3M0PA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 4.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
ELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0pA00
4HXJA 2RN8A 3JV3A 2JTEA 3SEMA 4J9FA 2FPFA 2GTOA 2DBMA 2CUDA 2EGAA 4AG2C 1JXOA 1BB9A 1CKBA 2KE9A 1G2BA 1YN8A 2D8JA 2V1QA 3C0CA 2KT8A 1WDXA 2DJQA 2EQIA 1QKXA 4RTVA 1JU5C 2L3QA 3QWXX 2K7AA 2M51A 2OI3A 2FRWA 3ULRB 2DX1A 1NEBA 1SHGA 1S1NA 2J05A 3VS2A 1YWPA 5IXBA 2BZYA 1NM7A 1E6HA 1NLOC 1WLPB 1H8KA 1W70A 3H0HA 1U06A 3M0TA 4Z88A 3VS1A 5IXFA 1AOJA 1KJWA 1ZUYA 1UFFA 1UDLA 3LH5A 2YUOA 1M8MA 2DL7A 2VVKA 2HSPA 2YT6A 5GJWB 3M0QA 2EGEA 2EYXA 1TUCA 2MIOA 3VS5A 3M0UA 4RTYA 1BU1A 2E5KA 1X69A 5IHKA 2K2MA 3CQTA 2BTTA 2IIMA 2O9SA 1K4US 1M3CA 3VS6A 3A98A 2HEQA 1GRIA 4F17A 1WFWA 2CSIA 2O31A 2ED1A 1PHTA 4LUDA 2FO0A 2LJ1A 3UA6A 2LP5A 4EIKA 4OMQA 3TVTA 2K3BA 1UHCA 2SEMA 4ESRA 2GTJA 1MV0B 1UUEA 2CH4W 4OMPA 4RTTA 1VA7A 2HDAA 2X3XD 1NYGA 1M3BA 2LQNA 1HSQA 2SRCA 1U5SA 5ECAA 3QWYA 1FMKA 2A08A 5IH2A 1WYXA 1X27A 4LUEA 2JM9A 4RTXA 1X2KA 1AWOA 3REAB 1X43A 1K9AA 2ROTA 4E6RA 1GCQC 2VWFA 2CUBA 3U23A 2FPEA 2JT4A 3TSZA 2DL5A 2DRKA 2HCKA 2O88A 1W6XA 2W0ZA 2EGCA 3RNJA 1JQQA 4LNPA 2J06A 1QWEA 3PVLA 2KT1A 4KRTA 1GCQA 1VYVA 3H0IA 1GFDA 1PRLC 2YSQA 2YUQA 2J6FA 4JZ4A 1RUWA 1K1ZA 1I1JA 4JJCA 1ZLMA 2DMOA 3NGPA 2DLPA 1UJ0A 5IHIA 1H92A 1RI9A 3UATA 4D8KA 1RLPC 1WI7A 2KR3A 2G6FX 1W1FA 4X1VA 1M3AA 1N5ZA 1SEMA 2ECZA 2BZ8A 4J9EA 3EHQA 2P4RA 3NHNA 2MOXA 2RQVA 2LCSA 2GQIA 4LE9A 2D8HA 2L0AA 1WXTA 4HVVA 1AVZC 1Y0MA 2H8HA 3H41A 2DVJA 2EW3A 2LJ0A 4J9IA 1FYNA 3GBQA 2LX7A 1YNZA 2PNIA 2O2OA 5FWBA 1GL5A 1JXMA 1ZBJA 2AK5A 2CDTA 1T3LA 3RBBB 1H3HA 2EVRA 2ESWA 1AWWA 1ZUKA 2KXDA 3UF4A 4R0KA 3IQLA 4CC4B 2GBQA 4RTUA 1YCSB 4Z8AA 2L2PA 2K79A 1UG1A 2LNHB 2ENMA 1GBRA 2W10A 1GFCA 2JMCA 4JJDA 4OMMA 2VKNA 2KXCA 2AZSA 2OAWA 2J6OA 4HVWA 1OOTA 2DILA 4DEXA 2CH4A 1OV3A 2L3SA 2A36A 3I9QA 3VS3A 2L3PA 4HVUA 2KROA 2QDLA 2KRSA 4K11A 2DBKA 5EC7A 4AFZC 3I35A 1UTIA 2YUPA 4J9BA 1ZUUA 4JZ3A 2LMJA 1WXBA 4F16A 3KFVA 2DA9A 4AFUC 2CT3A 1B3QA 2NUZA 1AD5A 2FG0A 4HCKA 2DL3A 1K0SA 2XMFA 2DL8A 2RPNA 2A37A 1ZX6A 2C0OA 1SRLA 3TSWA 2FEIA 2B86A 4RTWA 1LCKA 1XOVA 2K6DA 1IO6A 1ABQA 2YDLA 1OPKA 3R6NA 1JO8A 3I5RA 2CREA 1EFNA 2KNBB 2K9GA 1G83A 1K76A 2KEAA 1CKAA 5L23A 2FRYA 2JS0A 3NMZC 4GBQA 1PRMC 2M0YA 2YUNA 5I11A 2FPDA 1BBZA 1BK2A 3EG1A 1I0CA 4WCIA 1AEYA 1MUZA 1SSHA 1T0JA 4D8DA 4RUGA 3SHWA 3VS0A 1UHFA 3NPFA 2J6KA 1QWFA 3FJ5A 2O9VA 1PNJA 3VRZA 2KYBA 1GBQA 3VRYA 4ZNXA 2KRMA 1U3OA 1T0HA 1Z9QA 1J3TA 1M30A 4J9CA 1NLPC 2RQTA 2LQWA 2DF6A 2AZVA 2JM8A 1PWTA 2ROLA 2PTKA 2JXBA 2MCNA 1ZSGA 1I07A 3EG2A 2OJ2A 2EYYA 2C0TA 4CC3A 2DNUA 2PZ1A 2DE0X 1X6GA 1K0XA 1RLQC 1AZEA 3I5SA 2F2XA 1PKTA 4J9GA 2CSQA 2EYWA 1OPLA 4QT7A 1WXUA 2BZXA 1TUDA 1UGVA 2KBTA 1X2QA 1NYFA 4GLMA 5IHNA 5FW9A 3O5ZA 4F14A 1CSKA 3REBB 1KFZA 3PVQA 2KRNA 1AZGB 2D1XA 2JW4A 2X3WD 3EGUA 1VYTA 1SPKA 1VYUA 1E7OA 1QKWA 2JS2A 4JPBW 1TG0A 2F2WA 2EYZA 4JJBA 1E6GA 1X6BA 4ORZA 2J7IA 1T3SA 1QCFA 1SRMA 1KSWA 2JMAA 2GNCA 4OMOA 1UE9A 2RF0A 3PE0A 4LN2A 1OEBA 4M4ZA 4CC7A 4FSSA 2RMOA 1HJDA 3THKA 4AG1C 2C0IA 1YP5A 1WA7A 2I0NA 2RQWA 1PKSA 1ARKA 1UECA 2DM1A 2KYMA 5FWCA 2EKHA 1Z9ZA 4DEYA 1WX6A 2CT4A 2NWMA 4RTZA 2EBPA 1AWXA 1MV3A 2DYBA 2ABLA 4Z89A 2DL4A 2LZ6B 4J9HA 3VS7A 2GGRA 1YWOA 2ED0A 2AKKA 3EHRA 2RQUA 3EG0A 3M0PA 4J9DA 1JEGA 4AFSC 4IIMA 2F2VA 1KIKA 1WIEA 2V1RA 3M0SA 2RQRA 1M27C 2EPDA 2D0NA 3M0RA 2AKLA 2LJ3A 1HD3A 5HCKA 1GCPA 1V1CA 4IIOA 3EG3A 3ZL7C 4AFQC 1QLYA 1SHFA 1AWJA 2A28A 1ABOA 3H0FA 4OMLA 1NG2A 4OMNA 4A63B 5GJVB 1NEGA 3UA7A 2KGTA 2HBWA 2DRMA 1Y57A 1UJYA 3VS4A 4CC2A 1B07A 1A0NB 4Y92A 5I22A 2RNAA
chains in the Genus database with same CATH superfamily
4HXJA 3L2ZA 2RN8A 3KBGA 5CAIA 3JCMb 3JV3A 2JTEA 3TU4K 3V7RA 4XTUA 2GTOA 4AG2C 2KE9A 3CCSQ 1G2BA 3OYYA 2BE9B 1YN8A 3C0CA 2KT8A 2M0OA 1BKBA 4HCCA 3QUIA 3A8HB 2JUFA 4E2FB 2YLBA 4ZN3A 2K7AA 3TQ7P 4EDUA 1KC8U 2FRWA 2DX1A 4Q5WA 3J81E 1S1NA 4XTXA 1BI3A 2X51A 1RABB 4RKUE 1N27A 2YRVA 1AOJA 2F5KA 3QJ6A 4C8QA 4FCYA 1Q7YR 3LH5A 2YUOA 4C8QG 4IUUA 2HSPA 1TTHB 2YT6A 2VB6A 4BB7A 4FT2A 4JS5A 3S6WA 1AT1B 3S3OA 4E7LA 5C0MA 5J3BA 1VQKA 3URGA 2QQ9A 1PC0A 2QEXT 3OYNA 1G3TA 5CR2A 1O75A 4D6WA 4C92D 1YITQ 1VQKQ 1G3WA 1K4US 3G6ET 1Q81C 2EYQA 3P8HA 4C92E 3VS6A 1GRIA 3QSUA 4F17A 1BIAA 1M90C 4CRIA 2HKQB 3C95A 4EIKA 2LP5A 4L59A 4DOVA 2LTOA 2RK1A 3LGFA 2X3XD 4LDUA 4RTTA 2LQNA 5KYUA 2K2VA 1FMKA 4DBQA 1WYXA 4RTXA 1X2KA 1AWOA 1X43A 2ROTA 1KK7A 1M1GA 1Y07A 3OYEA 1NJIC 1WJQA 2LCLA 2JT4A 4EMKC 2Z0WA 2HQXA 3JCMg 4ZTJA 2NUTA 1RAAB 4PJNA 1H3ZA 1JJ2A 3M56A 3OYMA 1B34B 3CCMA 4C8QF 2EGCA 1JQQA 4M7AB 4LNPA 4FYVB 4OB2B 4PJOC 1QP2A 1AHJB 1VQ6T 1GCQA 4NS5A 4BUGA 3H0IA 3QZ9B 2O4XA 4KH1B 3ASKA 3ME9A 3CC2T 1R8OB 1RUWA 4M7DA 4JJCA 1ZLMA 4F7UF 5IHIA 4QVCA 1H92A 4O5VA 1NPPA 4AT1B 2KR3A 4HT8A 1IRXA 3OBWA 3EFRA 1N5ZA 1SEMA 2ECZA 3C4SA 3EFSA 1GXIE 2QASA 3EGXB 1VQ7T 1Q86U 4C0DC 2GQIA 2DIGA 2E70A 3BDUA 3CC4T 1EIFA 4QKUA 1WXTA 2GFUA 2NLUA 1K9MR 4J83A 5KYXB 2H8HA 1R0CB 3H41A 4ANJA 1FYNA 1QW1A 2PNIA 1X75C 1JXMA 1ZHIA 3RBBB 5GAMh 2ESWA 2LC4A 1SKUB 1MNEA 5KE3A 1KC8C 2KXDA 1I5LA 5GAMe 1SF9A 4Z8AA 3SD4A 3PFSA 5CKBA 3LLRA 3CCVA 3DKMA 5DY9A 3OYGA 2L89A 2ZZDA 3VUZA 2ENMA 3A5ZB 1GBRA 4OMMA 3KUFA 2VKNA 4HVWA 3OMGA 4DEXA 3CCVQ 4PK4A 5HK0A 5GAOl 3H9NA 1ACMB 4AMCA 3VS3A 3L1AA 4M7DF 1Q82R 4K11A 2FVUA 2DBKA 4X9DA 3JCMJ 1UTIA 1ZUUA 2MAMA 3EAEA 2BUDA 3KFVA 2DA9A 4WF2A 4ZTFA 4HCZA 5GANh 3EGDB 1QVPA 2XMFA 1WHJA 2DL8A 2RPNA 2OX7A 2P0KA 1SRLA 2DD4A 5GANe 3HFNA 1IO6A 3L2VA 1KG1A 3QJYA 3R6NA 3V7CA 1ZSZB 2K9GA 1G83A 3Q1JA 4O6JA 5AYFA 4QW2A 1W2BA 1F1BB 2JS0A 1VQ5T 2ZAEA 1V29B 2PVDB 5I2SA 4R55A 3TEEA 2YUNA 4KGVB 1WQWA 1AEYA 1BBZA 4WCIA 5LJ3f 1SSHA 3A8MB 3CEYA 1B34A 3G71T 3VS0A 4ELYC 4M7AA 1QWFA 1YHQA 4M7AG 1PG5B 3A1PA 4C8QD 4ZNXA 2EIFA 1T0HA 2DD5A 2DEUA 1Z9QA 1YHQQ 1IGQA 2WSEE 1YIJA 3NFCA 5GMKl 4C8QE 2DIQA 1NLPC 2LQWA 3WXMB 2DF6A 3C12A 2DETA 3HFOA 2JM8A 3OS1A 2E65A 1PWTA 3UWNA 1I07A 4E7IA 1BI0A 1RADB 2O01E 3EG2A 2EYYA 4KGZB 2PZ1A 1Q7YU 2QK0A 1X6GA 1BIBA 1K0XA 2DERA 1WJSA 1YJWA 3I5SA 4F7UE 1Q86C 2F2XA 3JB9I 2CSQA 3QBYA 1OU9A 4E7SA 3OS0A 2KBTA 5KYXA 2EQUA 5IHNA 4C5IA 4GLKA 5A2QE 2Y90A 2E5QA 4F14A 3REBB 3MHXA 2KRNA 4MZMA 2A0FB 1PCXA 2JW4A 2LQ8A 2X3WD 1E7OA 2YXYA 3J7AF 2F2WA 1VQLA 1E6GA 4ORZA 1YJ9T 1SSFA 1WHLA 1T3SA 3META 4BACA 1IB8A 4BY6C 2JMAA 2LDMA 2RF0A 4LN2A 1VQLQ 4CC7A 2RMOA 1HJDA 3GIBA 3THKA 4AG1C 4KUIA 3X20B 3BE3A 2RQWA 1PKSA 4BD3A 4JLIA 2NWMA 1NPRA 2R57A 2ABLA 1RAFB 1IHWA 2DL4A 4J9HA 5GAN6 4C92G 2ZPHB 2E41A 1K8AR 4M7DD 3EG0A 3V8KA 2L5QA 4J9DA 2X4WA 4PFOA 2PVOB 4IIMA 3JB9J 4M7DE 1WIEA 3JCMV 1KIKA 3M0SA 3CCRT 1S72Q 3SWNC 5LJ3g 2D0NA 4QQ6A 3FJPA 3LW5E 3N5BB 3UDCA 5FU7C 1HD3A 2DXUA 1BI1A 4BI4A 4IIOA 1WPYA 4ZN1A 1ABOA 3LWIA 5GAOr 2WSCE 1NEGA 2EQKA 4JRQA 1ZSZA 3VS4A 4CC2A 2CZ6B 5L8RE 1JBMA 3CC7A 4J9FA 2FPFA 1VQ9A 2DBMA 3BFMA 3CCJQ 1K9MU 2DK3A 4E7HA 4IUTA 3CC7Q 3OA6A 1WDXA 3BDLA 4J6XA 1QKXA 4RTVA 1I81A 1JU5C 2L3QA 3NTHA 1VQ4A 3OYDA 1M5Q1 2M51A 5LL6S 1BCOA 3EG9B 2Y4XA 5LJ5d 1WHGA 1YWPA 5A0GA 5IXBA 1VQ4Q 2PU9B 1W70A 3H0HA 4F7UB 1D0ZA 1KJWA 4M77F 2DL7A 4FW2A 2VVKA 1KQ2A 3QZ5B 3OYCA 1Q7YC 5GJWB 2K4YA 1LOJA 3DB4A 1OYXA 2MF2A 4KH0B 2XICA 1H641 1TUCA 3VUBA 3CMEA 2QA4T 4HT9A 1OZ2A 3HTRA 1BU1A 2E5KA 1LNXA 1Q82U 4M75F 3I55Q 1VIFA 2K2MA 3CQTA 2P84A 3CMEQ 3OS5A 5CK9A 4C5GA 2JNGA 3A98A 3X26B 1WFWA 2CSIA 1VUBA 3QO3A 1TU0B 1KD1R 4FM4B 2QQRA 2V26A 1P92A 2FO0A 4LUDA 3UA6A 4OB3B 3HSBA 2QG9B 2ZPGB 4XTVA 2JZ2A 2NUTB 2GTJA 3HHTB 1UUEA 4OMPA 2HDAA 3MEAA 5GAMf 1M3BA 1QMCA 3CCEA 5IH2A 2A08A 2HBPA 3JCMd 4LUEA 2JM9A 2QYZA 5CQYA 4JS4A 2WACA 4E6RA 3CCQT 2CYZB 2LRQA 4NL2A 1HK9A 1VQ8A 3CCEQ 2RI3A 3TSZA 4M7DB 4HCBA 2DL5A 5CO7A 4J7FA 2RJFA 3FDRA 1VQMA 1W6XA 2O88A 1VQ8Q 3CCST 1UGRB 9ATCB 3CPWP 1QWEA 4M7AC 3OMCA 1ZA2B 3CXCP 3PMTA 1VQMQ 1PRLC 3L2UA 5KCOA 4QVZA 2V8IA 4JZ4A 4BE2A 3M9QA 3OW2S 1UB4A 3NGPA 2DLPA 1WQ7A 1IREB 1M1FA 2VV5A 3RUXA 4E7KA 3GNGA 3AHUA 1SG5A 4RCCA 2P4RA 4M78F 2MOXA 2LCSA 1LVKA 4ZGJB 4LE9A 2D8HA 2RHZA 2ZCFB 4HVVA 1AVZC 4LD9K 3CCUA 3JCMc 3J80E 1K9MC 5IN1A 2KI7A 2E10A 1OU8A 2EW3A 5A0LA 1YITT 1MMGA 1VQKT 2RHUA 3CCUQ 1YNZA 3SFMA 5FWBA 5I2MA 1ZBJA 2CDTA 3VU3C 1T3LA 2EAYA 2EVRA 1AWWA 2DAQA 4Z02A 3EG9A 3LWHA 1ZUKA 3UF4A 2GBQA 3CMAA 2JOYA 2K79A 3CBPA 4F7UA 4F7UG 3OQ5A 1MMDA 1MMNA 2W10A 1GFCA 2DKGA 5D6XA 4JJDA 3CMAQ 4BE1A 2D6FA 2KXCA 2OAWA 2VASA 3HRTA 5KCHA 2CH4A 2A36A 4WTOB 2L3PA 4M77E 1QVGS 2QDLA 2DZCA 4PLLA 2DVEA 2COZA 5EC7A 4C92C 2CKKA 3JRZA 2YRDA 1K8AU 2FB7A 1OX9A 4M75D 2QEXA 2QGFB 3P8DA 4AFUC 4M75E 2NUZA 1EZZB 1K0SA 1M1KR 5FLXE 2A37A 3TSWA 4OGEA 3G4SA 2KQWA 2LNVA 1XOVA 2M1HA 2K6DA 5FRMA 2YDLA 1OPKA 3I56A 3G4SQ 1EFNA 2IG0A 5HK3A 8AT1B 3CCMQ 1N8RR 2MYSA 1K76A 2X9HA 4RCBA 3I56Q 1VQNA 2FRYA 4BDYA 3NMZC 1NBEB 4GBQA 2MWOA 4XQ3A 1MUZA 1T0JA 4M7DG 4D8DA 4DBHA 1VQNQ 2QQAA 2NUPB 5GAN4 2RI2A 2X35A 2JTFA 2EQJA 2CS7A 2RO0A 3VRZA 4ME7A 2KYBA 3VRYA 2YWWA 2KRMA 1U3OA 3RDVA 1UGSB 3MKDA 5LJ3j 4E7ZA 2RQTA 1VQ6A 4C0GA 1TUGB 2ROLA 3CPFA 2CZ1B 2PTKA 3V8LA 5LJ5h 1ZSGA 5GMKj 1LPLA 4J6WA 1TWBA 3QYHB 1WHHA 2DNUA 3NTKA 2CZ0B 5LJ5e 3E9GA 3DB3A 4C5HA 6AT1B 1D1CA 2IPOB 4B6MA 4J9GA 3CCVT 1OPLA 1WXUA 2ZGWA 1WJRA 4MZTA 4M78D 5DLOA 4N0AA 1UGVA 1FXXA 1WGSA 3CC4A 4M78E 3O5ZA 3QPHA 3PVQA 1M2OA 3OYFA 4LXCA 2DTHA 1VYUA 2D0QB 1TG0A 1X6BA 2FZKB 3OYAA 1KD1U 1XJWB 1KSWA 1ZQ1A 3PT9A 4P5NA 2DPPB 3QXEB 2P0QA 4XU1A 4FSSA 3DLMA 4M77B 2C0IA 2QI2A 1JJ2P 2I0NA 3JCMh 1ARKA 3FB9A 3VYHB 2JTMA 2EKHA 4L5GA 1MV3A 3M5AA 3JCMe 4IUQA 4M75B 1JB0E 3AT1B 3M0PA 3RMSA 1JEGA 1K8AC 2V1RA 1FMVA 2FHDA 2RQRA 2EPDA 2AKLA 1WHMA 5HCKA 1GCPA 1YHQT 2JN0A 4X34A 2F1LA 3UPUA 2C06A 2K5LA 3H8ZA 1Y96B 5GAOm 5GJVB 4PJOB 2HAXA 1IGUA 2FYKA 2E12A 2HBWA 3T9NA 5M9OA 1RAGB 1A0NB 4Y92A 2RNAA 2BIVA 3SEMA 3M59A 5DM7R 5GAN3 3OW2A 2I2LA 3VYGA 1K73R 3F70A 1BB9A 2VYTA 1VQ5A 2NUPA 2D8JA 1YIJQ 2V1QA 4ZGDB 3GOXA 4EMHA 2DJQA 2EQIA 4C8QC 3WVDB 2RHIA 3O8VA 4C0DB 5I21A 4XU3A 3PTAA 3ULRB 3MEVA 2OTLA 3V7SA 1NEBA 5FU6C 4OB1B 2H3JA 2J05A 1YJWQ 1NM7A 1E6HA 1WLPB 1H8KA 3VS1A 5IXFA 1U06A 4Z88A 1C0MA 2OTLQ 2GQVA 1ZUYA 1UFFA 1VQLT 1M8MA 3OS2A 3M57A 1YCYA 4JRKA 1KC8R 1KHCA 4M78B 1DJ7B 5CIUA 4NL3A 3L42A 4KUDK 2EYXA 2MIOA 3VS5A 5CKFA 4ELZC 1D1AA 5CKEA 5IHKA 1EX4A 3EFOB 5GMKm 4LDYA 1KQSS 3JCMQ 2O9SA 3WVEB 3A8LB 4TVRA 4BI3A 5HKCA 4FYYB 2O31A 2QQSA 2ED1A 1S72T 1PHTA 4Y28E 3RKYA 2LJ1A 1M1KU 3TVTA 1KD1C 1QVGA 2SEMA 4ESRA 3QDFA 1MV0B 1YJ9A 1VA7A 1OI1A 1W2BP 1NYGA 1Q95G 2K5IA 3RR6A 2PUOB 1HSQA 2ZPEB 5ECAA 3QWYA 4M77A 1TH7A 1X27A 4M77G 3REAB 2MWPA 1K9AA 4PFZA 1GCQC 2XU8A 1JRIA 4C5EA 1N8RU 2HL5C 3G1JA 3U23A 2ZPFB 2FPEA 2QGGA 1FX7A 3MP6A 1M8VA 4M7DC 2L3RA 5IAYA 2HCKA 4M75A 4PJJA 2W0ZA 3CCJT 3RNJA 4M75G 2VGMA 2KMTA 1RAEB 3M4GA 1ZBXA 3OW2P 4E47A 3CC7T 2L8DA 3S3NA 2DTOA 1GFDA 3MPUB 4KBMB 1KQ1A 1RAHB 2YSQA 4EMKA 3MEWA 2R5AA 2YLCA 3PGGA 4XTYA 1UJ0A 1RI9A 2X4YA 4D8KA 1RLPC 1Y96A 2JVVA 1VQ4T 4PJOA 3C94A 1M3AA 1WNLA 1OQKA 1VQ9Q 1VQPA 2GCXA 4J6YA 1D1BA 2RJEA 3EHQA 3A8GB 4MZPA 2F69A 1IHVA 1VIEA 2DO3A 2L0AA 1VQPQ 2MK5A 4J7IA 3I55T 4BE0A 2XD0A 2FL7A 3RERA 2H3EB 2DVJA 2LJ0A 2E64A 3CMET 2LX7A 4OGCA 3ZEHA 2O2OA 1GL5A 4LDXA 3RMQA 1H3HA 2Y4YA 3EH1A 4R0KA 3IQLA 3GPLA 4RTUA 1UG1A 2E6NA 4PL6A 3PMIA 3TREA 1QVGP 2JMCA 2AZSA 2J6OA 1U1SA 5A0DA 3X24B 4MDXA 1OOTA 2DILA 2L3SA 2QAZA 4M78A 5LJ5f 4BY6B 1I4K1 4UC4A 4M78G 4HVUA 3BW1A 2XG8D 1NE8A 3CCET 2KRSA 1YI2A 4ATOA 2ZPIB 4OMFB 2VC8A 4AFZC 2YUPA 1TS9A 2YHTA 4JZ3A 4PJOF 3UT1A 3EFOA 3X25B 4OVAA 1VQ8T 5LJ3h 5D6WA 1YI2Q 1VQOA 1UEBA 1N9RA 2OTJA 2CT3A 1B3QA 3G7ZA 5GMKh 3SDZA 1IZ6A 5J26A 2FG0A 4HCKA 1RI0A 2XDDA 1VQMT 1PD1A 1VQOQ 1ZX6A 1YFNA 2RJDA 2FEIA 2OTJQ 1M1KC 4V2SA 5GMKe 4RTWA 2PQWA 3PIOA 4XAXB 1LCKA 2EJGA 1PD0A 2MI6A 4CI0C 2COWA 3I5RA 1YJNA 2MPXC 4QQGA 3CD6A 4KULA 2EFIA 3HPWA 1B7TA 1MHNA 5CCAA 1YJNQ 4DBFA 2HQEA 2M0YA 2LT1A 3CD6Q 1BK2A 1I0CA 1K73U 4RUGA 3P8BB 4R56A 1HXDA 3SHWA 3LH0A 1UHFA 3NPFA 3JCMf 5FRNA 1R0BG 3FJ5A 5GANf 1U1TA 3GLXA 3CCLA 1PNJA 5D6YA 4LDWA 4N4HA 2DJZA 3CCSA 2DZ9A 3CCUT 3E2UA 1M30A 1UGQB 2AHJB 2RI5A 3CCLQ 2CZ7B 2AZVA 4PJMA 4NOYA 3OYIA 1TOVA 2JXBA 2QDYB 1OX8A 3JB9F 5KYWB 1G3SA 2CP0A 4B9WA 5J39A 1QVFS 4F04B 2DE0X 1U8RA 1XTDA 2OAUA 1AZEA 2A3LA 3CMAT 5FROA 3LYIA 1PKTA 4A4KA 4JJNK 3EH2A 4BDZA 2BZXA 2DXCA 4KT0E 4IKFA 4JRPA 5CQXA 1X2QA 1NYFA 2E6ZA 1G5VA 3QDRB 5FW9A 2HL3A 5LJ5g 2K3YA 1QCNA 2M02A 5GAN7 3EGUA 2XKOC 1SPKA 1QKWA 2HZYA 2JS2A 5KE2A 2RHYA 4JPBW 1D3BB 4M77D 4JJBA 3INZA 1YITA 3FIFA 1LJOA 1QCFA 1SRMA 2V8KA 3OYHA 5GAMg 3QKJA 1ZA1B 4A53A 2NYSA 4OMOA 1UE9A 1OEBA 3MP8A 3HRUA 1Q82C 2P0PA 5KYYB 1KQSA 2RD1A 2KK4A 2HMAA 1UGPB 1YP5A 4M77C 3G4ST 2RM4A 1HYOA 4B9XA 1WA7A 5FWCA 3CCMT 1C6VX 3G6EA 1Z9ZA 4DEYA 4DBRA 2QEXQ 2CT4A 3I56T 2IVWA 5GAOp 1X01A 1MNDA 2LZ6B 4Y91A 4EMGA 3S3MA 1YWOA 3MP1A 2ED0A 3EHRA 2PUKB 5CKDA 2RB6A 3G6EQ 4FT4A 4M75C 1VQNT 1QP3A 4XU2A 2M9UA 4PJOD 4N4IA 1KHIA 1M27C 2RA2A 3JB9H 4A4HA 1ZSZC 4PJOE 2COYA 1V1CA 1D0XA 5C6SA 5GANg 3ZL7C 4AFQC 4JDSA 1QLYA 4EPCA 3OYLA 3H0FA 4OMLA 1NG2A 2LQKA 4A63B 2RJCA 4VUBA 1D0YA 1W4SA 2KGTA 3SWNA 2K57A 1UJYA 4DQ2A 2LX9A 2E3HA 4A4EA 4HKEA 3LX7A 3OY9A 2RHXA 4GY5A 3CPWS 2LT4A 2HKNA 1RL2A 3CXCS 4ZGEB 2CUDA 4PLIA 2EGAA 1JXOA 1CKBA 1NZ9A 1WZOA 2HD0A 1K73C 3CC2A 2XI9A 1VQ6Q 3CBMA 2K3XA 4FW1A 3QWXX 4II1A 3M54A 3CC2Q 2OI3A 2XIDA 3E19A 4MMKA 2MMPA 1SHGA 2KY9A 3VS2A 4BI8B 1VQ7A 3PIPA 2FZCB 1FWZA 2BZYA 3MO8A 4YTLA 1NLOC 2V8JA 3M0TA 5KYWA 1D09B 3M4YA 1UDLA 3FC3A 4IURA 2KSSA 1VQ7Q 1MMAA 3X28B 3JB9D 4C0ZA 5GMKi 3CC4Q 4PFPA 1WHKA 3E1SA 5KH6A 3M0QA 2EGEA 2LVMA 3HP9A 1KQSP 4M78C 3M0UA 2PVGB 4RTYA 1X69A 4DA4A 2KAFA 1Q81R 2BTTA 2EQMA 2IIMA 2R5MA 3GNFB 1M3CA 2HEQA 3PNWC 1M90R 1D3BA 2AIRB 4RG8A 2G3RA 3OB9A 4J5YA 4C92B 4OMQA 2K3BA 2VXFA 1UHCA 1X6OA 1RAIB 2CH4W 5LJ3d 5AT1B 3OBYA 3HL8A 5KYYA 2SRCA 4PKCC 1U5SA 2QQBA 3KXTA 3GF5A 1NJIR 5GAOq 2VWFA 4J8OA 4A4GA 4EMKB 3MCAB 2CUBA 2GF7A 2DRKA 3VKIA 3OYBA 4RG2A 4E7JA 4C0FA 2J06A 1YIJT 3PVLA 2KT1A 4KRTA 4FIBA 1VYVA 3SB2A 2YUQA 2J6FA 2EWNA 5KYNA 1K1ZA 1I1JA 2ATCB 2DMOA 3QYGB 1TSFA 2AT1B 3JSCA 3UATA 1WI7A 1YJWT 3V8JA 2G6FX 2X4JA 1W1FA 4X1VA 1N6AA 2CP7A 2OTLT 1Y71A 2QTVA 2BZ8A 4J9EA 1PSFA 3G71A 3NHNA 1VQ5Q 2RQVA 2CP2A 5CVIA 2XDPA 1G3YA 1PSEA 1Y0MA 2RH2A 2XDBA 2BKDN 3G71Q 4IUPA 3OSVA 1OZ3A 3M53A 3VJPA 3OSSC 4J9IA 1QVFA 3GBQA 1V76A 3EGXA 5IT9E 2AK5A 4OP0A 1C1AA 3RIRA 2BE7D 5GAN2 3E9FA 4CC4B 1YCSB 2L2PA 2LNHB 4XTWA 2K5FA 4OF1A 1I8FA 3JAME 1R77A 2VGNA 3DLLA 2DFUA 1OV3A 3MJXA 2E4HA 1VOMA 3I9QA 1M2VB 1XQHA 1XNIA 2KROA 4PJLA 3FLGA 3VV0A 2E1HA 3I35A 4QVDA 2GFAA 3QG1A 4J9BA 4M7AF 1IXDA 2LMJA 1WXBA 4JUVA 1N9SA 2F5TX 4F16A 3NTIA 2D9TA 4IUVA 2EKOA 1OULA 3RKXA 3RKWA 5LJ5j 2QXFA 1YJ9Q 2KDSA 1AD5A 1QQJA 2DL3A 3A8OB 2C0OA 3HRSA 4C92A 2XK0A 3D7SB 4JLGA 2B86A 1JJ2S 2HNIA 2DXTA 3L2QA 5GAMj 2XHCA 1S72A 4L6V5 1ABQA 1I5OB 1JO8A 4RMOA 2CREA 2KNBB 1VQ9T 3JCMX 3EGDA 2KEAA 1CKAA 5L23A 1PRMC 2DTIA 4N4GA 5I11A 3CCRA 2FPDA 3EG1A 1FMWA 1VQPT 5GAN5 2CP5A 3ZBDA 2RK2A 2J6KA 1YBYA 2O9VA 3CCRQ 4PJOG 2R58A 5CKHA 3CBOA 4FSXA 1GBQA 3CCJA 2DEQA 1J3TA 1M9SA 4QQDA 4J9CA 4XK8E 3GP8A 4A54A 3FEOA 3H6ZA 2P4TA 1QVFP 3CPWA 4LD6A 3CXCA 2MCNA 5GANj 4N0AC 3MEUA 1RACB 2OJ2A 4C8QB 2EJFA 2C0TA 8ATCB 4CC3A 3JCMP 3L2RA 2JJ9A 2B8AA 1RLQC 1Q86R 5EG2A 3M58A 5FU6B 2EJ9A 2EYWA 2M16A 4QT7A 4C92F 2CP6A 1TUDA 2YRCA 1M4ZA 4GLMA 2E3IA 4PNOA 3HKSA 1CSKA 1Q81U 1KFZA 1MGQA 4FL6A 5GAMd 1AZGB 2D1XA 4HA8A 1VYTA 4MMLA 3QIIA 1YI2T 2DXBA 3I55A 1M90U 1BI2A 2EYZA 2J7IA 5DLQE 3TCJA 1VQOT 2GNCA 3L2WA 3PE0A 3R6OA 2OTJT 4M4ZA 4XTZA 5HY6A 2QA4A 5KYUB 3JB9G 3QHSA 3ER0A 1O9SA 3JCMW 3BY7A 1TXQA 4DOWA 4MDWA 2DYIA 3LGLA 1NJIU 2QA4Q 1M2VA 1UECA 2DM1A 2KYMA 5LJ3e 1WX6A 5GAN8 4FU6A 4RTZA 2HSEB 4A4FA 2EBPA 1AWXA 2DYBA 4Z89A 4OB0B 1YJNT 3VS7A 2X4XA 3M55A 2GGRA 4JRIA 3OYKA 3CD6T 2AKKA 3OYJA 2RQUA 5GAOn 2LCCA 3FRNA 2VXEA 2KVQG 4AFSC 2ZPBB 2F2VA 5GANd 4X9CA 3SWNB 2WSFE 4M7AD 5D7UA 5FU7B 2O4XB 1W2BS 3M0RA 1QCOA 2LJ3A 2VUBA 4M7AE 4KGXB 1Y7XA 2FZGB 4XU0A 2HQHA 1G8XA 1N8RC 3EG3A 2A7YA 3CCLT 3ZFJA 1SHFA 1AWJA 7AT1B 2A28A 2CGHA 3CCQA 2QTXA 4OMNA 4FYXB 1PM3A 1BCMA 3RESA 3UA7A 4FYWB 4LDVA 2DRMA 1Y57A 2CP3A 3CCQQ 1BYMA 1B07A 5I22A
chains in the Genus database with same CATH topology
4HXJA 2RN8A 3JV3A 2JTEA 3SEMA 4J9FA 2FPFA 2GTOA 2DBMA 2CUDA 2EGAA 4AG2C 1JXOA 1BB9A 1CKBA 2KE9A 1G2BA 1YN8A 2D8JA 2V1QA 3C0CA 2KT8A 1WDXA 2DJQA 2EQIA 1QKXA 4RTVA 1JU5C 2L3QA 3QWXX 2K7AA 2M51A 2OI3A 2FRWA 3ULRB 2DX1A 1NEBA 1SHGA 1S1NA 2J05A 3VS2A 1YWPA 5IXBA 2BZYA 1NM7A 1E6HA 1NLOC 1WLPB 1H8KA 1W70A 3H0HA 1U06A 3M0TA 4Z88A 3VS1A 5IXFA 1AOJA 1KJWA 1ZUYA 1UFFA 1UDLA 3LH5A 2YUOA 1M8MA 2DL7A 2VVKA 2HSPA 2YT6A 5GJWB 3M0QA 2EGEA 2EYXA 1TUCA 2MIOA 3VS5A 3M0UA 4RTYA 1BU1A 2E5KA 1X69A 5IHKA 2K2MA 3CQTA 2BTTA 2IIMA 2O9SA 1K4US 1M3CA 3VS6A 3A98A 2HEQA 1GRIA 4F17A 1WFWA 2CSIA 2O31A 2ED1A 1PHTA 4LUDA 2FO0A 2LJ1A 3UA6A 2LP5A 4EIKA 4OMQA 3TVTA 2K3BA 1UHCA 2SEMA 4ESRA 2GTJA 1MV0B 1UUEA 2CH4W 4OMPA 4RTTA 1VA7A 2HDAA 2X3XD 1NYGA 1M3BA 2LQNA 1HSQA 2SRCA 1U5SA 5ECAA 3QWYA 1FMKA 2A08A 5IH2A 1WYXA 1X27A 4LUEA 2JM9A 4RTXA 1X2KA 1AWOA 3REAB 1X43A 1K9AA 2ROTA 4E6RA 1GCQC 2VWFA 2CUBA 3U23A 2FPEA 2JT4A 3TSZA 2DL5A 2DRKA 2HCKA 2O88A 1W6XA 2W0ZA 2EGCA 3RNJA 1JQQA 4LNPA 2J06A 1QWEA 3PVLA 2KT1A 4KRTA 1GCQA 1VYVA 3H0IA 1GFDA 1PRLC 2YSQA 2YUQA 2J6FA 4JZ4A 1RUWA 1K1ZA 1I1JA 4JJCA 1ZLMA 2DMOA 3NGPA 2DLPA 1UJ0A 5IHIA 1H92A 1RI9A 3UATA 4D8KA 1RLPC 1WI7A 2KR3A 2G6FX 1W1FA 4X1VA 1M3AA 1N5ZA 1SEMA 2ECZA 2BZ8A 4J9EA 3EHQA 2P4RA 3NHNA 2MOXA 2RQVA 2LCSA 2GQIA 4LE9A 2D8HA 2L0AA 1WXTA 4HVVA 1AVZC 1Y0MA 2H8HA 3H41A 2DVJA 2EW3A 2LJ0A 4J9IA 1FYNA 3GBQA 2LX7A 1YNZA 2PNIA 2O2OA 5FWBA 1GL5A 1JXMA 1ZBJA 2AK5A 2CDTA 1T3LA 3RBBB 1H3HA 2EVRA 2ESWA 1AWWA 1ZUKA 2KXDA 3UF4A 4R0KA 3IQLA 4CC4B 2GBQA 4RTUA 1YCSB 4Z8AA 2L2PA 2K79A 1UG1A 2LNHB 2ENMA 1GBRA 2W10A 1GFCA 2JMCA 4JJDA 4OMMA 2VKNA 2KXCA 2AZSA 2OAWA 2J6OA 4HVWA 1OOTA 2DILA 4DEXA 2CH4A 1OV3A 2L3SA 2A36A 3I9QA 3VS3A 2L3PA 4HVUA 2KROA 2QDLA 2KRSA 4K11A 2DBKA 5EC7A 4AFZC 3I35A 1UTIA 2YUPA 4J9BA 1ZUUA 4JZ3A 2LMJA 1WXBA 4F16A 3KFVA 2DA9A 4AFUC 2CT3A 1B3QA 2NUZA 1AD5A 2FG0A 4HCKA 2DL3A 1K0SA 2XMFA 2DL8A 2RPNA 2A37A 1ZX6A 2C0OA 1SRLA 3TSWA 2FEIA 2B86A 4RTWA 1LCKA 1XOVA 2K6DA 1IO6A 1ABQA 2YDLA 1OPKA 3R6NA 1JO8A 3I5RA 2CREA 1EFNA 2KNBB 2K9GA 1G83A 1K76A 2KEAA 1CKAA 5L23A 2FRYA 2JS0A 3NMZC 4GBQA 1PRMC 2M0YA 2YUNA 5I11A 2FPDA 1BBZA 1BK2A 3EG1A 1I0CA 4WCIA 1AEYA 1MUZA 1SSHA 1T0JA 4D8DA 4RUGA 3SHWA 3VS0A 1UHFA 3NPFA 2J6KA 1QWFA 3FJ5A 2O9VA 1PNJA 3VRZA 2KYBA 1GBQA 3VRYA 4ZNXA 2KRMA 1U3OA 1T0HA 1Z9QA 1J3TA 1M30A 4J9CA 1NLPC 2RQTA 2LQWA 2DF6A 2AZVA 2JM8A 1PWTA 2ROLA 2PTKA 2JXBA 2MCNA 1ZSGA 1I07A 3EG2A 2OJ2A 2EYYA 2C0TA 4CC3A 2DNUA 2PZ1A 2DE0X 1X6GA 1K0XA 1RLQC 1AZEA 3I5SA 2F2XA 1PKTA 4J9GA 2CSQA 2EYWA 1OPLA 4QT7A 1WXUA 2BZXA 1TUDA 1UGVA 2KBTA 1X2QA 1NYFA 4GLMA 5IHNA 5FW9A 3O5ZA 4F14A 1CSKA 3REBB 1KFZA 3PVQA 2KRNA 1AZGB 2D1XA 2JW4A 2X3WD 3EGUA 1VYTA 1SPKA 1VYUA 1E7OA 1QKWA 2JS2A 4JPBW 1TG0A 2F2WA 2EYZA 4JJBA 1E6GA 1X6BA 4ORZA 2J7IA 1T3SA 1QCFA 1SRMA 1KSWA 2JMAA 2GNCA 4OMOA 1UE9A 2RF0A 3PE0A 4LN2A 1OEBA 4M4ZA 4CC7A 4FSSA 2RMOA 1HJDA 3THKA 4AG1C 2C0IA 1YP5A 1WA7A 2I0NA 2RQWA 1PKSA 1ARKA 1UECA 2DM1A 2KYMA 5FWCA 2EKHA 1Z9ZA 4DEYA 1WX6A 2CT4A 2NWMA 4RTZA 2EBPA 1AWXA 1MV3A 2DYBA 2ABLA 4Z89A 2DL4A 2LZ6B 4J9HA 3VS7A 2GGRA 1YWOA 2ED0A 2AKKA 3EHRA 2RQUA 3EG0A 3M0PA 4J9DA 1JEGA 4AFSC 4IIMA 2F2VA 1KIKA 1WIEA 2V1RA 3M0SA 2RQRA 1M27C 2EPDA 2D0NA 3M0RA 2AKLA 2LJ3A 1HD3A 5HCKA 1GCPA 1V1CA 4IIOA 3EG3A 3ZL7C 4AFQC 1QLYA 1SHFA 1AWJA 2A28A 1ABOA 3H0FA 4OMLA 1NG2A 4OMNA 4A63B 5GJVB 1NEGA 3UA7A 2KGTA 2HBWA 2DRMA 1Y57A 1UJYA 3VS4A 4CC2A 1B07A 1A0NB 4Y92A 5I22A 2RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXJ A;  2RN8 A;  3JV3 A;  2JTE A;  3SEM A;  4J9F A;  2FPF A;  2GTO A;  2DBM A;  2CUD A;  2EGA A;  4AG2 C;  1JXO A;  1BB9 A;  1CKB A;  2KE9 A;  1G2B A;  1YN8 A;  2D8J A;  2V1Q A;  3C0C A;  2KT8 A;  1WDX A;  2DJQ A;  2EQI A;  1QKX A;  4RTV A;  1JU5 C;  2L3Q A;  3QWX X;  2K7A A;  2M51 A;  2OI3 A;  2FRW A;  3ULR B;  2DX1 A;  1NEB A;  1SHG A;  1S1N A;  2J05 A;  3VS2 A;  1YWP A;  5IXB A;  2BZY A;  1NM7 A;  1E6H A;  1NLO C;  1WLP B;  1H8K A;  1W70 A;  3H0H A;  1U06 A;  3M0T A;  4Z88 A;  3VS1 A;  5IXF A;  1AOJ A;  1KJW A;  1ZUY A;  1UFF A;  1UDL A;  3LH5 A;  2YUO A;  1M8M A;  2DL7 A;  2VVK A;  2HSP A;  2YT6 A;  5GJW B;  3M0Q A;  2EGE A;  2EYX A;  1TUC A;  2MIO A;  3VS5 A;  3M0U A;  4RTY A;  1BU1 A;  2E5K A;  1X69 A;  5IHK A;  2K2M A;  3CQT A;  2BTT A;  2IIM A;  2O9S A;  1K4U S;  1M3C A;  3VS6 A;  3A98 A;  2HEQ A;  1GRI A;  4F17 A;  1WFW A;  2CSI A;  2O31 A;  2ED1 A;  1PHT A;  4LUD A;  2FO0 A;  2LJ1 A;  3UA6 A;  2LP5 A;  4EIK A;  4OMQ A;  3TVT A;  2K3B A;  1UHC A;  2SEM A;  4ESR A;  2GTJ A;  1MV0 B;  1UUE A;  2CH4 W;  4OMP A;  4RTT A;  1VA7 A;  2HDA A;  2X3X D;  1NYG A;  1M3B A;  2LQN A;  1HSQ A;  2SRC A;  1U5S A;  5ECA A;  3QWY A;  1FMK A;  2A08 A;  5IH2 A;  1WYX A;  1X27 A;  4LUE A;  2JM9 A;  4RTX A;  1X2K A;  1AWO A;  3REA B;  1X43 A;  1K9A A;  2ROT A;  4E6R A;  1GCQ C;  2VWF A;  2CUB A;  3U23 A;  2FPE A;  2JT4 A;  3TSZ A;  2DL5 A;  2DRK A;  2HCK A;  2O88 A;  1W6X A;  2W0Z A;  2EGC A;  3RNJ A;  1JQQ A;  4LNP A;  2J06 A;  1QWE A;  3PVL A;  2KT1 A;  4KRT A;  1GCQ A;  1VYV A;  3H0I A;  1GFD A;  1PRL C;  2YSQ A;  2YUQ A;  2J6F A;  4JZ4 A;  1RUW A;  1K1Z A;  1I1J A;  4JJC A;  1ZLM A;  2DMO A;  3NGP A;  2DLP A;  1UJ0 A;  5IHI A;  1H92 A;  1RI9 A;  3UAT A;  4D8K A;  1RLP C;  1WI7 A;  2KR3 A;  2G6F X;  1W1F A;  4X1V A;  1M3A A;  1N5Z A;  1SEM A;  2ECZ A;  2BZ8 A;  4J9E A;  3EHQ A;  2P4R A;  3NHN A;  2MOX A;  2RQV A;  2LCS A;  2GQI A;  4LE9 A;  2D8H A;  2L0A A;  1WXT A;  4HVV A;  1AVZ C;  1Y0M A;  2H8H A;  3H41 A;  2DVJ A;  2EW3 A;  2LJ0 A;  4J9I A;  1FYN A;  3GBQ A;  2LX7 A;  1YNZ A;  2PNI A;  2O2O A;  5FWB A;  1GL5 A;  1JXM A;  1ZBJ A;  2AK5 A;  2CDT A;  1T3L A;  3RBB B;  1H3H A;  2EVR A;  2ESW A;  1AWW A;  1ZUK A;  2KXD A;  3UF4 A;  4R0K A;  3IQL A;  4CC4 B;  2GBQ A;  4RTU A;  1YCS B;  4Z8A A;  2L2P A;  2K79 A;  1UG1 A;  2LNH B;  2ENM A;  1GBR A;  2W10 A;  1GFC A;  2JMC A;  4JJD A;  4OMM A;  2VKN A;  2KXC A;  2AZS A;  2OAW A;  2J6O A;  4HVW A;  1OOT A;  2DIL A;  4DEX A;  2CH4 A;  1OV3 A;  2L3S A;  2A36 A;  3I9Q A;  3VS3 A;  2L3P A;  4HVU A;  2KRO A;  2QDL A;  2KRS A;  4K11 A;  2DBK A;  5EC7 A;  4AFZ C;  3I35 A;  1UTI A;  2YUP A;  4J9B A;  1ZUU A;  4JZ3 A;  2LMJ A;  1WXB A;  4F16 A;  3KFV A;  2DA9 A;  4AFU C;  2CT3 A;  1B3Q A;  2NUZ A;  1AD5 A;  2FG0 A;  4HCK A;  2DL3 A;  1K0S A;  2XMF A;  2DL8 A;  2RPN A;  2A37 A;  1ZX6 A;  2C0O A;  1SRL A;  3TSW A;  2FEI A;  2B86 A;  4RTW A;  1LCK A;  1XOV A;  2K6D A;  1IO6 A;  1ABQ A;  2YDL A;  1OPK A;  3R6N A;  1JO8 A;  3I5R A;  2CRE A;  1EFN A;  2KNB B;  2K9G A;  1G83 A;  1K76 A;  2KEA A;  1CKA A;  5L23 A;  2FRY A;  2JS0 A;  3NMZ C;  4GBQ A;  1PRM C;  2M0Y A;  2YUN A;  5I11 A;  2FPD A;  1BBZ A;  1BK2 A;  3EG1 A;  1I0C A;  4WCI A;  1AEY A;  1MUZ A;  1SSH A;  1T0J A;  4D8D A;  4RUG A;  3SHW A;  3VS0 A;  1UHF A;  3NPF A;  2J6K A;  1QWF A;  3FJ5 A;  2O9V A;  1PNJ A;  3VRZ A;  2KYB A;  1GBQ A;  3VRY A;  4ZNX A;  2KRM A;  1U3O A;  1T0H A;  1Z9Q A;  1J3T A;  1M30 A;  4J9C A;  1NLP C;  2RQT A;  2LQW A;  2DF6 A;  2AZV A;  2JM8 A;  1PWT A;  2ROL A;  2PTK A;  2JXB A;  2MCN A;  1ZSG A;  1I07 A;  3EG2 A;  2OJ2 A;  2EYY A;  2C0T A;  4CC3 A;  2DNU A;  2PZ1 A;  2DE0 X;  1X6G A;  1K0X A;  1RLQ C;  1AZE A;  3I5S A;  2F2X A;  1PKT A;  4J9G A;  2CSQ A;  2EYW A;  1OPL A;  4QT7 A;  1WXU A;  2BZX A;  1TUD A;  1UGV A;  2KBT A;  1X2Q A;  1NYF A;  4GLM A;  5IHN A;  5FW9 A;  3O5Z A;  4F14 A;  1CSK A;  3REB B;  1KFZ A;  3PVQ A;  2KRN A;  1AZG B;  2D1X A;  2JW4 A;  2X3W D;  3EGU A;  1VYT A;  1SPK A;  1VYU A;  1E7O A;  1QKW A;  2JS2 A;  4JPB W;  1TG0 A;  2F2W A;  2EYZ A;  4JJB A;  1E6G A;  1X6B A;  4ORZ A;  2J7I A;  1T3S A;  1QCF A;  1SRM A;  1KSW A;  2JMA A;  2GNC A;  4OMO A;  1UE9 A;  2RF0 A;  3PE0 A;  4LN2 A;  1OEB A;  4M4Z A;  4CC7 A;  4FSS A;  2RMO A;  1HJD A;  3THK A;  4AG1 C;  2C0I A;  1YP5 A;  1WA7 A;  2I0N A;  2RQW A;  1PKS A;  1ARK A;  1UEC A;  2DM1 A;  2KYM A;  5FWC A;  2EKH A;  1Z9Z A;  4DEY A;  1WX6 A;  2CT4 A;  2NWM A;  4RTZ A;  2EBP A;  1AWX A;  1MV3 A;  2DYB A;  2ABL A;  4Z89 A;  2DL4 A;  2LZ6 B;  4J9H A;  3VS7 A;  2GGR A;  1YWO A;  2ED0 A;  2AKK A;  3EHR A;  2RQU A;  3EG0 A;  3M0P A;  4J9D A;  1JEG A;  4AFS C;  4IIM A;  2F2V A;  1KIK A;  1WIE A;  2V1R A;  3M0S A;  2RQR A;  1M27 C;  2EPD A;  2D0N A;  3M0R A;  2AKL A;  2LJ3 A;  1HD3 A;  5HCK A;  1GCP A;  1V1C A;  4IIO A;  3EG3 A;  3ZL7 C;  4AFQ C;  1QLY A;  1SHF A;  1AWJ A;  2A28 A;  1ABO A;  3H0F A;  4OML A;  1NG2 A;  4OMN A;  4A63 B;  5GJV B;  1NEG A;  3UA7 A;  2KGT A;  2HBW A;  2DRM A;  1Y57 A;  1UJY A;  3VS4 A;  4CC2 A;  1B07 A;  1A0N B;  4Y92 A;  5I22 A;  2RNA A; 
#chains in the Genus database with same CATH topology
 4HXJ A;  3L2Z A;  2RN8 A;  3KBG A;  5CAI A;  3JCM b;  3JV3 A;  2JTE A;  3TU4 K;  3V7R A;  4XTU A;  2GTO A;  4AG2 C;  2KE9 A;  3CCS Q;  1G2B A;  3OYY A;  2BE9 B;  1YN8 A;  3C0C A;  2KT8 A;  2M0O A;  1BKB A;  4HCC A;  3QUI A;  3A8H B;  2JUF A;  4E2F B;  2YLB A;  4ZN3 A;  2K7A A;  3TQ7 P;  4EDU A;  1KC8 U;  2FRW A;  2DX1 A;  4Q5W A;  3J81 E;  1S1N A;  4XTX A;  1BI3 A;  2X51 A;  1RAB B;  4RKU E;  1N27 A;  2YRV A;  1AOJ A;  2F5K A;  3QJ6 A;  4C8Q A;  4FCY A;  1Q7Y R;  3LH5 A;  2YUO A;  4C8Q G;  4IUU A;  2HSP A;  1TTH B;  2YT6 A;  2VB6 A;  4BB7 A;  4FT2 A;  4JS5 A;  3S6W A;  1AT1 B;  3S3O A;  4E7L A;  5C0M A;  5J3B A;  1VQK A;  3URG A;  2QQ9 A;  1PC0 A;  2QEX T;  3OYN A;  1G3T A;  5CR2 A;  1O75 A;  4D6W A;  4C92 D;  1YIT Q;  1VQK Q;  1G3W A;  1K4U S;  3G6E T;  1Q81 C;  2EYQ A;  3P8H A;  4C92 E;  3VS6 A;  1GRI A;  3QSU A;  4F17 A;  1BIA A;  1M90 C;  4CRI A;  2HKQ B;  3C95 A;  4EIK A;  2LP5 A;  4L59 A;  4DOV A;  2LTO A;  2RK1 A;  3LGF A;  2X3X D;  4LDU A;  4RTT A;  2LQN A;  5KYU A;  2K2V A;  1FMK A;  4DBQ A;  1WYX A;  4RTX A;  1X2K A;  1AWO A;  1X43 A;  2ROT A;  1KK7 A;  1M1G A;  1Y07 A;  3OYE A;  1NJI C;  1WJQ A;  2LCL A;  2JT4 A;  4EMK C;  2Z0W A;  2HQX A;  3JCM g;  4ZTJ A;  2NUT A;  1RAA B;  4PJN A;  1H3Z A;  1JJ2 A;  3M56 A;  3OYM A;  1B34 B;  3CCM A;  4C8Q F;  2EGC A;  1JQQ A;  4M7A B;  4LNP A;  4FYV B;  4OB2 B;  4PJO C;  1QP2 A;  1AHJ B;  1VQ6 T;  1GCQ A;  4NS5 A;  4BUG A;  3H0I A;  3QZ9 B;  2O4X A;  4KH1 B;  3ASK A;  3ME9 A;  3CC2 T;  1R8O B;  1RUW A;  4M7D A;  4JJC A;  1ZLM A;  4F7U F;  5IHI A;  4QVC A;  1H92 A;  4O5V A;  1NPP A;  4AT1 B;  2KR3 A;  4HT8 A;  1IRX A;  3OBW A;  3EFR A;  1N5Z A;  1SEM A;  2ECZ A;  3C4S A;  3EFS A;  1GXI E;  2QAS A;  3EGX B;  1VQ7 T;  1Q86 U;  4C0D C;  2GQI A;  2DIG A;  2E70 A;  3BDU A;  3CC4 T;  1EIF A;  4QKU A;  1WXT A;  2GFU A;  2NLU A;  1K9M R;  4J83 A;  5KYX B;  2H8H A;  1R0C B;  3H41 A;  4ANJ A;  1FYN A;  1QW1 A;  2PNI A;  1X75 C;  1JXM A;  1ZHI A;  3RBB B;  5GAM h;  2ESW A;  2LC4 A;  1SKU B;  1MNE A;  5KE3 A;  1KC8 C;  2KXD A;  1I5L A;  5GAM e;  1SF9 A;  4Z8A A;  3SD4 A;  3PFS A;  5CKB A;  3LLR A;  3CCV A;  3DKM A;  5DY9 A;  3OYG A;  2L89 A;  2ZZD A;  3VUZ A;  2ENM A;  3A5Z B;  1GBR A;  4OMM A;  3KUF A;  2VKN A;  4HVW A;  3OMG A;  4DEX A;  3CCV Q;  4PK4 A;  5HK0 A;  5GAO l;  3H9N A;  1ACM B;  4AMC A;  3VS3 A;  3L1A A;  4M7D F;  1Q82 R;  4K11 A;  2FVU A;  2DBK A;  4X9D A;  3JCM J;  1UTI A;  1ZUU A;  2MAM A;  3EAE A;  2BUD A;  3KFV A;  2DA9 A;  4WF2 A;  4ZTF A;  4HCZ A;  5GAN h;  3EGD B;  1QVP A;  2XMF A;  1WHJ A;  2DL8 A;  2RPN A;  2OX7 A;  2P0K A;  1SRL A;  2DD4 A;  5GAN e;  3HFN A;  1IO6 A;  3L2V A;  1KG1 A;  3QJY A;  3R6N A;  3V7C A;  1ZSZ B;  2K9G A;  1G83 A;  3Q1J A;  4O6J A;  5AYF A;  4QW2 A;  1W2B A;  1F1B B;  2JS0 A;  1VQ5 T;  2ZAE A;  1V29 B;  2PVD B;  5I2S A;  4R55 A;  3TEE A;  2YUN A;  4KGV B;  1WQW A;  1AEY A;  1BBZ A;  4WCI A;  5LJ3 f;  1SSH A;  3A8M B;  3CEY A;  1B34 A;  3G71 T;  3VS0 A;  4ELY C;  4M7A A;  1QWF A;  1YHQ A;  4M7A G;  1PG5 B;  3A1P A;  4C8Q D;  4ZNX A;  2EIF A;  1T0H A;  2DD5 A;  2DEU A;  1Z9Q A;  1YHQ Q;  1IGQ A;  2WSE E;  1YIJ A;  3NFC A;  5GMK l;  4C8Q E;  2DIQ A;  1NLP C;  2LQW A;  3WXM B;  2DF6 A;  3C12 A;  2DET A;  3HFO A;  2JM8 A;  3OS1 A;  2E65 A;  1PWT A;  3UWN A;  1I07 A;  4E7I A;  1BI0 A;  1RAD B;  2O01 E;  3EG2 A;  2EYY A;  4KGZ B;  2PZ1 A;  1Q7Y U;  2QK0 A;  1X6G A;  1BIB A;  1K0X A;  2DER A;  1WJS A;  1YJW A;  3I5S A;  4F7U E;  1Q86 C;  2F2X A;  3JB9 I;  2CSQ A;  3QBY A;  1OU9 A;  4E7S A;  3OS0 A;  2KBT A;  5KYX A;  2EQU A;  5IHN A;  4C5I A;  4GLK A;  5A2Q E;  2Y90 A;  2E5Q A;  4F14 A;  3REB B;  3MHX A;  2KRN A;  4MZM A;  2A0F B;  1PCX A;  2JW4 A;  2LQ8 A;  2X3W D;  1E7O A;  2YXY A;  3J7A F;  2F2W A;  1VQL A;  1E6G A;  4ORZ A;  1YJ9 T;  1SSF A;  1WHL A;  1T3S A;  3MET A;  4BAC A;  1IB8 A;  4BY6 C;  2JMA A;  2LDM A;  2RF0 A;  4LN2 A;  1VQL Q;  4CC7 A;  2RMO A;  1HJD A;  3GIB A;  3THK A;  4AG1 C;  4KUI A;  3X20 B;  3BE3 A;  2RQW A;  1PKS A;  4BD3 A;  4JLI A;  2NWM A;  1NPR A;  2R57 A;  2ABL A;  1RAF B;  1IHW A;  2DL4 A;  4J9H A;  5GAN 6;  4C92 G;  2ZPH B;  2E41 A;  1K8A R;  4M7D D;  3EG0 A;  3V8K A;  2L5Q A;  4J9D A;  2X4W A;  4PFO A;  2PVO B;  4IIM A;  3JB9 J;  4M7D E;  1WIE A;  3JCM V;  1KIK A;  3M0S A;  3CCR T;  1S72 Q;  3SWN C;  5LJ3 g;  2D0N A;  4QQ6 A;  3FJP A;  3LW5 E;  3N5B B;  3UDC A;  5FU7 C;  1HD3 A;  2DXU A;  1BI1 A;  4BI4 A;  4IIO A;  1WPY A;  4ZN1 A;  1ABO A;  3LWI A;  5GAO r;  2WSC E;  1NEG A;  2EQK A;  4JRQ A;  1ZSZ A;  3VS4 A;  4CC2 A;  2CZ6 B;  5L8R E;  1JBM A;  3CC7 A;  4J9F A;  2FPF A;  1VQ9 A;  2DBM A;  3BFM A;  3CCJ Q;  1K9M U;  2DK3 A;  4E7H A;  4IUT A;  3CC7 Q;  3OA6 A;  1WDX A;  3BDL A;  4J6X A;  1QKX A;  4RTV A;  1I81 A;  1JU5 C;  2L3Q A;  3NTH A;  1VQ4 A;  3OYD A;  1M5Q 1;  2M51 A;  5LL6 S;  1BCO A;  3EG9 B;  2Y4X A;  5LJ5 d;  1WHG A;  1YWP A;  5A0G A;  5IXB A;  1VQ4 Q;  2PU9 B;  1W70 A;  3H0H A;  4F7U B;  1D0Z A;  1KJW A;  4M77 F;  2DL7 A;  4FW2 A;  2VVK A;  1KQ2 A;  3QZ5 B;  3OYC A;  1Q7Y C;  5GJW B;  2K4Y A;  1LOJ A;  3DB4 A;  1OYX A;  2MF2 A;  4KH0 B;  2XIC A;  1H64 1;  1TUC A;  3VUB A;  3CME A;  2QA4 T;  4HT9 A;  1OZ2 A;  3HTR A;  1BU1 A;  2E5K A;  1LNX A;  1Q82 U;  4M75 F;  3I55 Q;  1VIF A;  2K2M A;  3CQT A;  2P84 A;  3CME Q;  3OS5 A;  5CK9 A;  4C5G A;  2JNG A;  3A98 A;  3X26 B;  1WFW A;  2CSI A;  1VUB A;  3QO3 A;  1TU0 B;  1KD1 R;  4FM4 B;  2QQR A;  2V26 A;  1P92 A;  2FO0 A;  4LUD A;  3UA6 A;  4OB3 B;  3HSB A;  2QG9 B;  2ZPG B;  4XTV A;  2JZ2 A;  2NUT B;  2GTJ A;  3HHT B;  1UUE A;  4OMP A;  2HDA A;  3MEA A;  5GAM f;  1M3B A;  1QMC A;  3CCE A;  5IH2 A;  2A08 A;  2HBP A;  3JCM d;  4LUE A;  2JM9 A;  2QYZ A;  5CQY A;  4JS4 A;  2WAC A;  4E6R A;  3CCQ T;  2CYZ B;  2LRQ A;  4NL2 A;  1HK9 A;  1VQ8 A;  3CCE Q;  2RI3 A;  3TSZ A;  4M7D B;  4HCB A;  2DL5 A;  5CO7 A;  4J7F A;  2RJF A;  3FDR A;  1VQM A;  1W6X A;  2O88 A;  1VQ8 Q;  3CCS T;  1UGR B;  9ATC B;  3CPW P;  1QWE A;  4M7A C;  3OMC A;  1ZA2 B;  3CXC P;  3PMT A;  1VQM Q;  1PRL C;  3L2U A;  5KCO A;  4QVZ A;  2V8I A;  4JZ4 A;  4BE2 A;  3M9Q A;  3OW2 S;  1UB4 A;  3NGP A;  2DLP A;  1WQ7 A;  1IRE B;  1M1F A;  2VV5 A;  3RUX A;  4E7K A;  3GNG A;  3AHU A;  1SG5 A;  4RCC A;  2P4R A;  4M78 F;  2MOX A;  2LCS A;  1LVK A;  4ZGJ B;  4LE9 A;  2D8H A;  2RHZ A;  2ZCF B;  4HVV A;  1AVZ C;  4LD9 K;  3CCU A;  3JCM c;  3J80 E;  1K9M C;  5IN1 A;  2KI7 A;  2E10 A;  1OU8 A;  2EW3 A;  5A0L A;  1YIT T;  1MMG A;  1VQK T;  2RHU A;  3CCU Q;  1YNZ A;  3SFM A;  5FWB A;  5I2M A;  1ZBJ A;  2CDT A;  3VU3 C;  1T3L A;  2EAY A;  2EVR A;  1AWW A;  2DAQ A;  4Z02 A;  3EG9 A;  3LWH A;  1ZUK A;  3UF4 A;  2GBQ A;  3CMA A;  2JOY A;  2K79 A;  3CBP A;  4F7U A;  4F7U G;  3OQ5 A;  1MMD A;  1MMN A;  2W10 A;  1GFC A;  2DKG A;  5D6X A;  4JJD A;  3CMA Q;  4BE1 A;  2D6F A;  2KXC A;  2OAW A;  2VAS A;  3HRT A;  5KCH A;  2CH4 A;  2A36 A;  4WTO B;  2L3P A;  4M77 E;  1QVG S;  2QDL A;  2DZC A;  4PLL A;  2DVE A;  2COZ A;  5EC7 A;  4C92 C;  2CKK A;  3JRZ A;  2YRD A;  1K8A U;  2FB7 A;  1OX9 A;  4M75 D;  2QEX A;  2QGF B;  3P8D A;  4AFU C;  4M75 E;  2NUZ A;  1EZZ B;  1K0S A;  1M1K R;  5FLX E;  2A37 A;  3TSW A;  4OGE A;  3G4S A;  2KQW A;  2LNV A;  1XOV A;  2M1H A;  2K6D A;  5FRM A;  2YDL A;  1OPK A;  3I56 A;  3G4S Q;  1EFN A;  2IG0 A;  5HK3 A;  8AT1 B;  3CCM Q;  1N8R R;  2MYS A;  1K76 A;  2X9H A;  4RCB A;  3I56 Q;  1VQN A;  2FRY A;  4BDY A;  3NMZ C;  1NBE B;  4GBQ A;  2MWO A;  4XQ3 A;  1MUZ A;  1T0J A;  4M7D G;  4D8D A;  4DBH A;  1VQN Q;  2QQA A;  2NUP B;  5GAN 4;  2RI2 A;  2X35 A;  2JTF A;  2EQJ A;  2CS7 A;  2RO0 A;  3VRZ A;  4ME7 A;  2KYB A;  3VRY A;  2YWW A;  2KRM A;  1U3O A;  3RDV A;  1UGS B;  3MKD A;  5LJ3 j;  4E7Z A;  2RQT A;  1VQ6 A;  4C0G A;  1TUG B;  2ROL A;  3CPF A;  2CZ1 B;  2PTK A;  3V8L A;  5LJ5 h;  1ZSG A;  5GMK j;  1LPL A;  4J6W A;  1TWB A;  3QYH B;  1WHH A;  2DNU A;  3NTK A;  2CZ0 B;  5LJ5 e;  3E9G A;  3DB3 A;  4C5H A;  6AT1 B;  1D1C A;  2IPO B;  4B6M A;  4J9G A;  3CCV T;  1OPL A;  1WXU A;  2ZGW A;  1WJR A;  4MZT A;  4M78 D;  5DLO A;  4N0A A;  1UGV A;  1FXX A;  1WGS A;  3CC4 A;  4M78 E;  3O5Z A;  3QPH A;  3PVQ A;  1M2O A;  3OYF A;  4LXC A;  2DTH A;  1VYU A;  2D0Q B;  1TG0 A;  1X6B A;  2FZK B;  3OYA A;  1KD1 U;  1XJW B;  1KSW A;  1ZQ1 A;  3PT9 A;  4P5N A;  2DPP B;  3QXE B;  2P0Q A;  4XU1 A;  4FSS A;  3DLM A;  4M77 B;  2C0I A;  2QI2 A;  1JJ2 P;  2I0N A;  3JCM h;  1ARK A;  3FB9 A;  3VYH B;  2JTM A;  2EKH A;  4L5G A;  1MV3 A;  3M5A A;  3JCM e;  4IUQ A;  4M75 B;  1JB0 E;  3AT1 B;  3M0P A;  3RMS A;  1JEG A;  1K8A C;  2V1R A;  1FMV A;  2FHD A;  2RQR A;  2EPD A;  2AKL A;  1WHM A;  5HCK A;  1GCP A;  1YHQ T;  2JN0 A;  4X34 A;  2F1L A;  3UPU A;  2C06 A;  2K5L A;  3H8Z A;  1Y96 B;  5GAO m;  5GJV B;  4PJO B;  2HAX A;  1IGU A;  2FYK A;  2E12 A;  2HBW A;  3T9N A;  5M9O A;  1RAG B;  1A0N B;  4Y92 A;  2RNA A;  2BIV A;  3SEM A;  3M59 A;  5DM7 R;  5GAN 3;  3OW2 A;  2I2L A;  3VYG A;  1K73 R;  3F70 A;  1BB9 A;  2VYT A;  1VQ5 A;  2NUP A;  2D8J A;  1YIJ Q;  2V1Q A;  4ZGD B;  3GOX A;  4EMH A;  2DJQ A;  2EQI A;  4C8Q C;  3WVD B;  2RHI A;  3O8V A;  4C0D B;  5I21 A;  4XU3 A;  3PTA A;  3ULR B;  3MEV A;  2OTL A;  3V7S A;  1NEB A;  5FU6 C;  4OB1 B;  2H3J A;  2J05 A;  1YJW Q;  1NM7 A;  1E6H A;  1WLP B;  1H8K A;  3VS1 A;  5IXF A;  1U06 A;  4Z88 A;  1C0M A;  2OTL Q;  2GQV A;  1ZUY A;  1UFF A;  1VQL T;  1M8M A;  3OS2 A;  3M57 A;  1YCY A;  4JRK A;  1KC8 R;  1KHC A;  4M78 B;  1DJ7 B;  5CIU A;  4NL3 A;  3L42 A;  4KUD K;  2EYX A;  2MIO A;  3VS5 A;  5CKF A;  4ELZ C;  1D1A A;  5CKE A;  5IHK A;  1EX4 A;  3EFO B;  5GMK m;  4LDY A;  1KQS S;  3JCM Q;  2O9S A;  3WVE B;  3A8L B;  4TVR A;  4BI3 A;  5HKC A;  4FYY B;  2O31 A;  2QQS A;  2ED1 A;  1S72 T;  1PHT A;  4Y28 E;  3RKY A;  2LJ1 A;  1M1K U;  3TVT A;  1KD1 C;  1QVG A;  2SEM A;  4ESR A;  3QDF A;  1MV0 B;  1YJ9 A;  1VA7 A;  1OI1 A;  1W2B P;  1NYG A;  1Q95 G;  2K5I A;  3RR6 A;  2PUO B;  1HSQ A;  2ZPE B;  5ECA A;  3QWY A;  4M77 A;  1TH7 A;  1X27 A;  4M77 G;  3REA B;  2MWP A;  1K9A A;  4PFZ A;  1GCQ C;  2XU8 A;  1JRI A;  4C5E A;  1N8R U;  2HL5 C;  3G1J A;  3U23 A;  2ZPF B;  2FPE A;  2QGG A;  1FX7 A;  3MP6 A;  1M8V A;  4M7D C;  2L3R A;  5IAY A;  2HCK A;  4M75 A;  4PJJ A;  2W0Z A;  3CCJ T;  3RNJ A;  4M75 G;  2VGM A;  2KMT A;  1RAE B;  3M4G A;  1ZBX A;  3OW2 P;  4E47 A;  3CC7 T;  2L8D A;  3S3N A;  2DTO A;  1GFD A;  3MPU B;  4KBM B;  1KQ1 A;  1RAH B;  2YSQ A;  4EMK A;  3MEW A;  2R5A A;  2YLC A;  3PGG A;  4XTY A;  1UJ0 A;  1RI9 A;  2X4Y A;  4D8K A;  1RLP C;  1Y96 A;  2JVV A;  1VQ4 T;  4PJO A;  3C94 A;  1M3A A;  1WNL A;  1OQK A;  1VQ9 Q;  1VQP A;  2GCX A;  4J6Y A;  1D1B A;  2RJE A;  3EHQ A;  3A8G B;  4MZP A;  2F69 A;  1IHV A;  1VIE A;  2DO3 A;  2L0A A;  1VQP Q;  2MK5 A;  4J7I A;  3I55 T;  4BE0 A;  2XD0 A;  2FL7 A;  3RER A;  2H3E B;  2DVJ A;  2LJ0 A;  2E64 A;  3CME T;  2LX7 A;  4OGC A;  3ZEH A;  2O2O A;  1GL5 A;  4LDX A;  3RMQ A;  1H3H A;  2Y4Y A;  3EH1 A;  4R0K A;  3IQL A;  3GPL A;  4RTU A;  1UG1 A;  2E6N A;  4PL6 A;  3PMI A;  3TRE A;  1QVG P;  2JMC A;  2AZS A;  2J6O A;  1U1S A;  5A0D A;  3X24 B;  4MDX A;  1OOT A;  2DIL A;  2L3S A;  2QAZ A;  4M78 A;  5LJ5 f;  4BY6 B;  1I4K 1;  4UC4 A;  4M78 G;  4HVU A;  3BW1 A;  2XG8 D;  1NE8 A;  3CCE T;  2KRS A;  1YI2 A;  4ATO A;  2ZPI B;  4OMF B;  2VC8 A;  4AFZ C;  2YUP A;  1TS9 A;  2YHT A;  4JZ3 A;  4PJO F;  3UT1 A;  3EFO A;  3X25 B;  4OVA A;  1VQ8 T;  5LJ3 h;  5D6W A;  1YI2 Q;  1VQO A;  1UEB A;  1N9R A;  2OTJ A;  2CT3 A;  1B3Q A;  3G7Z A;  5GMK h;  3SDZ A;  1IZ6 A;  5J26 A;  2FG0 A;  4HCK A;  1RI0 A;  2XDD A;  1VQM T;  1PD1 A;  1VQO Q;  1ZX6 A;  1YFN A;  2RJD A;  2FEI A;  2OTJ Q;  1M1K C;  4V2S A;  5GMK e;  4RTW A;  2PQW A;  3PIO A;  4XAX B;  1LCK A;  2EJG A;  1PD0 A;  2MI6 A;  4CI0 C;  2COW A;  3I5R A;  1YJN A;  2MPX C;  4QQG A;  3CD6 A;  4KUL A;  2EFI A;  3HPW A;  1B7T A;  1MHN A;  5CCA A;  1YJN Q;  4DBF A;  2HQE A;  2M0Y A;  2LT1 A;  3CD6 Q;  1BK2 A;  1I0C A;  1K73 U;  4RUG A;  3P8B B;  4R56 A;  1HXD A;  3SHW A;  3LH0 A;  1UHF A;  3NPF A;  3JCM f;  5FRN A;  1R0B G;  3FJ5 A;  5GAN f;  1U1T A;  3GLX A;  3CCL A;  1PNJ A;  5D6Y A;  4LDW A;  4N4H A;  2DJZ A;  3CCS A;  2DZ9 A;  3CCU T;  3E2U A;  1M30 A;  1UGQ B;  2AHJ B;  2RI5 A;  3CCL Q;  2CZ7 B;  2AZV A;  4PJM A;  4NOY A;  3OYI A;  1TOV A;  2JXB A;  2QDY B;  1OX8 A;  3JB9 F;  5KYW B;  1G3S A;  2CP0 A;  4B9W A;  5J39 A;  1QVF S;  4F04 B;  2DE0 X;  1U8R A;  1XTD A;  2OAU A;  1AZE A;  2A3L A;  3CMA T;  5FRO A;  3LYI A;  1PKT A;  4A4K A;  4JJN K;  3EH2 A;  4BDZ A;  2BZX A;  2DXC A;  4KT0 E;  4IKF A;  4JRP A;  5CQX A;  1X2Q A;  1NYF A;  2E6Z A;  1G5V A;  3QDR B;  5FW9 A;  2HL3 A;  5LJ5 g;  2K3Y A;  1QCN A;  2M02 A;  5GAN 7;  3EGU A;  2XKO C;  1SPK A;  1QKW A;  2HZY A;  2JS2 A;  5KE2 A;  2RHY A;  4JPB W;  1D3B B;  4M77 D;  4JJB A;  3INZ A;  1YIT A;  3FIF A;  1LJO A;  1QCF A;  1SRM A;  2V8K A;  3OYH A;  5GAM g;  3QKJ A;  1ZA1 B;  4A53 A;  2NYS A;  4OMO A;  1UE9 A;  1OEB A;  3MP8 A;  3HRU A;  1Q82 C;  2P0P A;  5KYY B;  1KQS A;  2RD1 A;  2KK4 A;  2HMA A;  1UGP B;  1YP5 A;  4M77 C;  3G4S T;  2RM4 A;  1HYO A;  4B9X A;  1WA7 A;  5FWC A;  3CCM T;  1C6V X;  3G6E A;  1Z9Z A;  4DEY A;  4DBR A;  2QEX Q;  2CT4 A;  3I56 T;  2IVW A;  5GAO p;  1X01 A;  1MND A;  2LZ6 B;  4Y91 A;  4EMG A;  3S3M A;  1YWO A;  3MP1 A;  2ED0 A;  3EHR A;  2PUK B;  5CKD A;  2RB6 A;  3G6E Q;  4FT4 A;  4M75 C;  1VQN T;  1QP3 A;  4XU2 A;  2M9U A;  4PJO D;  4N4I A;  1KHI A;  1M27 C;  2RA2 A;  3JB9 H;  4A4H A;  1ZSZ C;  4PJO E;  2COY A;  1V1C A;  1D0X A;  5C6S A;  5GAN g;  3ZL7 C;  4AFQ C;  4JDS A;  1QLY A;  4EPC A;  3OYL A;  3H0F A;  4OML A;  1NG2 A;  2LQK A;  4A63 B;  2RJC A;  4VUB A;  1D0Y A;  1W4S A;  2KGT A;  3SWN A;  2K57 A;  1UJY A;  4DQ2 A;  2LX9 A;  2E3H A;  4A4E A;  4HKE A;  3LX7 A;  3OY9 A;  2RHX A;  4GY5 A;  3CPW S;  2LT4 A;  2HKN A;  1RL2 A;  3CXC S;  4ZGE B;  2CUD A;  4PLI A;  2EGA A;  1JXO A;  1CKB A;  1NZ9 A;  1WZO A;  2HD0 A;  1K73 C;  3CC2 A;  2XI9 A;  1VQ6 Q;  3CBM A;  2K3X A;  4FW1 A;  3QWX X;  4II1 A;  3M54 A;  3CC2 Q;  2OI3 A;  2XID A;  3E19 A;  4MMK A;  2MMP A;  1SHG A;  2KY9 A;  3VS2 A;  4BI8 B;  1VQ7 A;  3PIP A;  2FZC B;  1FWZ A;  2BZY A;  3MO8 A;  4YTL A;  1NLO C;  2V8J A;  3M0T A;  5KYW A;  1D09 B;  3M4Y A;  1UDL A;  3FC3 A;  4IUR A;  2KSS A;  1VQ7 Q;  1MMA A;  3X28 B;  3JB9 D;  4C0Z A;  5GMK i;  3CC4 Q;  4PFP A;  1WHK A;  3E1S A;  5KH6 A;  3M0Q A;  2EGE A;  2LVM A;  3HP9 A;  1KQS P;  4M78 C;  3M0U A;  2PVG B;  4RTY A;  1X69 A;  4DA4 A;  2KAF A;  1Q81 R;  2BTT A;  2EQM A;  2IIM A;  2R5M A;  3GNF B;  1M3C A;  2HEQ A;  3PNW C;  1M90 R;  1D3B A;  2AIR B;  4RG8 A;  2G3R A;  3OB9 A;  4J5Y A;  4C92 B;  4OMQ A;  2K3B A;  2VXF A;  1UHC A;  1X6O A;  1RAI B;  2CH4 W;  5LJ3 d;  5AT1 B;  3OBY A;  3HL8 A;  5KYY A;  2SRC A;  4PKC C;  1U5S A;  2QQB A;  3KXT A;  3GF5 A;  1NJI R;  5GAO q;  2VWF A;  4J8O A;  4A4G A;  4EMK B;  3MCA B;  2CUB A;  2GF7 A;  2DRK A;  3VKI A;  3OYB A;  4RG2 A;  4E7J A;  4C0F A;  2J06 A;  1YIJ T;  3PVL A;  2KT1 A;  4KRT A;  4FIB A;  1VYV A;  3SB2 A;  2YUQ A;  2J6F A;  2EWN A;  5KYN A;  1K1Z A;  1I1J A;  2ATC B;  2DMO A;  3QYG B;  1TSF A;  2AT1 B;  3JSC A;  3UAT A;  1WI7 A;  1YJW T;  3V8J A;  2G6F X;  2X4J A;  1W1F A;  4X1V A;  1N6A A;  2CP7 A;  2OTL T;  1Y71 A;  2QTV A;  2BZ8 A;  4J9E A;  1PSF A;  3G71 A;  3NHN A;  1VQ5 Q;  2RQV A;  2CP2 A;  5CVI A;  2XDP A;  1G3Y A;  1PSE A;  1Y0M A;  2RH2 A;  2XDB A;  2BKD N;  3G71 Q;  4IUP A;  3OSV A;  1OZ3 A;  3M53 A;  3VJP A;  3OSS C;  4J9I A;  1QVF A;  3GBQ A;  1V76 A;  3EGX A;  5IT9 E;  2AK5 A;  4OP0 A;  1C1A A;  3RIR A;  2BE7 D;  5GAN 2;  3E9F A;  4CC4 B;  1YCS B;  2L2P A;  2LNH B;  4XTW A;  2K5F A;  4OF1 A;  1I8F A;  3JAM E;  1R77 A;  2VGN A;  3DLL A;  2DFU A;  1OV3 A;  3MJX A;  2E4H A;  1VOM A;  3I9Q A;  1M2V B;  1XQH A;  1XNI A;  2KRO A;  4PJL A;  3FLG A;  3VV0 A;  2E1H A;  3I35 A;  4QVD A;  2GFA A;  3QG1 A;  4J9B A;  4M7A F;  1IXD A;  2LMJ A;  1WXB A;  4JUV A;  1N9S A;  2F5T X;  4F16 A;  3NTI A;  2D9T A;  4IUV A;  2EKO A;  1OUL A;  3RKX A;  3RKW A;  5LJ5 j;  2QXF A;  1YJ9 Q;  2KDS A;  1AD5 A;  1QQJ A;  2DL3 A;  3A8O B;  2C0O A;  3HRS A;  4C92 A;  2XK0 A;  3D7S B;  4JLG A;  2B86 A;  1JJ2 S;  2HNI A;  2DXT A;  3L2Q A;  5GAM j;  2XHC A;  1S72 A;  4L6V 5;  1ABQ A;  1I5O B;  1JO8 A;  4RMO A;  2CRE A;  2KNB B;  1VQ9 T;  3JCM X;  3EGD A;  2KEA A;  1CKA A;  5L23 A;  1PRM C;  2DTI A;  4N4G A;  5I11 A;  3CCR A;  2FPD A;  3EG1 A;  1FMW A;  1VQP T;  5GAN 5;  2CP5 A;  3ZBD A;  2RK2 A;  2J6K A;  1YBY A;  2O9V A;  3CCR Q;  4PJO G;  2R58 A;  5CKH A;  3CBO A;  4FSX A;  1GBQ A;  3CCJ A;  2DEQ A;  1J3T A;  1M9S A;  4QQD A;  4J9C A;  4XK8 E;  3GP8 A;  4A54 A;  3FEO A;  3H6Z A;  2P4T A;  1QVF P;  3CPW A;  4LD6 A;  3CXC A;  2MCN A;  5GAN j;  4N0A C;  3MEU A;  1RAC B;  2OJ2 A;  4C8Q B;  2EJF A;  2C0T A;  8ATC B;  4CC3 A;  3JCM P;  3L2R A;  2JJ9 A;  2B8A A;  1RLQ C;  1Q86 R;  5EG2 A;  3M58 A;  5FU6 B;  2EJ9 A;  2EYW A;  2M16 A;  4QT7 A;  4C92 F;  2CP6 A;  1TUD A;  2YRC A;  1M4Z A;  4GLM A;  2E3I A;  4PNO A;  3HKS A;  1CSK A;  1Q81 U;  1KFZ A;  1MGQ A;  4FL6 A;  5GAM d;  1AZG B;  2D1X A;  4HA8 A;  1VYT A;  4MML A;  3QII A;  1YI2 T;  2DXB A;  3I55 A;  1M90 U;  1BI2 A;  2EYZ A;  2J7I A;  5DLQ E;  3TCJ A;  1VQO T;  2GNC A;  3L2W A;  3PE0 A;  3R6O A;  2OTJ T;  4M4Z A;  4XTZ A;  5HY6 A;  2QA4 A;  5KYU B;  3JB9 G;  3QHS A;  3ER0 A;  1O9S A;  3JCM W;  3BY7 A;  1TXQ A;  4DOW A;  4MDW A;  2DYI A;  3LGL A;  1NJI U;  2QA4 Q;  1M2V A;  1UEC A;  2DM1 A;  2KYM A;  5LJ3 e;  1WX6 A;  5GAN 8;  4FU6 A;  4RTZ A;  2HSE B;  4A4F A;  2EBP A;  1AWX A;  2DYB A;  4Z89 A;  4OB0 B;  1YJN T;  3VS7 A;  2X4X A;  3M55 A;  2GGR A;  4JRI A;  3OYK A;  3CD6 T;  2AKK A;  3OYJ A;  2RQU A;  5GAO n;  2LCC A;  3FRN A;  2VXE A;  2KVQ G;  4AFS C;  2ZPB B;  2F2V A;  5GAN d;  4X9C A;  3SWN B;  2WSF E;  4M7A D;  5D7U A;  5FU7 B;  2O4X B;  1W2B S;  3M0R A;  1QCO A;  2LJ3 A;  2VUB A;  4M7A E;  4KGX B;  1Y7X A;  2FZG B;  4XU0 A;  2HQH A;  1G8X A;  1N8R C;  3EG3 A;  2A7Y A;  3CCL T;  3ZFJ A;  1SHF A;  1AWJ A;  7AT1 B;  2A28 A;  2CGH A;  3CCQ A;  2QTX A;  4OMN A;  4FYX B;  1PM3 A;  1BCM A;  3RES A;  3UA7 A;  4FYW B;  4LDV A;  2DRM A;  1Y57 A;  2CP3 A;  3CCQ Q;  1BYM A;  1B07 A;  5I22 A; 
#chains in the Genus database with same CATH homology
 4HXJ A;  2RN8 A;  3JV3 A;  2JTE A;  3SEM A;  4J9F A;  2FPF A;  2GTO A;  2DBM A;  2CUD A;  2EGA A;  4AG2 C;  1JXO A;  1BB9 A;  1CKB A;  2KE9 A;  1G2B A;  1YN8 A;  2D8J A;  2V1Q A;  3C0C A;  2KT8 A;  1WDX A;  2DJQ A;  2EQI A;  1QKX A;  4RTV A;  1JU5 C;  2L3Q A;  3QWX X;  2K7A A;  2M51 A;  2OI3 A;  2FRW A;  3ULR B;  2DX1 A;  1NEB A;  1SHG A;  1S1N A;  2J05 A;  3VS2 A;  1YWP A;  5IXB A;  2BZY A;  1NM7 A;  1E6H A;  1NLO C;  1WLP B;  1H8K A;  1W70 A;  3H0H A;  1U06 A;  3M0T A;  4Z88 A;  3VS1 A;  5IXF A;  1AOJ A;  1KJW A;  1ZUY A;  1UFF A;  1UDL A;  3LH5 A;  2YUO A;  1M8M A;  2DL7 A;  2VVK A;  2HSP A;  2YT6 A;  5GJW B;  3M0Q A;  2EGE A;  2EYX A;  1TUC A;  2MIO A;  3VS5 A;  3M0U A;  4RTY A;  1BU1 A;  2E5K A;  1X69 A;  5IHK A;  2K2M A;  3CQT A;  2BTT A;  2IIM A;  2O9S A;  1K4U S;  1M3C A;  3VS6 A;  3A98 A;  2HEQ A;  1GRI A;  4F17 A;  1WFW A;  2CSI A;  2O31 A;  2ED1 A;  1PHT A;  4LUD A;  2FO0 A;  2LJ1 A;  3UA6 A;  2LP5 A;  4EIK A;  4OMQ A;  3TVT A;  2K3B A;  1UHC A;  2SEM A;  4ESR A;  2GTJ A;  1MV0 B;  1UUE A;  2CH4 W;  4OMP A;  4RTT A;  1VA7 A;  2HDA A;  2X3X D;  1NYG A;  1M3B A;  2LQN A;  1HSQ A;  2SRC A;  1U5S A;  5ECA A;  3QWY A;  1FMK A;  2A08 A;  5IH2 A;  1WYX A;  1X27 A;  4LUE A;  2JM9 A;  4RTX A;  1X2K A;  1AWO A;  3REA B;  1X43 A;  1K9A A;  2ROT A;  4E6R A;  1GCQ C;  2VWF A;  2CUB A;  3U23 A;  2FPE A;  2JT4 A;  3TSZ A;  2DL5 A;  2DRK A;  2HCK A;  2O88 A;  1W6X A;  2W0Z A;  2EGC A;  3RNJ A;  1JQQ A;  4LNP A;  2J06 A;  1QWE A;  3PVL A;  2KT1 A;  4KRT A;  1GCQ A;  1VYV A;  3H0I A;  1GFD A;  1PRL C;  2YSQ A;  2YUQ A;  2J6F A;  4JZ4 A;  1RUW A;  1K1Z A;  1I1J A;  4JJC A;  1ZLM A;  2DMO A;  3NGP A;  2DLP A;  1UJ0 A;  5IHI A;  1H92 A;  1RI9 A;  3UAT A;  4D8K A;  1RLP C;  1WI7 A;  2KR3 A;  2G6F X;  1W1F A;  4X1V A;  1M3A A;  1N5Z A;  1SEM A;  2ECZ A;  2BZ8 A;  4J9E A;  3EHQ A;  2P4R A;  3NHN A;  2MOX A;  2RQV A;  2LCS A;  2GQI A;  4LE9 A;  2D8H A;  2L0A A;  1WXT A;  4HVV A;  1AVZ C;  1Y0M A;  2H8H A;  3H41 A;  2DVJ A;  2EW3 A;  2LJ0 A;  4J9I A;  1FYN A;  3GBQ A;  2LX7 A;  1YNZ A;  2PNI A;  2O2O A;  5FWB A;  1GL5 A;  1JXM A;  1ZBJ A;  2AK5 A;  2CDT A;  1T3L A;  3RBB B;  1H3H A;  2EVR A;  2ESW A;  1AWW A;  1ZUK A;  2KXD A;  3UF4 A;  4R0K A;  3IQL A;  4CC4 B;  2GBQ A;  4RTU A;  1YCS B;  4Z8A A;  2L2P A;  2K79 A;  1UG1 A;  2LNH B;  2ENM A;  1GBR A;  2W10 A;  1GFC A;  2JMC A;  4JJD A;  4OMM A;  2VKN A;  2KXC A;  2AZS A;  2OAW A;  2J6O A;  4HVW A;  1OOT A;  2DIL A;  4DEX A;  2CH4 A;  1OV3 A;  2L3S A;  2A36 A;  3I9Q A;  3VS3 A;  2L3P A;  4HVU A;  2KRO A;  2QDL A;  2KRS A;  4K11 A;  2DBK A;  5EC7 A;  4AFZ C;  3I35 A;  1UTI A;  2YUP A;  4J9B A;  1ZUU A;  4JZ3 A;  2LMJ A;  1WXB A;  4F16 A;  3KFV A;  2DA9 A;  4AFU C;  2CT3 A;  1B3Q A;  2NUZ A;  1AD5 A;  2FG0 A;  4HCK A;  2DL3 A;  1K0S A;  2XMF A;  2DL8 A;  2RPN A;  2A37 A;  1ZX6 A;  2C0O A;  1SRL A;  3TSW A;  2FEI A;  2B86 A;  4RTW A;  1LCK A;  1XOV A;  2K6D A;  1IO6 A;  1ABQ A;  2YDL A;  1OPK A;  3R6N A;  1JO8 A;  3I5R A;  2CRE A;  1EFN A;  2KNB B;  2K9G A;  1G83 A;  1K76 A;  2KEA A;  1CKA A;  5L23 A;  2FRY A;  2JS0 A;  3NMZ C;  4GBQ A;  1PRM C;  2M0Y A;  2YUN A;  5I11 A;  2FPD A;  1BBZ A;  1BK2 A;  3EG1 A;  1I0C A;  4WCI A;  1AEY A;  1MUZ A;  1SSH A;  1T0J A;  4D8D A;  4RUG A;  3SHW A;  3VS0 A;  1UHF A;  3NPF A;  2J6K A;  1QWF A;  3FJ5 A;  2O9V A;  1PNJ A;  3VRZ A;  2KYB A;  1GBQ A;  3VRY A;  4ZNX A;  2KRM A;  1U3O A;  1T0H A;  1Z9Q A;  1J3T A;  1M30 A;  4J9C A;  1NLP C;  2RQT A;  2LQW A;  2DF6 A;  2AZV A;  2JM8 A;  1PWT A;  2ROL A;  2PTK A;  2JXB A;  2MCN A;  1ZSG A;  1I07 A;  3EG2 A;  2OJ2 A;  2EYY A;  2C0T A;  4CC3 A;  2DNU A;  2PZ1 A;  2DE0 X;  1X6G A;  1K0X A;  1RLQ C;  1AZE A;  3I5S A;  2F2X A;  1PKT A;  4J9G A;  2CSQ A;  2EYW A;  1OPL A;  4QT7 A;  1WXU A;  2BZX A;  1TUD A;  1UGV A;  2KBT A;  1X2Q A;  1NYF A;  4GLM A;  5IHN A;  5FW9 A;  3O5Z A;  4F14 A;  1CSK A;  3REB B;  1KFZ A;  3PVQ A;  2KRN A;  1AZG B;  2D1X A;  2JW4 A;  2X3W D;  3EGU A;  1VYT A;  1SPK A;  1VYU A;  1E7O A;  1QKW A;  2JS2 A;  4JPB W;  1TG0 A;  2F2W A;  2EYZ A;  4JJB A;  1E6G A;  1X6B A;  4ORZ A;  2J7I A;  1T3S A;  1QCF A;  1SRM A;  1KSW A;  2JMA A;  2GNC A;  4OMO A;  1UE9 A;  2RF0 A;  3PE0 A;  4LN2 A;  1OEB A;  4M4Z A;  4CC7 A;  4FSS A;  2RMO A;  1HJD A;  3THK A;  4AG1 C;  2C0I A;  1YP5 A;  1WA7 A;  2I0N A;  2RQW A;  1PKS A;  1ARK A;  1UEC A;  2DM1 A;  2KYM A;  5FWC A;  2EKH A;  1Z9Z A;  4DEY A;  1WX6 A;  2CT4 A;  2NWM A;  4RTZ A;  2EBP A;  1AWX A;  1MV3 A;  2DYB A;  2ABL A;  4Z89 A;  2DL4 A;  2LZ6 B;  4J9H A;  3VS7 A;  2GGR A;  1YWO A;  2ED0 A;  2AKK A;  3EHR A;  2RQU A;  3EG0 A;  3M0P A;  4J9D A;  1JEG A;  4AFS C;  4IIM A;  2F2V A;  1KIK A;  1WIE A;  2V1R A;  3M0S A;  2RQR A;  1M27 C;  2EPD A;  2D0N A;  3M0R A;  2AKL A;  2LJ3 A;  1HD3 A;  5HCK A;  1GCP A;  1V1C A;  4IIO A;  3EG3 A;  3ZL7 C;  4AFQ C;  1QLY A;  1SHF A;  1AWJ A;  2A28 A;  1ABO A;  3H0F A;  4OML A;  1NG2 A;  4OMN A;  4A63 B;  5GJV B;  1NEG A;  3UA7 A;  2KGT A;  2HBW A;  2DRM A;  1Y57 A;  1UJY A;  3VS4 A;  4CC2 A;  1B07 A;  1A0N B;  4Y92 A;  5I22 A;  2RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...