA 4CC2A 2YRVA 3MKDA 2XHCA 3NTKA 5GMKm 2LT1A 2ZCFB 4JLIA 2FZGB 2KRNA 2DL8A 2DL7A 3OYMA 2DM1A 2FRWA 5FW9A 3G6ET 1ZHIA 1U8RA 5HK0A 4OB3B 3L2VA 1FMVA 3OS1A 4M7AA 2LRQA 4MMKA 4Z89A 3I5SA 2ENMA 5L23A 1Q81R 2P0KA 2G6FX 4M78F 2RH2A 3X28B 1MMNA 4O5VA 4Q5WA 1IHWA 2CP3A 1KHIA 1WHHA 2FL7A 3O5ZA 2HSPA 1GFCA 1PD0A 3H9NA 5CCAA 2DFUA 1M9SA 3OB9A 3CCVQ 1VQNT 3X20B 1WJRA 1YN8A 4M7AF 4XU3A 1SEMA 3M0PA 3CCQQ 2K3YA 2BE7D 2QQRA 1R8OB 2MPXC 1UB4A 2RMOA 3UATA 3C12A 3TEEA 2YLCA 2CZ1B 2L3PA 4M75B 2LCLA 2GQIA 8ATCB 3CMET 2OTLA 2EKOA 3PVQA 1VQ9A 3I55A 2H3JA 4M77C 1TS9A 2PVOB 3E9FA 2EIFA 4NS5A 1QVGA 3M0RA 3I56Q 1TSFA 4XTWA 1ZUUA 1T3SA 2DAQA 5FU7B 3ZBDA 4JJNK 1VQ5A 2HAXA 3CCRA 2F5TX 1D09B 4DQ2A 4OMFB 4IUQA 2O88A 3M4GA 3J81E 4E7KA 2GQVA 5CAIA 1UTIA 1M2VB 1QVFA 4ZTFA 5LJ5h 1Q82R 1N6AA 3L2UA 4MZPA 2CYZB 1B3QA 1GCPA 1HYOA 3WXMB 3REAB 1KQSA 1K4US 1X6GA 5GANf 2KR3A 5GJVB 3E9GA 4PK4A 2DZ9A 5KYYB 1T0HA 4JS5A 1UGSB 4PLLA 2EGEA 3MCAB 4Z88A 5GJWB 1YJNA 2LX9A 4LD9K 1D0YA 1N9RA 1ABOA 1DJ7B 4RMOA 2JZ2A 1GCQA 2ZPGB 5HKCA 1IHVA 4FYWB 4EDUA 3CMAQ 1BKBA 3T9NA 4RTYA 2X4XA 2LQWA 1UECA 1BCMA 3ULRB 4N4GA 3OYIA 3CD6T 1VQ8Q 2Y90A 4EMHA 3LGLA 3CBMA 4DBHA 4LXCA 1VQNA 1ZA1B 1TXQA 2C0OA 1C6VX 4C92C 1TUDA 1AVZC 1M1KU 2OTJQ 3LH5A 1RAFB 1AEYA 4A4HA 3G6EA 1BI0A 1RAHB 5GAN2 3OYYA 2ZPBB 2K3XA 3A5ZB 1KQ1A 2X51A 1KQSS 4E7LA 1YJ9A 4DA4A 2MOXA 2E65A 1J3TA 1OULA 3CXCA 2RHUA 4P5NA 3QPHA 3VS0A 4XU2A 4M77D 4C5GA 1VQNQ 1TTHB 3VKIA 2PU9B 3C4SA 2JS2A 2CP7A 2X4JA 3SDZA 3QZ5B 4E7ZA 5GAN3 2LTOA 1VYTA 5CKDA 3JCMc 1D3BA 5GAN8 3EHRA 1ZA2B 3PGGA 2JOYA 3E19A 3FC3A 2ZAEA 2X4YA 5KYUA 4EMGA 4X1VA 4OB1B 1Q86C 3CBPA 1P92A 2O4XB 2DX1A 3HTRA 1YJNT 2DVJA 4IUTA 4E47A 1AWOA 4E2FB 1BI3A 3CCJA 4R55A 1YBYA 2IG0A 1RAIB 2GFUA 2XD0A 1K73R 1OX8A 3BFMA 2AIRB 2DRMA 5I2SA 3OMCA 2KQWA 3CD6Q 1EFNA 3QBYA 3BW1A 4M7DA 3OBWA 2EQKA 3H6ZA 4EMKC 2R58A 1K0SA 2CP5A 2BUDA 1OPKA 4BE2A 3QO3A 1VQKT 3HKSA 2QEXA 2RQUA 2DD4A 2CDTA 3OYJA 5I22A 2LT4A 4LE9A 2LZ6B 1BK2A 1H641 1M5Q1 2KAFA 2MK5A 3EG9B 3TSZA 2CKKA 4EMKA 1QMCA 4XK8E 1MUZA 4AMCA 1BCOA 2HCKA 5CO7A 2O9SA 4GBQA 2J6OA 3PFSA 3JB9D 1RI0A 1QCNA 4RTZA 2IPOB 5IXBA 1NYFA 3QKJA 2BZ8A 4DBQA 2GCXA 2PQWA 2GBQA 3CC7A 1I81A 1VYVA 3HP9A 5EC7A 3L2RA 2FEIA 3VUBA 2YRDA 1KFZA 3A8GB 5KCOA 3M0UA 4XTVA 1UGVA 1ZUYA 2D0NA 1N9SA
chains in the Genus database with same CATH topology
2BZXA 1PWTA 3EG2A 1AZEA 3CQTA 2CT3A 4Y92A 2PNIA 4RTTA 2J6FA 1JO8A 1GBRA 4HVWA 2K7AA 2ECZA 1KIKA 3VS1A 2GGRA 3TVTA 4AFZC 2JW4A 1NEBA 2KROA 2NWMA 1YWOA 1E7OA 1VA7A 5IXFA 3VS7A 1WXTA 1S1NA 4LN2A 2AKKA 3UA7A 2I0NA 3EG3A 4J9HA 1QWEA 4HVVA 2NUZA 2QDLA 1TG0A 2L3SA 4QT7A 3VS2A 1AD5A 1Y0MA 2C0IA 1M3BA 1WA7A 1UUEA 2F2VA 3C0CA 2OAWA 3TSWA 1WFWA 1YP5A 2YUNA 2YT6A 2MCNA 3VS4A 4D8DA 2DF6A 2YSQA 3NGPA 1OOTA 2AZSA 1GCQC 1ABQA 2EVRA 3VS3A 2FPFA 3FJ5A 4RUGA 4RTUA 2M51A 2DRKA 2RPNA 4K11A 2P4RA 3H0HA 2D1XA 2EYZA 2XMFA 2DL3A 1FYNA 1M3CA 4CC3A 2DILA 1WYXA 2KRSA 4LUEA 1QWFA 1H92A 2YUOA 1UE9A 4RTVA 2K9GA 1M27C 2H8HA 1SSHA 1B07A 1W1FA 2SRCA 1V1CA 2GTJA 2X3XD 2ESWA 4A63B 1AOJA 2V1QA 5ECAA 2KRMA 4OMOA 1ARKA 4CC2A 1YCSB 2SEMA 1CSKA 2M0YA 1YWPA 1PKSA 2W10A 2CUDA 2KRNA 2DL8A 1X69A 2DL7A 1NYGA 2LQNA 4DEYA 2DM1A 2FRWA 5FW9A 3U23A 3H41A 4AFUC 2DJQA 3NPFA 1ZBJA 1E6HA 1CKAA 1WI7A 3IQLA 1K9AA 1X6BA 1OPLA 4KRTA 3PE0A 4RTWA 4Z89A 2RQWA 3I5SA 4CC4B 2OJ2A 4JZ4A 2DBMA 2ENMA 2LMJA 5L23A 1G83A 4F14A 2G6FX 2KNBB 1QLYA 2CUBA 3VRZA 4AFQC 1RLQC 2VWFA 4D8KA 2EGCA 2A36A 1Z9QA 5IH2A 3VS5A 2EQIA 3NMZC 3O5ZA 1K76A 2HSPA 3I9QA 1GFCA 1UJYA 1H8KA 1WXUA 4DEXA 1NG2A 1NLPC 2L2PA 1YN8A 2D8JA 2CREA 4JJCA 1SEMA 3M0PA 1ZX6A 2K3BA 1A0NB 1WXBA 3QWYA 2O9VA 2EPDA 2RMOA 1WX6A 3UATA 4ORZA 1U5SA 3I5RA 1GRIA 2L3PA 4AFSC 1WDXA 2GQIA 1PRMC 2VVKA 2JT4A 2CSIA 2IIMA 3KFVA 4OMQA 2HEQA 2DYBA 4RTXA 3PVQA 4J9DA 1RUWA 5HCKA 3UA6A 1UJ0A 1W70A 1I0CA 1VYUA 2AK5A 1HD3A 3M0RA 2A28A 4OMPA 2LCSA 1M3AA 2KGTA 1ZUUA 2OI3A 1T3SA 2F2XA 2KT1A 1Z9ZA 1TUCA 2KYMA 1X2QA 1GL5A 1GBQA 1M30A 3RBBB 3A98A 5IHNA 2O88A 1W6XA 2JM8A 1OV3A 1UTIA 2RF0A 2FG0A 1K1ZA 4OMMA 2LJ1A 4Z8AA 2J06A 1UHFA 2DL5A 3EHQA 1SRLA 2J7IA 1RI9A 1YNZA 1B3QA 4J9GA 1GCPA 4JJDA 1K4US 2YUQA 3REAB 1I1JA 2JMCA 2ROTA 4R0KA 2KXCA 1X6GA 2L3QA 2KEAA 3H0IA 2KYBA 1PHTA 2KR3A 3EG0A 5GJVB 1SHGA 2BTTA 5FWBA 1T0HA 2EGEA 4Z88A 5GJWB 2GNCA 4FSSA 3R6NA 2DMOA 1KJWA 1BB9A 1E6GA 4OMLA 1ABOA 3RNJA 4JPBW 2HBWA 1ZSGA 1AWJA 3M0QA 2EBPA 1GCQA 1QKXA 1SRMA 3EGUA 4J9FA 2KE9A 1KSWA 2AZVA 2PTKA 4RTYA 2B86A 2FPDA 2LQWA 1UECA 3ULRB 3M0SA 1JXOA 1AWWA 2F2WA 2CT4A 1SHFA 2HDAA 1U06A 1QCFA 1AWXA 1PKTA 4F17A 1GFDA 4F16A 2CSQA 2JMAA 2C0OA 2DNUA 3QWXX 1U3OA 1X27A 1TUDA 1AVZC 3H0FA 2FRYA 2VKNA 3LH5A 4LUDA 3SEMA 2X3WD 3VS6A 2BZYA 1PRLC 2L0AA 1AEYA 1CKBA 1G2BA 4HVUA 2A37A 2JTEA 2EKHA 2O2OA 1FMKA 2ROLA 2DE0X 2FO0A 4GLMA 4J9CA 3UF4A 4LNPA 2LJ0A 1IO6A 4WCIA 2K6DA 1X43A 2ABLA 4AG2C 2MOXA 2W0ZA 2DA9A 2O31A 1J3TA 2J6KA 1NM7A 2LX7A 3VS0A 1HSQA 3REBB 4J9IA 4J9EA 2KT8A 1QKWA 2EW3A 2JS2A 4EIKA 2RQRA 1XOVA 3ZL7C 3I35A 1JEGA 4J9BA 1VYTA 4IIOA 2RN8A 1T0JA 2J05A 1T3LA 4ZNXA 1I07A 1NLOC 2YUPA 2RQVA 2EYXA 3EHRA 2ED0A 2CH4A 1K0XA 1M8MA 1PNJA 2EYWA 1UHCA 1LCKA 3PVLA 2GTOA 1JU5C 4X1VA 4ESRA 2DX1A 2K79A 2DVJA 2DL4A 1ZLMA 1AWOA 4OMNA 2JS0A 4AG1C 4M4ZA 2DRMA 2C0TA 2RQTA 5FWCA 2LP5A 4JJBA 3NHNA 4IIMA 1EFNA 3THKA 1ZUKA 1AZGB 2ED1A 2E5KA 1H3HA 5IHKA 1UDLA 2LNHB 4E6RA 1K0SA 4CC7A 1OPKA 1WLPB 1X2KA 2K2MA 2YDLA 2RQUA 2CDTA 5I22A 4LE9A 2JM9A 2LZ6B 1BK2A 2CH4W 3SHWA 3TSZA 2PZ1A 1NEGA 3EG1A 2DBKA 1MUZA 1RLPC 2HCKA 2EGAA 5I11A 1UFFA 2O9SA 1OEBA 4GBQA 3GBQA 2J6OA 2JXBA 2V1RA 2KBTA 2RNAA 1N5ZA 4JZ3A 4RTZA 1HJDA 3JV3A 5IXBA 1NYFA 2FPEA 1BU1A 1MV0B 2BZ8A 1SPKA 3M0TA 2AKLA 2LJ3A 2GBQA 3VRYA 1VYVA 2D8HA 1MV3A 5EC7A 4HXJA 2EYYA 2FEIA 1UG1A 1BBZA 1JQQA 5IHIA 2A08A 1KFZA 2KXDA 3M0UA 1UGVA 2MIOA 1JXMA 1Y57A 2DLPA 1ZUYA 4HCKA 2D0NA 1WIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZX A;  1PWT A;  3EG2 A;  1AZE A;  3CQT A;  2CT3 A;  4Y92 A;  2PNI A;  4RTT A;  2J6F A;  1JO8 A;  1GBR A;  4HVW A;  2K7A A;  2ECZ A;  1KIK A;  3VS1 A;  2GGR A;  3TVT A;  4AFZ C;  2JW4 A;  1NEB A;  2KRO A;  2NWM A;  1YWO A;  1E7O A;  1VA7 A;  5IXF A;  3VS7 A;  1WXT A;  1S1N A;  4LN2 A;  2AKK A;  3UA7 A;  2I0N A;  3EG3 A;  4J9H A;  1QWE A;  4HVV A;  2NUZ A;  2QDL A;  1TG0 A;  2L3S A;  4QT7 A;  3VS2 A;  1AD5 A;  1Y0M A;  2C0I A;  1M3B A;  1WA7 A;  1UUE A;  2F2V A;  3C0C A;  2OAW A;  3TSW A;  1WFW A;  1YP5 A;  2YUN A;  2YT6 A;  2MCN A;  3VS4 A;  4D8D A;  2DF6 A;  2YSQ A;  3NGP A;  1OOT A;  2AZS A;  1GCQ C;  1ABQ A;  2EVR A;  3VS3 A;  2FPF A;  3FJ5 A;  4RUG A;  4RTU A;  2M51 A;  2DRK A;  2RPN A;  4K11 A;  2P4R A;  3H0H A;  2D1X A;  2EYZ A;  2XMF A;  2DL3 A;  1FYN A;  1M3C A;  4CC3 A;  2DIL A;  1WYX A;  2KRS A;  4LUE A;  1QWF A;  1H92 A;  2YUO A;  1UE9 A;  4RTV A;  2K9G A;  1M27 C;  2H8H A;  1SSH A;  1B07 A;  1W1F A;  2SRC A;  1V1C A;  2GTJ A;  2X3X D;  2ESW A;  4A63 B;  1AOJ A;  2V1Q A;  5ECA A;  2KRM A;  4OMO A;  1ARK A;  4CC2 A;  1YCS B;  2SEM A;  1CSK A;  2M0Y A;  1YWP A;  1PKS A;  2W10 A;  2CUD A;  2KRN A;  2DL8 A;  1X69 A;  2DL7 A;  1NYG A;  2LQN A;  4DEY A;  2DM1 A;  2FRW A;  5FW9 A;  3U23 A;  3H41 A;  4AFU C;  2DJQ A;  3NPF A;  1ZBJ A;  1E6H A;  1CKA A;  1WI7 A;  3IQL A;  1K9A A;  1X6B A;  1OPL A;  4KRT A;  3PE0 A;  4RTW A;  4Z89 A;  2RQW A;  3I5S A;  4CC4 B;  2OJ2 A;  4JZ4 A;  2DBM A;  2ENM A;  2LMJ A;  5L23 A;  1G83 A;  4F14 A;  2G6F X;  2KNB B;  1QLY A;  2CUB A;  3VRZ A;  4AFQ C;  1RLQ C;  2VWF A;  4D8K A;  2EGC A;  2A36 A;  1Z9Q A;  5IH2 A;  3VS5 A;  2EQI A;  3NMZ C;  3O5Z A;  1K76 A;  2HSP A;  3I9Q A;  1GFC A;  1UJY A;  1H8K A;  1WXU A;  4DEX A;  1NG2 A;  1NLP C;  2L2P A;  1YN8 A;  2D8J A;  2CRE A;  4JJC A;  1SEM A;  3M0P A;  1ZX6 A;  2K3B A;  1A0N B;  1WXB A;  3QWY A;  2O9V A;  2EPD A;  2RMO A;  1WX6 A;  3UAT A;  4ORZ A;  1U5S A;  3I5R A;  1GRI A;  2L3P A;  4AFS C;  1WDX A;  2GQI A;  1PRM C;  2VVK A;  2JT4 A;  2CSI A;  2IIM A;  3KFV A;  4OMQ A;  2HEQ A;  2DYB A;  4RTX A;  3PVQ A;  4J9D A;  1RUW A;  5HCK A;  3UA6 A;  1UJ0 A;  1W70 A;  1I0C A;  1VYU A;  2AK5 A;  1HD3 A;  3M0R A;  2A28 A;  4OMP A;  2LCS A;  1M3A A;  2KGT A;  1ZUU A;  2OI3 A;  1T3S A;  2F2X A;  2KT1 A;  1Z9Z A;  1TUC A;  2KYM A;  1X2Q A;  1GL5 A;  1GBQ A;  1M30 A;  3RBB B;  3A98 A;  5IHN A;  2O88 A;  1W6X A;  2JM8 A;  1OV3 A;  1UTI A;  2RF0 A;  2FG0 A;  1K1Z A;  4OMM A;  2LJ1 A;  4Z8A A;  2J06 A;  1UHF A;  2DL5 A;  3EHQ A;  1SRL A;  2J7I A;  1RI9 A;  1YNZ A;  1B3Q A;  4J9G A;  1GCP A;  4JJD A;  1K4U S;  2YUQ A;  3REA B;  1I1J A;  2JMC A;  2ROT A;  4R0K A;  2KXC A;  1X6G A;  2L3Q A;  2KEA A;  3H0I A;  2KYB A;  1PHT A;  2KR3 A;  3EG0 A;  5GJV B;  1SHG A;  2BTT A;  5FWB A;  1T0H A;  2EGE A;  4Z88 A;  5GJW B;  2GNC A;  4FSS A;  3R6N A;  2DMO A;  1KJW A;  1BB9 A;  1E6G A;  4OML A;  1ABO A;  3RNJ A;  4JPB W;  2HBW A;  1ZSG A;  1AWJ A;  3M0Q A;  2EBP A;  1GCQ A;  1QKX A;  1SRM A;  3EGU A;  4J9F A;  2KE9 A;  1KSW A;  2AZV A;  2PTK A;  4RTY A;  2B86 A;  2FPD A;  2LQW A;  1UEC A;  3ULR B;  3M0S A;  1JXO A;  1AWW A;  2F2W A;  2CT4 A;  1SHF A;  2HDA A;  1U06 A;  1QCF A;  1AWX A;  1PKT A;  4F17 A;  1GFD A;  4F16 A;  2CSQ A;  2JMA A;  2C0O A;  2DNU A;  3QWX X;  1U3O A;  1X27 A;  1TUD A;  1AVZ C;  3H0F A;  2FRY A;  2VKN A;  3LH5 A;  4LUD A;  3SEM A;  2X3W D;  3VS6 A;  2BZY A;  1PRL C;  2L0A A;  1AEY A;  1CKB A;  1G2B A;  4HVU A;  2A37 A;  2JTE A;  2EKH A;  2O2O A;  1FMK A;  2ROL A;  2DE0 X;  2FO0 A;  4GLM A;  4J9C A;  3UF4 A;  4LNP A;  2LJ0 A;  1IO6 A;  4WCI A;  2K6D A;  1X43 A;  2ABL A;  4AG2 C;  2MOX A;  2W0Z A;  2DA9 A;  2O31 A;  1J3T A;  2J6K A;  1NM7 A;  2LX7 A;  3VS0 A;  1HSQ A;  3REB B;  4J9I A;  4J9E A;  2KT8 A;  1QKW A;  2EW3 A;  2JS2 A;  4EIK A;  2RQR A;  1XOV A;  3ZL7 C;  3I35 A;  1JEG A;  4J9B A;  1VYT A;  4IIO A;  2RN8 A;  1T0J A;  2J05 A;  1T3L A;  4ZNX A;  1I07 A;  1NLO C;  2YUP A;  2RQV A;  2EYX A;  3EHR A;  2ED0 A;  2CH4 A;  1K0X A;  1M8M A;  1PNJ A;  2EYW A;  1UHC A;  1LCK A;  3PVL A;  2GTO A;  1JU5 C;  4X1V A;  4ESR A;  2DX1 A;  2K79 A;  2DVJ A;  2DL4 A;  1ZLM A;  1AWO A;  4OMN A;  2JS0 A;  4AG1 C;  4M4Z A;  2DRM A;  2C0T A;  2RQT A;  5FWC A;  2LP5 A;  4JJB A;  3NHN A;  4IIM A;  1EFN A;  3THK A;  1ZUK A;  1AZG B;  2ED1 A;  2E5K A;  1H3H A;  5IHK A;  1UDL A;  2LNH B;  4E6R A;  1K0S A;  4CC7 A;  1OPK A;  1WLP B;  1X2K A;  2K2M A;  2YDL A;  2RQU A;  2CDT A;  5I22 A;  4LE9 A;  2JM9 A;  2LZ6 B;  1BK2 A;  2CH4 W;  3SHW A;  3TSZ A;  2PZ1 A;  1NEG A;  3EG1 A;  2DBK A;  1MUZ A;  1RLP C;  2HCK A;  2EGA A;  5I11 A;  1UFF A;  2O9S A;  1OEB A;  4GBQ A;  3GBQ A;  2J6O A;  2JXB A;  2V1R A;  2KBT A;  2RNA A;  1N5Z A;  4JZ3 A;  4RTZ A;  1HJD A;  3JV3 A;  5IXB A;  1NYF A;  2FPE A;  1BU1 A;  1MV0 B;  2BZ8 A;  1SPK A;  3M0T A;  2AKL A;  2LJ3 A;  2GBQ A;  3VRY A;  1VYV A;  2D8H A;  1MV3 A;  5EC7 A;  4HXJ A;  2EYY A;  2FEI A;  1UG1 A;  1BBZ A;  1JQQ A;  5IHI A;  2A08 A;  1KFZ A;  2KXD A;  3M0U A;  1UGV A;  2MIO A;  1JXM A;  1Y57 A;  2DLP A;  1ZUY A;  4HCK A;  2D0N A;  1WIE A; 
#chains in the Genus database with same CATH topology
 1NJI U;  1PWT A;  1ZBX A;  3VYG A;  4IUP A;  1AZE A;  3CQT A;  2CT3 A;  1JO8 A;  2K7A A;  2P4T A;  3FEO A;  1GXI E;  2JW4 A;  3I56 T;  3CCL T;  1O9S A;  2NUP A;  2NWM A;  1YWO A;  1E7O A;  2QAS A;  1WJS A;  4FW2 A;  3SD4 A;  2E12 A;  3HRU A;  2VGN A;  5C0M A;  4QQG A;  1G5V A;  2LC4 A;  3VS7 A;  5GMK h;  1S1N A;  2HL3 A;  1M90 R;  3MJX A;  3M9Q A;  2QDL A;  2XG8 D;  1YJW Q;  4QT7 A;  1WHJ A;  4IUV A;  3OYA A;  2M9U A;  2DEU A;  2F2V A;  3C0C A;  3RER A;  1VQ4 Q;  3TSW A;  1WFW A;  1YP5 A;  2YUN A;  3TRE A;  2MCN A;  2E3H A;  1K8A R;  1GCQ C;  5CKF A;  3JCM J;  1W2B A;  4PJM A;  3FJ5 A;  4RUG A;  1Y7X A;  3OSV A;  2HNI A;  1Q82 C;  3FDR A;  4K11 A;  2DKG A;  2CP2 A;  1VQL A;  2DXC A;  4HKE A;  2P4R A;  1WHG A;  2XMF A;  4J8O A;  1FYN A;  3H8Z A;  1KHC A;  2KI7 A;  2VGM A;  4CC3 A;  2DIL A;  4D6W A;  2KMT A;  4J83 A;  4BD3 A;  2DIQ A;  2YUO A;  4AT1 B;  2EYQ A;  1G3Y A;  4C92 A;  2H8H A;  4GY5 A;  3L2Q A;  1SSH A;  3JB9 G;  1I4K 1;  2X3X D;  2PUK B;  3P8D A;  1G8X A;  2RHZ A;  2ZPI B;  3MO8 A;  1K9M C;  4C92 E;  1C0M A;  4ZTJ A;  2SEM A;  1CSK A;  1FMW A;  2M0Y A;  4KH0 B;  1YIJ A;  1YWP A;  1Y96 A;  2LQN A;  4DEY A;  4AFU C;  2DJQ A;  3OYG A;  1E6H A;  1CKA A;  3CPF A;  4OP0 A;  1OI1 A;  1X6B A;  1OPL A;  3EGD B;  3EFR A;  4KRT A;  1WJQ A;  4RTW A;  2RQW A;  5A2Q E;  2OJ2 A;  4JZ4 A;  3LGF A;  2LMJ A;  2ZZD A;  2RHI A;  4J6Y A;  4F7U E;  2CUB A;  4AFQ C;  4QKU A;  4C8Q G;  4BDZ A;  2KSS A;  4PJO G;  2EGC A;  3MEA A;  1Z9Q A;  3CCM T;  3EFS A;  2VV5 A;  2D6F A;  2MMP A;  3I9Q A;  1V76 A;  3V8L A;  4DBR A;  1C1A A;  2JN0 A;  5D7U A;  3CCU A;  3JAM E;  2DO3 A;  5GAN 6;  2HMA A;  5KYY A;  1NLP C;  2L2P A;  1TU0 B;  1BYM A;  2ATC B;  2D8J A;  2DTH A;  1ZX6 A;  2K3B A;  1I5L A;  4C8Q A;  1WXB A;  3CCL A;  5CKB A;  1WX6 A;  4ORZ A;  1U5S A;  1FX7 A;  5GAO m;  1GRI A;  3R6O A;  1LOJ A;  2K57 A;  1PRM C;  2VVK A;  5KYU B;  2JT4 A;  3RKX A;  1VUB A;  2IIM A;  3KFV A;  4C8Q C;  2DYB A;  4QVD A;  1QQJ A;  3X25 B;  4J9D A;  2RJE A;  1RUW A;  1VQL T;  3CXC P;  2LNV A;  1M1F A;  1W70 A;  1I0C A;  4PJO E;  2AK5 A;  1WQ7 A;  2RI5 A;  3G71 T;  3RMS A;  1Q82 U;  4C0D C;  2RJF A;  4F7U G;  2HL5 C;  2F2X A;  2KT1 A;  2JNG A;  1Z9Z A;  4FW1 A;  4O6J A;  1GL5 A;  2FZC B;  4MDW A;  5HY6 A;  3A98 A;  5IHN A;  2ZPF B;  2PVG B;  1W6X A;  3LX7 A;  3X24 B;  4BUG A;  5GAM d;  1VQ6 Q;  1NZ9 A;  5J26 A;  4KGZ B;  2L3R A;  2LQK A;  1M1G A;  1M2V A;  4OVA A;  5LJ3 e;  4Z8A A;  3MP1 A;  1UHF A;  3NTH A;  3MP8 A;  1RI9 A;  1S72 A;  4C5H A;  3G1J A;  1WZO A;  4KGX B;  5LJ5 j;  2YUQ A;  3M57 A;  1I1J A;  2JMC A;  2ROT A;  1MMA A;  4J7I A;  4MML A;  2L3Q A;  2ZPH B;  3H0I A;  2KYB A;  1X6O A;  3EG0 A;  4C92 G;  3JB9 F;  2X4W A;  3EGX A;  4L6V 5;  5KCH A;  4BE0 A;  4RKU E;  4OF1 A;  3SWN C;  4PJO D;  2DET A;  3G4S A;  3UT1 A;  5KYX A;  2RA2 A;  2MAM A;  4FSS A;  1EX4 A;  2Y4X A;  4X9C A;  3R6N A;  1KJW A;  1BB9 A;  4M75 A;  4OML A;  3C94 A;  1Q7Y C;  2QDY B;  1TOV A;  3M0Q A;  5GAN e;  2VB6 A;  2QXF A;  1SRM A;  4LDV A;  2DD5 A;  3EGU A;  4J9F A;  2KE9 A;  3AT1 B;  3QJ6 A;  1JXO A;  2RO0 A;  4B9X A;  3OSS C;  2QK0 A;  1SHF A;  2HDA A;  1KC8 R;  1RAB B;  3CC2 T;  4GLK A;  1AWX A;  1PKT A;  4II1 A;  4A4G A;  1D1A A;  2DNU A;  4M77 B;  3H0F A;  2FRY A;  2X35 A;  2CGH A;  2JVV A;  1U1S A;  1RAE B;  2L0A A;  4C92 F;  3L2Z A;  4HVU A;  2A37 A;  3JCM f;  1TWB A;  1ZSZ B;  3SFM A;  3L1A A;  2O2O A;  2DXB A;  4J9C A;  2DE0 X;  4ANJ A;  2QA4 T;  1HXD A;  1AHJ B;  1OU9 A;  3CCS A;  4LNP A;  5CR2 A;  2LJ0 A;  2H3E B;  2RM4 A;  4NL3 A;  1IO6 A;  1W2B S;  2K5I A;  5I2M A;  1VQ7 A;  3OYB A;  2LX7 A;  3REB B;  1RL2 A;  3BE3 A;  3CEY A;  4J9I A;  5GAM e;  1G3T A;  2YHT A;  1QKW A;  2EW3 A;  4FM4 B;  3CC2 A;  5KYN A;  2G3R A;  3I35 A;  2D9T A;  4L5G A;  2M02 A;  4J9B A;  3D7S B;  2RN8 A;  1Q7Y U;  4ZNX A;  2E6N A;  2YUP A;  1NLO C;  3GLX A;  2RQV A;  1VQ8 A;  3M4Y A;  1K0X A;  2KK4 A;  1N8R U;  1PNJ A;  2EYW A;  2C06 A;  1KK7 A;  1LCK A;  4M77 G;  1JJ2 P;  2GTO A;  4C92 D;  3HPW A;  1M4Z A;  2XKO C;  4ESR A;  4HT8 A;  4ZN3 A;  1W2B P;  4JLG A;  3G4S T;  4M75 G;  2YWW A;  3L42 A;  2E6Z A;  1M90 C;  2AHJ B;  2RQT A;  4JDS A;  4Z02 A;  5FWC A;  3RKW A;  1VQ4 A;  9ATC B;  4B9W A;  2GF7 A;  1AZG B;  2DYI A;  1H3H A;  1VIF A;  3A8M B;  4BY6 C;  3CCS Q;  3I55 T;  3CCE T;  4CC7 A;  1OX9 A;  1WLP B;  2K2M A;  2DJZ A;  4E7S A;  5GMK e;  4A54 A;  2WSE E;  4F7U B;  1V29 B;  2CP0 A;  4A4F A;  1RLP C;  4PJO F;  2EGA A;  5I11 A;  1UFF A;  4FYX B;  4M75 E;  2JXB A;  1VIE A;  4JZ3 A;  4OGE A;  2HKN A;  3JV3 A;  2FPE A;  3GIB A;  2AKL A;  2LJ3 A;  3F70 A;  4ZN1 A;  4CRI A;  1YHQ Q;  2D8H A;  1MV3 A;  2JTF A;  4PKC C;  3CCE A;  2E70 A;  1JQQ A;  4F04 B;  4X34 A;  2QQB A;  5IN1 A;  2KXD A;  2COZ A;  3CC7 Q;  3MP6 A;  4FL6 A;  1WGS A;  1VQ9 Q;  4KBM B;  4E7J A;  1EIF A;  3EH2 A;  3MPU B;  3VU3 C;  5GMK l;  3CCE Q;  3QHS A;  2BZX A;  2WAC A;  4M78 B;  4Y92 A;  2PNI A;  4RTT A;  3UWN A;  3HSB A;  4HVW A;  2ECZ A;  1KIK A;  3TVT A;  4AFZ C;  1TUG B;  2KY9 A;  1VA7 A;  4RG8 A;  1YI2 T;  4BI3 A;  1S72 Q;  5DM7 R;  2QEX Q;  2KVQ G;  2A3L A;  4LDY A;  2AKK A;  4J9H A;  3QJY A;  1QWE A;  2NUZ A;  5DY9 A;  1AD5 A;  3ASK A;  3SWN A;  4WF2 A;  1Y0M A;  2C0I A;  4V2S A;  1UUE A;  1QVG S;  5GMK j;  5I21 A;  3CCR T;  2OAW A;  3LWH A;  3JCM g;  3VS4 A;  4L59 A;  2DF6 A;  3CXC S;  1OOT A;  2L5Q A;  2EVR A;  4C0F A;  2DPP B;  5FU6 B;  2OTL Q;  2EQM A;  4M7A D;  1Y96 B;  4CI0 C;  2RPN A;  3V7S A;  2V8J A;  3PIO A;  3OS0 A;  4KUD K;  3EGX B;  4M77 F;  2DL3 A;  3PIP A;  1KD1 U;  2EAY A;  4QVC A;  1WYX A;  2XDB A;  1BIA A;  3TQ7 P;  4PJO A;  3LWI A;  1KC8 U;  1X75 C;  3V8K A;  3CPW P;  1M27 C;  1M8V A;  1IGQ A;  1IZ6 A;  3URG A;  1W1F A;  3PMI A;  3HHT B;  4A63 B;  1AOJ A;  4M78 G;  3CMA A;  1YI2 Q;  2E3I A;  3JCM b;  4OMO A;  1B7T A;  3QDF A;  6AT1 B;  1YCS B;  1O75 A;  2RHY A;  5D6Y A;  3CC2 Q;  2CUD A;  2M16 A;  2FZK B;  1ACM B;  4N0A A;  1NYG A;  3HRT A;  3OS5 A;  5CKH A;  3U23 A;  3H41 A;  3HL8 A;  3OMG A;  8AT1 B;  1WI7 A;  2RJC A;  1K9A A;  4KUI A;  2OTJ A;  2QA4 A;  4VUB A;  3PE0 A;  4N0A C;  5C6S A;  3P8B B;  1SKU B;  4QQD A;  5IT9 E;  3JSC A;  4C0G A;  2KNB B;  1QLY A;  4FIB A;  5LJ3 d;  5A0D A;  3VRZ A;  1RLQ C;  1I8F A;  2L8D A;  3WVE B;  4HCC A;  3S6W A;  2VAS A;  3VUZ A;  1Y07 A;  3DLL A;  2Z0W A;  3CPW A;  1H8K A;  3M54 A;  1EZZ B;  2OX7 A;  1WXU A;  3LW5 E;  4DEX A;  2QQA A;  5GAM g;  3OYH A;  3CC4 Q;  4B6M A;  1Q7Y R;  3I56 A;  2RJD A;  4IUR A;  5HK3 A;  2DVE A;  4JJC A;  2OTL T;  1UGP B;  3JB9 H;  4A53 A;  1QW1 A;  3OYE A;  1A0N B;  1JJ2 A;  4JRQ A;  3I55 Q;  2RHX A;  3OQ5 A;  3M55 A;  1XQH A;  3I5R A;  2P0Q A;  3KUF A;  1NJI R;  1K9M U;  1VQO A;  2CSI A;  3JRZ A;  4M7A E;  4OMQ A;  3JB9 J;  4ZGJ B;  4RTX A;  3GPL A;  1SF9 A;  3G71 Q;  1OZ2 A;  3RDV A;  5HCK A;  1I5O B;  1SSF A;  3UA6 A;  1UJ0 A;  1VQL Q;  3A8O B;  1VYU A;  2NUT A;  4RG2 A;  2A28 A;  4KGV B;  1M3A A;  2KGT A;  2DZC A;  3OA6 A;  1KD1 R;  2KYM A;  4A4K A;  1BI2 A;  5GAN g;  4HT9 A;  1GBQ A;  3RBB B;  3GF5 A;  1Q86 U;  5LJ3 j;  3RR6 A;  1OV3 A;  1W4S A;  2R5M A;  3VJP A;  2FG0 A;  2K5F A;  3BY7 A;  3EGD A;  4OMM A;  2LJ1 A;  5CVI A;  2DL5 A;  1YI2 A;  3EHQ A;  1FXX A;  1VQO T;  1YNZ A;  2ZGW A;  5IAY A;  3M59 A;  2KEA A;  2EFI A;  2BTT A;  3OYN A;  1IRE B;  3N5B B;  3ZFJ A;  4M7A B;  4J7F A;  4MZM A;  5FWB A;  5A0L A;  5GAO q;  4HCB A;  1VQ7 T;  4XTZ A;  2GNC A;  4M78 D;  1HK9 A;  3M58 A;  2DMO A;  1K73 U;  1E6G A;  2HBW A;  4C92 B;  2EBP A;  1QKX A;  3LLR A;  1G3W A;  3GNF B;  3CCU T;  4M7D G;  1KSW A;  1PSF A;  1WHL A;  1YJW A;  2B86 A;  5CKE A;  1N8R R;  2CT4 A;  4BI4 A;  3OYD A;  4KT0 E;  1U06 A;  2RK1 A;  1MGQ A;  4F17 A;  2VC8 A;  1GFD A;  3JB9 I;  3ZEH A;  2CSQ A;  2JMA A;  2HD0 A;  3G4S Q;  2YLB A;  3QWX X;  1Q81 C;  1U3O A;  1X27 A;  2VXF A;  2VKN A;  3PT9 A;  2X3W D;  1PG5 B;  1D1C A;  2FVU A;  2QTX A;  1PRL C;  1ZSZ A;  1G2B A;  1M1K C;  5CIU A;  2JTE A;  2ROL A;  4GLM A;  3UF4 A;  2R57 A;  2KDS A;  5GAN 7;  4PLI A;  4JRI A;  1OYX A;  5KH6 A;  1ZSZ C;  1X43 A;  2ABL A;  2DA9 A;  3GOX A;  2EJG A;  3MEU A;  1NM7 A;  2CZ6 B;  4JS4 A;  2BIV A;  3SB2 A;  1RAA B;  2KT8 A;  5GAN d;  3CPW S;  3FRN A;  4C8Q D;  5FLX E;  1KG1 A;  2XIC A;  3ZL7 C;  3JCM h;  3VYH B;  1MMG A;  1K73 C;  1VQM T;  3BDL A;  4IIO A;  1R0B G;  1T3L A;  3RKY A;  2QQS A;  2VUB A;  3E2U A;  5KE3 A;  1R0C B;  2EYX A;  3EAE A;  2DTO A;  3CBO A;  2EJ9 A;  2RI2 A;  4TVR A;  1JU5 C;  2M1H A;  2P0P A;  2A0F B;  1K8A C;  2DEQ A;  2ZPE B;  2BKD N;  2K79 A;  4LDU A;  1ZLM A;  2V8K A;  1S72 T;  4XQ3 A;  1WHK A;  1JRI A;  2QQ9 A;  5FU6 C;  4J6X A;  4M4Z A;  2C0T A;  3CCL Q;  3OYL A;  3SWN B;  4M75 C;  5LJ3 g;  1ZUK A;  5GAO r;  2ED1 A;  2E5K A;  3QXE B;  5LJ5 d;  2WSC E;  3V8J A;  4E6R A;  4M7D D;  3CCU Q;  1MND A;  2YDL A;  3CC7 T;  5FRO A;  4M75 D;  4OB2 B;  2JM9 A;  3RES A;  2CH4 W;  3SHW A;  2PZ1 A;  3J7A F;  3EG1 A;  3JCM e;  1PD1 A;  3A8H B;  4FT2 A;  1VQ7 Q;  2FB7 A;  1RAD B;  2DBK A;  4YTL A;  1PC0 A;  3M5A A;  3FB9 A;  3AHU A;  1SG5 A;  4DBF A;  3ER0 A;  2V1R A;  2KBT A;  1N5Z A;  1H3Z A;  1KD1 C;  5GAN 5;  4ATO A;  3DKM A;  1WPY A;  1YFN A;  5GAM f;  2K5L A;  3HRS A;  1PM3 A;  1VQO Q;  3PMT A;  1G3S A;  5FRM A;  5CQY A;  4HXJ A;  3UPU A;  2EYY A;  3G7Z A;  2XID A;  4F7U F;  1WNL A;  2MWP A;  4WTO B;  4C8Q B;  1JXM A;  4XTY A;  4Y28 E;  2DLP A;  3P8H A;  4HCK A;  3G6E Q;  1IXD A;  4PJJ A;  3EG2 A;  3CCR Q;  2NYS A;  4KUL A;  2E10 A;  2J6F A;  3MEV A;  3VS1 A;  2DK3 A;  4JRK A;  3QZ9 B;  2KRO A;  2QEX T;  3RMQ A;  5IXF A;  3NFC A;  1WQW A;  1NPP A;  1WXT A;  3LYI A;  3FJP A;  2I0N A;  3EG3 A;  3OYC A;  4HVV A;  3VS2 A;  2L3S A;  2PUO B;  4C5I A;  1M3B A;  1WA7 A;  1VQM A;  4BY6 B;  2XK0 A;  1N27 A;  5LJ5 f;  4ELZ C;  2YT6 A;  3FIF A;  1Q86 R;  2O4X A;  1OU8 A;  3NGP A;  4PJN A;  3VS3 A;  1Q95 G;  3JCM d;  4BDY A;  3V7C A;  3A8L B;  3NTI A;  3CCV A;  4RTU A;  3M56 A;  4QVZ A;  2MF2 A;  5GAN h;  4ZGD B;  3CC4 T;  1TH7 A;  1FWZ A;  3OY9 A;  4N4I A;  2QG9 B;  2RK2 A;  1QVP A;  5AT1 B;  3KXT A;  2E41 A;  2KRS A;  4LUE A;  1H92 A;  1UE9 A;  1VQ4 T;  4RTV A;  1X01 A;  3OS2 A;  1LVK A;  1NJI C;  4LD6 A;  2SRC A;  1V1C A;  2ESW A;  3S3N A;  2MYS A;  2E5Q A;  2OTJ T;  1K9M R;  2V1Q A;  2JJ9 A;  5ECA A;  4ZGE B;  2KRM A;  2QGG A;  2HBP A;  1MNE A;  1ARK A;  2CP6 A;  2NUT B;  4IKF A;  3EFO A;  1PKS A;  3HFN A;  2W10 A;  3CCS T;  1PCX A;  4RCB A;  1VQ8 T;  1RAG B;  1X69 A;  2PVD B;  3NPF A;  1ZBJ A;  4BB7 A;  3CMA T;  1UGQ B;  3IQL A;  2AT1 B;  1KC8 C;  1NE8 A;  4OB0 B;  4CC4 B;  3UDC A;  2DBM A;  4HCZ A;  1G83 A;  4F14 A;  1K8A U;  3RIR A;  4DOV A;  4BAC A;  3HFO A;  2VWF A;  4IUU A;  4ME7 A;  4D8K A;  2A36 A;  4PFZ A;  3WVD B;  2RI3 A;  2B8A A;  3JCM Q;  5IH2 A;  3VS5 A;  1IGU A;  2EQI A;  3DB4 A;  3NMZ C;  2LCC A;  1K76 A;  1UJY A;  1VQM Q;  2EQJ A;  1D0Z A;  3V7R A;  2QYZ A;  3EH1 A;  1M90 U;  2FYK A;  4PFO A;  1NG2 A;  2CRE A;  1F1B B;  2IVW A;  1VQK Q;  3QWY A;  5DLO A;  3JCM X;  5GAM h;  2O9V A;  2EPD A;  1IB8 A;  2FHD A;  4XU0 A;  4M78 E;  4M77 A;  4NOY A;  2LQ8 A;  1NBE B;  2QA4 Q;  4BE1 A;  3KBG A;  3OYK A;  4AFS C;  1WDX A;  2V26 A;  4DOW A;  2HEQ A;  1KQS P;  2F1L A;  3E1S A;  3CC4 A;  4PJL A;  1ZQ1 A;  3JCM V;  1JBM A;  2LDM A;  1HD3 A;  1VOM A;  4OMP A;  2LCS A;  3QDR B;  2LVM A;  1M1K R;  3GP8 A;  2K2V A;  2OI3 A;  3FLG A;  1TUC A;  1X2Q A;  5LJ5 g;  1M30 A;  1QP3 A;  4LDW A;  1KQ2 A;  2RB6 A;  2JM8 A;  1XJW B;  2I2L A;  5M9O A;  2RF0 A;  4J6W A;  4C0D B;  1K1Z A;  2O01 E;  1VQ9 T;  4FYY B;  4BI8 B;  2DXT A;  1VQ5 T;  5A0G A;  4FSX A;  2J06 A;  2QI2 A;  3EFO B;  1SRL A;  2J7I A;  4J9G A;  4JJD A;  2CZ7 B;  3OW2 S;  4QW2 A;  4R0K A;  2KXC A;  4PL6 A;  3A1P A;  1B34 A;  1RAC B;  4E7H A;  1PHT A;  1OQK A;  1SHG A;  4M7A C;  4FT4 A;  3QII A;  1YIT T;  1M2O A;  5CQX A;  4PJO B;  3RNJ A;  4JPB W;  2QGF B;  3CCQ A;  3J80 E;  4M75 F;  1ZSG A;  4M7D C;  1AWJ A;  2QAZ A;  4C8Q E;  2XDP A;  4X9D A;  2DTI A;  1VQ6 T;  2JTM A;  2AZV A;  2PTK A;  1R77 A;  2NLU A;  2FPD A;  7AT1 B;  5J3B A;  3M0S A;  1AWW A;  2F2W A;  1D0X A;  5FRN A;  2EQU A;  5GMK i;  2COW A;  3QG1 A;  1QCF A;  1WHM A;  2M0O A;  1Y71 A;  1PSE A;  3PTA A;  4F16 A;  3JCM P;  4M7D B;  1QVF P;  3Q1J A;  1QCO A;  2CS7 A;  5KYW B;  2VXE A;  3SEM A;  2RD1 A;  4LUD A;  3VS6 A;  4PJO C;  2BZY A;  3S3O A;  1CKB A;  4A4E A;  4PNO A;  2EKH A;  1FMK A;  1YIT Q;  2FO0 A;  3LH0 A;  5D6W A;  3ME9 A;  3L2W A;  4WCI A;  1YIJ T;  2K6D A;  4AG2 C;  2W0Z A;  3TU4 K;  2O31 A;  2J6K A;  2Y4Y A;  1XTD A;  2HKQ B;  1HSQ A;  4OGC A;  4J9E A;  3O8V A;  4C8Q F;  1QVG P;  4EIK A;  2RQR A;  1XOV A;  2YRC A;  4Y91 A;  1VQ5 Q;  3PNW C;  1JEG A;  3MET A;  1T0J A;  2J05 A;  4C5E A;  5KYW A;  5GAO n;  1N8R C;  1I07 A;  4FCY A;  3CCM Q;  1VQP A;  2D0Q B;  2ED0 A;  3CD6 A;  2CH4 A;  4HA8 A;  3JCM W;  1M8M A;  2HZY A;  1UHC A;  3PVL A;  5GAM j;  1YJW T;  2DXU A;  4M77 E;  4M78 A;  5J39 A;  3GNG A;  1XNI A;  2DL4 A;  1IRX A;  4OMN A;  4MZT A;  1B34 B;  1YHQ A;  2JS0 A;  4F7U A;  2XU8 A;  4AG1 C;  3CME Q;  5LL6 S;  4EPC A;  2LP5 A;  4JJB A;  3NHN A;  4IIM A;  3TCJ A;  4QQ6 A;  3THK A;  4UC4 A;  1YJ9 T;  5CK9 A;  5IHK A;  1UDL A;  3QUI A;  2LNH B;  2XI9 A;  3OYF A;  1YIT A;  1QVF S;  3CCQ T;  1X2K A;  5LJ3 h;  2X9H A;  2WSF E;  1D3B B;  5KYX B;  3OW2 P;  3CCV T;  1MMD A;  2VYT A;  1VQ6 A;  3CCJ Q;  4FU6 A;  1OZ3 A;  2K4Y A;  4XTX A;  2XDD A;  1NEG A;  4JUV A;  1JB0 E;  5GAN j;  2OAU A;  4XAX B;  1OEB A;  3GBQ A;  3OBY A;  4J5Y A;  2RNA A;  5GAO l;  5GAO p;  1BIB A;  5FU7 C;  4R56 A;  2E4H A;  4PFP A;  1HJD A;  2YXY A;  3QSU A;  1BU1 A;  1MV0 B;  1SPK A;  2F69 A;  5LJ3 f;  3M0T A;  4JRP A;  3QYH B;  1UEB A;  2QTV A;  3VRY A;  5D6X A;  2BE9 B;  3CCJ T;  2HQE A;  1UG1 A;  1BBZ A;  5IHI A;  2A08 A;  2JUF A;  4ELY C;  5GAN 4;  1LJO A;  2MIO A;  1MHN A;  1Y57 A;  3G71 A;  2L89 A;  3M53 A;  3VV0 A;  4MDX A;  4N4H A;  4M7D F;  2MI6 A;  1WIE A;  3QYG B;  5LJ5 e;  4LDX A;  1GBR A;  1YJ9 Q;  3DLM A;  2GGR A;  3MHX A;  2COY A;  4RCC A;  1AT1 B;  2NUP B;  2HSE B;  2CZ0 B;  1NEB A;  4FYV B;  1LPL A;  2DIG A;  5L8R E;  3OW2 A;  1YJN Q;  4LN2 A;  3UA7 A;  1VQP T;  2E64 A;  2DER A;  1Q81 U;  1TG0 A;  4XTU A;  4EMK B;  1UGR B;  2F5K A;  3C95 A;  2EJF A;  4M78 C;  3RUX A;  3DB3 A;  3EG9 A;  3MEW A;  4D8D A;  2YSQ A;  2AZS A;  1ABQ A;  3X26 B;  2FPF A;  5AYF A;  5EG2 A;  2M51 A;  2DRK A;  3H0H A;  3CME A;  4M7D E;  1YHQ T;  2A7Y A;  2D1X A;  2EYZ A;  1JJ2 S;  1M3C A;  2P84 A;  1YIJ Q;  5DLQ E;  1QWF A;  5KE2 A;  1LNX A;  2V8I A;  2MWO A;  2GFA A;  2K9G A;  4E7I A;  3S3M A;  2EWN A;  3BDU A;  1U1T A;  1QP2 A;  2HQX A;  2HQH A;  1NPR A;  4M7A G;  1B07 A;  1VQK A;  1YCY A;  2GTJ A;  4XU1 A;  2R5A A;  2E1H A;  3CCM A;  1VQP Q;  4NL2 A;  1D1B A;  3INZ A;  1BI1 A;  4KH1 B;  4C0Z A;  4CC2 A;  2YRV A;  3MKD A;  2XHC A;  3NTK A;  5GMK m;  2LT1 A;  2ZCF B;  4JLI A;  2FZG B;  2KRN A;  2DL8 A;  2DL7 A;  3OYM A;  2DM1 A;  2FRW A;  5FW9 A;  3G6E T;  1ZHI A;  1U8R A;  5HK0 A;  4OB3 B;  3L2V A;  1FMV A;  3OS1 A;  4M7A A;  2LRQ A;  4MMK A;  4Z89 A;  3I5S A;  2ENM A;  5L23 A;  1Q81 R;  2P0K A;  2G6F X;  4M78 F;  2RH2 A;  3X28 B;  1MMN A;  4O5V A;  4Q5W A;  1IHW A;  2CP3 A;  1KHI A;  1WHH A;  2FL7 A;  3O5Z A;  2HSP A;  1GFC A;  1PD0 A;  3H9N A;  5CCA A;  2DFU A;  1M9S A;  3OB9 A;  3CCV Q;  1VQN T;  3X20 B;  1WJR A;  1YN8 A;  4M7A F;  4XU3 A;  1SEM A;  3M0P A;  3CCQ Q;  2K3Y A;  2BE7 D;  2QQR A;  1R8O B;  2MPX C;  1UB4 A;  2RMO A;  3UAT A;  3C12 A;  3TEE A;  2YLC A;  2CZ1 B;  2L3P A;  4M75 B;  2LCL A;  2GQI A;  8ATC B;  3CME T;  2OTL A;  2EKO A;  3PVQ A;  1VQ9 A;  3I55 A;  2H3J A;  4M77 C;  1TS9 A;  2PVO B;  3E9F A;  2EIF A;  4NS5 A;  1QVG A;  3M0R A;  3I56 Q;  1TSF A;  4XTW A;  1ZUU A;  1T3S A;  2DAQ A;  5FU7 B;  3ZBD A;  4JJN K;  1VQ5 A;  2HAX A;  3CCR A;  2F5T X;  1D09 B;  4DQ2 A;  4OMF B;  4IUQ A;  2O88 A;  3M4G A;  3J81 E;  4E7K A;  2GQV A;  5CAI A;  1UTI A;  1M2V B;  1QVF A;  4ZTF A;  5LJ5 h;  1Q82 R;  1N6A A;  3L2U A;  4MZP A;  2CYZ B;  1B3Q A;  1GCP A;  1HYO A;  3WXM B;  3REA B;  1KQS A;  1K4U S;  1X6G A;  5GAN f;  2KR3 A;  5GJV B;  3E9G A;  4PK4 A;  2DZ9 A;  5KYY B;  1T0H A;  4JS5 A;  1UGS B;  4PLL A;  2EGE A;  3MCA B;  4Z88 A;  5GJW B;  1YJN A;  2LX9 A;  4LD9 K;  1D0Y A;  1N9R A;  1ABO A;  1DJ7 B;  4RMO A;  2JZ2 A;  1GCQ A;  2ZPG B;  5HKC A;  1IHV A;  4FYW B;  4EDU A;  3CMA Q;  1BKB A;  3T9N A;  4RTY A;  2X4X A;  2LQW A;  1UEC A;  1BCM A;  3ULR B;  4N4G A;  3OYI A;  3CD6 T;  1VQ8 Q;  2Y90 A;  4EMH A;  3LGL A;  3CBM A;  4DBH A;  4LXC A;  1VQN A;  1ZA1 B;  1TXQ A;  2C0O A;  1C6V X;  4C92 C;  1TUD A;  1AVZ C;  1M1K U;  2OTJ Q;  3LH5 A;  1RAF B;  1AEY A;  4A4H A;  3G6E A;  1BI0 A;  1RAH B;  5GAN 2;  3OYY A;  2ZPB B;  2K3X A;  3A5Z B;  1KQ1 A;  2X51 A;  1KQS S;  4E7L A;  1YJ9 A;  4DA4 A;  2MOX A;  2E65 A;  1J3T A;  1OUL A;  3CXC A;  2RHU A;  4P5N A;  3QPH A;  3VS0 A;  4XU2 A;  4M77 D;  4C5G A;  1VQN Q;  1TTH B;  3VKI A;  2PU9 B;  3C4S A;  2JS2 A;  2CP7 A;  2X4J A;  3SDZ A;  3QZ5 B;  4E7Z A;  5GAN 3;  2LTO A;  1VYT A;  5CKD A;  3JCM c;  1D3B A;  5GAN 8;  3EHR A;  1ZA2 B;  3PGG A;  2JOY A;  3E19 A;  3FC3 A;  2ZAE A;  2X4Y A;  5KYU A;  4EMG A;  4X1V A;  4OB1 B;  1Q86 C;  3CBP A;  1P92 A;  2O4X B;  2DX1 A;  3HTR A;  1YJN T;  2DVJ A;  4IUT A;  4E47 A;  1AWO A;  4E2F B;  1BI3 A;  3CCJ A;  4R55 A;  1YBY A;  2IG0 A;  1RAI B;  2GFU A;  2XD0 A;  1K73 R;  1OX8 A;  3BFM A;  2AIR B;  2DRM A;  5I2S A;  3OMC A;  2KQW A;  3CD6 Q;  1EFN A;  3QBY A;  3BW1 A;  4M7D A;  3OBW A;  2EQK A;  3H6Z A;  4EMK C;  2R58 A;  1K0S A;  2CP5 A;  2BUD A;  1OPK A;  4BE2 A;  3QO3 A;  1VQK T;  3HKS A;  2QEX A;  2RQU A;  2DD4 A;  2CDT A;  3OYJ A;  5I22 A;  2LT4 A;  4LE9 A;  2LZ6 B;  1BK2 A;  1H64 1;  1M5Q 1;  2KAF A;  2MK5 A;  3EG9 B;  3TSZ A;  2CKK A;  4EMK A;  1QMC A;  4XK8 E;  1MUZ A;  4AMC A;  1BCO A;  2HCK A;  5CO7 A;  2O9S A;  4GBQ A;  2J6O A;  3PFS A;  3JB9 D;  1RI0 A;  1QCN A;  4RTZ A;  2IPO B;  5IXB A;  1NYF A;  3QKJ A;  2BZ8 A;  4DBQ A;  2GCX A;  2PQW A;  2GBQ A;  3CC7 A;  1I81 A;  1VYV A;  3HP9 A;  5EC7 A;  3L2R A;  2FEI A;  3VUB A;  2YRD A;  1KFZ A;  3A8G B;  5KCO A;  3M0U A;  4XTV A;  1UGV A;  1ZUY A;  2D0N A;  1N9S A; 
#chains in the Genus database with same CATH homology
 2BZX A;  1PWT A;  3EG2 A;  1AZE A;  3CQT A;  2CT3 A;  4Y92 A;  2PNI A;  4RTT A;  2J6F A;  1JO8 A;  1GBR A;  4HVW A;  2K7A A;  2ECZ A;  1KIK A;  3VS1 A;  2GGR A;  3TVT A;  4AFZ C;  2JW4 A;  1NEB A;  2KRO A;  2NWM A;  1YWO A;  1E7O A;  1VA7 A;  5IXF A;  3VS7 A;  1WXT A;  1S1N A;  4LN2 A;  2AKK A;  3UA7 A;  2I0N A;  3EG3 A;  4J9H A;  1QWE A;  4HVV A;  2NUZ A;  2QDL A;  1TG0 A;  2L3S A;  4QT7 A;  3VS2 A;  1AD5 A;  1Y0M A;  2C0I A;  1M3B A;  1WA7 A;  1UUE A;  2F2V A;  3C0C A;  2OAW A;  3TSW A;  1WFW A;  1YP5 A;  2YUN A;  2YT6 A;  2MCN A;  3VS4 A;  4D8D A;  2DF6 A;  2YSQ A;  3NGP A;  1OOT A;  2AZS A;  1GCQ C;  1ABQ A;  2EVR A;  3VS3 A;  2FPF A;  3FJ5 A;  4RUG A;  4RTU A;  2M51 A;  2DRK A;  2RPN A;  4K11 A;  2P4R A;  3H0H A;  2D1X A;  2EYZ A;  2XMF A;  2DL3 A;  1FYN A;  1M3C A;  4CC3 A;  2DIL A;  1WYX A;  2KRS A;  4LUE A;  1QWF A;  1H92 A;  2YUO A;  1UE9 A;  4RTV A;  2K9G A;  1M27 C;  2H8H A;  1SSH A;  1B07 A;  1W1F A;  2SRC A;  1V1C A;  2GTJ A;  2X3X D;  2ESW A;  4A63 B;  1AOJ A;  2V1Q A;  5ECA A;  2KRM A;  4OMO A;  1ARK A;  4CC2 A;  1YCS B;  2SEM A;  1CSK A;  2M0Y A;  1YWP A;  1PKS A;  2W10 A;  2CUD A;  2KRN A;  2DL8 A;  1X69 A;  2DL7 A;  1NYG A;  2LQN A;  4DEY A;  2DM1 A;  2FRW A;  5FW9 A;  3U23 A;  3H41 A;  4AFU C;  2DJQ A;  3NPF A;  1ZBJ A;  1E6H A;  1CKA A;  1WI7 A;  3IQL A;  1K9A A;  1X6B A;  1OPL A;  4KRT A;  3PE0 A;  4RTW A;  4Z89 A;  2RQW A;  3I5S A;  4CC4 B;  2OJ2 A;  4JZ4 A;  2DBM A;  2ENM A;  2LMJ A;  5L23 A;  1G83 A;  4F14 A;  2G6F X;  2KNB B;  1QLY A;  2CUB A;  3VRZ A;  4AFQ C;  1RLQ C;  2VWF A;  4D8K A;  2EGC A;  2A36 A;  1Z9Q A;  5IH2 A;  3VS5 A;  2EQI A;  3NMZ C;  3O5Z A;  1K76 A;  2HSP A;  3I9Q A;  1GFC A;  1UJY A;  1H8K A;  1WXU A;  4DEX A;  1NG2 A;  1NLP C;  2L2P A;  1YN8 A;  2D8J A;  2CRE A;  4JJC A;  1SEM A;  3M0P A;  1ZX6 A;  2K3B A;  1A0N B;  1WXB A;  3QWY A;  2O9V A;  2EPD A;  2RMO A;  1WX6 A;  3UAT A;  4ORZ A;  1U5S A;  3I5R A;  1GRI A;  2L3P A;  4AFS C;  1WDX A;  2GQI A;  1PRM C;  2VVK A;  2JT4 A;  2CSI A;  2IIM A;  3KFV A;  4OMQ A;  2HEQ A;  2DYB A;  4RTX A;  3PVQ A;  4J9D A;  1RUW A;  5HCK A;  3UA6 A;  1UJ0 A;  1W70 A;  1I0C A;  1VYU A;  2AK5 A;  1HD3 A;  3M0R A;  2A28 A;  4OMP A;  2LCS A;  1M3A A;  2KGT A;  1ZUU A;  2OI3 A;  1T3S A;  2F2X A;  2KT1 A;  1Z9Z A;  1TUC A;  2KYM A;  1X2Q A;  1GL5 A;  1GBQ A;  1M30 A;  3RBB B;  3A98 A;  5IHN A;  2O88 A;  1W6X A;  2JM8 A;  1OV3 A;  1UTI A;  2RF0 A;  2FG0 A;  1K1Z A;  4OMM A;  2LJ1 A;  4Z8A A;  2J06 A;  1UHF A;  2DL5 A;  3EHQ A;  1SRL A;  2J7I A;  1RI9 A;  1YNZ A;  1B3Q A;  4J9G A;  1GCP A;  4JJD A;  1K4U S;  2YUQ A;  3REA B;  1I1J A;  2JMC A;  2ROT A;  4R0K A;  2KXC A;  1X6G A;  2L3Q A;  2KEA A;  3H0I A;  2KYB A;  1PHT A;  2KR3 A;  3EG0 A;  5GJV B;  1SHG A;  2BTT A;  5FWB A;  1T0H A;  2EGE A;  4Z88 A;  5GJW B;  2GNC A;  4FSS A;  3R6N A;  2DMO A;  1KJW A;  1BB9 A;  1E6G A;  4OML A;  1ABO A;  3RNJ A;  4JPB W;  2HBW A;  1ZSG A;  1AWJ A;  3M0Q A;  2EBP A;  1GCQ A;  1QKX A;  1SRM A;  3EGU A;  4J9F A;  2KE9 A;  1KSW A;  2AZV A;  2PTK A;  4RTY A;  2B86 A;  2FPD A;  2LQW A;  1UEC A;  3ULR B;  3M0S A;  1JXO A;  1AWW A;  2F2W A;  2CT4 A;  1SHF A;  2HDA A;  1U06 A;  1QCF A;  1AWX A;  1PKT A;  4F17 A;  1GFD A;  4F16 A;  2CSQ A;  2JMA A;  2C0O A;  2DNU A;  3QWX X;  1U3O A;  1X27 A;  1TUD A;  1AVZ C;  3H0F A;  2FRY A;  2VKN A;  3LH5 A;  4LUD A;  3SEM A;  2X3W D;  3VS6 A;  2BZY A;  1PRL C;  2L0A A;  1AEY A;  1CKB A;  1G2B A;  4HVU A;  2A37 A;  2JTE A;  2EKH A;  2O2O A;  1FMK A;  2ROL A;  2DE0 X;  2FO0 A;  4GLM A;  4J9C A;  3UF4 A;  4LNP A;  2LJ0 A;  1IO6 A;  4WCI A;  2K6D A;  1X43 A;  2ABL A;  4AG2 C;  2MOX A;  2W0Z A;  2DA9 A;  2O31 A;  1J3T A;  2J6K A;  1NM7 A;  2LX7 A;  3VS0 A;  1HSQ A;  3REB B;  4J9I A;  4J9E A;  2KT8 A;  1QKW A;  2EW3 A;  2JS2 A;  4EIK A;  2RQR A;  1XOV A;  3ZL7 C;  3I35 A;  1JEG A;  4J9B A;  1VYT A;  4IIO A;  2RN8 A;  1T0J A;  2J05 A;  1T3L A;  4ZNX A;  1I07 A;  1NLO C;  2YUP A;  2RQV A;  2EYX A;  3EHR A;  2ED0 A;  2CH4 A;  1K0X A;  1M8M A;  1PNJ A;  2EYW A;  1UHC A;  1LCK A;  3PVL A;  2GTO A;  1JU5 C;  4X1V A;  4ESR A;  2DX1 A;  2K79 A;  2DVJ A;  2DL4 A;  1ZLM A;  1AWO A;  4OMN A;  2JS0 A;  4AG1 C;  4M4Z A;  2DRM A;  2C0T A;  2RQT A;  5FWC A;  2LP5 A;  4JJB A;  3NHN A;  4IIM A;  1EFN A;  3THK A;  1ZUK A;  1AZG B;  2ED1 A;  2E5K A;  1H3H A;  5IHK A;  1UDL A;  2LNH B;  4E6R A;  1K0S A;  4CC7 A;  1OPK A;  1WLP B;  1X2K A;  2K2M A;  2YDL A;  2RQU A;  2CDT A;  5I22 A;  4LE9 A;  2JM9 A;  2LZ6 B;  1BK2 A;  2CH4 W;  3SHW A;  3TSZ A;  2PZ1 A;  1NEG A;  3EG1 A;  2DBK A;  1MUZ A;  1RLP C;  2HCK A;  2EGA A;  5I11 A;  1UFF A;  2O9S A;  1OEB A;  4GBQ A;  3GBQ A;  2J6O A;  2JXB A;  2V1R A;  2KBT A;  2RNA A;  1N5Z A;  4JZ3 A;  4RTZ A;  1HJD A;  3JV3 A;  5IXB A;  1NYF A;  2FPE A;  1BU1 A;  1MV0 B;  2BZ8 A;  1SPK A;  3M0T A;  2AKL A;  2LJ3 A;  2GBQ A;  3VRY A;  1VYV A;  2D8H A;  1MV3 A;  5EC7 A;  4HXJ A;  2EYY A;  2FEI A;  1UG1 A;  1BBZ A;  1JQQ A;  5IHI A;  2A08 A;  1KFZ A;  2KXD A;  3M0U A;  1UGV A;  2MIO A;  1JXM A;  1Y57 A;  2DLP A;  1ZUY A;  4HCK A;  2D0N A;  1WIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...