3M0RA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 6.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'GKELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
molecule tags Signaling protein
source organism Gallus gallus
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0rA00
2L2PA 1M3CA 2M51A 1WXUA 3UATA 2ECZA 4CC3A 3M0SA 2GTOA 4JJCA 5IXBA 1AWWA 1WDXA 2AK5A 2KBTA 2JM8A 1U06A 2DVJA 2HEQA 5L23A 1BBZA 2RQUA 1TG0A 1GFCA 2SEMA 1VYVA 3EG2A 4GBQA 4QT7A 2EYXA 4WCIA 3M0QA 1AOJA 4RTYA 4R0KA 2J6OA 3EG1A 2EW3A 3NGPA 4RTUA 4E6RA 1PHTA 1WXTA 2KNBB 2YT6A 3I9QA 3VS7A 2J6KA 2BZ8A 2EQIA 4HCKA 4KRTA 3NHNA 2D8JA 2B86A 3PE0A 1G2BA 1I1JA 2F2XA 2RNAA 1T0HA 2XMFA 3REAB 2DL7A 2A37A 2JMCA 1Z9QA 3UA7A 2YUNA 4D8DA 1RLQC 2PTKA 3VS5A 1ZUYA 2HCKA 1WFWA 2HSPA 2HDAA 4RTWA 3VS2A 2EYYA 2KRNA 2FPEA 1B3QA 4CC7A 2DL5A 2PNIA 2VVKA 4RTVA 1WIEA 1JQQA 3EHRA 2KE9A 4J9FA 2L3SA 2NUZA 3M0UA 2DMOA 4M4ZA 1G83A 3R6NA 2CT3A 2YSQA 1AD5A 3TSWA 1UUEA 2KT8A 1MV3A 1K0SA 1E6GA 1M30A 2K7AA 4LUDA 5IHIA 4AG2C 1GBQA 4HXJA 1ZBJA 4DEYA 1GCQC 3EG0A 3JV3A 4OMLA 2W10A 1H3HA 1E6HA 1KSWA 1K4US 2K79A 4EIKA 1CKAA 1WYXA 2EBPA 2D1XA 1NYGA 5IXFA 1KJWA 1XOVA 2E5KA 1X2KA 2ROTA 4OMPA 4J9DA 1Y57A 2MCNA 4JJDA 4AFUC 1T0JA 3EGUA 2AZVA 1KFZA 1PWTA 4Z8AA 2O2OA 2X3WD 4CC4B 1ARKA 2L3PA 4JJBA 2JS2A 2RF0A 1I07A 1AZEA 1NEGA 1H8KA 3A98A 2EGCA 2SRCA 1VA7A 1M3BA 2DRMA 1NYFA 1ZLMA 2IIMA 2KXDA 1UECA 1X6BA 3THKA 2RPNA 4Z88A 1ABQA 1JU5C 1SHFA 2DX1A 3VS4A 2RN8A 1GCQA 2BZXA 2D8HA 3RNJA 1M8MA 2LJ0A 4DEXA 2MIOA 2LQWA 1UHCA 2FRYA 1W1FA 2VWFA 1EFNA 1SRLA 2LNHB 2DJQA 2LP5A 3QWYA 1A0NB 1QWFA 4RUGA 2D0NA 2GGRA 2MOXA 2DILA 3I5RA 3KFVA 3NMZC 3PVQA 4D8KA 3M0PA 1VYUA 2YDLA 1WX6A 1AWJA 4J9IA 1GRIA 1MV0B 2AKKA 4F16A 2DE0X 2V1QA 2EYWA 1AEYA 1LCKA 1PRLC 4JZ4A 1GBRA 5GJVB 4JPBW 1QKXA 1WA7A 1CKBA 1N5ZA 4AFZC 4RTXA 2RQTA 2DL3A 2KT1A 2DF6A 4OMMA 2GBQA 1SEMA 2K2MA 1KIKA 2CSIA 2DL4A 4JZ3A 2LJ3A 4ESRA 4RTTA 3REBB 2JXBA 2EGAA 2NWMA 3I35A 4J9HA 2J7IA 2DNUA 2KYBA 3TSZA 2L3QA 1UDLA 1TUDA 2G6FX 1UTIA 1MUZA 4J9EA 4HVUA 5I22A 4AFSC 5ECAA 3FJ5A 1W70A 4FSSA 2PZ1A 2ABLA 1J3TA 2FPDA 3VS3A 1I0CA 2A36A 1QWEA 2CSQA 2O9SA 5IHNA 2OI3A 5I11A 3VRYA 2VKNA 1K1ZA 1NM7A 1UGVA 1YWPA 3H0FA 3IQLA 2AZSA 2ENMA 2M0YA 2LJ1A 2KYMA 2H8HA 1X2QA 2GNCA 1JXOA 2J05A 1ZSGA 2JW4A 2YUOA 4HVWA 3C0CA 4LE9A 1X6GA 3RBBB 2O31A 3EG3A 1X27A 2YUPA 4AFQC 4HVVA 2FRWA 2KRSA 1AVZC 1U5SA 2EKHA 1RI9A 3PVLA 2FG0A 2DYBA 2K3BA 4ORZA 2K6DA 2RQRA 3TVTA 2JMAA 3VS1A 2JM9A 2O9VA 1YN8A 2L0AA 2ED0A 4IIOA 1VYTA 2DBKA 3CQTA 2CUDA 1RLPC 1U3OA 3UA6A 2RMOA 2EYZA 1NLOC 3VS0A 1GCPA 2KXCA 2AKLA 2J6FA 1GL5A 1RUWA 4X1VA 1JXMA 1V1CA 1K0XA 1HSQA 1M3AA 1UHFA 1ZX6A 2KGTA 1OPKA 2CH4A 1QLYA 3VS6A 2K9GA 2C0OA 2I0NA 5IHKA 3M0TA 3O5ZA 1PKTA 2CT4A 2P4RA 1PNJA 1YCSB 3H0HA 1OPLA 2FO0A 1PRMC 1AWOA 1YNZA 1B07A 1BK2A 2YUQA 2C0IA 1AWXA 5IH2A 1K9AA 2LZ6B 2X3XD 2RQVA 5EC7A 5FW9A 2QDLA 4OMNA 1JO8A 1HD3A 4J9GA 1OV3A 5HCKA 1SHGA 2O88A 4IIMA 1WI7A 2LX7A 1ABOA 1ZUKA 3VRZA 2A28A 1K76A 1CSKA 2DA9A 2CH4W 2EVRA 1PKSA 2HBWA 3SEMA 2LCSA 1E7OA 2KEAA 1IO6A 2V1RA 1NLPC 1H92A 4OMQA 3EHQA 1TUCA 3ZL7C 4CC2A 1WLPB 2ROLA 3SHWA 2KRMA 3U23A 1X43A 1Y0MA 2F2WA 4GLMA 2W0ZA 2KR3A 1FYNA 2ED1A 2CDTA 1UE9A 1QKWA 4OMOA 4ZNXA 3H41A 4F14A 1SPKA 2FEIA 4RTZA 4Z89A 1UJ0A 1FMKA 4LN2A 1WXBA 2GQIA 2FPFA 5GJWB 2LMJA 1T3SA 1BB9A 2JS0A 4K11A 1W6XA 2ESWA 4AG1C 1AZGB 1X69A 4Y92A 1HJDA 2A08A 1SRMA 3M0RA 1M27C 1OOTA 3UF4A 2DM1A 2BTTA 2GTJA 2EGEA 1T3LA 2JTEA 4A63B 2DLPA 1OEBA 3GBQA 1ZUUA 1YWOA 1UFFA 2EPDA 1Z9ZA 2CUBA 2J06A 4LUEA 1BU1A 3LH5A 4J9CA 2BZYA 4F17A 1GFDA 2DL8A 3ULRB 1YP5A 3NPFA 4LNPA 2CREA 5FWBA 1S1NA 1UG1A 1SSHA 1NEBA 2OJ2A 2JT4A 1UJYA 3QWXX 3H0IA 2DBMA 2KROA 2DRKA 1QCFA 2RQWA 2C0TA 2LQNA 5FWCA 3I5SA 4J9BA 1NG2A 1JEGA 2F2VA 2OAWA
chains in the Genus database with same CATH superfamily
2CYZB 1M3CA 3EFOB 4M7DD 2LVMA 1WXUA 4CC3A 3CCLT 1YHQA 1NJIC 3M0SA 4MDWA 5IXBA 1OU8A 2QTXA 5GMKm 2HEQA 1BBZA 2RQUA 1GFCA 1NZ9A 2DAQA 4KH1B 3V8JA 3CC4Q 3SWNB 4M75A 2K5LA 3VKIA 2KI7A 4PNOA 4RTYA 1W2BA 2J6OA 3S3MA 3EFRA 3GLXA 4M7AA 4J8OA 3RKXA 3FC3A 4KBMB 5LJ5e 1RAAB 1BIAA 1PHTA 1WXTA 3I9QA 1VQMA 4C0DB 2QQBA 2LNVA 1VQLT 3SD4A 4J83A 3TQ7P 4C92C 4OB1B 2CP0A 3CCRQ 3PMIA 2WSFE 3RR6A 2DTIA 3QZ5B 2DL7A 2A37A 2JMCA 1Z9QA 1ZSZA 4M78C 4J7FA 4D8DA 3CCRT 2PTKA 2HCKA 1WFWA 3ZFJA 3CCMA 2AIRB 4BE2A 3RESA 2KRNA 4CC7A 2DL5A 2MAMA 2FL7A 5CCAA 3NTKA 1JQQA 4XTXA 1D0YA 1RAIB 3QO3A 2L3SA 4M4ZA 1G83A 3MP1A 2L89A 2DD4A 1UUEA 2DK3A 4M77B 2MI6A 3BY7A 2DZ9A 4LUDA 2ZPIB 4AG2C 1GBQA 1R77A 4HXJA 5GAMj 1YITT 1GCQC 3CBOA 1E6HA 3M5AA 1OZ2A 3OS5A 4FM4B 4B9XA 4EIKA 3JB9H 1G3SA 1WHJA 1WYXA 4OB0B 1O75A 4PFPA 1Q82R 1I4K1 1KJWA 4D6WA 3CCVQ 4NL2A 2EJGA 4PJOC 1VUBA 3KXTA 2ROTA 1KQSS 3WVEB 4OVAA 3L2UA 1S72T 3T9NA 4C92B 3INZA 3EGUA 3PTAA 2EKOA 4M77E 2H3JA 3SB2A 3KBGA 3OW2A 2O2OA 4EDUA 1X01A 2DXUA 2RF0A 4M78B 3CCET 1I07A 4C5GA 1UGQB 1M3BA 5GANg 1NYFA 2IIMA 1VQPT 4F7UE 3V7RA 2GFAA 3X25B 4XTYA 1UECA 1X6BA 1YJWA 1ABQA 4HCBA 1SHFA 2DX1A 4BY6B 1PSEA 1G3WA 2RN8A 1GCQA 5L8RE 4C92E 1WJQA 1M8MA 2LJ0A 2WACA 2RK2A 1TU0B 2LQWA 2M1HA 1BIBA 1W1FA 3CMET 5GAOr 2OTJT 1EFNA 1SRLA 2LNHB 3GPLA 2IVWA 2GFUA 3RERA 3CD6Q 5HK3A 1Q81U 1ZSZB 2DILA 4II1A 2K3XA 3I5RA 3M0PA 1VYUA 2YDLA 1YJNQ 1NPPA 5I2SA 4XAXB 5CQXA 5GAN3 2F5KA 5EG2A 4OGCA 1AEYA 1PRLC 3V7SA 1KC8R 4KH0B 1K73C 1GBRA 3QYGB 1GXIE 1QKXA 1WA7A 5GAMf 2DTOA 4PJOB 2RHZA 2RQTA 4C0GA 2VB6A 4PJOF 4OF1A 3EG9A 2CP5A 4OMMA 3H8ZA 2WSCE 2K2MA 4C8QG 1YITQ 4HCCA 4F7UG 2E3IA 2NWMA 4J9HA 3OYIA 4M75E 2MK5A 5LJ3j 1BKBA 1C0MA 3HP9A 2L3QA 1UDLA 5C6SA 2LT1A 3Q1JA 4J9EA 4M78A 1KD1R 2ZPGB 4AFSC 3CCMQ 2RJFA 1W70A 2QA4A 3OA6A 1D1CA 1TUGB 1JB0E 2A36A 2VKNA 3CCEA 1K1ZA 1NM7A 1ZA1B 1YWPA 2RJDA 2E6ZA 2LJ1A 1BCOA 2JW4A 2YUOA 3CXCS 3EG3A 2YUPA 1MHNA 2M0OA 3G71T 5DM7R 2FRWA 1AVZC 5DY9A 5CKBA 4F04B 5CO7A 1BI0A 3JB9G 2K3YA 4M75F 4ORZA 2K6DA 3CBPA 4E7JA 4E7ZA 3VS1A 3RIRA 1KC8U 2DBKA 1W4SA 3OYCA 3HRUA 1XJWB 3N5BB 3VS0A 3JCMP 2AKLA 4C92F 4X1VA 1V1CA 3CCJA 2E70A 4XU1A 4JRIA 4HKEA 3M54A 3DB4A 1QP2A 4C0FA 4M7AD 2I0NA 3GOXA 1WGSA 2G3RA 3H0HA 2P0QA 9ATCB 1VQ7T 3CCJT 5KE3A 2NUTB 1KC8C 2RHYA 1B07A 3MP8A 2YRVA 4E7HA 2HAXA 4E7LA 4PKCC 1QMCA 2VGNA 5J3BA 5HCKA 1YJWQ 1I5OB 2O88A 3CCQQ 4IIMA 4N0AA 4EMHA 3CCVT 2CH4W 3ZBDA 2EVRA 1Q7YU 1QVGA 4PL6A 3SEMA 3FRNA 1E7OA 3OYFA 2ATCB 2KEAA 3M58A 3HHTB 4F7UF 2OTLT 1PD1A 2RI2A 2ROLA 3EFSA 3J80E 4Z02A 1Y0MA 3META 4J6YA 1IHVA 2W0ZA 1WQWA 1FYNA 5HY6A 2DZCA 4F14A 2E41A 2FEIA 2XG8D 4RTZA 3QHSA 1FMKA 5GMKh 5GJWB 2LMJA 1BB9A 3G7ZA 4K11A 1W6XA 3L2RA 3EFOA 2K4YA 3AT1B 1HJDA 3CCLA 3VYGA 2QGGA 3QIIA 3UF4A 1M1FA 1X6OA 2EGEA 1VQ5T 3QUIA 2DLPA 3M56A 4F7UB 3GBQA 3J81E 3GF5A 1ZUUA 1YWOA 1UFFA 2EPDA 2NLUA 3CCUQ 3OSSC 2QA4Q 2COZA 1TSFA 3I55A 1FMVA 1N9SA 2DL8A 1D3BB 3NPFA 2FZCB 1N6AA 3E2UA 3URGA 1IGQA 3CPWS 1VQLQ 1TOVA 2KVQG 2PUOB 4MZMA 2OJ2A 1UJYA 2COYA 3JAME 1K73U 5KH6A 5FWCA 3I5SA 5CK9A 5GAMd 3JB9F 1MNDA 5KYYB 2OAWA 2L2PA 1D3BA 4MZTA 3UATA 1G3TA 1R8OB 2GTOA 2AK5A 2EJFA 2KBTA 2Z0WA 2JM8A 1U06A 1AT1B 5L23A 1M9SA 4KT0E 1YJWT 1M1KU 3PT9A 4AT1B 3A8MB 4GBQA 5CKDA 3QDRB 1K73R 2EYXA 2ZPEB 1VQPA 5GAMe 1AOJA 4R0KA 2V26A 3CC7T 3C4SA 3EG1A 1UEBA 2K2VA 4KGZB 3NGPA 4RTUA 2XKOC 3QYHB 4E47A 3H9NA 1WHMA 2YT6A 5D7UA 1NJIU 2FZKB 5FU7C 1MMGA 4BACA 2EQIA 4HCKA 2GQVA 2KY9A 5GAN5 3MHXA 4IUUA 1KQ1A 3LW5E 3GP8A 5CIUA 3PE0A 2F2XA 1WHLA 2O01E 5HK0A 3REAB 3PIOA 3EGDB 1SG5A 4BI8B 1JBMA 2OTLQ 4BB7A 1KHIA 1RLQC 4IUPA 3VS5A 1ZUYA 1ZA2B 4KGXB 4J5YA 3CC7A 4RTWA 1RACB 4M77C 1N9RA 1B34A 5LJ5g 1VQ5A 2PNIA 3EHRA 1WHKA 5GMKe 3JB9D 1QVGS 2V8KA 2JNGA 5J26A 1W2BP 2E4HA 1BI2A 3R6NA 1B7TA 2LRQA 1M1GA 5LJ3e 2D6FA 2R57A 4BUGA 4PLLA 4QW2A 2LQ8A 1E6GA 1M30A 2K7AA 3OYMA 2VXFA 2V8JA 2DXBA 4OB2B 3EH1A 4IUQA 4M78F 4OMLA 1PD0A 2W10A 1H3HA 3CD6A 5GAN8 2ZPBB 2VUBA 1QP3A 4BI4A 4ZTFA 1CKAA 1TS9A 2D1XA 4ZN3A 3PIPA 2DEQA 1VQ6A 1YJNA 2QQ9A 2JJ9A 3VUBA 4O5VA 2VYTA 2ZPHB 1S72Q 2PQWA 2XDBA 2AZVA 3OYLA 1KFZA 3HFOA 5LJ5d 1VQNQ 4M77A 2X3WD 1ARKA 2L3PA 1NEGA 2DYIA 1N8RU 3A98A 2RJEA 3OS0A 1M2OA 1QW1A 1VA7A 1ACMB 1YI2T 4M77F 3VUZA 1G5VA 5CKFA 4V2SA 3THKA 3QJYA 1YFNA 4JS4A 2X4JA 2F5TX 4DEXA 1UHCA 2MWPA 2FRYA 2XD0A 3M57A 2DJQA 2LP5A 4DBQA 1VQKA 1QWFA 3HKSA 2D0NA 4BDYA 2MOXA 1KD1C 4XK8E 2HD0A 1VQNT 3E1SA 4D8KA 3OMCA 4LDWA 3CCVA 1LJOA 1TTHB 2L3RA 3L2VA 1Q81R 1IXDA 4F16A 2XIDA 4ZGDB 2EYWA 2QAZA 5AYFA 3CCSQ 1Q7YR 1LCKA 3X24B 1P92A 4JPBW 1VQ8T 1CKBA 5AT1B 4A4FA 1BI1A 3P8BB 4RKUE 2DL3A 3CMAT 3JB9J 2DF6A 2GBQA 1MMNA 4FYXB 3JCMc 1KIKA 2CSIA 2YHTA 4JZ3A 2LJ3A 2HSEB 1IGUA 1YIJT 4QVZA 3CC2A 1RAFB 2J7IA 4M78G 1Y96A 4ANJA 3FJPA 3S6WA 3TSZA 5A0DA 2FZGB 3A8LB 2G6FX 3G6ET 1UTIA 1MUZA 3X28B 2E12A 5I22A 4Y28E 2E5QA 5ECAA 3CC7Q 4LXCA 2DIQA 2M16A 2XHCA 1M4ZA 4PJNA 1H3ZA 3JCMd 1QWEA 5IHNA 5I11A 3HSBA 3CC2T 1JRIA 3H0FA 3IQLA 2ENMA 4BI3A 1KD1U 5GAN7 5CR2A 4PJJA 1X2QA 4HVWA 5GAOl 4C0DC 1VQ9T 3MKDA 2YWWA 1YJ9T 3CCQA 4AFQC 3C94A 3G71A 3CCQT 1YJ9A 2EKHA 5LJ5f 1VQ9A 1IHWA 2PVOB 2DYBA 1X75C 1M1KC 2K5IA 3UPUA 2R58A 2O9VA 3MP6A 2L0AA 2CUDA 1U3OA 4FU6A 2KAFA 2EYZA 3S3OA 3QPHA 1JXMA 2FHDA 1HSQA 1K8AU 2EWNA 1ZX6A 4PK4A 2KGTA 3G4SQ 1OPKA 4O6JA 1QLYA 2A7YA 1Y7XA 3CMEA 2JUFA 2GCXA 2RHUA 3SWNA 2CGHA 2P4RA 4BDZA 1UGPB 1M1KR 1OPLA 3JCMe 4N0AC 2CZ7B 3VV0A 1BK2A 4QVCA 2VGMA 2C0IA 2QTVA 2QG9B 5FW9A 2QDLA 4OGEA 3CMAQ 1JO8A 4RCBA 1OV3A 3QZ9B 3CEYA 2V8IA 3CXCA 2LX7A 4EMKA 3EGXB 3VRZA 2LCLA 5A0GA 2DXTA 1Q86C 1YIJQ 2DA9A 3NTHA 1PKSA 2HBWA 2LCSA 1IO6A 1NLPC 3KUFA 4KULA 2M9UA 3RKYA 2KMTA 4OMQA 3EHQA 5KYUA 4L59A 3ZL7C 4ZTJA 4C8QB 4CC2A 1YJNT 3SHWA 2DKGA 5FROA 2F2WA 2DPPB 2KQWA 3CCJQ 2ED1A 4OMOA 4ZNXA 1SF9A 2KSSA 3OYDA 4Z89A 1UJ0A 1R0CB 2BE7D 4LN2A 2XDDA 1QCNA 4PJOD 1Q7YC 2D9TA 2O4XA 4Y92A 1X69A 3LLRA 5FU7B 3ZEHA 1VQOT 3M0RA 1SRMA 2FVUA 3QG1A 3CC2Q 3E19A 5I2MA 2JTEA 1YCYA 2HQXA 2QQAA 1OULA 1U1TA 1Z9ZA 2CUBA 1QCOA 1BU1A 3I56T 1WZOA 1D0ZA 2BZYA 2QASA 5A2QE 1BCMA 3ULRB 5A0LA 3R6OA 1SSHA 4M7DE 3E9GA 4X9CA 3QWXX 3I56A 3EGXA 4M77D 2E6NA 2KROA 2DRKA 2C0TA 2E3HA 4PJLA 4QVDA 2F2VA 1JJ2P 3P8DA 4IUTA 2ECZA 2LT4A 1VQMT 4JJCA 3C12A 1AWWA 4C92A 2VASA 2DVJA 4ELYC 4HT8A 5KCOA 1TG0A 2BKDN 2PVGB 3EG2A 2KK4A 2HNIA 4WCIA 2XICA 1M8VA 2EW3A 3G1JA 3LWHA 4N4GA 1FXXA 5CQYA 4M7AC 1JJ2A 4A4HA 1QVFP 2KNBB 5CVIA 3VS7A 1FX7A 2J6KA 2BZ8A 4KRTA 2H3EB 4J6WA 1DJ7B 2HKNA 3EAEA 1EZZB 1G2BA 1I1JA 5IN1A 3NFCA 3OYNA 2XMFA 3GNFB 1VQLA 3HRSA 4ATOA 4R55A 3UA7A 1WHGA 2MWOA 5LJ5h 2F69A 5GAMg 4JRPA 1VOMA 2HSPA 3OMGA 1KQ2A 1V29B 1TH7A 2EYYA 4XQ3A 5J39A 1VQOQ 1Q86U 2FPEA 4ELZC 1RAHB 4M7DB 4RTVA 3J7AF 3CCEQ 3LGFA 4HCZA 1WPYA 4J7IA 1LVKA 2R5AA 2KE9A 2E10A 3RKWA 5GANd 5GMKj 3HRTA 3MEVA 2CZ6B 3JCMV 3M0UA 2DMOA 5DLOA 4NL3A 1YHQT 2NUPB 5GAOm 2YSQA 1OZ3A 4XU3A 2Y90A 2KT8A 3UT1A 2DFUA 1K0SA 1QQJA 5IHIA 4KGVB 1ZBJA 2VV5A 1PSFA 3BDLA 2RH2A 4DEYA 2FB7A 5GAOp 1VQKQ 3EH2A 1K4US 1OYXA 1K9MU 2K79A 4M7AB 2EBPA 4A4GA 3JRZA 1NYGA 1BYMA 5GAN2 4KUIA 1XOVA 2E5KA 2DERA 1QVFS 3OW2S 1X2KA 2JZ2A 4A53A 1I81A 4OMPA 3FDRA 4J9DA 3L42A 5LJ3h 2MCNA 4JJDA 3CXCP 2OTLA 1EX4A 1T0JA 2DJZA 4M77G 1TXQA 3L2WA 1K9MR 1PWTA 3CPFA 2X51A 5LJ3g 4FW1A 4QKUA 4RCCA 3V7CA 3QXEB 2FYKA 5GANe 5FU6B 1Q86R 2SRCA 2DRMA 4IURA 1G3YA 3PGGA 3AHUA 3OYEA 2ZAEA 3ASKA 2RPNA 4Z88A 1JU5C 3OYJA 2AT1B 2I2LA 1KHCA 4PJOE 2AHJB 3HL8A 5KCHA 2VWFA 3RUXA 5DLQE 4RUGA 2GGRA 3HFNA 1LPLA 3MEAA 4FL6A 2BUDA 3NMZC 8AT1B 3OYHA 1WX6A 3TREA 4J9IA 2LTOA 2LX9A 2OX7A 1GRIA 1MV0B 2AKKA 4MMKA 4M7DA 2HMAA 4JUVA 3A1PA 1VQ9Q 4JZ4A 1M90C 4MDXA 2DTHA 2PVDB 4AFZC 1IB8A 1N5ZA 4JDSA 4RTXA 3RMSA 1VQNA 3CBMA 2DXCA 5GMKi 3JCMW 4M75D 1VQ7A 2KT1A 4DA4A 3M4GA 1SEMA 4WF2A 2XDPA 4ESRA 2RHXA 3E9FA 2M02A 4RTTA 1M5Q1 2NUTA 1N8RC 3I35A 1VQ4Q 4NS5A 3WXMB 4PJOA 1M2VB 2JTMA 3JB9I 4M78E 4AMCA 3RDVA 2DNUA 3G4SA 3OY9A 4BE0A 4JRQA 4XTVA 2QA4T 4MMLA 4HVUA 4ME7A 1YI2A 4E7SA 3MCAB 4FSSA 2PZ1A 2XI9A 4C5EA 1J3TA 2E1HA 2FPDA 3VS3A 4FT2A 2OI3A 3VRYA 1OX9A 2MF2A 2X4XA 2AZSA 4JLGA 2M0YA 2RA2A 4A4KA 1ZBXA 2KYMA 5KYXA 2H8HA 4M7DG 2GNCA 1JXOA 2RJCA 3C0CA 4QQ6A 1X6GA 3RBBB 5D6YA 1WHHA 3OB9A 1MMDA 3DB3A 2OAUA 4HVVA 3LYIA 2EQMA 3CCSA 5LJ3d 1RI9A 2FG0A 4RG2A 1VQ6T 2K3BA 2PU9B 1YBYA 2HQEA 2A0FB 2JMAA 2HKQB 1D0XA 1NE8A 4IIOA 3JSCA 4GLKA 3CD6T 3A8GB 2QGFB 4C92D 2LCCA 2KXCA 1ZSZC 3L2QA 2J6FA 1RUWA 3NTIA 4PLIA 1M3AA 2Y4YA 4M75G 2DETA 1XTDA 2QQRA 5GAOq 3EG9B 2YLCA 2MMPA 1NPRA 4DQ2A 1PKTA 2CT4A 4M7AF 2VC8A 4EMGA 1PM3A 1WNLA 2A3LA 1AWOA 2QDYB 3JCMh 1G8XA 5IH2A 5EC7A 2X3XD 4OMNA 3JCMJ 1HD3A 1H641 4J9GA 3TEEA 1WJSA 2YXYA 2X35A 1WI7A 1ABOA 1ZUKA 4C92G 1D1AA 2A28A 5LJ3f 2PUKB 1CSKA 5GAN6 5GMKl 3L1AA 1TWBA 1VQ5Q 1BI3A 2V1RA 4XU0A 5FLXE 3I56Q 1N27A 3OQ5A 4XTWA 3VYHB 2CP7A 2DD5A 4BE1A 2DEUA 2D0QB 4GLMA 2C06A 2KR3A 1AHJB 3M53A 4ZGJB 2CDTA 1RL2A 1QKWA 4N4HA 4PJMA 3QKJA 1YHQQ 2QQSA 5KYWA 8ATCB 4RMOA 1WXBA 4UC4A 2FPFA 3LH0A 2JS0A 3OBYA 2MPXC 1SKUB 2ESWA 3FEOA 4R56A 4AG1C 1Y71A 5FRMA 1VQ6Q 1AZGB 4E7KA 2A08A 1M27C 2QEXA 4KUDK 1OOTA 3OYYA 3CMAA 2DM1A 2GTJA 2R5MA 2HQHA 1T3LA 2CZ0B 4B6MA 1S72A 4EMKC 4A63B 3EGDA 1OQKA 1OEBA 3PFSA 1VQ8A 1D09B 3CCMT 4WTOB 4LUEA 3LH5A 4L5GA 3M55A 4F17A 5KYYA 3CCRA 1YP5A 4LNPA 2RK1A 5FWBA 1PG5B 3M4YA 4C0ZA 1UG1A 2EQKA 3H0IA 4FIBA 1M90U 3OW2P 4J9BA 1NG2A 2HBPA 1KQSP 1JEGA 1EIFA 3OSVA 3MPUB 4DBHA 3PMTA 2M51A 3OS1A 1Q95G 2KDSA 1VQOA 2RI3A 4DBFA 1WDXA 1RADB 5GANh 4QQDA 3FLGA 1FMWA 4YTLA 2SEMA 1VYVA 5M9OA 4QT7A 2RHIA 4LD9K 1M90R 3M0QA 1HYOA 4HA8A 4LDVA 3BFMA 4E6RA 2P84A 2MYSA 6AT1B 2JOYA 3JCMf 5KE2A 1PC0A 2IG0A 4LD6A 5D6XA 4FW2A 4M75B 4JJNK 2NUPA 3NHNA 2D8JA 2B86A 1FWZA 2RNAA 2EQUA 1T0HA 4JS5A 3O8VA 4LDUA 2VXEA 3F70A 3TU4K 2E64A 1B34B 2K57A 4Q5WA 2BIVA 2CP3A 2YUNA 2DO3A 4M75C 3MJXA 2X9HA 4E2FB 5FU6C 4EPCA 4PFOA 2HDAA 3QDFA 4BD3A 4XTZA 3VS2A 3VU3C 1OU9A 1B3QA 4JLIA 2VVKA 3ME9A 1WIEA 3JCMX 3FIFA 4Y91A 1K9MC 1I8FA 1ZQ1A 2QEXT 2HL5C 4J9FA 2NUZA 2EAYA 2CT3A 1AD5A 4GY5A 3TSWA 1C1AA 3MEWA 3QSUA 4C8QD 2GF7A 3G71Q 1MV3A 1YJ9Q 2X4YA 1VIEA 1VQMQ 5CAIA 3JV3A 3EG0A 3CPWP 1KSWA 1K8AR 2X4WA 5I21A 5KYNA 4J6XA 5IXFA 2ZCFB 4FT4A 1QVGP 1SSFA 3OS2A 2QI2A 3C95A 4A54A 2QEXQ 1Q82U 1O9SA 3SWNC 1Y57A 1LOJA 1UB4A 4AFUC 1C6VX 3CMEQ 4N4IA 1VQ8Q 1MGQA 3S3NA 1PCXA 4C8QC 4Z8AA 5IT9E 3QJ6A 3OYBA 4CC4B 3I55Q 4JJBA 2JS2A 1VQ7Q 3ER0A 2P0PA 1AZEA 3GNGA 1H8KA 4C8QE 2EGCA 5GANj 1WQ7A 1ZLMA 3LGLA 2KXDA 3G6EA 3VS4A 1Q82C 2YRCA 2BZXA 5LJ5j 2D8HA 1YI2Q 3HTRA 4FYVB 3RNJA 3DKMA 1YIJA 2MIOA 5HKCA 4LDYA 2JN0A 1LNXA 3QWYA 1A0NB 4M7DF 3OYGA 1M2VA 3KFVA 3PVQA 1KG1A 1NBEB 3RMQA 2ZGWA 1AWJA 3CCUT 4PFZA 3HPWA 3TCJA 1RI0A 2B8AA 2DE0X 4ZN1A 4X9DA 1Q81C 2V1QA 1D1BA 1R0BG 2JTFA 4C5IA 3DLMA 4JRKA 2EYQA 5GJVB 4RG8A 5KYXB 3VJPA 2Y4XA 3OYAA 1K8AC 2RM4A 3A5ZB 2K5FA 4NOYA 1NJIR 2XU8A 1VQKT 1OX8A 2DL4A 2OTJA 1XQHA 4LDXA 3REBB 2JXBA 2P4TA 2EGAA 2HZYA 1VQ4T 2KYBA 1TUDA 4DOVA 4PJOG 4OMFB 2RO0A 2HL3A 1U1SA 1WJRA 2EQJA 3FJ5A 2O4XB 2ABLA 1UGRB 3MEUA 2COWA 1I0CA 2CSQA 2O9SA 4L6V5 3CC4T 2DVEA 2RI5A 1UGVA 4M7AE 4FSXA 1UGSB 4M7AG 2XK0A 2J05A 7AT1B 1ZSGA 4LE9A 3CCST 2EIFA 2LQKA 3H6ZA 2O31A 3BE3A 1X27A 1ZHIA 5KYUB 4DBRA 4E7IA 2KRSA 3UDCA 4P5NA 4IUVA 3WVDB 1U5SA 3PNWC 3JCMb 3PVLA 3GIBA 4BY6C 2RQRA 3TVTA 2RB6A 2JM9A 1YN8A 2ED0A 1MMAA 5CKEA 3UWNA 1VYTA 2EFIA 3CC4A 3CQTA 1RLPC 1V76A 3UA6A 2RMOA 1XNIA 1NLOC 1GCPA 1IZ6A 1YITA 4M7DC 1GL5A 3DLLA 4XTUA 2BE9B 4FYYB 1K0XA 1UHFA 2E65A 1VQ4A 3G4ST 2CH4A 1IRXA 4HT9A 3VS6A 2K9GA 2C0OA 1OI1A 4X34A 5IHKA 3M0TA 3O5ZA 3JCMg 4CI0C 2QK0A 1PNJA 1YCSB 1RABB 2FO0A 1PRMC 4TVRA 3OYKA 5GANf 4EMKB 1VIFA 1YNZA 1Y96B 3A8OB 3CCLQ 4VUBA 2YUQA 3JCMQ 1RAEB 1AWXA 2YLBA 1K9AA 2LZ6B 2RQVA 2ZZDA 4A4EA 3G6EQ 1SHGA 1N8RR 2QXFA 2CP6A 1IREB 1K76A 2P0KA 3CCUA 2JVVA 3OBWA 2ZPFB 1JJ2S 4FYWB 1I5LA 5CKHA 3BDUA 5LL6S 5C0MA 3SFMA 1H92A 5GAN4 5GAMh 1TUCA 3X20B 2QYZA 2CKKA 1WLPB 4FCYA 2IPOB 4B9WA 2KRMA 1Y07A 3U23A 1X43A 3M9QA 1HXDA 3SDZA 2EJ9A 2RD1A 1UE9A 4CRIA 4IKFA 2LDMA 3H41A 2CZ1B 1SPKA 4C8QA 4XU2A 1MNEA 2GQIA 3BW1A 3P8HA 1QVPA 5D6WA 1T3SA 4F7UA 3L2ZA 1KK7A 1VQPQ 2WSEE 1F1BB 4OP0A 3X26B 4DOWA 5FRNA 3V8KA 3QBYA 3MO8A 3FB9A 2OTJQ 5GAOn 2F1LA 1W2BS 5IAYA 2NYSA 4M78D 2DIGA 4C8QF 3CPWA 3A8HB 2BTTA 4QQGA 2L5QA 3D7SB 1KQSA 3M59A 4MZPA 1HK9A 4C5HA 1QVFA 2CS7A 2J06A 3V8LA 4J9CA 1GFDA 2YRDA 3LWIA 2CREA 1S1NA 3LX7A 1NEBA 5KYWB 1RAGB 3I55T 2L8DA 2JT4A 2DBMA 4ZGEB 1QCFA 2RQWA 2LC4A 2CP2A 2LQNA 1U8RA 4OB3B
chains in the Genus database with same CATH topology
2L2PA 1M3CA 2M51A 1WXUA 3UATA 2ECZA 4CC3A 3M0SA 2GTOA 4JJCA 5IXBA 1AWWA 1WDXA 2AK5A 2KBTA 2JM8A 1U06A 2DVJA 2HEQA 5L23A 1BBZA 2RQUA 1TG0A 1GFCA 2SEMA 1VYVA 3EG2A 4GBQA 4QT7A 2EYXA 4WCIA 3M0QA 1AOJA 4RTYA 4R0KA 2J6OA 3EG1A 2EW3A 3NGPA 4RTUA 4E6RA 1PHTA 1WXTA 2KNBB 2YT6A 3I9QA 3VS7A 2J6KA 2BZ8A 2EQIA 4HCKA 4KRTA 3NHNA 2D8JA 2B86A 3PE0A 1G2BA 1I1JA 2F2XA 2RNAA 1T0HA 2XMFA 3REAB 2DL7A 2A37A 2JMCA 1Z9QA 3UA7A 2YUNA 4D8DA 1RLQC 2PTKA 3VS5A 1ZUYA 2HCKA 1WFWA 2HSPA 2HDAA 4RTWA 3VS2A 2EYYA 2KRNA 2FPEA 1B3QA 4CC7A 2DL5A 2PNIA 2VVKA 4RTVA 1WIEA 1JQQA 3EHRA 2KE9A 4J9FA 2L3SA 2NUZA 3M0UA 2DMOA 4M4ZA 1G83A 3R6NA 2CT3A 2YSQA 1AD5A 3TSWA 1UUEA 2KT8A 1MV3A 1K0SA 1E6GA 1M30A 2K7AA 4LUDA 5IHIA 4AG2C 1GBQA 4HXJA 1ZBJA 4DEYA 1GCQC 3EG0A 3JV3A 4OMLA 2W10A 1H3HA 1E6HA 1KSWA 1K4US 2K79A 4EIKA 1CKAA 1WYXA 2EBPA 2D1XA 1NYGA 5IXFA 1KJWA 1XOVA 2E5KA 1X2KA 2ROTA 4OMPA 4J9DA 1Y57A 2MCNA 4JJDA 4AFUC 1T0JA 3EGUA 2AZVA 1KFZA 1PWTA 4Z8AA 2O2OA 2X3WD 4CC4B 1ARKA 2L3PA 4JJBA 2JS2A 2RF0A 1I07A 1AZEA 1NEGA 1H8KA 3A98A 2EGCA 2SRCA 1VA7A 1M3BA 2DRMA 1NYFA 1ZLMA 2IIMA 2KXDA 1UECA 1X6BA 3THKA 2RPNA 4Z88A 1ABQA 1JU5C 1SHFA 2DX1A 3VS4A 2RN8A 1GCQA 2BZXA 2D8HA 3RNJA 1M8MA 2LJ0A 4DEXA 2MIOA 2LQWA 1UHCA 2FRYA 1W1FA 2VWFA 1EFNA 1SRLA 2LNHB 2DJQA 2LP5A 3QWYA 1A0NB 1QWFA 4RUGA 2D0NA 2GGRA 2MOXA 2DILA 3I5RA 3KFVA 3NMZC 3PVQA 4D8KA 3M0PA 1VYUA 2YDLA 1WX6A 1AWJA 4J9IA 1GRIA 1MV0B 2AKKA 4F16A 2DE0X 2V1QA 2EYWA 1AEYA 1LCKA 1PRLC 4JZ4A 1GBRA 5GJVB 4JPBW 1QKXA 1WA7A 1CKBA 1N5ZA 4AFZC 4RTXA 2RQTA 2DL3A 2KT1A 2DF6A 4OMMA 2GBQA 1SEMA 2K2MA 1KIKA 2CSIA 2DL4A 4JZ3A 2LJ3A 4ESRA 4RTTA 3REBB 2JXBA 2EGAA 2NWMA 3I35A 4J9HA 2J7IA 2DNUA 2KYBA 3TSZA 2L3QA 1UDLA 1TUDA 2G6FX 1UTIA 1MUZA 4J9EA 4HVUA 5I22A 4AFSC 5ECAA 3FJ5A 1W70A 4FSSA 2PZ1A 2ABLA 1J3TA 2FPDA 3VS3A 1I0CA 2A36A 1QWEA 2CSQA 2O9SA 5IHNA 2OI3A 5I11A 3VRYA 2VKNA 1K1ZA 1NM7A 1UGVA 1YWPA 3H0FA 3IQLA 2AZSA 2ENMA 2M0YA 2LJ1A 2KYMA 2H8HA 1X2QA 2GNCA 1JXOA 2J05A 1ZSGA 2JW4A 2YUOA 4HVWA 3C0CA 4LE9A 1X6GA 3RBBB 2O31A 3EG3A 1X27A 2YUPA 4AFQC 4HVVA 2FRWA 2KRSA 1AVZC 1U5SA 2EKHA 1RI9A 3PVLA 2FG0A 2DYBA 2K3BA 4ORZA 2K6DA 2RQRA 3TVTA 2JMAA 3VS1A 2JM9A 2O9VA 1YN8A 2L0AA 2ED0A 4IIOA 1VYTA 2DBKA 3CQTA 2CUDA 1RLPC 1U3OA 3UA6A 2RMOA 2EYZA 1NLOC 3VS0A 1GCPA 2KXCA 2AKLA 2J6FA 1GL5A 1RUWA 4X1VA 1JXMA 1V1CA 1K0XA 1HSQA 1M3AA 1UHFA 1ZX6A 2KGTA 1OPKA 2CH4A 1QLYA 3VS6A 2K9GA 2C0OA 2I0NA 5IHKA 3M0TA 3O5ZA 1PKTA 2CT4A 2P4RA 1PNJA 1YCSB 3H0HA 1OPLA 2FO0A 1PRMC 1AWOA 1YNZA 1B07A 1BK2A 2YUQA 2C0IA 1AWXA 5IH2A 1K9AA 2LZ6B 2X3XD 2RQVA 5EC7A 5FW9A 2QDLA 4OMNA 1JO8A 1HD3A 4J9GA 1OV3A 5HCKA 1SHGA 2O88A 4IIMA 1WI7A 2LX7A 1ABOA 1ZUKA 3VRZA 2A28A 1K76A 1CSKA 2DA9A 2CH4W 2EVRA 1PKSA 2HBWA 3SEMA 2LCSA 1E7OA 2KEAA 1IO6A 2V1RA 1NLPC 1H92A 4OMQA 3EHQA 1TUCA 3ZL7C 4CC2A 1WLPB 2ROLA 3SHWA 2KRMA 3U23A 1X43A 1Y0MA 2F2WA 4GLMA 2W0ZA 2KR3A 1FYNA 2ED1A 2CDTA 1UE9A 1QKWA 4OMOA 4ZNXA 3H41A 4F14A 1SPKA 2FEIA 4RTZA 4Z89A 1UJ0A 1FMKA 4LN2A 1WXBA 2GQIA 2FPFA 5GJWB 2LMJA 1T3SA 1BB9A 2JS0A 4K11A 1W6XA 2ESWA 4AG1C 1AZGB 1X69A 4Y92A 1HJDA 2A08A 1SRMA 3M0RA 1M27C 1OOTA 3UF4A 2DM1A 2BTTA 2GTJA 2EGEA 1T3LA 2JTEA 4A63B 2DLPA 1OEBA 3GBQA 1ZUUA 1YWOA 1UFFA 2EPDA 1Z9ZA 2CUBA 2J06A 4LUEA 1BU1A 3LH5A 4J9CA 2BZYA 4F17A 1GFDA 2DL8A 3ULRB 1YP5A 3NPFA 4LNPA 2CREA 5FWBA 1S1NA 1UG1A 1SSHA 1NEBA 2OJ2A 2JT4A 1UJYA 3QWXX 3H0IA 2DBMA 2KROA 2DRKA 1QCFA 2RQWA 2C0TA 2LQNA 5FWCA 3I5SA 4J9BA 1NG2A 1JEGA 2F2VA 2OAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2P A;  1M3C A;  2M51 A;  1WXU A;  3UAT A;  2ECZ A;  4CC3 A;  3M0S A;  2GTO A;  4JJC A;  5IXB A;  1AWW A;  1WDX A;  2AK5 A;  2KBT A;  2JM8 A;  1U06 A;  2DVJ A;  2HEQ A;  5L23 A;  1BBZ A;  2RQU A;  1TG0 A;  1GFC A;  2SEM A;  1VYV A;  3EG2 A;  4GBQ A;  4QT7 A;  2EYX A;  4WCI A;  3M0Q A;  1AOJ A;  4RTY A;  4R0K A;  2J6O A;  3EG1 A;  2EW3 A;  3NGP A;  4RTU A;  4E6R A;  1PHT A;  1WXT A;  2KNB B;  2YT6 A;  3I9Q A;  3VS7 A;  2J6K A;  2BZ8 A;  2EQI A;  4HCK A;  4KRT A;  3NHN A;  2D8J A;  2B86 A;  3PE0 A;  1G2B A;  1I1J A;  2F2X A;  2RNA A;  1T0H A;  2XMF A;  3REA B;  2DL7 A;  2A37 A;  2JMC A;  1Z9Q A;  3UA7 A;  2YUN A;  4D8D A;  1RLQ C;  2PTK A;  3VS5 A;  1ZUY A;  2HCK A;  1WFW A;  2HSP A;  2HDA A;  4RTW A;  3VS2 A;  2EYY A;  2KRN A;  2FPE A;  1B3Q A;  4CC7 A;  2DL5 A;  2PNI A;  2VVK A;  4RTV A;  1WIE A;  1JQQ A;  3EHR A;  2KE9 A;  4J9F A;  2L3S A;  2NUZ A;  3M0U A;  2DMO A;  4M4Z A;  1G83 A;  3R6N A;  2CT3 A;  2YSQ A;  1AD5 A;  3TSW A;  1UUE A;  2KT8 A;  1MV3 A;  1K0S A;  1E6G A;  1M30 A;  2K7A A;  4LUD A;  5IHI A;  4AG2 C;  1GBQ A;  4HXJ A;  1ZBJ A;  4DEY A;  1GCQ C;  3EG0 A;  3JV3 A;  4OML A;  2W10 A;  1H3H A;  1E6H A;  1KSW A;  1K4U S;  2K79 A;  4EIK A;  1CKA A;  1WYX A;  2EBP A;  2D1X A;  1NYG A;  5IXF A;  1KJW A;  1XOV A;  2E5K A;  1X2K A;  2ROT A;  4OMP A;  4J9D A;  1Y57 A;  2MCN A;  4JJD A;  4AFU C;  1T0J A;  3EGU A;  2AZV A;  1KFZ A;  1PWT A;  4Z8A A;  2O2O A;  2X3W D;  4CC4 B;  1ARK A;  2L3P A;  4JJB A;  2JS2 A;  2RF0 A;  1I07 A;  1AZE A;  1NEG A;  1H8K A;  3A98 A;  2EGC A;  2SRC A;  1VA7 A;  1M3B A;  2DRM A;  1NYF A;  1ZLM A;  2IIM A;  2KXD A;  1UEC A;  1X6B A;  3THK A;  2RPN A;  4Z88 A;  1ABQ A;  1JU5 C;  1SHF A;  2DX1 A;  3VS4 A;  2RN8 A;  1GCQ A;  2BZX A;  2D8H A;  3RNJ A;  1M8M A;  2LJ0 A;  4DEX A;  2MIO A;  2LQW A;  1UHC A;  2FRY A;  1W1F A;  2VWF A;  1EFN A;  1SRL A;  2LNH B;  2DJQ A;  2LP5 A;  3QWY A;  1A0N B;  1QWF A;  4RUG A;  2D0N A;  2GGR A;  2MOX A;  2DIL A;  3I5R A;  3KFV A;  3NMZ C;  3PVQ A;  4D8K A;  3M0P A;  1VYU A;  2YDL A;  1WX6 A;  1AWJ A;  4J9I A;  1GRI A;  1MV0 B;  2AKK A;  4F16 A;  2DE0 X;  2V1Q A;  2EYW A;  1AEY A;  1LCK A;  1PRL C;  4JZ4 A;  1GBR A;  5GJV B;  4JPB W;  1QKX A;  1WA7 A;  1CKB A;  1N5Z A;  4AFZ C;  4RTX A;  2RQT A;  2DL3 A;  2KT1 A;  2DF6 A;  4OMM A;  2GBQ A;  1SEM A;  2K2M A;  1KIK A;  2CSI A;  2DL4 A;  4JZ3 A;  2LJ3 A;  4ESR A;  4RTT A;  3REB B;  2JXB A;  2EGA A;  2NWM A;  3I35 A;  4J9H A;  2J7I A;  2DNU A;  2KYB A;  3TSZ A;  2L3Q A;  1UDL A;  1TUD A;  2G6F X;  1UTI A;  1MUZ A;  4J9E A;  4HVU A;  5I22 A;  4AFS C;  5ECA A;  3FJ5 A;  1W70 A;  4FSS A;  2PZ1 A;  2ABL A;  1J3T A;  2FPD A;  3VS3 A;  1I0C A;  2A36 A;  1QWE A;  2CSQ A;  2O9S A;  5IHN A;  2OI3 A;  5I11 A;  3VRY A;  2VKN A;  1K1Z A;  1NM7 A;  1UGV A;  1YWP A;  3H0F A;  3IQL A;  2AZS A;  2ENM A;  2M0Y A;  2LJ1 A;  2KYM A;  2H8H A;  1X2Q A;  2GNC A;  1JXO A;  2J05 A;  1ZSG A;  2JW4 A;  2YUO A;  4HVW A;  3C0C A;  4LE9 A;  1X6G A;  3RBB B;  2O31 A;  3EG3 A;  1X27 A;  2YUP A;  4AFQ C;  4HVV A;  2FRW A;  2KRS A;  1AVZ C;  1U5S A;  2EKH A;  1RI9 A;  3PVL A;  2FG0 A;  2DYB A;  2K3B A;  4ORZ A;  2K6D A;  2RQR A;  3TVT A;  2JMA A;  3VS1 A;  2JM9 A;  2O9V A;  1YN8 A;  2L0A A;  2ED0 A;  4IIO A;  1VYT A;  2DBK A;  3CQT A;  2CUD A;  1RLP C;  1U3O A;  3UA6 A;  2RMO A;  2EYZ A;  1NLO C;  3VS0 A;  1GCP A;  2KXC A;  2AKL A;  2J6F A;  1GL5 A;  1RUW A;  4X1V A;  1JXM A;  1V1C A;  1K0X A;  1HSQ A;  1M3A A;  1UHF A;  1ZX6 A;  2KGT A;  1OPK A;  2CH4 A;  1QLY A;  3VS6 A;  2K9G A;  2C0O A;  2I0N A;  5IHK A;  3M0T A;  3O5Z A;  1PKT A;  2CT4 A;  2P4R A;  1PNJ A;  1YCS B;  3H0H A;  1OPL A;  2FO0 A;  1PRM C;  1AWO A;  1YNZ A;  1B07 A;  1BK2 A;  2YUQ A;  2C0I A;  1AWX A;  5IH2 A;  1K9A A;  2LZ6 B;  2X3X D;  2RQV A;  5EC7 A;  5FW9 A;  2QDL A;  4OMN A;  1JO8 A;  1HD3 A;  4J9G A;  1OV3 A;  5HCK A;  1SHG A;  2O88 A;  4IIM A;  1WI7 A;  2LX7 A;  1ABO A;  1ZUK A;  3VRZ A;  2A28 A;  1K76 A;  1CSK A;  2DA9 A;  2CH4 W;  2EVR A;  1PKS A;  2HBW A;  3SEM A;  2LCS A;  1E7O A;  2KEA A;  1IO6 A;  2V1R A;  1NLP C;  1H92 A;  4OMQ A;  3EHQ A;  1TUC A;  3ZL7 C;  4CC2 A;  1WLP B;  2ROL A;  3SHW A;  2KRM A;  3U23 A;  1X43 A;  1Y0M A;  2F2W A;  4GLM A;  2W0Z A;  2KR3 A;  1FYN A;  2ED1 A;  2CDT A;  1UE9 A;  1QKW A;  4OMO A;  4ZNX A;  3H41 A;  4F14 A;  1SPK A;  2FEI A;  4RTZ A;  4Z89 A;  1UJ0 A;  1FMK A;  4LN2 A;  1WXB A;  2GQI A;  2FPF A;  5GJW B;  2LMJ A;  1T3S A;  1BB9 A;  2JS0 A;  4K11 A;  1W6X A;  2ESW A;  4AG1 C;  1AZG B;  1X69 A;  4Y92 A;  1HJD A;  2A08 A;  1SRM A;  3M0R A;  1M27 C;  1OOT A;  3UF4 A;  2DM1 A;  2BTT A;  2GTJ A;  2EGE A;  1T3L A;  2JTE A;  4A63 B;  2DLP A;  1OEB A;  3GBQ A;  1ZUU A;  1YWO A;  1UFF A;  2EPD A;  1Z9Z A;  2CUB A;  2J06 A;  4LUE A;  1BU1 A;  3LH5 A;  4J9C A;  2BZY A;  4F17 A;  1GFD A;  2DL8 A;  3ULR B;  1YP5 A;  3NPF A;  4LNP A;  2CRE A;  5FWB A;  1S1N A;  1UG1 A;  1SSH A;  1NEB A;  2OJ2 A;  2JT4 A;  1UJY A;  3QWX X;  3H0I A;  2DBM A;  2KRO A;  2DRK A;  1QCF A;  2RQW A;  2C0T A;  2LQN A;  5FWC A;  3I5S A;  4J9B A;  1NG2 A;  1JEG A;  2F2V A;  2OAW A; 
#chains in the Genus database with same CATH topology
 2CYZ B;  1M3C A;  3EFO B;  4M7D D;  2LVM A;  1WXU A;  4CC3 A;  3CCL T;  1YHQ A;  1NJI C;  3M0S A;  4MDW A;  5IXB A;  1OU8 A;  2QTX A;  5GMK m;  2HEQ A;  1BBZ A;  2RQU A;  1GFC A;  1NZ9 A;  2DAQ A;  4KH1 B;  3V8J A;  3CC4 Q;  3SWN B;  4M75 A;  2K5L A;  3VKI A;  2KI7 A;  4PNO A;  4RTY A;  1W2B A;  2J6O A;  3S3M A;  3EFR A;  3GLX A;  4M7A A;  4J8O A;  3RKX A;  3FC3 A;  4KBM B;  5LJ5 e;  1RAA B;  1BIA A;  1PHT A;  1WXT A;  3I9Q A;  1VQM A;  4C0D B;  2QQB A;  2LNV A;  1VQL T;  3SD4 A;  4J83 A;  3TQ7 P;  4C92 C;  4OB1 B;  2CP0 A;  3CCR Q;  3PMI A;  2WSF E;  3RR6 A;  2DTI A;  3QZ5 B;  2DL7 A;  2A37 A;  2JMC A;  1Z9Q A;  1ZSZ A;  4M78 C;  4J7F A;  4D8D A;  3CCR T;  2PTK A;  2HCK A;  1WFW A;  3ZFJ A;  3CCM A;  2AIR B;  4BE2 A;  3RES A;  2KRN A;  4CC7 A;  2DL5 A;  2MAM A;  2FL7 A;  5CCA A;  3NTK A;  1JQQ A;  4XTX A;  1D0Y A;  1RAI B;  3QO3 A;  2L3S A;  4M4Z A;  1G83 A;  3MP1 A;  2L89 A;  2DD4 A;  1UUE A;  2DK3 A;  4M77 B;  2MI6 A;  3BY7 A;  2DZ9 A;  4LUD A;  2ZPI B;  4AG2 C;  1GBQ A;  1R77 A;  4HXJ A;  5GAM j;  1YIT T;  1GCQ C;  3CBO A;  1E6H A;  3M5A A;  1OZ2 A;  3OS5 A;  4FM4 B;  4B9X A;  4EIK A;  3JB9 H;  1G3S A;  1WHJ A;  1WYX A;  4OB0 B;  1O75 A;  4PFP A;  1Q82 R;  1I4K 1;  1KJW A;  4D6W A;  3CCV Q;  4NL2 A;  2EJG A;  4PJO C;  1VUB A;  3KXT A;  2ROT A;  1KQS S;  3WVE B;  4OVA A;  3L2U A;  1S72 T;  3T9N A;  4C92 B;  3INZ A;  3EGU A;  3PTA A;  2EKO A;  4M77 E;  2H3J A;  3SB2 A;  3KBG A;  3OW2 A;  2O2O A;  4EDU A;  1X01 A;  2DXU A;  2RF0 A;  4M78 B;  3CCE T;  1I07 A;  4C5G A;  1UGQ B;  1M3B A;  5GAN g;  1NYF A;  2IIM A;  1VQP T;  4F7U E;  3V7R A;  2GFA A;  3X25 B;  4XTY A;  1UEC A;  1X6B A;  1YJW A;  1ABQ A;  4HCB A;  1SHF A;  2DX1 A;  4BY6 B;  1PSE A;  1G3W A;  2RN8 A;  1GCQ A;  5L8R E;  4C92 E;  1WJQ A;  1M8M A;  2LJ0 A;  2WAC A;  2RK2 A;  1TU0 B;  2LQW A;  2M1H A;  1BIB A;  1W1F A;  3CME T;  5GAO r;  2OTJ T;  1EFN A;  1SRL A;  2LNH B;  3GPL A;  2IVW A;  2GFU A;  3RER A;  3CD6 Q;  5HK3 A;  1Q81 U;  1ZSZ B;  2DIL A;  4II1 A;  2K3X A;  3I5R A;  3M0P A;  1VYU A;  2YDL A;  1YJN Q;  1NPP A;  5I2S A;  4XAX B;  5CQX A;  5GAN 3;  2F5K A;  5EG2 A;  4OGC A;  1AEY A;  1PRL C;  3V7S A;  1KC8 R;  4KH0 B;  1K73 C;  1GBR A;  3QYG B;  1GXI E;  1QKX A;  1WA7 A;  5GAM f;  2DTO A;  4PJO B;  2RHZ A;  2RQT A;  4C0G A;  2VB6 A;  4PJO F;  4OF1 A;  3EG9 A;  2CP5 A;  4OMM A;  3H8Z A;  2WSC E;  2K2M A;  4C8Q G;  1YIT Q;  4HCC A;  4F7U G;  2E3I A;  2NWM A;  4J9H A;  3OYI A;  4M75 E;  2MK5 A;  5LJ3 j;  1BKB A;  1C0M A;  3HP9 A;  2L3Q A;  1UDL A;  5C6S A;  2LT1 A;  3Q1J A;  4J9E A;  4M78 A;  1KD1 R;  2ZPG B;  4AFS C;  3CCM Q;  2RJF A;  1W70 A;  2QA4 A;  3OA6 A;  1D1C A;  1TUG B;  1JB0 E;  2A36 A;  2VKN A;  3CCE A;  1K1Z A;  1NM7 A;  1ZA1 B;  1YWP A;  2RJD A;  2E6Z A;  2LJ1 A;  1BCO A;  2JW4 A;  2YUO A;  3CXC S;  3EG3 A;  2YUP A;  1MHN A;  2M0O A;  3G71 T;  5DM7 R;  2FRW A;  1AVZ C;  5DY9 A;  5CKB A;  4F04 B;  5CO7 A;  1BI0 A;  3JB9 G;  2K3Y A;  4M75 F;  4ORZ A;  2K6D A;  3CBP A;  4E7J A;  4E7Z A;  3VS1 A;  3RIR A;  1KC8 U;  2DBK A;  1W4S A;  3OYC A;  3HRU A;  1XJW B;  3N5B B;  3VS0 A;  3JCM P;  2AKL A;  4C92 F;  4X1V A;  1V1C A;  3CCJ A;  2E70 A;  4XU1 A;  4JRI A;  4HKE A;  3M54 A;  3DB4 A;  1QP2 A;  4C0F A;  4M7A D;  2I0N A;  3GOX A;  1WGS A;  2G3R A;  3H0H A;  2P0Q A;  9ATC B;  1VQ7 T;  3CCJ T;  5KE3 A;  2NUT B;  1KC8 C;  2RHY A;  1B07 A;  3MP8 A;  2YRV A;  4E7H A;  2HAX A;  4E7L A;  4PKC C;  1QMC A;  2VGN A;  5J3B A;  5HCK A;  1YJW Q;  1I5O B;  2O88 A;  3CCQ Q;  4IIM A;  4N0A A;  4EMH A;  3CCV T;  2CH4 W;  3ZBD A;  2EVR A;  1Q7Y U;  1QVG A;  4PL6 A;  3SEM A;  3FRN A;  1E7O A;  3OYF A;  2ATC B;  2KEA A;  3M58 A;  3HHT B;  4F7U F;  2OTL T;  1PD1 A;  2RI2 A;  2ROL A;  3EFS A;  3J80 E;  4Z02 A;  1Y0M A;  3MET A;  4J6Y A;  1IHV A;  2W0Z A;  1WQW A;  1FYN A;  5HY6 A;  2DZC A;  4F14 A;  2E41 A;  2FEI A;  2XG8 D;  4RTZ A;  3QHS A;  1FMK A;  5GMK h;  5GJW B;  2LMJ A;  1BB9 A;  3G7Z A;  4K11 A;  1W6X A;  3L2R A;  3EFO A;  2K4Y A;  3AT1 B;  1HJD A;  3CCL A;  3VYG A;  2QGG A;  3QII A;  3UF4 A;  1M1F A;  1X6O A;  2EGE A;  1VQ5 T;  3QUI A;  2DLP A;  3M56 A;  4F7U B;  3GBQ A;  3J81 E;  3GF5 A;  1ZUU A;  1YWO A;  1UFF A;  2EPD A;  2NLU A;  3CCU Q;  3OSS C;  2QA4 Q;  2COZ A;  1TSF A;  3I55 A;  1FMV A;  1N9S A;  2DL8 A;  1D3B B;  3NPF A;  2FZC B;  1N6A A;  3E2U A;  3URG A;  1IGQ A;  3CPW S;  1VQL Q;  1TOV A;  2KVQ G;  2PUO B;  4MZM A;  2OJ2 A;  1UJY A;  2COY A;  3JAM E;  1K73 U;  5KH6 A;  5FWC A;  3I5S A;  5CK9 A;  5GAM d;  3JB9 F;  1MND A;  5KYY B;  2OAW A;  2L2P A;  1D3B A;  4MZT A;  3UAT A;  1G3T A;  1R8O B;  2GTO A;  2AK5 A;  2EJF A;  2KBT A;  2Z0W A;  2JM8 A;  1U06 A;  1AT1 B;  5L23 A;  1M9S A;  4KT0 E;  1YJW T;  1M1K U;  3PT9 A;  4AT1 B;  3A8M B;  4GBQ A;  5CKD A;  3QDR B;  1K73 R;  2EYX A;  2ZPE B;  1VQP A;  5GAM e;  1AOJ A;  4R0K A;  2V26 A;  3CC7 T;  3C4S A;  3EG1 A;  1UEB A;  2K2V A;  4KGZ B;  3NGP A;  4RTU A;  2XKO C;  3QYH B;  4E47 A;  3H9N A;  1WHM A;  2YT6 A;  5D7U A;  1NJI U;  2FZK B;  5FU7 C;  1MMG A;  4BAC A;  2EQI A;  4HCK A;  2GQV A;  2KY9 A;  5GAN 5;  3MHX A;  4IUU A;  1KQ1 A;  3LW5 E;  3GP8 A;  5CIU A;  3PE0 A;  2F2X A;  1WHL A;  2O01 E;  5HK0 A;  3REA B;  3PIO A;  3EGD B;  1SG5 A;  4BI8 B;  1JBM A;  2OTL Q;  4BB7 A;  1KHI A;  1RLQ C;  4IUP A;  3VS5 A;  1ZUY A;  1ZA2 B;  4KGX B;  4J5Y A;  3CC7 A;  4RTW A;  1RAC B;  4M77 C;  1N9R A;  1B34 A;  5LJ5 g;  1VQ5 A;  2PNI A;  3EHR A;  1WHK A;  5GMK e;  3JB9 D;  1QVG S;  2V8K A;  2JNG A;  5J26 A;  1W2B P;  2E4H A;  1BI2 A;  3R6N A;  1B7T A;  2LRQ A;  1M1G A;  5LJ3 e;  2D6F A;  2R57 A;  4BUG A;  4PLL A;  4QW2 A;  2LQ8 A;  1E6G A;  1M30 A;  2K7A A;  3OYM A;  2VXF A;  2V8J A;  2DXB A;  4OB2 B;  3EH1 A;  4IUQ A;  4M78 F;  4OML A;  1PD0 A;  2W10 A;  1H3H A;  3CD6 A;  5GAN 8;  2ZPB B;  2VUB A;  1QP3 A;  4BI4 A;  4ZTF A;  1CKA A;  1TS9 A;  2D1X A;  4ZN3 A;  3PIP A;  2DEQ A;  1VQ6 A;  1YJN A;  2QQ9 A;  2JJ9 A;  3VUB A;  4O5V A;  2VYT A;  2ZPH B;  1S72 Q;  2PQW A;  2XDB A;  2AZV A;  3OYL A;  1KFZ A;  3HFO A;  5LJ5 d;  1VQN Q;  4M77 A;  2X3W D;  1ARK A;  2L3P A;  1NEG A;  2DYI A;  1N8R U;  3A98 A;  2RJE A;  3OS0 A;  1M2O A;  1QW1 A;  1VA7 A;  1ACM B;  1YI2 T;  4M77 F;  3VUZ A;  1G5V A;  5CKF A;  4V2S A;  3THK A;  3QJY A;  1YFN A;  4JS4 A;  2X4J A;  2F5T X;  4DEX A;  1UHC A;  2MWP A;  2FRY A;  2XD0 A;  3M57 A;  2DJQ A;  2LP5 A;  4DBQ A;  1VQK A;  1QWF A;  3HKS A;  2D0N A;  4BDY A;  2MOX A;  1KD1 C;  4XK8 E;  2HD0 A;  1VQN T;  3E1S A;  4D8K A;  3OMC A;  4LDW A;  3CCV A;  1LJO A;  1TTH B;  2L3R A;  3L2V A;  1Q81 R;  1IXD A;  4F16 A;  2XID A;  4ZGD B;  2EYW A;  2QAZ A;  5AYF A;  3CCS Q;  1Q7Y R;  1LCK A;  3X24 B;  1P92 A;  4JPB W;  1VQ8 T;  1CKB A;  5AT1 B;  4A4F A;  1BI1 A;  3P8B B;  4RKU E;  2DL3 A;  3CMA T;  3JB9 J;  2DF6 A;  2GBQ A;  1MMN A;  4FYX B;  3JCM c;  1KIK A;  2CSI A;  2YHT A;  4JZ3 A;  2LJ3 A;  2HSE B;  1IGU A;  1YIJ T;  4QVZ A;  3CC2 A;  1RAF B;  2J7I A;  4M78 G;  1Y96 A;  4ANJ A;  3FJP A;  3S6W A;  3TSZ A;  5A0D A;  2FZG B;  3A8L B;  2G6F X;  3G6E T;  1UTI A;  1MUZ A;  3X28 B;  2E12 A;  5I22 A;  4Y28 E;  2E5Q A;  5ECA A;  3CC7 Q;  4LXC A;  2DIQ A;  2M16 A;  2XHC A;  1M4Z A;  4PJN A;  1H3Z A;  3JCM d;  1QWE A;  5IHN A;  5I11 A;  3HSB A;  3CC2 T;  1JRI A;  3H0F A;  3IQL A;  2ENM A;  4BI3 A;  1KD1 U;  5GAN 7;  5CR2 A;  4PJJ A;  1X2Q A;  4HVW A;  5GAO l;  4C0D C;  1VQ9 T;  3MKD A;  2YWW A;  1YJ9 T;  3CCQ A;  4AFQ C;  3C94 A;  3G71 A;  3CCQ T;  1YJ9 A;  2EKH A;  5LJ5 f;  1VQ9 A;  1IHW A;  2PVO B;  2DYB A;  1X75 C;  1M1K C;  2K5I A;  3UPU A;  2R58 A;  2O9V A;  3MP6 A;  2L0A A;  2CUD A;  1U3O A;  4FU6 A;  2KAF A;  2EYZ A;  3S3O A;  3QPH A;  1JXM A;  2FHD A;  1HSQ A;  1K8A U;  2EWN A;  1ZX6 A;  4PK4 A;  2KGT A;  3G4S Q;  1OPK A;  4O6J A;  1QLY A;  2A7Y A;  1Y7X A;  3CME A;  2JUF A;  2GCX A;  2RHU A;  3SWN A;  2CGH A;  2P4R A;  4BDZ A;  1UGP B;  1M1K R;  1OPL A;  3JCM e;  4N0A C;  2CZ7 B;  3VV0 A;  1BK2 A;  4QVC A;  2VGM A;  2C0I A;  2QTV A;  2QG9 B;  5FW9 A;  2QDL A;  4OGE A;  3CMA Q;  1JO8 A;  4RCB A;  1OV3 A;  3QZ9 B;  3CEY A;  2V8I A;  3CXC A;  2LX7 A;  4EMK A;  3EGX B;  3VRZ A;  2LCL A;  5A0G A;  2DXT A;  1Q86 C;  1YIJ Q;  2DA9 A;  3NTH A;  1PKS A;  2HBW A;  2LCS A;  1IO6 A;  1NLP C;  3KUF A;  4KUL A;  2M9U A;  3RKY A;  2KMT A;  4OMQ A;  3EHQ A;  5KYU A;  4L59 A;  3ZL7 C;  4ZTJ A;  4C8Q B;  4CC2 A;  1YJN T;  3SHW A;  2DKG A;  5FRO A;  2F2W A;  2DPP B;  2KQW A;  3CCJ Q;  2ED1 A;  4OMO A;  4ZNX A;  1SF9 A;  2KSS A;  3OYD A;  4Z89 A;  1UJ0 A;  1R0C B;  2BE7 D;  4LN2 A;  2XDD A;  1QCN A;  4PJO D;  1Q7Y C;  2D9T A;  2O4X A;  4Y92 A;  1X69 A;  3LLR A;  5FU7 B;  3ZEH A;  1VQO T;  3M0R A;  1SRM A;  2FVU A;  3QG1 A;  3CC2 Q;  3E19 A;  5I2M A;  2JTE A;  1YCY A;  2HQX A;  2QQA A;  1OUL A;  1U1T A;  1Z9Z A;  2CUB A;  1QCO A;  1BU1 A;  3I56 T;  1WZO A;  1D0Z A;  2BZY A;  2QAS A;  5A2Q E;  1BCM A;  3ULR B;  5A0L A;  3R6O A;  1SSH A;  4M7D E;  3E9G A;  4X9C A;  3QWX X;  3I56 A;  3EGX A;  4M77 D;  2E6N A;  2KRO A;  2DRK A;  2C0T A;  2E3H A;  4PJL A;  4QVD A;  2F2V A;  1JJ2 P;  3P8D A;  4IUT A;  2ECZ A;  2LT4 A;  1VQM T;  4JJC A;  3C12 A;  1AWW A;  4C92 A;  2VAS A;  2DVJ A;  4ELY C;  4HT8 A;  5KCO A;  1TG0 A;  2BKD N;  2PVG B;  3EG2 A;  2KK4 A;  2HNI A;  4WCI A;  2XIC A;  1M8V A;  2EW3 A;  3G1J A;  3LWH A;  4N4G A;  1FXX A;  5CQY A;  4M7A C;  1JJ2 A;  4A4H A;  1QVF P;  2KNB B;  5CVI A;  3VS7 A;  1FX7 A;  2J6K A;  2BZ8 A;  4KRT A;  2H3E B;  4J6W A;  1DJ7 B;  2HKN A;  3EAE A;  1EZZ B;  1G2B A;  1I1J A;  5IN1 A;  3NFC A;  3OYN A;  2XMF A;  3GNF B;  1VQL A;  3HRS A;  4ATO A;  4R55 A;  3UA7 A;  1WHG A;  2MWO A;  5LJ5 h;  2F69 A;  5GAM g;  4JRP A;  1VOM A;  2HSP A;  3OMG A;  1KQ2 A;  1V29 B;  1TH7 A;  2EYY A;  4XQ3 A;  5J39 A;  1VQO Q;  1Q86 U;  2FPE A;  4ELZ C;  1RAH B;  4M7D B;  4RTV A;  3J7A F;  3CCE Q;  3LGF A;  4HCZ A;  1WPY A;  4J7I A;  1LVK A;  2R5A A;  2KE9 A;  2E10 A;  3RKW A;  5GAN d;  5GMK j;  3HRT A;  3MEV A;  2CZ6 B;  3JCM V;  3M0U A;  2DMO A;  5DLO A;  4NL3 A;  1YHQ T;  2NUP B;  5GAO m;  2YSQ A;  1OZ3 A;  4XU3 A;  2Y90 A;  2KT8 A;  3UT1 A;  2DFU A;  1K0S A;  1QQJ A;  5IHI A;  4KGV B;  1ZBJ A;  2VV5 A;  1PSF A;  3BDL A;  2RH2 A;  4DEY A;  2FB7 A;  5GAO p;  1VQK Q;  3EH2 A;  1K4U S;  1OYX A;  1K9M U;  2K79 A;  4M7A B;  2EBP A;  4A4G A;  3JRZ A;  1NYG A;  1BYM A;  5GAN 2;  4KUI A;  1XOV A;  2E5K A;  2DER A;  1QVF S;  3OW2 S;  1X2K A;  2JZ2 A;  4A53 A;  1I81 A;  4OMP A;  3FDR A;  4J9D A;  3L42 A;  5LJ3 h;  2MCN A;  4JJD A;  3CXC P;  2OTL A;  1EX4 A;  1T0J A;  2DJZ A;  4M77 G;  1TXQ A;  3L2W A;  1K9M R;  1PWT A;  3CPF A;  2X51 A;  5LJ3 g;  4FW1 A;  4QKU A;  4RCC A;  3V7C A;  3QXE B;  2FYK A;  5GAN e;  5FU6 B;  1Q86 R;  2SRC A;  2DRM A;  4IUR A;  1G3Y A;  3PGG A;  3AHU A;  3OYE A;  2ZAE A;  3ASK A;  2RPN A;  4Z88 A;  1JU5 C;  3OYJ A;  2AT1 B;  2I2L A;  1KHC A;  4PJO E;  2AHJ B;  3HL8 A;  5KCH A;  2VWF A;  3RUX A;  5DLQ E;  4RUG A;  2GGR A;  3HFN A;  1LPL A;  3MEA A;  4FL6 A;  2BUD A;  3NMZ C;  8AT1 B;  3OYH A;  1WX6 A;  3TRE A;  4J9I A;  2LTO A;  2LX9 A;  2OX7 A;  1GRI A;  1MV0 B;  2AKK A;  4MMK A;  4M7D A;  2HMA A;  4JUV A;  3A1P A;  1VQ9 Q;  4JZ4 A;  1M90 C;  4MDX A;  2DTH A;  2PVD B;  4AFZ C;  1IB8 A;  1N5Z A;  4JDS A;  4RTX A;  3RMS A;  1VQN A;  3CBM A;  2DXC A;  5GMK i;  3JCM W;  4M75 D;  1VQ7 A;  2KT1 A;  4DA4 A;  3M4G A;  1SEM A;  4WF2 A;  2XDP A;  4ESR A;  2RHX A;  3E9F A;  2M02 A;  4RTT A;  1M5Q 1;  2NUT A;  1N8R C;  3I35 A;  1VQ4 Q;  4NS5 A;  3WXM B;  4PJO A;  1M2V B;  2JTM A;  3JB9 I;  4M78 E;  4AMC A;  3RDV A;  2DNU A;  3G4S A;  3OY9 A;  4BE0 A;  4JRQ A;  4XTV A;  2QA4 T;  4MML A;  4HVU A;  4ME7 A;  1YI2 A;  4E7S A;  3MCA B;  4FSS A;  2PZ1 A;  2XI9 A;  4C5E A;  1J3T A;  2E1H A;  2FPD A;  3VS3 A;  4FT2 A;  2OI3 A;  3VRY A;  1OX9 A;  2MF2 A;  2X4X A;  2AZS A;  4JLG A;  2M0Y A;  2RA2 A;  4A4K A;  1ZBX A;  2KYM A;  5KYX A;  2H8H A;  4M7D G;  2GNC A;  1JXO A;  2RJC A;  3C0C A;  4QQ6 A;  1X6G A;  3RBB B;  5D6Y A;  1WHH A;  3OB9 A;  1MMD A;  3DB3 A;  2OAU A;  4HVV A;  3LYI A;  2EQM A;  3CCS A;  5LJ3 d;  1RI9 A;  2FG0 A;  4RG2 A;  1VQ6 T;  2K3B A;  2PU9 B;  1YBY A;  2HQE A;  2A0F B;  2JMA A;  2HKQ B;  1D0X A;  1NE8 A;  4IIO A;  3JSC A;  4GLK A;  3CD6 T;  3A8G B;  2QGF B;  4C92 D;  2LCC A;  2KXC A;  1ZSZ C;  3L2Q A;  2J6F A;  1RUW A;  3NTI A;  4PLI A;  1M3A A;  2Y4Y A;  4M75 G;  2DET A;  1XTD A;  2QQR A;  5GAO q;  3EG9 B;  2YLC A;  2MMP A;  1NPR A;  4DQ2 A;  1PKT A;  2CT4 A;  4M7A F;  2VC8 A;  4EMG A;  1PM3 A;  1WNL A;  2A3L A;  1AWO A;  2QDY B;  3JCM h;  1G8X A;  5IH2 A;  5EC7 A;  2X3X D;  4OMN A;  3JCM J;  1HD3 A;  1H64 1;  4J9G A;  3TEE A;  1WJS A;  2YXY A;  2X35 A;  1WI7 A;  1ABO A;  1ZUK A;  4C92 G;  1D1A A;  2A28 A;  5LJ3 f;  2PUK B;  1CSK A;  5GAN 6;  5GMK l;  3L1A A;  1TWB A;  1VQ5 Q;  1BI3 A;  2V1R A;  4XU0 A;  5FLX E;  3I56 Q;  1N27 A;  3OQ5 A;  4XTW A;  3VYH B;  2CP7 A;  2DD5 A;  4BE1 A;  2DEU A;  2D0Q B;  4GLM A;  2C06 A;  2KR3 A;  1AHJ B;  3M53 A;  4ZGJ B;  2CDT A;  1RL2 A;  1QKW A;  4N4H A;  4PJM A;  3QKJ A;  1YHQ Q;  2QQS A;  5KYW A;  8ATC B;  4RMO A;  1WXB A;  4UC4 A;  2FPF A;  3LH0 A;  2JS0 A;  3OBY A;  2MPX C;  1SKU B;  2ESW A;  3FEO A;  4R56 A;  4AG1 C;  1Y71 A;  5FRM A;  1VQ6 Q;  1AZG B;  4E7K A;  2A08 A;  1M27 C;  2QEX A;  4KUD K;  1OOT A;  3OYY A;  3CMA A;  2DM1 A;  2GTJ A;  2R5M A;  2HQH A;  1T3L A;  2CZ0 B;  4B6M A;  1S72 A;  4EMK C;  4A63 B;  3EGD A;  1OQK A;  1OEB A;  3PFS A;  1VQ8 A;  1D09 B;  3CCM T;  4WTO B;  4LUE A;  3LH5 A;  4L5G A;  3M55 A;  4F17 A;  5KYY A;  3CCR A;  1YP5 A;  4LNP A;  2RK1 A;  5FWB A;  1PG5 B;  3M4Y A;  4C0Z A;  1UG1 A;  2EQK A;  3H0I A;  4FIB A;  1M90 U;  3OW2 P;  4J9B A;  1NG2 A;  2HBP A;  1KQS P;  1JEG A;  1EIF A;  3OSV A;  3MPU B;  4DBH A;  3PMT A;  2M51 A;  3OS1 A;  1Q95 G;  2KDS A;  1VQO A;  2RI3 A;  4DBF A;  1WDX A;  1RAD B;  5GAN h;  4QQD A;  3FLG A;  1FMW A;  4YTL A;  2SEM A;  1VYV A;  5M9O A;  4QT7 A;  2RHI A;  4LD9 K;  1M90 R;  3M0Q A;  1HYO A;  4HA8 A;  4LDV A;  3BFM A;  4E6R A;  2P84 A;  2MYS A;  6AT1 B;  2JOY A;  3JCM f;  5KE2 A;  1PC0 A;  2IG0 A;  4LD6 A;  5D6X A;  4FW2 A;  4M75 B;  4JJN K;  2NUP A;  3NHN A;  2D8J A;  2B86 A;  1FWZ A;  2RNA A;  2EQU A;  1T0H A;  4JS5 A;  3O8V A;  4LDU A;  2VXE A;  3F70 A;  3TU4 K;  2E64 A;  1B34 B;  2K57 A;  4Q5W A;  2BIV A;  2CP3 A;  2YUN A;  2DO3 A;  4M75 C;  3MJX A;  2X9H A;  4E2F B;  5FU6 C;  4EPC A;  4PFO A;  2HDA A;  3QDF A;  4BD3 A;  4XTZ A;  3VS2 A;  3VU3 C;  1OU9 A;  1B3Q A;  4JLI A;  2VVK A;  3ME9 A;  1WIE A;  3JCM X;  3FIF A;  4Y91 A;  1K9M C;  1I8F A;  1ZQ1 A;  2QEX T;  2HL5 C;  4J9F A;  2NUZ A;  2EAY A;  2CT3 A;  1AD5 A;  4GY5 A;  3TSW A;  1C1A A;  3MEW A;  3QSU A;  4C8Q D;  2GF7 A;  3G71 Q;  1MV3 A;  1YJ9 Q;  2X4Y A;  1VIE A;  1VQM Q;  5CAI A;  3JV3 A;  3EG0 A;  3CPW P;  1KSW A;  1K8A R;  2X4W A;  5I21 A;  5KYN A;  4J6X A;  5IXF A;  2ZCF B;  4FT4 A;  1QVG P;  1SSF A;  3OS2 A;  2QI2 A;  3C95 A;  4A54 A;  2QEX Q;  1Q82 U;  1O9S A;  3SWN C;  1Y57 A;  1LOJ A;  1UB4 A;  4AFU C;  1C6V X;  3CME Q;  4N4I A;  1VQ8 Q;  1MGQ A;  3S3N A;  1PCX A;  4C8Q C;  4Z8A A;  5IT9 E;  3QJ6 A;  3OYB A;  4CC4 B;  3I55 Q;  4JJB A;  2JS2 A;  1VQ7 Q;  3ER0 A;  2P0P A;  1AZE A;  3GNG A;  1H8K A;  4C8Q E;  2EGC A;  5GAN j;  1WQ7 A;  1ZLM A;  3LGL A;  2KXD A;  3G6E A;  3VS4 A;  1Q82 C;  2YRC A;  2BZX A;  5LJ5 j;  2D8H A;  1YI2 Q;  3HTR A;  4FYV B;  3RNJ A;  3DKM A;  1YIJ A;  2MIO A;  5HKC A;  4LDY A;  2JN0 A;  1LNX A;  3QWY A;  1A0N B;  4M7D F;  3OYG A;  1M2V A;  3KFV A;  3PVQ A;  1KG1 A;  1NBE B;  3RMQ A;  2ZGW A;  1AWJ A;  3CCU T;  4PFZ A;  3HPW A;  3TCJ A;  1RI0 A;  2B8A A;  2DE0 X;  4ZN1 A;  4X9D A;  1Q81 C;  2V1Q A;  1D1B A;  1R0B G;  2JTF A;  4C5I A;  3DLM A;  4JRK A;  2EYQ A;  5GJV B;  4RG8 A;  5KYX B;  3VJP A;  2Y4X A;  3OYA A;  1K8A C;  2RM4 A;  3A5Z B;  2K5F A;  4NOY A;  1NJI R;  2XU8 A;  1VQK T;  1OX8 A;  2DL4 A;  2OTJ A;  1XQH A;  4LDX A;  3REB B;  2JXB A;  2P4T A;  2EGA A;  2HZY A;  1VQ4 T;  2KYB A;  1TUD A;  4DOV A;  4PJO G;  4OMF B;  2RO0 A;  2HL3 A;  1U1S A;  1WJR A;  2EQJ A;  3FJ5 A;  2O4X B;  2ABL A;  1UGR B;  3MEU A;  2COW A;  1I0C A;  2CSQ A;  2O9S A;  4L6V 5;  3CC4 T;  2DVE A;  2RI5 A;  1UGV A;  4M7A E;  4FSX A;  1UGS B;  4M7A G;  2XK0 A;  2J05 A;  7AT1 B;  1ZSG A;  4LE9 A;  3CCS T;  2EIF A;  2LQK A;  3H6Z A;  2O31 A;  3BE3 A;  1X27 A;  1ZHI A;  5KYU B;  4DBR A;  4E7I A;  2KRS A;  3UDC A;  4P5N A;  4IUV A;  3WVD B;  1U5S A;  3PNW C;  3JCM b;  3PVL A;  3GIB A;  4BY6 C;  2RQR A;  3TVT A;  2RB6 A;  2JM9 A;  1YN8 A;  2ED0 A;  1MMA A;  5CKE A;  3UWN A;  1VYT A;  2EFI A;  3CC4 A;  3CQT A;  1RLP C;  1V76 A;  3UA6 A;  2RMO A;  1XNI A;  1NLO C;  1GCP A;  1IZ6 A;  1YIT A;  4M7D C;  1GL5 A;  3DLL A;  4XTU A;  2BE9 B;  4FYY B;  1K0X A;  1UHF A;  2E65 A;  1VQ4 A;  3G4S T;  2CH4 A;  1IRX A;  4HT9 A;  3VS6 A;  2K9G A;  2C0O A;  1OI1 A;  4X34 A;  5IHK A;  3M0T A;  3O5Z A;  3JCM g;  4CI0 C;  2QK0 A;  1PNJ A;  1YCS B;  1RAB B;  2FO0 A;  1PRM C;  4TVR A;  3OYK A;  5GAN f;  4EMK B;  1VIF A;  1YNZ A;  1Y96 B;  3A8O B;  3CCL Q;  4VUB A;  2YUQ A;  3JCM Q;  1RAE B;  1AWX A;  2YLB A;  1K9A A;  2LZ6 B;  2RQV A;  2ZZD A;  4A4E A;  3G6E Q;  1SHG A;  1N8R R;  2QXF A;  2CP6 A;  1IRE B;  1K76 A;  2P0K A;  3CCU A;  2JVV A;  3OBW A;  2ZPF B;  1JJ2 S;  4FYW B;  1I5L A;  5CKH A;  3BDU A;  5LL6 S;  5C0M A;  3SFM A;  1H92 A;  5GAN 4;  5GAM h;  1TUC A;  3X20 B;  2QYZ A;  2CKK A;  1WLP B;  4FCY A;  2IPO B;  4B9W A;  2KRM A;  1Y07 A;  3U23 A;  1X43 A;  3M9Q A;  1HXD A;  3SDZ A;  2EJ9 A;  2RD1 A;  1UE9 A;  4CRI A;  4IKF A;  2LDM A;  3H41 A;  2CZ1 B;  1SPK A;  4C8Q A;  4XU2 A;  1MNE A;  2GQI A;  3BW1 A;  3P8H A;  1QVP A;  5D6W A;  1T3S A;  4F7U A;  3L2Z A;  1KK7 A;  1VQP Q;  2WSE E;  1F1B B;  4OP0 A;  3X26 B;  4DOW A;  5FRN A;  3V8K A;  3QBY A;  3MO8 A;  3FB9 A;  2OTJ Q;  5GAO n;  2F1L A;  1W2B S;  5IAY A;  2NYS A;  4M78 D;  2DIG A;  4C8Q F;  3CPW A;  3A8H B;  2BTT A;  4QQG A;  2L5Q A;  3D7S B;  1KQS A;  3M59 A;  4MZP A;  1HK9 A;  4C5H A;  1QVF A;  2CS7 A;  2J06 A;  3V8L A;  4J9C A;  1GFD A;  2YRD A;  3LWI A;  2CRE A;  1S1N A;  3LX7 A;  1NEB A;  5KYW B;  1RAG B;  3I55 T;  2L8D A;  2JT4 A;  2DBM A;  4ZGE B;  1QCF A;  2RQW A;  2LC4 A;  2CP2 A;  2LQN A;  1U8R A;  4OB3 B; 
#chains in the Genus database with same CATH homology
 2L2P A;  1M3C A;  2M51 A;  1WXU A;  3UAT A;  2ECZ A;  4CC3 A;  3M0S A;  2GTO A;  4JJC A;  5IXB A;  1AWW A;  1WDX A;  2AK5 A;  2KBT A;  2JM8 A;  1U06 A;  2DVJ A;  2HEQ A;  5L23 A;  1BBZ A;  2RQU A;  1TG0 A;  1GFC A;  2SEM A;  1VYV A;  3EG2 A;  4GBQ A;  4QT7 A;  2EYX A;  4WCI A;  3M0Q A;  1AOJ A;  4RTY A;  4R0K A;  2J6O A;  3EG1 A;  2EW3 A;  3NGP A;  4RTU A;  4E6R A;  1PHT A;  1WXT A;  2KNB B;  2YT6 A;  3I9Q A;  3VS7 A;  2J6K A;  2BZ8 A;  2EQI A;  4HCK A;  4KRT A;  3NHN A;  2D8J A;  2B86 A;  3PE0 A;  1G2B A;  1I1J A;  2F2X A;  2RNA A;  1T0H A;  2XMF A;  3REA B;  2DL7 A;  2A37 A;  2JMC A;  1Z9Q A;  3UA7 A;  2YUN A;  4D8D A;  1RLQ C;  2PTK A;  3VS5 A;  1ZUY A;  2HCK A;  1WFW A;  2HSP A;  2HDA A;  4RTW A;  3VS2 A;  2EYY A;  2KRN A;  2FPE A;  1B3Q A;  4CC7 A;  2DL5 A;  2PNI A;  2VVK A;  4RTV A;  1WIE A;  1JQQ A;  3EHR A;  2KE9 A;  4J9F A;  2L3S A;  2NUZ A;  3M0U A;  2DMO A;  4M4Z A;  1G83 A;  3R6N A;  2CT3 A;  2YSQ A;  1AD5 A;  3TSW A;  1UUE A;  2KT8 A;  1MV3 A;  1K0S A;  1E6G A;  1M30 A;  2K7A A;  4LUD A;  5IHI A;  4AG2 C;  1GBQ A;  4HXJ A;  1ZBJ A;  4DEY A;  1GCQ C;  3EG0 A;  3JV3 A;  4OML A;  2W10 A;  1H3H A;  1E6H A;  1KSW A;  1K4U S;  2K79 A;  4EIK A;  1CKA A;  1WYX A;  2EBP A;  2D1X A;  1NYG A;  5IXF A;  1KJW A;  1XOV A;  2E5K A;  1X2K A;  2ROT A;  4OMP A;  4J9D A;  1Y57 A;  2MCN A;  4JJD A;  4AFU C;  1T0J A;  3EGU A;  2AZV A;  1KFZ A;  1PWT A;  4Z8A A;  2O2O A;  2X3W D;  4CC4 B;  1ARK A;  2L3P A;  4JJB A;  2JS2 A;  2RF0 A;  1I07 A;  1AZE A;  1NEG A;  1H8K A;  3A98 A;  2EGC A;  2SRC A;  1VA7 A;  1M3B A;  2DRM A;  1NYF A;  1ZLM A;  2IIM A;  2KXD A;  1UEC A;  1X6B A;  3THK A;  2RPN A;  4Z88 A;  1ABQ A;  1JU5 C;  1SHF A;  2DX1 A;  3VS4 A;  2RN8 A;  1GCQ A;  2BZX A;  2D8H A;  3RNJ A;  1M8M A;  2LJ0 A;  4DEX A;  2MIO A;  2LQW A;  1UHC A;  2FRY A;  1W1F A;  2VWF A;  1EFN A;  1SRL A;  2LNH B;  2DJQ A;  2LP5 A;  3QWY A;  1A0N B;  1QWF A;  4RUG A;  2D0N A;  2GGR A;  2MOX A;  2DIL A;  3I5R A;  3KFV A;  3NMZ C;  3PVQ A;  4D8K A;  3M0P A;  1VYU A;  2YDL A;  1WX6 A;  1AWJ A;  4J9I A;  1GRI A;  1MV0 B;  2AKK A;  4F16 A;  2DE0 X;  2V1Q A;  2EYW A;  1AEY A;  1LCK A;  1PRL C;  4JZ4 A;  1GBR A;  5GJV B;  4JPB W;  1QKX A;  1WA7 A;  1CKB A;  1N5Z A;  4AFZ C;  4RTX A;  2RQT A;  2DL3 A;  2KT1 A;  2DF6 A;  4OMM A;  2GBQ A;  1SEM A;  2K2M A;  1KIK A;  2CSI A;  2DL4 A;  4JZ3 A;  2LJ3 A;  4ESR A;  4RTT A;  3REB B;  2JXB A;  2EGA A;  2NWM A;  3I35 A;  4J9H A;  2J7I A;  2DNU A;  2KYB A;  3TSZ A;  2L3Q A;  1UDL A;  1TUD A;  2G6F X;  1UTI A;  1MUZ A;  4J9E A;  4HVU A;  5I22 A;  4AFS C;  5ECA A;  3FJ5 A;  1W70 A;  4FSS A;  2PZ1 A;  2ABL A;  1J3T A;  2FPD A;  3VS3 A;  1I0C A;  2A36 A;  1QWE A;  2CSQ A;  2O9S A;  5IHN A;  2OI3 A;  5I11 A;  3VRY A;  2VKN A;  1K1Z A;  1NM7 A;  1UGV A;  1YWP A;  3H0F A;  3IQL A;  2AZS A;  2ENM A;  2M0Y A;  2LJ1 A;  2KYM A;  2H8H A;  1X2Q A;  2GNC A;  1JXO A;  2J05 A;  1ZSG A;  2JW4 A;  2YUO A;  4HVW A;  3C0C A;  4LE9 A;  1X6G A;  3RBB B;  2O31 A;  3EG3 A;  1X27 A;  2YUP A;  4AFQ C;  4HVV A;  2FRW A;  2KRS A;  1AVZ C;  1U5S A;  2EKH A;  1RI9 A;  3PVL A;  2FG0 A;  2DYB A;  2K3B A;  4ORZ A;  2K6D A;  2RQR A;  3TVT A;  2JMA A;  3VS1 A;  2JM9 A;  2O9V A;  1YN8 A;  2L0A A;  2ED0 A;  4IIO A;  1VYT A;  2DBK A;  3CQT A;  2CUD A;  1RLP C;  1U3O A;  3UA6 A;  2RMO A;  2EYZ A;  1NLO C;  3VS0 A;  1GCP A;  2KXC A;  2AKL A;  2J6F A;  1GL5 A;  1RUW A;  4X1V A;  1JXM A;  1V1C A;  1K0X A;  1HSQ A;  1M3A A;  1UHF A;  1ZX6 A;  2KGT A;  1OPK A;  2CH4 A;  1QLY A;  3VS6 A;  2K9G A;  2C0O A;  2I0N A;  5IHK A;  3M0T A;  3O5Z A;  1PKT A;  2CT4 A;  2P4R A;  1PNJ A;  1YCS B;  3H0H A;  1OPL A;  2FO0 A;  1PRM C;  1AWO A;  1YNZ A;  1B07 A;  1BK2 A;  2YUQ A;  2C0I A;  1AWX A;  5IH2 A;  1K9A A;  2LZ6 B;  2X3X D;  2RQV A;  5EC7 A;  5FW9 A;  2QDL A;  4OMN A;  1JO8 A;  1HD3 A;  4J9G A;  1OV3 A;  5HCK A;  1SHG A;  2O88 A;  4IIM A;  1WI7 A;  2LX7 A;  1ABO A;  1ZUK A;  3VRZ A;  2A28 A;  1K76 A;  1CSK A;  2DA9 A;  2CH4 W;  2EVR A;  1PKS A;  2HBW A;  3SEM A;  2LCS A;  1E7O A;  2KEA A;  1IO6 A;  2V1R A;  1NLP C;  1H92 A;  4OMQ A;  3EHQ A;  1TUC A;  3ZL7 C;  4CC2 A;  1WLP B;  2ROL A;  3SHW A;  2KRM A;  3U23 A;  1X43 A;  1Y0M A;  2F2W A;  4GLM A;  2W0Z A;  2KR3 A;  1FYN A;  2ED1 A;  2CDT A;  1UE9 A;  1QKW A;  4OMO A;  4ZNX A;  3H41 A;  4F14 A;  1SPK A;  2FEI A;  4RTZ A;  4Z89 A;  1UJ0 A;  1FMK A;  4LN2 A;  1WXB A;  2GQI A;  2FPF A;  5GJW B;  2LMJ A;  1T3S A;  1BB9 A;  2JS0 A;  4K11 A;  1W6X A;  2ESW A;  4AG1 C;  1AZG B;  1X69 A;  4Y92 A;  1HJD A;  2A08 A;  1SRM A;  3M0R A;  1M27 C;  1OOT A;  3UF4 A;  2DM1 A;  2BTT A;  2GTJ A;  2EGE A;  1T3L A;  2JTE A;  4A63 B;  2DLP A;  1OEB A;  3GBQ A;  1ZUU A;  1YWO A;  1UFF A;  2EPD A;  1Z9Z A;  2CUB A;  2J06 A;  4LUE A;  1BU1 A;  3LH5 A;  4J9C A;  2BZY A;  4F17 A;  1GFD A;  2DL8 A;  3ULR B;  1YP5 A;  3NPF A;  4LNP A;  2CRE A;  5FWB A;  1S1N A;  1UG1 A;  1SSH A;  1NEB A;  2OJ2 A;  2JT4 A;  1UJY A;  3QWX X;  3H0I A;  2DBM A;  2KRO A;  2DRK A;  1QCF A;  2RQW A;  2C0T A;  2LQN A;  5FWC A;  3I5S A;  4J9B A;  1NG2 A;  1JEG A;  2F2V A;  2OAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...