3M0TA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 9.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
b'KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
molecule keywords Spectrin alpha chain, brain
source organism Gallus gallus
molecule tags Signaling protein
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0tA00
2L3SA 2MCNA 1E6GA 2KEAA 4RTWA 2A08A 3VS2A 1WFWA 2MOXA 3EHQA 2KRNA 4HXJA 3THKA 2DL7A 1V1CA 2DL5A 3H0HA 1KSWA 1NLPC 2J6KA 1YP5A 2EW3A 1BU1A 2L0AA 4RTVA 4OMPA 5I22A 2NWMA 2K3BA 1AWJA 1MUZA 1KIKA 4LUDA 4LNPA 3EG0A 2G6FX 1AWOA 1WDXA 2V1QA 2YUQA 2ED0A 2MIOA 2FEIA 2BZYA 2M0YA 1W1FA 2ECZA 1U5SA 1WA7A 1WXUA 2OAWA 4IIOA 2LMJA 2CUDA 1UJYA 3GBQA 2RQVA 1PRLC 2DL4A 1TUCA 2DM1A 2IIMA 2YUOA 4J9FA 4K11A 4AG2C 3U23A 5I11A 2PNIA 2KT1A 3REAB 4J9GA 4ESRA 4JJBA 1I0CA 3A98A 2YUNA 2CT3A 2RQUA 3TVTA 3VRYA 3EGUA 1EFNA 5GJVB 1ZLMA 1UTIA 2EVRA 1WXBA 1ABQA 2XMFA 2RN8A 2KYBA 2AKKA 3VS6A 1M3CA 1SHFA 3EHRA 3M0QA 2FRWA 4J9EA 2JS0A 2QDLA 5GJWB 4LUEA 1NYGA 1PKTA 3FJ5A 3EG1A 3SEMA 2FPEA 2EGEA 2M51A 4Z88A 1ZX6A 2JW4A 5FWCA 4OMQA 1BB9A 3M0PA 3LH5A 2CDTA 4RTZA 1PHTA 4HVVA 4IIMA 1LCKA 2D8HA 2D1XA 2JS2A 2RQWA 4EIKA 4GLMA 1QKWA 2AK5A 3JV3A 2KNBB 1E7OA 1OV3A 2VWFA 1SRLA 1YNZA 2O9SA 3TSWA 5FWBA 2J7IA 1JU5C 3EG3A 2C0IA 2L3QA 2DL8A 3UA6A 5EC7A 4CC4B 2E5KA 1WX6A 1GCQA 1TG0A 5HCKA 2JT4A 2KR3A 2YUPA 2FPDA 1NEGA 2JXBA 3VS4A 2RPNA 2EYWA 3M0RA 5FW9A 2P4RA 3IQLA 1CKBA 2CH4W 2PZ1A 2OJ2A 1VYVA 2AZVA 5IXBA 1HD3A 1QCFA 1E6HA 2DMOA 3QWXX 2DL3A 1M27C 4J9CA 1VYTA 3O5ZA 2KGTA 2JM9A 1M30A 3PE0A 1X27A 2DA9A 2EBPA 2LZ6B 2GTOA 1OOTA 4M4ZA 1G2BA 1SHGA 1FYNA 1N5ZA 1NLOC 4RUGA 1QWEA 1K1ZA 3UA7A 2RNAA 1AEYA 1JO8A 1AZEA 1K76A 2LJ1A 2V1RA 4JJCA 2J05A 4ORZA 1S1NA 1WLPB 3PVQA 4GBQA 3UF4A 1ARKA 1ABOA 2CSQA 1GRIA 2LQNA 4Y92A 4KRTA 1GCQC 1X6BA 4F17A 4DEYA 2FG0A 4Z8AA 1UG1A 4J9IA 2PTKA 2DILA 2RQRA 1VA7A 2GTJA 1JQQA 5IHNA 2ROTA 2YT6A 1W6XA 1JXMA 4R0KA 2KT8A 3R6NA 2EYZA 5IH2A 2W10A 3TSZA 3NMZC 1KJWA 3VS7A 4DEXA 1W70A 2EPDA 2L2PA 1GBQA 1H8KA 1ZUUA 1AWXA 3CQTA 1Z9QA 2VKNA 1UE9A 1X2QA 2BTTA 2C0TA 1K0SA 2CREA 1GL5A 2LJ0A 2ENMA 1RLPC 1Y0MA 2FRYA 2F2VA 2O88A 1I1JA 1B07A 3VS3A 1UHCA 3NPFA 2K79A 1NM7A 1PNJA 1UDLA 4WCIA 3VS0A 1HSQA 1AOJA 2JMCA 2DRMA 1UUEA 1SEMA 4D8DA 1QWFA 1OPKA 3ZL7C 2I0NA 1XOVA 4JJDA 1BBZA 1U06A 1OPLA 1YWOA 2GQIA 1RUWA 2H8HA 1AWWA 2EYYA 2EGAA 1YCSB 2DF6A 2JM8A 1NEBA 2KXCA 1H3HA 4ZNXA 4HCKA 4J9DA 2HBWA 2D0NA 3H0FA 2KROA 1OEBA 1Y57A 1X6GA 2AKLA 1FMKA 2KYMA 2YSQA 2A28A 2VVKA 3I5SA 4OMMA 1UECA 1RI9A 1I07A 1M3BA 2DE0X 4A63B 2DRKA 2ESWA 1T0HA 4AFZC 3KFVA 4HVUA 1QLYA 2L3PA 2ROLA 3ULRB 2A36A 2BZXA 1K0XA 3I9QA 1KFZA 2KE9A 2KRMA 2JMAA 3EG2A 2J06A 2LQWA 2HEQA 3UATA 4RTXA 4RTTA 2SRCA 1ZBJA 1SPKA 4CC3A 2SEMA 3RNJA 2GBQA 2K9GA 1IO6A 4AFQC 1NG2A 1UHFA 1TUDA 2J6FA 2EKHA 4RTYA 2KBTA 1ZSGA 1UJ0A 1GCPA 1VYUA 2LJ3A 4CC7A 1GFDA 3M0SA 1AVZC 2GNCA 4JPBW 2DNUA 1CSKA 5IXFA 2DYBA 4J9BA 2BZ8A 2EQIA 4OMOA 4D8KA 1PRMC 2LNHB 2J6OA 1AD5A 2DBKA 2HSPA 2X3WD 4RTUA 2HDAA 4CC2A 1G83A 3RBBB 3NGPA 1WYXA 1AZGB 2DLPA 1T3LA 2JTEA 3VS1A 1PKSA 4AFSC 4JZ4A 3QWYA 2KXDA 3C0CA 2OI3A 1A0NB 1H92A 1NYFA 4JZ3A 1JXOA 1T0JA 3PVLA 2RQTA 1X43A 3M0UA 2O31A 1K4US 2DVJA 2CT4A 4J9HA 3M0TA 1JEGA 1SRMA 1UGVA 1PWTA 1J3TA 1Z9ZA 2O9VA 4AG1C 2ED1A 4Z89A 1WXTA 2RMOA 2CH4A 2RF0A 5L23A 1B3QA 2EGCA 1M8MA 1MV0B 4FSSA 2HCKA 1ZUYA 4LN2A 1K9AA 1X69A 4E6RA 1SSHA 3SHWA 2FPFA 2O2OA 1MV3A 2K6DA 2DX1A 4F16A 2A37A 1X2KA 2AZSA 1WI7A 2B86A 2F2WA 2GGRA 1GFCA 2C0OA 2D8JA 1YWPA 4OMLA 2LX7A 4HVWA 1CKAA 1BK2A 2DBMA 3H0IA 4QT7A 1U3OA 1HJDA 1QKXA 1T3SA 2CUBA 2YDLA 4X1VA 3I5RA 5IHIA 4OMNA 2K7AA 2CSIA 2LCSA 3NHNA 2K2MA 4LE9A 3VS5A 3REBB 2FO0A 1RLQC 5IHKA 2KRSA 2F2XA 4F14A 1ZUKA 1YN8A 3I35A 1GBRA 1WIEA 2DJQA 3H41A 2EYXA 1UFFA 2NUZA 2W0ZA 4AFUC 2ABLA 5ECAA 2LP5A 1M3AA 3VRZA 2X3XD
chains in the Genus database with same CATH superfamily
5KYUB 2RJFA 3VS2A 2KEAA 2WSFE 4PKCC 4JRPA 2RI2A 3THKA 1WNLA 2MK5A 1YCYA 2LCLA 1V1CA 1VQ4A 3ZEHA 1D1CA 1KSWA 4F7UE 5KCOA 4LDXA 2MI6A 2JOYA 4RTVA 2L0AA 1YJNA 4J6XA 3QDFA 1MUZA 4LUDA 2L3RA 5FU7C 2X4XA 2ED0A 2KQWA 2JTFA 2HKQB 3OYLA 1W1FA 4JLGA 4KGZB 1WXUA 2EFIA 1KK7A 1PRLC 1TUCA 2MF2A 4IUQA 1NBEB 4AG2C 1M2VA 5CVIA 3T9NA 2O4XB 2RM4A 3REAB 4JJBA 4JUVA 3P8DA 2YUNA 4QQGA 1I4K1 2COZA 2JVVA 1VQ5T 2RK2A 1EFNA 2CZ1B 4XQ3A 5GJVB 1ZLMA 2EVRA 3ME9A 2V8JA 2VXEA 2FRWA 3E2UA 5GJWB 1VQKT 4MMKA 3EG1A 3SEMA 2CP3A 2OTLA 5LJ3e 2FPEA 2EGEA 4KH1B 1D1AA 1YI2Q 1BB9A 3LH5A 4C92G 3G4ST 2YXYA 1PHTA 1BCOA 3LYIA 1V76A 4R56A 1KC8U 4M77E 5CAIA 2I2LA 2NUTA 4PJNA 1JJ2A 3BDUA 2K57A 2E5QA 3M56A 4GLMA 2ZZDA 1UEBA 2DJZA 2P0PA 4M7DD 3LGLA 3PT9A 1SG5A 1WHMA 1SKUB 2C0IA 2PVGB 1OZ2A 1VQNT 1XTDA 2E5KA 2E4HA 4M7AE 1GXIE 5HCKA 1WJSA 2YUPA 2HSEB 1RABB 2EYWA 3M0RA 5FW9A 3MPUB 3PIOA 2RI5A 1VYVA 1N6AA 1ZBXA 3G1JA 1M27C 4FYWB 4J9CA 4NL2A 3L2UA 3A8LB 3PE0A 3HTRA 1OX9A 3RERA 2LZ6B 3UT1A 2XKOC 4F7UA 3RIRA 1FYNA 1IREB 2RNAA 4JLIA 1JO8A 1K73C 1M2OA 1QMCA 5KCHA 3V7SA 5DLOA 2J05A 1WLPB 2QQBA 1VQ9A 4GBQA 1ARKA 3RESA 1ABOA 2XDDA 2LQNA 1H3ZA 4ZTFA 1QCOA 1GCQC 3CCLA 2FG0A 2K3XA 5CK9A 4OB3B 2M02A 1UG1A 4J9IA 2RQRA 1JQQA 3WVDB 3N5BB 3CMEQ 3JCMQ 1YFNA 3CC2A 2EYZA 4OGCA 4BI4A 5DM7R 2W10A 1KQSS 4PL6A 1IXDA 3VS7A 1W70A 2EPDA 2QAZA 4J8OA 1H8KA 1MMNA 1AWXA 4Y91A 5KH6A 3EH1A 2WSEE 2BTTA 2C0TA 3HHTB 1RAFB 4OVAA 2LX9A 4F7UB 2LJ0A 1G5VA 4N4HA 2F2VA 2XG8D 1Q81C 4LXCA 3NPFA 3M59A 5IAYA 1MMAA 2H3EB 1AHJB 1XJWB 2XDPA 1OPKA 2I0NA 2LVMA 4M77A 1RUWA 4P5NA 3LGFA 4LD9K 2EYYA 2EGAA 3MCAB 1WHJA 4OF1A 3OW2P 3CEYA 4LD6A 4HCKA 4LDYA 4MZPA 3L2QA 1ZA2B 2RO0A 3H0FA 1M9SA 2KDSA 1Q86R 2HL3A 1Y57A 2LC4A 2VVKA 3SWNB 3E1SA 1UECA 1RI9A 1I07A 3C12A 3HRUA 4M7AA 2DRKA 3UDCA 1JB0E 2ESWA 3QZ9B 3SD4A 1TOVA 1TWBA 1WQ7A 1VQ7Q 3UWNA 1NJIU 1OZ3A 2A36A 3ULRB 1K0XA 1KFZA 4LDVA 5FU6C 2FL7A 1VQ8Q 3L1AA 3QIIA 1M90C 2KE9A 4EMKC 2V8IA 1TUGB 3UATA 1VQMQ 1YBYA 3JB9H 5DLQE 2NYSA 2F5TX 2LQKA 3M5AA 2VASA 3GF5A 3A8GB 5LJ3h 3MP8A 2FB7A 1JJ2P 3OBWA 2KBTA 1ZSGA 3FDRA 4M7DB 3DB3A 4KGXB 1VYUA 1VQ5A 1ZHIA 4C0FA 3SB2A 4HT8A 5AT1B 3OYCA 2DNUA 1CSKA 2EQKA 1XNIA 2VGNA 4XTYA 3J80E 8AT1B 2LNHB 2X3WD 2D0QB 3S3NA 3CCMQ 1LPLA 1U1SA 1VQ4T 3G4SA 5LJ3j 1M1KC 3HRTA 3MEWA 3C94A 2VUBA 1YHQQ 5CKHA 4JRQA 1OULA 3M9QA 3NTIA 4M75D 4D6WA 3HL8A 3JB9D 5CKEA 1A0NB 4FW1A 3CCQQ 1H92A 3CPWS 2QEXT 1D0YA 2RQTA 1X43A 2HQHA 3QSUA 1K8AR 3PMIA 3VYGA 1QVGS 2PUKB 1VQNA 3OMCA 2CP2A 5GAOr 2MAMA 2DZCA 5D6YA 3CCSQ 3I55Q 2EGCA 5AYFA 5GAN4 4FSSA 4MMLA 4QQ6A 2HCKA 2KSSA 1WHGA 1D1BA 3DB4A 1PSEA 3E9FA 5LL6S 1M1KU 4HT9A 3SHWA 2A37A 3SDZA 1X2KA 2F2WA 2B86A 2BE9B 5GAOp 2FVUA 4OMLA 4HVWA 4C0DC 2E65A 1BK2A 2DXUA 4QKUA 1FX7A 1Q82R 2YLBA 1U3OA 2RJCA 1UGPB 2P0QA 4X1VA 1BI2A 2LTOA 2QASA 4OMNA 7AT1B 2DVEA 2D9TA 3VKIA 2DFUA 1RLQC 1NPPA 3MHXA 1YN8A 4QW2A 4A4FA 2ZPGB 2IVWA 1UFFA 3QHSA 1KG1A 2JTMA 2NUZA 2ZPFB 1VQLQ 2Y4XA 1R77A 1M3AA 3INZA 2O01E 4RCCA 2HKNA 4HXJA 3EHQA 1IHWA 4PLIA 1N8RC 4FYYB 2DL5A 2XD0A 4A4EA 3RKWA 1BU1A 5I21A 5I2SA 2OTJQ 3J81E 4M78B 2NWMA 2E3IA 2L5QA 3G71T 3OYAA 4C5GA 4C5EA 1TH7A 1D3BA 2MIOA 5FU7B 2BZYA 3X28B 2M0YA 4FU6A 1VQ6Q 2LMJA 3L42A 1EIFA 1UJYA 3GBQA 3FC3A 5DY9A 4J9FA 2KY9A 3FLGA 4ME7A 3V8LA 2PNIA 2KT1A 3GPLA 2QA4Q 2JZ2A 1I0CA 5GMKm 4PJOB 1B34B 2WACA 1WXBA 4CRIA 5LJ5e 2KYBA 1G3TA 2AKKA 4PLLA 1WZOA 2E6ZA 3VYHB 3EHRA 3M0QA 4J9EA 3J7AF 2QDLA 5GAN3 1NYGA 3JCMc 4AMCA 4KH0B 2M51A 1ZX6A 2F5KA 2JW4A 2PU9B 3META 1D3BB 1YIJQ 1UGQB 1BI1A 2QG9B 4IIMA 5GAMj 1LCKA 2CS7A 5J39A 2D8HA 3LLRA 2RQWA 2VC8A 1QVPA 2DD5A 3FB9A 5KYXA 2DIGA 4IUPA 3WVEB 1KQ2A 1KQSA 2RHZA 4MDWA 4E7SA 1ZSZA 3GNGA 4M75B 5FWBA 4N4GA 1JU5C 3EG3A 2DL8A 3UA6A 5GANe 3CCVQ 1FWZA 4CC4B 4OGEA 1GCQA 5LJ3g 4M78G 1KHCA 1FMWA 2KR3A 2JXBA 1K73R 3IQLA 2R58A 1CKBA 2CH4W 2XHCA 5GAN8 1HD3A 4CI0C 1MGQA 2RHIA 1U1TA 2KGTA 1X27A 1FMVA 2EBPA 2OX7A 5FROA 1BIAA 3L2ZA 3CC7T 2GTOA 3CCJQ 1G2BA 1SHGA 1X75C 3UA7A 2XDBA 1AZEA 1K76A 2LJ1A 2V1RA 3CCRQ 2QEXA 2AHJB 4PJOG 4E7IA 3OY9A 1I5LA 4MZTA 1R0CB 2M9UA 4C8QG 1YJ9T 3OW2A 1VQPT 4Y92A 3CMAT 2RA2A 1IHVA 4DEYA 2QTVA 1KD1C 5HK0A 3CXCS 1Q81R 1FXXA 3JSCA 2E41A 2PTKA 3HSBA 3EFSA 2ROTA 1KC8C 4R0KA 2KT8A 3EAEA 2L89A 3C95A 3CD6T 5IH2A 4B9WA 3NMZC 1KJWA 4ZGJB 4M78F 2G3RA 1NZ9A 2KK4A 4PNOA 4HCBA 2EJFA 1Z9QA 3A8MB 1YJWQ 2R5MA 1K0SA 2MPXC 1GL5A 4E7JA 1RLPC 3JB9G 2M0OA 3JCMh 2O88A 1B07A 3S3MA 1KHIA 4E7ZA 2HMAA 4BDYA 1VOMA 1KD1U 1PNJA 4EMKA 3CCEQ 4C8QC 1UDLA 2HQXA 4WCIA 5IT9E 1AOJA 5FRNA 3G6EQ 4E2FB 5J26A 1SEMA 1QWFA 3MEAA 4M77D 1X01A 1M1GA 2JJ9A 2CZ7B 2LRQA 4JJDA 1BBZA 1NE8A 1OPLA 2VGMA 2H8HA 1AWWA 3DLLA 4PJOF 1YCSB 1M2VB 2IPOB 2YRCA 4C8QF 2RHUA 5I2MA 1M90R 5CKDA 4IURA 3MKDA 2KROA 3CPWA 4C0ZA 2AT1B 1FMKA 2KYMA 2YSQA 3A8OB 1WJQA 4GLKA 3OA6A 1R8OB 3OYDA 4EDUA 4M7AD 1M3BA 4A63B 1X6OA 1QVGA 5LJ3d 4HVUA 3G71A 2RD1A 3M53A 3FEOA 2L3PA 2BZXA 4C92C 4PFZA 3RMSA 1TXQA 2JMAA 1AT1B 2J06A 4EMKB 4DBQA 4QQDA 2RJEA 5LJ5h 3HPWA 2SRCA 3QG1A 2NUTB 2SEMA 3RNJA 1VQOQ 4HKEA 4XU2A 2DTIA 1TUDA 4C92F 2J6FA 4C0GA 3HFOA 1ZSZC 2R57A 1VIFA 1M1KR 2C06A 1KQSP 3CC4Q 3A1PA 3A8HB 4GY5A 3M0SA 3QDRB 3MJXA 3VU3C 2GNCA 5GAMg 3GLXA 4XTVA 3H6ZA 2DYBA 2ZPIB 4J9BA 2V8KA 5LJ5j 3ER0A 3TQ7P 5A0GA 1LVKA 2J6OA 4XAXB 2CKKA 2JNGA 4RTUA 2R5AA 4J7FA 4CC2A 3EG9A 4JS5A 3LX7A 1YI2T 3CCUQ 2Y4YA 1BIBA 5GANh 2JTEA 3VS1A 2LDMA 4JZ4A 4O6JA 2KXDA 2RI3A 2PVOB 3TU4K 4O5VA 1Q7YU 1S72Q 1NYFA 1JXOA 3OS5A 1T0JA 2RHXA 3M0UA 4PFOA 1YITQ 1K4US 3LW5E 3OSSC 4J9HA 5D6WA 1J3TA 1PWTA 3OYHA 3JCMJ 4B6MA 2EQMA 2EQUA 2ED1A 5CKBA 4Z89A 1WXTA 1NJIC 2CH4A 2RF0A 3LWIA 3QBYA 5GANj 1K9AA 2OAUA 2O2OA 1MV3A 2VV5A 5GAN5 5CKFA 1W2BS 3MP6A 2X9HA 1PD0A 4J6WA 2GGRA 4KUDK 1TS9A 1OX8A 1YJNQ 4MDXA 5GMKh 2LX7A 3X24B 4EPCA 4QT7A 2CZ0B 2K5FA 1HJDA 1QKXA 2CUBA 5HKCA 3CC7A 2ZPBB 1DJ7B 3RKYA 2RK1A 3OB9A 2DEQA 3QYGB 5GAMe 4LE9A 1N8RR 3REBB 5IHKA 5KE2A 5C0MA 4E7LA 2DETA 4F14A 1ZUKA 2CP5A 1Q95G 1G3YA 1GBRA 1YJ9A 1QW1A 3H41A 4L5GA 4EMGA 2W0ZA 3H9NA 3CMAA 1VQPA 4AFUC 1OU8A 2BKDN 5GMKj 3L2WA 4X34A 3VRZA 4II1A 4M77B 4ZGEB 2MOXA 2K3YA 1WJRA 5KE3A 2DL7A 2PUOB 4KBMB 2DAQA 4FSXA 3CMET 3CD6A 3EGXA 4BI3A 4Q5WA 1NLPC 1BI0A 1W4SA 1F1BB 3FJPA 3A5ZB 1IGUA 2IG0A 2OTLQ 1YIJA 1YP5A 2EW3A 5KYYA 4F7UG 3JCMW 2HBPA 2K3BA 1AWJA 2YHTA 5GAMd 3CPWP 2DERA 4M7AB 3ASKA 4C8QE 2G6FX 2V1QA 2YUQA 2FEIA 1B7TA 2QI2A 3V8KA 4BI8B 1RAHB 2L8DA 1QVGP 1U5SA 4IIOA 1BI3A 1VIEA 2CUDA 4JRIA 4BE1A 3JCMg 3E9GA 4XTUA 2RQVA 2DM1A 2IIMA 4K11A 2CP7A 4N0AC 3U23A 5I11A 3AT1B 4OMFB 4E7KA 2JN0A 2KMTA 4A54A 4ESRA 3MEUA 2CT3A 3JCMb 2RQUA 3VRYA 5GMKl 4ELYC 4Z02A 1UTIA 2XMFA 2RN8A 4X9CA 2K5IA 3VS6A 1M3CA 1SHFA 4R55A 2JS0A 1ZQ1A 3V8JA 3PNWC 1PKTA 2QQRA 3FJ5A 2QGGA 4C92E 1D09B 4C92D 2XI9A 4Z88A 3OS1A 4IUVA 4OMQA 5FWCA 4LDUA 1M5Q1 2X4JA 2CDTA 2NUPA 4RTZA 1VQ7T 2A3LA 4DBFA 3CXCA 1SF9A 3CBPA 4KT0E 4HVVA 3JB9I 3GOXA 1C0MA 1VQ8T 4F7UF 3OSVA 1RACB 4EIKA 1IZ6A 1QKWA 2MWOA 1VQ9Q 3JV3A 4XTZA 2BIVA 2KNBB 1E7OA 4NOYA 2VWFA 1SRLA 2CP0A 1VQMT 4J6YA 1IB8A 1WQWA 3I56Q 3TCJA 3TSWA 4BY6C 2J7IA 5LJ5g 4M7DG 2COYA 1HYOA 1N9RA 5KYWA 3CCLQ 3QJYA 5EC7A 1RI0A 3SWNC 3QPHA 5GAN6 2FPDA 3VS4A 1TU0B 3CC2Q 1QVFS 3JCMe 2PZ1A 2OJ2A 1ZA1B 3EGDA 2A7YA 3WXMB 4UC4A 5IXBA 1QCFA 2K5LA 3O5ZA 4HCCA 2EAYA 4IUTA 1M30A 3CCMT 1YI2A 4PK4A 4L6V5 3URGA 1KD1R 1TSFA 3OS0A 1QWEA 1YHQT 1V29B 1KC8R 4IUUA 2GCXA 2DK3A 4HA8A 4JJCA 4ORZA 1S1NA 2ATCB 5GANg 3CCQT 4E47A 1Y07A 4M7DC 3PVQA 4C8QA 4ELZC 2DD4A 2CSQA 1GRIA 3NFCA 2E64A 1X6BA 3FIFA 1H641 2MYSA 3JCMd 4C5IA 2GTJA 3CCST 4M7DF 1C6VX 4NL3A 1PCXA 2DXTA 3I55T 1Q86U 2DO3A 2YT6A 1JXMA 3V7RA 3EH2A 5GAMh 1RL2A 2HNIA 5GAOq 3MP1A 5GMKi 3CBMA 4BACA 2CP6A 1P92A 2RHYA 1GBQA 2WSCE 3O8VA 4YTLA 1ZUUA 2HL5C 3CQTA 3BW1A 4A4GA 1MNEA 1R0BG 2D6FA 1QP2A 5CCAA 1Y0MA 3GNFB 5GAOm 4KULA 4XU0A 2LNVA 1LOJA 3VS3A 9ATCB 2QQAA 3QZ5B 3M54A 3OMGA 4J7IA 4C92A 2K79A 4VUBA 4DBHA 2E70A 3VS0A 2JMCA 4JJNK 5L8RE 1UUEA 4D8DA 3NTKA 3ZFJA 1HXDA 1XOVA 3OYIA 5KYUA 2GQIA 1VUBA 4A4KA 4ZN3A 1VQLT 5CR2A 2AIRB 2DF6A 1VQ5Q 2KXCA 1H3HA 2XK0A 4ZNXA 1IGQA 2ZPEB 3MO8A 2HBWA 2D0NA 3PTAA 4PJLA 2AKLA 2EJ9A 5LJ5d 3CMEA 2E6NA 1VQKQ 2FZKB 2V26A 1MMDA 1QQJA 3CCUA 4OMMA 1BCMA 1T0HA 3QKJA 4BD3A 3G4SQ 2OTJT 4PFPA 2ROLA 2RH2A 2PQWA 3I9QA 1O75A 2DEUA 1JRIA 3D7SB 1YITA 3VUZA 2KRMA 2LQWA 1W2BA 3KUFA 4RTTA 1VQ6T 1SPKA 2M1HA 4BUGA 2O4XA 3CXCP 5KYXB 4AFQC 1IO6A 2HAXA 4DOVA 1UHFA 4RCBA 1WGSA 1D0XA 2LT1A 1VQNQ 1ZSZB 4RTYA 2QA4T 1UJ0A 2DZ9A 5GMKe 5GANd 4JDSA 2LJ3A 4CC7A 4KGVB 1GFDA 1AVZC 4M78C 4JPBW 3KXTA 5HY6A 2F69A 2GF7A 1O9SA 3E19A 2BZ8A 5LJ3f 1U8RA 4AT1B 2EQIA 2QQ9A 1PRMC 1Q82U 2DBKA 1G3SA 2H3JA 2HSPA 2GFAA 1D0ZA 1VQ7A 3NGPA 1WYXA 2ZCFB 1AZGB 1NJIR 1XQHA 1YIJT 1VQ8A 4AFSC 3OQ5A 2OI3A 2Y90A 4M75G 3SFMA 1WHLA 2KVQG 1M4ZA 3PVLA 2EQJA 1RAIB 1VQMA 2ZAEA 2DVJA 3DKMA 2A0FB 2X51A 2CT4A 1IRXA 4PJOC 5HK3A 3M0TA 3X20B 1I8FA 4DA4A 1K9MC 1SRMA 1UGVA 1JEGA 3C4SA 1Z9ZA 3GP8A 4FYVB 4OB0B 2K2VA 4PJMA 1SSFA 2QK0A 3QXEB 3CCVT 1B3QA 4ZGDB 1MV0B 1ZUYA 4LN2A 2FPFA 4QVCA 2Z0WA 2K6DA 2DX1A 4F16A 2LT4A 1UGRB 4WTOB 1GFCA 3S3OA 1TTHB 2LCCA 3CBOA 2ZPHB 2CGHA 3MEVA 3CCMA 1T3SA 2EIFA 4QVDA 4C5HA 2PVDB 5FLXE 1LJOA 3I5RA 1M1FA 1K9MU 3CCJT 4M7DE 4M75C 4RKUE 1YHQA 2CSIA 2LCSA 2VYTA 3BDLA 2K2MA 1I5OB 3CCQA 3CCRT 3OS2A 2DPPB 2QTXA 2MMPA 5FU6B 1EZZB 4RMOA 3F70A 1Y96A 2QGFB 3JCMX 3FRNA 1MMGA 4FYXB 1M8VA 4M75F 4N0AA 3JB9F 2X3XD 3RR6A 2L3SA 5A0LA 5J3BA 2MCNA 1E6GA 4RTWA 2A08A 3CCSA 3RDVA 3JAME 1WFWA 3I55A 2KRNA 3TREA 2B8AA 1Q7YC 3OYFA 3H0HA 3L2RA 2FZCB 3Q1JA 3LWHA 2J6KA 3OYNA 4OMPA 5FRMA 2DXCA 5I22A 3JB9J 1RAAB 1KIKA 4LNPA 3EG0A 5GAN2 1YJWT 3JCMP 3BY7A 4JRKA 1AWOA 1WDXA 3OYKA 3RKXA 3P8HA 3VJPA 3I56A 2E1HA 4IKFA 1QVFA 1WA7A 2ECZA 5CQXA 2OAWA 3L2VA 3CCET 1Y96B 2DL4A 4OB1B 1MNDA 2YUOA 4FT2A 4A53A 3G6ET 3VV0A 3JCMV 1N27A 2DTHA 1VQLA 3HRSA 2YWWA 1W2BP 5GAOn 4J9GA 3NTHA 3A98A 4LDWA 3M4GA 3TVTA 4WF2A 2DXBA 3EGUA 3DLMA 1BYMA 2QDYB 1K73U 3SWNA 1ABQA 1OYXA 4XTXA 4X9DA 2ZGWA 2X4YA 4LUEA 4J5YA 2GFUA 3PFSA 5GAMf 2BUDA 3M55A 1VQ4Q 5IN1A 2OTJA 2E10A 3M0PA 5D6XA 4FCYA 4QVZA 4L59A 2DKGA 2QXFA 3EG9B 4XTWA 2JS2A 2D1XA 4C0DB 2HQEA 4DOWA 2FYKA 3OYMA 3UPUA 2QEXQ 4J83A 1VQ6A 2AK5A 1OV3A 1Y71A 1YNZA 2O9SA 1VQOT 5KYNA 4M7DA 4BY6B 3EFOA 1WHKA 3V7CA 4A4HA 2L3QA 1RADB 2QA4A 4M78E 4M78D 1OQKA 1Q81U 2EJGA 1JBMA 2P84A 4RG8A 1WX6A 2NLUA 1TG0A 2JT4A 3CC4T 1NEGA 2RPNA 2P4RA 1PM3A 3OW2S 5D7UA 3KBGA 4HCZA 2KAFA 5A2QE 2AZVA 3OYEA 1E6HA 2DMOA 3QWXX 3BE3A 2DL3A 2P4TA 1VYTA 2HZYA 2JM9A 3X26B 2DA9A 4B9XA 3QYHB 1WHHA 4N4IA 4XU3A 2COWA 3HP9A 3CCUT 1OOTA 4M4ZA 1BKBA 1N5ZA 1NLOC 4RUGA 1K1ZA 3OBYA 4FW2A 1AEYA 4FIBA 4PJOE 3RMQA 4PJOD 3HFNA 1S72T 3EFRA 2EWNA 4FL6A 4C8QD 4EMHA 4E7HA 1G8XA 4DQ2A 3UF4A 5A0DA 1YITT 3EFOB 4FM4B 4Y28E 4KRTA 2CZ6B 4F17A 4Z8AA 2XU8A 3CCVA 1M90U 1VQKA 1RAGB 2DILA 1VA7A 4OB2B 5IHNA 3TEEA 3AHUA 1W6XA 1JJ2S 4OP0A 3R6NA 3OYYA 3TSZA 4DEXA 2BE7D 2L2PA 4NS5A 1YJNT 3EGXB 4M75E 3G71Q 3LH0A 2VKNA 3M58A 1UE9A 2VB6A 1X2QA 2CREA 4ZN1A 2ENMA 4V2SA 1KQ1A 5KYYB 2FRYA 1I81A 3PIPA 2XIDA 3CCJA 1I1JA 5GAOl 1UHCA 4MZMA 1NM7A 3CCRA 2CYZB 1HSQA 4BB7A 5GAN7 2DRMA 2E3HA 1G3WA 3ZL7C 1U06A 1YWOA 2HD0A 4M77G 4RG2A 3JCMf 1QP3A 3PGGA 1QVFP 2JM8A 1NEBA 4ZTJA 3M4YA 4J9DA 1MHNA 2X4WA 4BE0A 1OEBA 1X6GA 2A28A 3R6OA 4M78A 3I5SA 2DE0X 3OYGA 1ACMB 2OTLT 4M7AG 4AFZC 3KFVA 3RUXA 2E12A 3G7ZA 3ZBDA 1QLYA 1YJWA 1PD1A 1NPRA 4KUIA 5M9OA 1EX4A 3M57A 3OYJA 2K4YA 1C1AA 2NUPB 3EG2A 2RB6A 2HEQA 1Q86C 2FZGB 4RTXA 2RJDA 3CCEA 1ZBJA 4CC3A 4M77C 1UGSB 3P8BB 3G6EA 2GBQA 2K9GA 4ANJA 2GQVA 1NG2A 2QYZA 1LNXA 4PJOA 2EKHA 4BDZA 8ATCB 1B34A 2VXFA 2EYQA 1GCPA 1OU9A 2EKOA 3BFMA 5KYWB 5LJ5f 4M77F 3PMTA 5IXFA 2P0KA 2FHDA 1Y7XA 4M7AC 3GIBA 3QJ6A 3VUBA 1PG5B 4OMOA 4D8KA 1AD5A 1K9MR 2HDAA 3EGDB 4XK8E 1G83A 3RBBB 3CC7Q 2YLCA 3QO3A 2DLPA 1T3LA 1PKSA 6AT1B 3QWYA 2XICA 4M7AF 1PSFA 1N8RU 3C0CA 1QCNA 1PC0A 4M75A 2MWPA 4JZ3A 4DBRA 2DTOA 1OI1A 2O31A 3OYBA 1VQ9T 3QUIA 1YJ9Q 1VQOA 3I56T 1VQPQ 3CMAQ 5EG2A 3HKSA 2DIQA 1N9SA 5GANf 2O9VA 4AG1C 4C8QB 3CCLT 2LQ8A 2RMOA 2DYIA 2YRDA 3H8ZA 3CC4A 5L23A 5CIUA 2QQSA 1M8MA 1X69A 4E6RA 2JUFA 1SSHA 4BE2A 3CD6Q 3CC2T 2AZSA 1WI7A 2C0OA 2D8JA 4TVRA 2M16A 5CO7A 1YWPA 4F04B 2X35A 1K8AC 4JS4A 1WPYA 2KI7A 1CKAA 2DBMA 3H0IA 3CPFA 2YDLA 5C6SA 5IHIA 2K7AA 3S6WA 4ATOA 1HK9A 1UB4A 3JRZA 3NHNA 3VS5A 2FO0A 2KRSA 1S72A 4XU1A 3X25B 1Q7YR 2F2XA 4C92B 3I35A 4FT4A 1WIEA 2DJQA 2YRVA 2EYXA 2F1LA 1Q82C 4PJJA 2ABLA 5CQYA 5ECAA 2LP5A 1RAEB 1K8AU
chains in the Genus database with same CATH topology
2L3SA 2MCNA 1E6GA 2KEAA 4RTWA 2A08A 3VS2A 1WFWA 2MOXA 3EHQA 2KRNA 4HXJA 3THKA 2DL7A 1V1CA 2DL5A 3H0HA 1KSWA 1NLPC 2J6KA 1YP5A 2EW3A 1BU1A 2L0AA 4RTVA 4OMPA 5I22A 2NWMA 2K3BA 1AWJA 1MUZA 1KIKA 4LUDA 4LNPA 3EG0A 2G6FX 1AWOA 1WDXA 2V1QA 2YUQA 2ED0A 2MIOA 2FEIA 2BZYA 2M0YA 1W1FA 2ECZA 1U5SA 1WA7A 1WXUA 2OAWA 4IIOA 2LMJA 2CUDA 1UJYA 3GBQA 2RQVA 1PRLC 2DL4A 1TUCA 2DM1A 2IIMA 2YUOA 4J9FA 4K11A 4AG2C 3U23A 5I11A 2PNIA 2KT1A 3REAB 4J9GA 4ESRA 4JJBA 1I0CA 3A98A 2YUNA 2CT3A 2RQUA 3TVTA 3VRYA 3EGUA 1EFNA 5GJVB 1ZLMA 1UTIA 2EVRA 1WXBA 1ABQA 2XMFA 2RN8A 2KYBA 2AKKA 3VS6A 1M3CA 1SHFA 3EHRA 3M0QA 2FRWA 4J9EA 2JS0A 2QDLA 5GJWB 4LUEA 1NYGA 1PKTA 3FJ5A 3EG1A 3SEMA 2FPEA 2EGEA 2M51A 4Z88A 1ZX6A 2JW4A 5FWCA 4OMQA 1BB9A 3M0PA 3LH5A 2CDTA 4RTZA 1PHTA 4HVVA 4IIMA 1LCKA 2D8HA 2D1XA 2JS2A 2RQWA 4EIKA 4GLMA 1QKWA 2AK5A 3JV3A 2KNBB 1E7OA 1OV3A 2VWFA 1SRLA 1YNZA 2O9SA 3TSWA 5FWBA 2J7IA 1JU5C 3EG3A 2C0IA 2L3QA 2DL8A 3UA6A 5EC7A 4CC4B 2E5KA 1WX6A 1GCQA 1TG0A 5HCKA 2JT4A 2KR3A 2YUPA 2FPDA 1NEGA 2JXBA 3VS4A 2RPNA 2EYWA 3M0RA 5FW9A 2P4RA 3IQLA 1CKBA 2CH4W 2PZ1A 2OJ2A 1VYVA 2AZVA 5IXBA 1HD3A 1QCFA 1E6HA 2DMOA 3QWXX 2DL3A 1M27C 4J9CA 1VYTA 3O5ZA 2KGTA 2JM9A 1M30A 3PE0A 1X27A 2DA9A 2EBPA 2LZ6B 2GTOA 1OOTA 4M4ZA 1G2BA 1SHGA 1FYNA 1N5ZA 1NLOC 4RUGA 1QWEA 1K1ZA 3UA7A 2RNAA 1AEYA 1JO8A 1AZEA 1K76A 2LJ1A 2V1RA 4JJCA 2J05A 4ORZA 1S1NA 1WLPB 3PVQA 4GBQA 3UF4A 1ARKA 1ABOA 2CSQA 1GRIA 2LQNA 4Y92A 4KRTA 1GCQC 1X6BA 4F17A 4DEYA 2FG0A 4Z8AA 1UG1A 4J9IA 2PTKA 2DILA 2RQRA 1VA7A 2GTJA 1JQQA 5IHNA 2ROTA 2YT6A 1W6XA 1JXMA 4R0KA 2KT8A 3R6NA 2EYZA 5IH2A 2W10A 3TSZA 3NMZC 1KJWA 3VS7A 4DEXA 1W70A 2EPDA 2L2PA 1GBQA 1H8KA 1ZUUA 1AWXA 3CQTA 1Z9QA 2VKNA 1UE9A 1X2QA 2BTTA 2C0TA 1K0SA 2CREA 1GL5A 2LJ0A 2ENMA 1RLPC 1Y0MA 2FRYA 2F2VA 2O88A 1I1JA 1B07A 3VS3A 1UHCA 3NPFA 2K79A 1NM7A 1PNJA 1UDLA 4WCIA 3VS0A 1HSQA 1AOJA 2JMCA 2DRMA 1UUEA 1SEMA 4D8DA 1QWFA 1OPKA 3ZL7C 2I0NA 1XOVA 4JJDA 1BBZA 1U06A 1OPLA 1YWOA 2GQIA 1RUWA 2H8HA 1AWWA 2EYYA 2EGAA 1YCSB 2DF6A 2JM8A 1NEBA 2KXCA 1H3HA 4ZNXA 4HCKA 4J9DA 2HBWA 2D0NA 3H0FA 2KROA 1OEBA 1Y57A 1X6GA 2AKLA 1FMKA 2KYMA 2YSQA 2A28A 2VVKA 3I5SA 4OMMA 1UECA 1RI9A 1I07A 1M3BA 2DE0X 4A63B 2DRKA 2ESWA 1T0HA 4AFZC 3KFVA 4HVUA 1QLYA 2L3PA 2ROLA 3ULRB 2A36A 2BZXA 1K0XA 3I9QA 1KFZA 2KE9A 2KRMA 2JMAA 3EG2A 2J06A 2LQWA 2HEQA 3UATA 4RTXA 4RTTA 2SRCA 1ZBJA 1SPKA 4CC3A 2SEMA 3RNJA 2GBQA 2K9GA 1IO6A 4AFQC 1NG2A 1UHFA 1TUDA 2J6FA 2EKHA 4RTYA 2KBTA 1ZSGA 1UJ0A 1GCPA 1VYUA 2LJ3A 4CC7A 1GFDA 3M0SA 1AVZC 2GNCA 4JPBW 2DNUA 1CSKA 5IXFA 2DYBA 4J9BA 2BZ8A 2EQIA 4OMOA 4D8KA 1PRMC 2LNHB 2J6OA 1AD5A 2DBKA 2HSPA 2X3WD 4RTUA 2HDAA 4CC2A 1G83A 3RBBB 3NGPA 1WYXA 1AZGB 2DLPA 1T3LA 2JTEA 3VS1A 1PKSA 4AFSC 4JZ4A 3QWYA 2KXDA 3C0CA 2OI3A 1A0NB 1H92A 1NYFA 4JZ3A 1JXOA 1T0JA 3PVLA 2RQTA 1X43A 3M0UA 2O31A 1K4US 2DVJA 2CT4A 4J9HA 3M0TA 1JEGA 1SRMA 1UGVA 1PWTA 1J3TA 1Z9ZA 2O9VA 4AG1C 2ED1A 4Z89A 1WXTA 2RMOA 2CH4A 2RF0A 5L23A 1B3QA 2EGCA 1M8MA 1MV0B 4FSSA 2HCKA 1ZUYA 4LN2A 1K9AA 1X69A 4E6RA 1SSHA 3SHWA 2FPFA 2O2OA 1MV3A 2K6DA 2DX1A 4F16A 2A37A 1X2KA 2AZSA 1WI7A 2B86A 2F2WA 2GGRA 1GFCA 2C0OA 2D8JA 1YWPA 4OMLA 2LX7A 4HVWA 1CKAA 1BK2A 2DBMA 3H0IA 4QT7A 1U3OA 1HJDA 1QKXA 1T3SA 2CUBA 2YDLA 4X1VA 3I5RA 5IHIA 4OMNA 2K7AA 2CSIA 2LCSA 3NHNA 2K2MA 4LE9A 3VS5A 3REBB 2FO0A 1RLQC 5IHKA 2KRSA 2F2XA 4F14A 1ZUKA 1YN8A 3I35A 1GBRA 1WIEA 2DJQA 3H41A 2EYXA 1UFFA 2NUZA 2W0ZA 4AFUC 2ABLA 5ECAA 2LP5A 1M3AA 3VRZA 2X3XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3S A;  2MCN A;  1E6G A;  2KEA A;  4RTW A;  2A08 A;  3VS2 A;  1WFW A;  2MOX A;  3EHQ A;  2KRN A;  4HXJ A;  3THK A;  2DL7 A;  1V1C A;  2DL5 A;  3H0H A;  1KSW A;  1NLP C;  2J6K A;  1YP5 A;  2EW3 A;  1BU1 A;  2L0A A;  4RTV A;  4OMP A;  5I22 A;  2NWM A;  2K3B A;  1AWJ A;  1MUZ A;  1KIK A;  4LUD A;  4LNP A;  3EG0 A;  2G6F X;  1AWO A;  1WDX A;  2V1Q A;  2YUQ A;  2ED0 A;  2MIO A;  2FEI A;  2BZY A;  2M0Y A;  1W1F A;  2ECZ A;  1U5S A;  1WA7 A;  1WXU A;  2OAW A;  4IIO A;  2LMJ A;  2CUD A;  1UJY A;  3GBQ A;  2RQV A;  1PRL C;  2DL4 A;  1TUC A;  2DM1 A;  2IIM A;  2YUO A;  4J9F A;  4K11 A;  4AG2 C;  3U23 A;  5I11 A;  2PNI A;  2KT1 A;  3REA B;  4J9G A;  4ESR A;  4JJB A;  1I0C A;  3A98 A;  2YUN A;  2CT3 A;  2RQU A;  3TVT A;  3VRY A;  3EGU A;  1EFN A;  5GJV B;  1ZLM A;  1UTI A;  2EVR A;  1WXB A;  1ABQ A;  2XMF A;  2RN8 A;  2KYB A;  2AKK A;  3VS6 A;  1M3C A;  1SHF A;  3EHR A;  3M0Q A;  2FRW A;  4J9E A;  2JS0 A;  2QDL A;  5GJW B;  4LUE A;  1NYG A;  1PKT A;  3FJ5 A;  3EG1 A;  3SEM A;  2FPE A;  2EGE A;  2M51 A;  4Z88 A;  1ZX6 A;  2JW4 A;  5FWC A;  4OMQ A;  1BB9 A;  3M0P A;  3LH5 A;  2CDT A;  4RTZ A;  1PHT A;  4HVV A;  4IIM A;  1LCK A;  2D8H A;  2D1X A;  2JS2 A;  2RQW A;  4EIK A;  4GLM A;  1QKW A;  2AK5 A;  3JV3 A;  2KNB B;  1E7O A;  1OV3 A;  2VWF A;  1SRL A;  1YNZ A;  2O9S A;  3TSW A;  5FWB A;  2J7I A;  1JU5 C;  3EG3 A;  2C0I A;  2L3Q A;  2DL8 A;  3UA6 A;  5EC7 A;  4CC4 B;  2E5K A;  1WX6 A;  1GCQ A;  1TG0 A;  5HCK A;  2JT4 A;  2KR3 A;  2YUP A;  2FPD A;  1NEG A;  2JXB A;  3VS4 A;  2RPN A;  2EYW A;  3M0R A;  5FW9 A;  2P4R A;  3IQL A;  1CKB A;  2CH4 W;  2PZ1 A;  2OJ2 A;  1VYV A;  2AZV A;  5IXB A;  1HD3 A;  1QCF A;  1E6H A;  2DMO A;  3QWX X;  2DL3 A;  1M27 C;  4J9C A;  1VYT A;  3O5Z A;  2KGT A;  2JM9 A;  1M30 A;  3PE0 A;  1X27 A;  2DA9 A;  2EBP A;  2LZ6 B;  2GTO A;  1OOT A;  4M4Z A;  1G2B A;  1SHG A;  1FYN A;  1N5Z A;  1NLO C;  4RUG A;  1QWE A;  1K1Z A;  3UA7 A;  2RNA A;  1AEY A;  1JO8 A;  1AZE A;  1K76 A;  2LJ1 A;  2V1R A;  4JJC A;  2J05 A;  4ORZ A;  1S1N A;  1WLP B;  3PVQ A;  4GBQ A;  3UF4 A;  1ARK A;  1ABO A;  2CSQ A;  1GRI A;  2LQN A;  4Y92 A;  4KRT A;  1GCQ C;  1X6B A;  4F17 A;  4DEY A;  2FG0 A;  4Z8A A;  1UG1 A;  4J9I A;  2PTK A;  2DIL A;  2RQR A;  1VA7 A;  2GTJ A;  1JQQ A;  5IHN A;  2ROT A;  2YT6 A;  1W6X A;  1JXM A;  4R0K A;  2KT8 A;  3R6N A;  2EYZ A;  5IH2 A;  2W10 A;  3TSZ A;  3NMZ C;  1KJW A;  3VS7 A;  4DEX A;  1W70 A;  2EPD A;  2L2P A;  1GBQ A;  1H8K A;  1ZUU A;  1AWX A;  3CQT A;  1Z9Q A;  2VKN A;  1UE9 A;  1X2Q A;  2BTT A;  2C0T A;  1K0S A;  2CRE A;  1GL5 A;  2LJ0 A;  2ENM A;  1RLP C;  1Y0M A;  2FRY A;  2F2V A;  2O88 A;  1I1J A;  1B07 A;  3VS3 A;  1UHC A;  3NPF A;  2K79 A;  1NM7 A;  1PNJ A;  1UDL A;  4WCI A;  3VS0 A;  1HSQ A;  1AOJ A;  2JMC A;  2DRM A;  1UUE A;  1SEM A;  4D8D A;  1QWF A;  1OPK A;  3ZL7 C;  2I0N A;  1XOV A;  4JJD A;  1BBZ A;  1U06 A;  1OPL A;  1YWO A;  2GQI A;  1RUW A;  2H8H A;  1AWW A;  2EYY A;  2EGA A;  1YCS B;  2DF6 A;  2JM8 A;  1NEB A;  2KXC A;  1H3H A;  4ZNX A;  4HCK A;  4J9D A;  2HBW A;  2D0N A;  3H0F A;  2KRO A;  1OEB A;  1Y57 A;  1X6G A;  2AKL A;  1FMK A;  2KYM A;  2YSQ A;  2A28 A;  2VVK A;  3I5S A;  4OMM A;  1UEC A;  1RI9 A;  1I07 A;  1M3B A;  2DE0 X;  4A63 B;  2DRK A;  2ESW A;  1T0H A;  4AFZ C;  3KFV A;  4HVU A;  1QLY A;  2L3P A;  2ROL A;  3ULR B;  2A36 A;  2BZX A;  1K0X A;  3I9Q A;  1KFZ A;  2KE9 A;  2KRM A;  2JMA A;  3EG2 A;  2J06 A;  2LQW A;  2HEQ A;  3UAT A;  4RTX A;  4RTT A;  2SRC A;  1ZBJ A;  1SPK A;  4CC3 A;  2SEM A;  3RNJ A;  2GBQ A;  2K9G A;  1IO6 A;  4AFQ C;  1NG2 A;  1UHF A;  1TUD A;  2J6F A;  2EKH A;  4RTY A;  2KBT A;  1ZSG A;  1UJ0 A;  1GCP A;  1VYU A;  2LJ3 A;  4CC7 A;  1GFD A;  3M0S A;  1AVZ C;  2GNC A;  4JPB W;  2DNU A;  1CSK A;  5IXF A;  2DYB A;  4J9B A;  2BZ8 A;  2EQI A;  4OMO A;  4D8K A;  1PRM C;  2LNH B;  2J6O A;  1AD5 A;  2DBK A;  2HSP A;  2X3W D;  4RTU A;  2HDA A;  4CC2 A;  1G83 A;  3RBB B;  3NGP A;  1WYX A;  1AZG B;  2DLP A;  1T3L A;  2JTE A;  3VS1 A;  1PKS A;  4AFS C;  4JZ4 A;  3QWY A;  2KXD A;  3C0C A;  2OI3 A;  1A0N B;  1H92 A;  1NYF A;  4JZ3 A;  1JXO A;  1T0J A;  3PVL A;  2RQT A;  1X43 A;  3M0U A;  2O31 A;  1K4U S;  2DVJ A;  2CT4 A;  4J9H A;  3M0T A;  1JEG A;  1SRM A;  1UGV A;  1PWT A;  1J3T A;  1Z9Z A;  2O9V A;  4AG1 C;  2ED1 A;  4Z89 A;  1WXT A;  2RMO A;  2CH4 A;  2RF0 A;  5L23 A;  1B3Q A;  2EGC A;  1M8M A;  1MV0 B;  4FSS A;  2HCK A;  1ZUY A;  4LN2 A;  1K9A A;  1X69 A;  4E6R A;  1SSH A;  3SHW A;  2FPF A;  2O2O A;  1MV3 A;  2K6D A;  2DX1 A;  4F16 A;  2A37 A;  1X2K A;  2AZS A;  1WI7 A;  2B86 A;  2F2W A;  2GGR A;  1GFC A;  2C0O A;  2D8J A;  1YWP A;  4OML A;  2LX7 A;  4HVW A;  1CKA A;  1BK2 A;  2DBM A;  3H0I A;  4QT7 A;  1U3O A;  1HJD A;  1QKX A;  1T3S A;  2CUB A;  2YDL A;  4X1V A;  3I5R A;  5IHI A;  4OMN A;  2K7A A;  2CSI A;  2LCS A;  3NHN A;  2K2M A;  4LE9 A;  3VS5 A;  3REB B;  2FO0 A;  1RLQ C;  5IHK A;  2KRS A;  2F2X A;  4F14 A;  1ZUK A;  1YN8 A;  3I35 A;  1GBR A;  1WIE A;  2DJQ A;  3H41 A;  2EYX A;  1UFF A;  2NUZ A;  2W0Z A;  4AFU C;  2ABL A;  5ECA A;  2LP5 A;  1M3A A;  3VRZ A;  2X3X D; 
#chains in the Genus database with same CATH topology
 5KYU B;  2RJF A;  3VS2 A;  2KEA A;  2WSF E;  4PKC C;  4JRP A;  2RI2 A;  3THK A;  1WNL A;  2MK5 A;  1YCY A;  2LCL A;  1V1C A;  1VQ4 A;  3ZEH A;  1D1C A;  1KSW A;  4F7U E;  5KCO A;  4LDX A;  2MI6 A;  2JOY A;  4RTV A;  2L0A A;  1YJN A;  4J6X A;  3QDF A;  1MUZ A;  4LUD A;  2L3R A;  5FU7 C;  2X4X A;  2ED0 A;  2KQW A;  2JTF A;  2HKQ B;  3OYL A;  1W1F A;  4JLG A;  4KGZ B;  1WXU A;  2EFI A;  1KK7 A;  1PRL C;  1TUC A;  2MF2 A;  4IUQ A;  1NBE B;  4AG2 C;  1M2V A;  5CVI A;  3T9N A;  2O4X B;  2RM4 A;  3REA B;  4JJB A;  4JUV A;  3P8D A;  2YUN A;  4QQG A;  1I4K 1;  2COZ A;  2JVV A;  1VQ5 T;  2RK2 A;  1EFN A;  2CZ1 B;  4XQ3 A;  5GJV B;  1ZLM A;  2EVR A;  3ME9 A;  2V8J A;  2VXE A;  2FRW A;  3E2U A;  5GJW B;  1VQK T;  4MMK A;  3EG1 A;  3SEM A;  2CP3 A;  2OTL A;  5LJ3 e;  2FPE A;  2EGE A;  4KH1 B;  1D1A A;  1YI2 Q;  1BB9 A;  3LH5 A;  4C92 G;  3G4S T;  2YXY A;  1PHT A;  1BCO A;  3LYI A;  1V76 A;  4R56 A;  1KC8 U;  4M77 E;  5CAI A;  2I2L A;  2NUT A;  4PJN A;  1JJ2 A;  3BDU A;  2K57 A;  2E5Q A;  3M56 A;  4GLM A;  2ZZD A;  1UEB A;  2DJZ A;  2P0P A;  4M7D D;  3LGL A;  3PT9 A;  1SG5 A;  1WHM A;  1SKU B;  2C0I A;  2PVG B;  1OZ2 A;  1VQN T;  1XTD A;  2E5K A;  2E4H A;  4M7A E;  1GXI E;  5HCK A;  1WJS A;  2YUP A;  2HSE B;  1RAB B;  2EYW A;  3M0R A;  5FW9 A;  3MPU B;  3PIO A;  2RI5 A;  1VYV A;  1N6A A;  1ZBX A;  3G1J A;  1M27 C;  4FYW B;  4J9C A;  4NL2 A;  3L2U A;  3A8L B;  3PE0 A;  3HTR A;  1OX9 A;  3RER A;  2LZ6 B;  3UT1 A;  2XKO C;  4F7U A;  3RIR A;  1FYN A;  1IRE B;  2RNA A;  4JLI A;  1JO8 A;  1K73 C;  1M2O A;  1QMC A;  5KCH A;  3V7S A;  5DLO A;  2J05 A;  1WLP B;  2QQB A;  1VQ9 A;  4GBQ A;  1ARK A;  3RES A;  1ABO A;  2XDD A;  2LQN A;  1H3Z A;  4ZTF A;  1QCO A;  1GCQ C;  3CCL A;  2FG0 A;  2K3X A;  5CK9 A;  4OB3 B;  2M02 A;  1UG1 A;  4J9I A;  2RQR A;  1JQQ A;  3WVD B;  3N5B B;  3CME Q;  3JCM Q;  1YFN A;  3CC2 A;  2EYZ A;  4OGC A;  4BI4 A;  5DM7 R;  2W10 A;  1KQS S;  4PL6 A;  1IXD A;  3VS7 A;  1W70 A;  2EPD A;  2QAZ A;  4J8O A;  1H8K A;  1MMN A;  1AWX A;  4Y91 A;  5KH6 A;  3EH1 A;  2WSE E;  2BTT A;  2C0T A;  3HHT B;  1RAF B;  4OVA A;  2LX9 A;  4F7U B;  2LJ0 A;  1G5V A;  4N4H A;  2F2V A;  2XG8 D;  1Q81 C;  4LXC A;  3NPF A;  3M59 A;  5IAY A;  1MMA A;  2H3E B;  1AHJ B;  1XJW B;  2XDP A;  1OPK A;  2I0N A;  2LVM A;  4M77 A;  1RUW A;  4P5N A;  3LGF A;  4LD9 K;  2EYY A;  2EGA A;  3MCA B;  1WHJ A;  4OF1 A;  3OW2 P;  3CEY A;  4LD6 A;  4HCK A;  4LDY A;  4MZP A;  3L2Q A;  1ZA2 B;  2RO0 A;  3H0F A;  1M9S A;  2KDS A;  1Q86 R;  2HL3 A;  1Y57 A;  2LC4 A;  2VVK A;  3SWN B;  3E1S A;  1UEC A;  1RI9 A;  1I07 A;  3C12 A;  3HRU A;  4M7A A;  2DRK A;  3UDC A;  1JB0 E;  2ESW A;  3QZ9 B;  3SD4 A;  1TOV A;  1TWB A;  1WQ7 A;  1VQ7 Q;  3UWN A;  1NJI U;  1OZ3 A;  2A36 A;  3ULR B;  1K0X A;  1KFZ A;  4LDV A;  5FU6 C;  2FL7 A;  1VQ8 Q;  3L1A A;  3QII A;  1M90 C;  2KE9 A;  4EMK C;  2V8I A;  1TUG B;  3UAT A;  1VQM Q;  1YBY A;  3JB9 H;  5DLQ E;  2NYS A;  2F5T X;  2LQK A;  3M5A A;  2VAS A;  3GF5 A;  3A8G B;  5LJ3 h;  3MP8 A;  2FB7 A;  1JJ2 P;  3OBW A;  2KBT A;  1ZSG A;  3FDR A;  4M7D B;  3DB3 A;  4KGX B;  1VYU A;  1VQ5 A;  1ZHI A;  4C0F A;  3SB2 A;  4HT8 A;  5AT1 B;  3OYC A;  2DNU A;  1CSK A;  2EQK A;  1XNI A;  2VGN A;  4XTY A;  3J80 E;  8AT1 B;  2LNH B;  2X3W D;  2D0Q B;  3S3N A;  3CCM Q;  1LPL A;  1U1S A;  1VQ4 T;  3G4S A;  5LJ3 j;  1M1K C;  3HRT A;  3MEW A;  3C94 A;  2VUB A;  1YHQ Q;  5CKH A;  4JRQ A;  1OUL A;  3M9Q A;  3NTI A;  4M75 D;  4D6W A;  3HL8 A;  3JB9 D;  5CKE A;  1A0N B;  4FW1 A;  3CCQ Q;  1H92 A;  3CPW S;  2QEX T;  1D0Y A;  2RQT A;  1X43 A;  2HQH A;  3QSU A;  1K8A R;  3PMI A;  3VYG A;  1QVG S;  2PUK B;  1VQN A;  3OMC A;  2CP2 A;  5GAO r;  2MAM A;  2DZC A;  5D6Y A;  3CCS Q;  3I55 Q;  2EGC A;  5AYF A;  5GAN 4;  4FSS A;  4MML A;  4QQ6 A;  2HCK A;  2KSS A;  1WHG A;  1D1B A;  3DB4 A;  1PSE A;  3E9F A;  5LL6 S;  1M1K U;  4HT9 A;  3SHW A;  2A37 A;  3SDZ A;  1X2K A;  2F2W A;  2B86 A;  2BE9 B;  5GAO p;  2FVU A;  4OML A;  4HVW A;  4C0D C;  2E65 A;  1BK2 A;  2DXU A;  4QKU A;  1FX7 A;  1Q82 R;  2YLB A;  1U3O A;  2RJC A;  1UGP B;  2P0Q A;  4X1V A;  1BI2 A;  2LTO A;  2QAS A;  4OMN A;  7AT1 B;  2DVE A;  2D9T A;  3VKI A;  2DFU A;  1RLQ C;  1NPP A;  3MHX A;  1YN8 A;  4QW2 A;  4A4F A;  2ZPG B;  2IVW A;  1UFF A;  3QHS A;  1KG1 A;  2JTM A;  2NUZ A;  2ZPF B;  1VQL Q;  2Y4X A;  1R77 A;  1M3A A;  3INZ A;  2O01 E;  4RCC A;  2HKN A;  4HXJ A;  3EHQ A;  1IHW A;  4PLI A;  1N8R C;  4FYY B;  2DL5 A;  2XD0 A;  4A4E A;  3RKW A;  1BU1 A;  5I21 A;  5I2S A;  2OTJ Q;  3J81 E;  4M78 B;  2NWM A;  2E3I A;  2L5Q A;  3G71 T;  3OYA A;  4C5G A;  4C5E A;  1TH7 A;  1D3B A;  2MIO A;  5FU7 B;  2BZY A;  3X28 B;  2M0Y A;  4FU6 A;  1VQ6 Q;  2LMJ A;  3L42 A;  1EIF A;  1UJY A;  3GBQ A;  3FC3 A;  5DY9 A;  4J9F A;  2KY9 A;  3FLG A;  4ME7 A;  3V8L A;  2PNI A;  2KT1 A;  3GPL A;  2QA4 Q;  2JZ2 A;  1I0C A;  5GMK m;  4PJO B;  1B34 B;  2WAC A;  1WXB A;  4CRI A;  5LJ5 e;  2KYB A;  1G3T A;  2AKK A;  4PLL A;  1WZO A;  2E6Z A;  3VYH B;  3EHR A;  3M0Q A;  4J9E A;  3J7A F;  2QDL A;  5GAN 3;  1NYG A;  3JCM c;  4AMC A;  4KH0 B;  2M51 A;  1ZX6 A;  2F5K A;  2JW4 A;  2PU9 B;  3MET A;  1D3B B;  1YIJ Q;  1UGQ B;  1BI1 A;  2QG9 B;  4IIM A;  5GAM j;  1LCK A;  2CS7 A;  5J39 A;  2D8H A;  3LLR A;  2RQW A;  2VC8 A;  1QVP A;  2DD5 A;  3FB9 A;  5KYX A;  2DIG A;  4IUP A;  3WVE B;  1KQ2 A;  1KQS A;  2RHZ A;  4MDW A;  4E7S A;  1ZSZ A;  3GNG A;  4M75 B;  5FWB A;  4N4G A;  1JU5 C;  3EG3 A;  2DL8 A;  3UA6 A;  5GAN e;  3CCV Q;  1FWZ A;  4CC4 B;  4OGE A;  1GCQ A;  5LJ3 g;  4M78 G;  1KHC A;  1FMW A;  2KR3 A;  2JXB A;  1K73 R;  3IQL A;  2R58 A;  1CKB A;  2CH4 W;  2XHC A;  5GAN 8;  1HD3 A;  4CI0 C;  1MGQ A;  2RHI A;  1U1T A;  2KGT A;  1X27 A;  1FMV A;  2EBP A;  2OX7 A;  5FRO A;  1BIA A;  3L2Z A;  3CC7 T;  2GTO A;  3CCJ Q;  1G2B A;  1SHG A;  1X75 C;  3UA7 A;  2XDB A;  1AZE A;  1K76 A;  2LJ1 A;  2V1R A;  3CCR Q;  2QEX A;  2AHJ B;  4PJO G;  4E7I A;  3OY9 A;  1I5L A;  4MZT A;  1R0C B;  2M9U A;  4C8Q G;  1YJ9 T;  3OW2 A;  1VQP T;  4Y92 A;  3CMA T;  2RA2 A;  1IHV A;  4DEY A;  2QTV A;  1KD1 C;  5HK0 A;  3CXC S;  1Q81 R;  1FXX A;  3JSC A;  2E41 A;  2PTK A;  3HSB A;  3EFS A;  2ROT A;  1KC8 C;  4R0K A;  2KT8 A;  3EAE A;  2L89 A;  3C95 A;  3CD6 T;  5IH2 A;  4B9W A;  3NMZ C;  1KJW A;  4ZGJ B;  4M78 F;  2G3R A;  1NZ9 A;  2KK4 A;  4PNO A;  4HCB A;  2EJF A;  1Z9Q A;  3A8M B;  1YJW Q;  2R5M A;  1K0S A;  2MPX C;  1GL5 A;  4E7J A;  1RLP C;  3JB9 G;  2M0O A;  3JCM h;  2O88 A;  1B07 A;  3S3M A;  1KHI A;  4E7Z A;  2HMA A;  4BDY A;  1VOM A;  1KD1 U;  1PNJ A;  4EMK A;  3CCE Q;  4C8Q C;  1UDL A;  2HQX A;  4WCI A;  5IT9 E;  1AOJ A;  5FRN A;  3G6E Q;  4E2F B;  5J26 A;  1SEM A;  1QWF A;  3MEA A;  4M77 D;  1X01 A;  1M1G A;  2JJ9 A;  2CZ7 B;  2LRQ A;  4JJD A;  1BBZ A;  1NE8 A;  1OPL A;  2VGM A;  2H8H A;  1AWW A;  3DLL A;  4PJO F;  1YCS B;  1M2V B;  2IPO B;  2YRC A;  4C8Q F;  2RHU A;  5I2M A;  1M90 R;  5CKD A;  4IUR A;  3MKD A;  2KRO A;  3CPW A;  4C0Z A;  2AT1 B;  1FMK A;  2KYM A;  2YSQ A;  3A8O B;  1WJQ A;  4GLK A;  3OA6 A;  1R8O B;  3OYD A;  4EDU A;  4M7A D;  1M3B A;  4A63 B;  1X6O A;  1QVG A;  5LJ3 d;  4HVU A;  3G71 A;  2RD1 A;  3M53 A;  3FEO A;  2L3P A;  2BZX A;  4C92 C;  4PFZ A;  3RMS A;  1TXQ A;  2JMA A;  1AT1 B;  2J06 A;  4EMK B;  4DBQ A;  4QQD A;  2RJE A;  5LJ5 h;  3HPW A;  2SRC A;  3QG1 A;  2NUT B;  2SEM A;  3RNJ A;  1VQO Q;  4HKE A;  4XU2 A;  2DTI A;  1TUD A;  4C92 F;  2J6F A;  4C0G A;  3HFO A;  1ZSZ C;  2R57 A;  1VIF A;  1M1K R;  2C06 A;  1KQS P;  3CC4 Q;  3A1P A;  3A8H B;  4GY5 A;  3M0S A;  3QDR B;  3MJX A;  3VU3 C;  2GNC A;  5GAM g;  3GLX A;  4XTV A;  3H6Z A;  2DYB A;  2ZPI B;  4J9B A;  2V8K A;  5LJ5 j;  3ER0 A;  3TQ7 P;  5A0G A;  1LVK A;  2J6O A;  4XAX B;  2CKK A;  2JNG A;  4RTU A;  2R5A A;  4J7F A;  4CC2 A;  3EG9 A;  4JS5 A;  3LX7 A;  1YI2 T;  3CCU Q;  2Y4Y A;  1BIB A;  5GAN h;  2JTE A;  3VS1 A;  2LDM A;  4JZ4 A;  4O6J A;  2KXD A;  2RI3 A;  2PVO B;  3TU4 K;  4O5V A;  1Q7Y U;  1S72 Q;  1NYF A;  1JXO A;  3OS5 A;  1T0J A;  2RHX A;  3M0U A;  4PFO A;  1YIT Q;  1K4U S;  3LW5 E;  3OSS C;  4J9H A;  5D6W A;  1J3T A;  1PWT A;  3OYH A;  3JCM J;  4B6M A;  2EQM A;  2EQU A;  2ED1 A;  5CKB A;  4Z89 A;  1WXT A;  1NJI C;  2CH4 A;  2RF0 A;  3LWI A;  3QBY A;  5GAN j;  1K9A A;  2OAU A;  2O2O A;  1MV3 A;  2VV5 A;  5GAN 5;  5CKF A;  1W2B S;  3MP6 A;  2X9H A;  1PD0 A;  4J6W A;  2GGR A;  4KUD K;  1TS9 A;  1OX8 A;  1YJN Q;  4MDX A;  5GMK h;  2LX7 A;  3X24 B;  4EPC A;  4QT7 A;  2CZ0 B;  2K5F A;  1HJD A;  1QKX A;  2CUB A;  5HKC A;  3CC7 A;  2ZPB B;  1DJ7 B;  3RKY A;  2RK1 A;  3OB9 A;  2DEQ A;  3QYG B;  5GAM e;  4LE9 A;  1N8R R;  3REB B;  5IHK A;  5KE2 A;  5C0M A;  4E7L A;  2DET A;  4F14 A;  1ZUK A;  2CP5 A;  1Q95 G;  1G3Y A;  1GBR A;  1YJ9 A;  1QW1 A;  3H41 A;  4L5G A;  4EMG A;  2W0Z A;  3H9N A;  3CMA A;  1VQP A;  4AFU C;  1OU8 A;  2BKD N;  5GMK j;  3L2W A;  4X34 A;  3VRZ A;  4II1 A;  4M77 B;  4ZGE B;  2MOX A;  2K3Y A;  1WJR A;  5KE3 A;  2DL7 A;  2PUO B;  4KBM B;  2DAQ A;  4FSX A;  3CME T;  3CD6 A;  3EGX A;  4BI3 A;  4Q5W A;  1NLP C;  1BI0 A;  1W4S A;  1F1B B;  3FJP A;  3A5Z B;  1IGU A;  2IG0 A;  2OTL Q;  1YIJ A;  1YP5 A;  2EW3 A;  5KYY A;  4F7U G;  3JCM W;  2HBP A;  2K3B A;  1AWJ A;  2YHT A;  5GAM d;  3CPW P;  2DER A;  4M7A B;  3ASK A;  4C8Q E;  2G6F X;  2V1Q A;  2YUQ A;  2FEI A;  1B7T A;  2QI2 A;  3V8K A;  4BI8 B;  1RAH B;  2L8D A;  1QVG P;  1U5S A;  4IIO A;  1BI3 A;  1VIE A;  2CUD A;  4JRI A;  4BE1 A;  3JCM g;  3E9G A;  4XTU A;  2RQV A;  2DM1 A;  2IIM A;  4K11 A;  2CP7 A;  4N0A C;  3U23 A;  5I11 A;  3AT1 B;  4OMF B;  4E7K A;  2JN0 A;  2KMT A;  4A54 A;  4ESR A;  3MEU A;  2CT3 A;  3JCM b;  2RQU A;  3VRY A;  5GMK l;  4ELY C;  4Z02 A;  1UTI A;  2XMF A;  2RN8 A;  4X9C A;  2K5I A;  3VS6 A;  1M3C A;  1SHF A;  4R55 A;  2JS0 A;  1ZQ1 A;  3V8J A;  3PNW C;  1PKT A;  2QQR A;  3FJ5 A;  2QGG A;  4C92 E;  1D09 B;  4C92 D;  2XI9 A;  4Z88 A;  3OS1 A;  4IUV A;  4OMQ A;  5FWC A;  4LDU A;  1M5Q 1;  2X4J A;  2CDT A;  2NUP A;  4RTZ A;  1VQ7 T;  2A3L A;  4DBF A;  3CXC A;  1SF9 A;  3CBP A;  4KT0 E;  4HVV A;  3JB9 I;  3GOX A;  1C0M A;  1VQ8 T;  4F7U F;  3OSV A;  1RAC B;  4EIK A;  1IZ6 A;  1QKW A;  2MWO A;  1VQ9 Q;  3JV3 A;  4XTZ A;  2BIV A;  2KNB B;  1E7O A;  4NOY A;  2VWF A;  1SRL A;  2CP0 A;  1VQM T;  4J6Y A;  1IB8 A;  1WQW A;  3I56 Q;  3TCJ A;  3TSW A;  4BY6 C;  2J7I A;  5LJ5 g;  4M7D G;  2COY A;  1HYO A;  1N9R A;  5KYW A;  3CCL Q;  3QJY A;  5EC7 A;  1RI0 A;  3SWN C;  3QPH A;  5GAN 6;  2FPD A;  3VS4 A;  1TU0 B;  3CC2 Q;  1QVF S;  3JCM e;  2PZ1 A;  2OJ2 A;  1ZA1 B;  3EGD A;  2A7Y A;  3WXM B;  4UC4 A;  5IXB A;  1QCF A;  2K5L A;  3O5Z A;  4HCC A;  2EAY A;  4IUT A;  1M30 A;  3CCM T;  1YI2 A;  4PK4 A;  4L6V 5;  3URG A;  1KD1 R;  1TSF A;  3OS0 A;  1QWE A;  1YHQ T;  1V29 B;  1KC8 R;  4IUU A;  2GCX A;  2DK3 A;  4HA8 A;  4JJC A;  4ORZ A;  1S1N A;  2ATC B;  5GAN g;  3CCQ T;  4E47 A;  1Y07 A;  4M7D C;  3PVQ A;  4C8Q A;  4ELZ C;  2DD4 A;  2CSQ A;  1GRI A;  3NFC A;  2E64 A;  1X6B A;  3FIF A;  1H64 1;  2MYS A;  3JCM d;  4C5I A;  2GTJ A;  3CCS T;  4M7D F;  1C6V X;  4NL3 A;  1PCX A;  2DXT A;  3I55 T;  1Q86 U;  2DO3 A;  2YT6 A;  1JXM A;  3V7R A;  3EH2 A;  5GAM h;  1RL2 A;  2HNI A;  5GAO q;  3MP1 A;  5GMK i;  3CBM A;  4BAC A;  2CP6 A;  1P92 A;  2RHY A;  1GBQ A;  2WSC E;  3O8V A;  4YTL A;  1ZUU A;  2HL5 C;  3CQT A;  3BW1 A;  4A4G A;  1MNE A;  1R0B G;  2D6F A;  1QP2 A;  5CCA A;  1Y0M A;  3GNF B;  5GAO m;  4KUL A;  4XU0 A;  2LNV A;  1LOJ A;  3VS3 A;  9ATC B;  2QQA A;  3QZ5 B;  3M54 A;  3OMG A;  4J7I A;  4C92 A;  2K79 A;  4VUB A;  4DBH A;  2E70 A;  3VS0 A;  2JMC A;  4JJN K;  5L8R E;  1UUE A;  4D8D A;  3NTK A;  3ZFJ A;  1HXD A;  1XOV A;  3OYI A;  5KYU A;  2GQI A;  1VUB A;  4A4K A;  4ZN3 A;  1VQL T;  5CR2 A;  2AIR B;  2DF6 A;  1VQ5 Q;  2KXC A;  1H3H A;  2XK0 A;  4ZNX A;  1IGQ A;  2ZPE B;  3MO8 A;  2HBW A;  2D0N A;  3PTA A;  4PJL A;  2AKL A;  2EJ9 A;  5LJ5 d;  3CME A;  2E6N A;  1VQK Q;  2FZK B;  2V26 A;  1MMD A;  1QQJ A;  3CCU A;  4OMM A;  1BCM A;  1T0H A;  3QKJ A;  4BD3 A;  3G4S Q;  2OTJ T;  4PFP A;  2ROL A;  2RH2 A;  2PQW A;  3I9Q A;  1O75 A;  2DEU A;  1JRI A;  3D7S B;  1YIT A;  3VUZ A;  2KRM A;  2LQW A;  1W2B A;  3KUF A;  4RTT A;  1VQ6 T;  1SPK A;  2M1H A;  4BUG A;  2O4X A;  3CXC P;  5KYX B;  4AFQ C;  1IO6 A;  2HAX A;  4DOV A;  1UHF A;  4RCB A;  1WGS A;  1D0X A;  2LT1 A;  1VQN Q;  1ZSZ B;  4RTY A;  2QA4 T;  1UJ0 A;  2DZ9 A;  5GMK e;  5GAN d;  4JDS A;  2LJ3 A;  4CC7 A;  4KGV B;  1GFD A;  1AVZ C;  4M78 C;  4JPB W;  3KXT A;  5HY6 A;  2F69 A;  2GF7 A;  1O9S A;  3E19 A;  2BZ8 A;  5LJ3 f;  1U8R A;  4AT1 B;  2EQI A;  2QQ9 A;  1PRM C;  1Q82 U;  2DBK A;  1G3S A;  2H3J A;  2HSP A;  2GFA A;  1D0Z A;  1VQ7 A;  3NGP A;  1WYX A;  2ZCF B;  1AZG B;  1NJI R;  1XQH A;  1YIJ T;  1VQ8 A;  4AFS C;  3OQ5 A;  2OI3 A;  2Y90 A;  4M75 G;  3SFM A;  1WHL A;  2KVQ G;  1M4Z A;  3PVL A;  2EQJ A;  1RAI B;  1VQM A;  2ZAE A;  2DVJ A;  3DKM A;  2A0F B;  2X51 A;  2CT4 A;  1IRX A;  4PJO C;  5HK3 A;  3M0T A;  3X20 B;  1I8F A;  4DA4 A;  1K9M C;  1SRM A;  1UGV A;  1JEG A;  3C4S A;  1Z9Z A;  3GP8 A;  4FYV B;  4OB0 B;  2K2V A;  4PJM A;  1SSF A;  2QK0 A;  3QXE B;  3CCV T;  1B3Q A;  4ZGD B;  1MV0 B;  1ZUY A;  4LN2 A;  2FPF A;  4QVC A;  2Z0W A;  2K6D A;  2DX1 A;  4F16 A;  2LT4 A;  1UGR B;  4WTO B;  1GFC A;  3S3O A;  1TTH B;  2LCC A;  3CBO A;  2ZPH B;  2CGH A;  3MEV A;  3CCM A;  1T3S A;  2EIF A;  4QVD A;  4C5H A;  2PVD B;  5FLX E;  1LJO A;  3I5R A;  1M1F A;  1K9M U;  3CCJ T;  4M7D E;  4M75 C;  4RKU E;  1YHQ A;  2CSI A;  2LCS A;  2VYT A;  3BDL A;  2K2M A;  1I5O B;  3CCQ A;  3CCR T;  3OS2 A;  2DPP B;  2QTX A;  2MMP A;  5FU6 B;  1EZZ B;  4RMO A;  3F70 A;  1Y96 A;  2QGF B;  3JCM X;  3FRN A;  1MMG A;  4FYX B;  1M8V A;  4M75 F;  4N0A A;  3JB9 F;  2X3X D;  3RR6 A;  2L3S A;  5A0L A;  5J3B A;  2MCN A;  1E6G A;  4RTW A;  2A08 A;  3CCS A;  3RDV A;  3JAM E;  1WFW A;  3I55 A;  2KRN A;  3TRE A;  2B8A A;  1Q7Y C;  3OYF A;  3H0H A;  3L2R A;  2FZC B;  3Q1J A;  3LWH A;  2J6K A;  3OYN A;  4OMP A;  5FRM A;  2DXC A;  5I22 A;  3JB9 J;  1RAA B;  1KIK A;  4LNP A;  3EG0 A;  5GAN 2;  1YJW T;  3JCM P;  3BY7 A;  4JRK A;  1AWO A;  1WDX A;  3OYK A;  3RKX A;  3P8H A;  3VJP A;  3I56 A;  2E1H A;  4IKF A;  1QVF A;  1WA7 A;  2ECZ A;  5CQX A;  2OAW A;  3L2V A;  3CCE T;  1Y96 B;  2DL4 A;  4OB1 B;  1MND A;  2YUO A;  4FT2 A;  4A53 A;  3G6E T;  3VV0 A;  3JCM V;  1N27 A;  2DTH A;  1VQL A;  3HRS A;  2YWW A;  1W2B P;  5GAO n;  4J9G A;  3NTH A;  3A98 A;  4LDW A;  3M4G A;  3TVT A;  4WF2 A;  2DXB A;  3EGU A;  3DLM A;  1BYM A;  2QDY B;  1K73 U;  3SWN A;  1ABQ A;  1OYX A;  4XTX A;  4X9D A;  2ZGW A;  2X4Y A;  4LUE A;  4J5Y A;  2GFU A;  3PFS A;  5GAM f;  2BUD A;  3M55 A;  1VQ4 Q;  5IN1 A;  2OTJ A;  2E10 A;  3M0P A;  5D6X A;  4FCY A;  4QVZ A;  4L59 A;  2DKG A;  2QXF A;  3EG9 B;  4XTW A;  2JS2 A;  2D1X A;  4C0D B;  2HQE A;  4DOW A;  2FYK A;  3OYM A;  3UPU A;  2QEX Q;  4J83 A;  1VQ6 A;  2AK5 A;  1OV3 A;  1Y71 A;  1YNZ A;  2O9S A;  1VQO T;  5KYN A;  4M7D A;  4BY6 B;  3EFO A;  1WHK A;  3V7C A;  4A4H A;  2L3Q A;  1RAD B;  2QA4 A;  4M78 E;  4M78 D;  1OQK A;  1Q81 U;  2EJG A;  1JBM A;  2P84 A;  4RG8 A;  1WX6 A;  2NLU A;  1TG0 A;  2JT4 A;  3CC4 T;  1NEG A;  2RPN A;  2P4R A;  1PM3 A;  3OW2 S;  5D7U A;  3KBG A;  4HCZ A;  2KAF A;  5A2Q E;  2AZV A;  3OYE A;  1E6H A;  2DMO A;  3QWX X;  3BE3 A;  2DL3 A;  2P4T A;  1VYT A;  2HZY A;  2JM9 A;  3X26 B;  2DA9 A;  4B9X A;  3QYH B;  1WHH A;  4N4I A;  4XU3 A;  2COW A;  3HP9 A;  3CCU T;  1OOT A;  4M4Z A;  1BKB A;  1N5Z A;  1NLO C;  4RUG A;  1K1Z A;  3OBY A;  4FW2 A;  1AEY A;  4FIB A;  4PJO E;  3RMQ A;  4PJO D;  3HFN A;  1S72 T;  3EFR A;  2EWN A;  4FL6 A;  4C8Q D;  4EMH A;  4E7H A;  1G8X A;  4DQ2 A;  3UF4 A;  5A0D A;  1YIT T;  3EFO B;  4FM4 B;  4Y28 E;  4KRT A;  2CZ6 B;  4F17 A;  4Z8A A;  2XU8 A;  3CCV A;  1M90 U;  1VQK A;  1RAG B;  2DIL A;  1VA7 A;  4OB2 B;  5IHN A;  3TEE A;  3AHU A;  1W6X A;  1JJ2 S;  4OP0 A;  3R6N A;  3OYY A;  3TSZ A;  4DEX A;  2BE7 D;  2L2P A;  4NS5 A;  1YJN T;  3EGX B;  4M75 E;  3G71 Q;  3LH0 A;  2VKN A;  3M58 A;  1UE9 A;  2VB6 A;  1X2Q A;  2CRE A;  4ZN1 A;  2ENM A;  4V2S A;  1KQ1 A;  5KYY B;  2FRY A;  1I81 A;  3PIP A;  2XID A;  3CCJ A;  1I1J A;  5GAO l;  1UHC A;  4MZM A;  1NM7 A;  3CCR A;  2CYZ B;  1HSQ A;  4BB7 A;  5GAN 7;  2DRM A;  2E3H A;  1G3W A;  3ZL7 C;  1U06 A;  1YWO A;  2HD0 A;  4M77 G;  4RG2 A;  3JCM f;  1QP3 A;  3PGG A;  1QVF P;  2JM8 A;  1NEB A;  4ZTJ A;  3M4Y A;  4J9D A;  1MHN A;  2X4W A;  4BE0 A;  1OEB A;  1X6G A;  2A28 A;  3R6O A;  4M78 A;  3I5S A;  2DE0 X;  3OYG A;  1ACM B;  2OTL T;  4M7A G;  4AFZ C;  3KFV A;  3RUX A;  2E12 A;  3G7Z A;  3ZBD A;  1QLY A;  1YJW A;  1PD1 A;  1NPR A;  4KUI A;  5M9O A;  1EX4 A;  3M57 A;  3OYJ A;  2K4Y A;  1C1A A;  2NUP B;  3EG2 A;  2RB6 A;  2HEQ A;  1Q86 C;  2FZG B;  4RTX A;  2RJD A;  3CCE A;  1ZBJ A;  4CC3 A;  4M77 C;  1UGS B;  3P8B B;  3G6E A;  2GBQ A;  2K9G A;  4ANJ A;  2GQV A;  1NG2 A;  2QYZ A;  1LNX A;  4PJO A;  2EKH A;  4BDZ A;  8ATC B;  1B34 A;  2VXF A;  2EYQ A;  1GCP A;  1OU9 A;  2EKO A;  3BFM A;  5KYW B;  5LJ5 f;  4M77 F;  3PMT A;  5IXF A;  2P0K A;  2FHD A;  1Y7X A;  4M7A C;  3GIB A;  3QJ6 A;  3VUB A;  1PG5 B;  4OMO A;  4D8K A;  1AD5 A;  1K9M R;  2HDA A;  3EGD B;  4XK8 E;  1G83 A;  3RBB B;  3CC7 Q;  2YLC A;  3QO3 A;  2DLP A;  1T3L A;  1PKS A;  6AT1 B;  3QWY A;  2XIC A;  4M7A F;  1PSF A;  1N8R U;  3C0C A;  1QCN A;  1PC0 A;  4M75 A;  2MWP A;  4JZ3 A;  4DBR A;  2DTO A;  1OI1 A;  2O31 A;  3OYB A;  1VQ9 T;  3QUI A;  1YJ9 Q;  1VQO A;  3I56 T;  1VQP Q;  3CMA Q;  5EG2 A;  3HKS A;  2DIQ A;  1N9S A;  5GAN f;  2O9V A;  4AG1 C;  4C8Q B;  3CCL T;  2LQ8 A;  2RMO A;  2DYI A;  2YRD A;  3H8Z A;  3CC4 A;  5L23 A;  5CIU A;  2QQS A;  1M8M A;  1X69 A;  4E6R A;  2JUF A;  1SSH A;  4BE2 A;  3CD6 Q;  3CC2 T;  2AZS A;  1WI7 A;  2C0O A;  2D8J A;  4TVR A;  2M16 A;  5CO7 A;  1YWP A;  4F04 B;  2X35 A;  1K8A C;  4JS4 A;  1WPY A;  2KI7 A;  1CKA A;  2DBM A;  3H0I A;  3CPF A;  2YDL A;  5C6S A;  5IHI A;  2K7A A;  3S6W A;  4ATO A;  1HK9 A;  1UB4 A;  3JRZ A;  3NHN A;  3VS5 A;  2FO0 A;  2KRS A;  1S72 A;  4XU1 A;  3X25 B;  1Q7Y R;  2F2X A;  4C92 B;  3I35 A;  4FT4 A;  1WIE A;  2DJQ A;  2YRV A;  2EYX A;  2F1L A;  1Q82 C;  4PJJ A;  2ABL A;  5CQY A;  5ECA A;  2LP5 A;  1RAE B;  1K8A U; 
#chains in the Genus database with same CATH homology
 2L3S A;  2MCN A;  1E6G A;  2KEA A;  4RTW A;  2A08 A;  3VS2 A;  1WFW A;  2MOX A;  3EHQ A;  2KRN A;  4HXJ A;  3THK A;  2DL7 A;  1V1C A;  2DL5 A;  3H0H A;  1KSW A;  1NLP C;  2J6K A;  1YP5 A;  2EW3 A;  1BU1 A;  2L0A A;  4RTV A;  4OMP A;  5I22 A;  2NWM A;  2K3B A;  1AWJ A;  1MUZ A;  1KIK A;  4LUD A;  4LNP A;  3EG0 A;  2G6F X;  1AWO A;  1WDX A;  2V1Q A;  2YUQ A;  2ED0 A;  2MIO A;  2FEI A;  2BZY A;  2M0Y A;  1W1F A;  2ECZ A;  1U5S A;  1WA7 A;  1WXU A;  2OAW A;  4IIO A;  2LMJ A;  2CUD A;  1UJY A;  3GBQ A;  2RQV A;  1PRL C;  2DL4 A;  1TUC A;  2DM1 A;  2IIM A;  2YUO A;  4J9F A;  4K11 A;  4AG2 C;  3U23 A;  5I11 A;  2PNI A;  2KT1 A;  3REA B;  4J9G A;  4ESR A;  4JJB A;  1I0C A;  3A98 A;  2YUN A;  2CT3 A;  2RQU A;  3TVT A;  3VRY A;  3EGU A;  1EFN A;  5GJV B;  1ZLM A;  1UTI A;  2EVR A;  1WXB A;  1ABQ A;  2XMF A;  2RN8 A;  2KYB A;  2AKK A;  3VS6 A;  1M3C A;  1SHF A;  3EHR A;  3M0Q A;  2FRW A;  4J9E A;  2JS0 A;  2QDL A;  5GJW B;  4LUE A;  1NYG A;  1PKT A;  3FJ5 A;  3EG1 A;  3SEM A;  2FPE A;  2EGE A;  2M51 A;  4Z88 A;  1ZX6 A;  2JW4 A;  5FWC A;  4OMQ A;  1BB9 A;  3M0P A;  3LH5 A;  2CDT A;  4RTZ A;  1PHT A;  4HVV A;  4IIM A;  1LCK A;  2D8H A;  2D1X A;  2JS2 A;  2RQW A;  4EIK A;  4GLM A;  1QKW A;  2AK5 A;  3JV3 A;  2KNB B;  1E7O A;  1OV3 A;  2VWF A;  1SRL A;  1YNZ A;  2O9S A;  3TSW A;  5FWB A;  2J7I A;  1JU5 C;  3EG3 A;  2C0I A;  2L3Q A;  2DL8 A;  3UA6 A;  5EC7 A;  4CC4 B;  2E5K A;  1WX6 A;  1GCQ A;  1TG0 A;  5HCK A;  2JT4 A;  2KR3 A;  2YUP A;  2FPD A;  1NEG A;  2JXB A;  3VS4 A;  2RPN A;  2EYW A;  3M0R A;  5FW9 A;  2P4R A;  3IQL A;  1CKB A;  2CH4 W;  2PZ1 A;  2OJ2 A;  1VYV A;  2AZV A;  5IXB A;  1HD3 A;  1QCF A;  1E6H A;  2DMO A;  3QWX X;  2DL3 A;  1M27 C;  4J9C A;  1VYT A;  3O5Z A;  2KGT A;  2JM9 A;  1M30 A;  3PE0 A;  1X27 A;  2DA9 A;  2EBP A;  2LZ6 B;  2GTO A;  1OOT A;  4M4Z A;  1G2B A;  1SHG A;  1FYN A;  1N5Z A;  1NLO C;  4RUG A;  1QWE A;  1K1Z A;  3UA7 A;  2RNA A;  1AEY A;  1JO8 A;  1AZE A;  1K76 A;  2LJ1 A;  2V1R A;  4JJC A;  2J05 A;  4ORZ A;  1S1N A;  1WLP B;  3PVQ A;  4GBQ A;  3UF4 A;  1ARK A;  1ABO A;  2CSQ A;  1GRI A;  2LQN A;  4Y92 A;  4KRT A;  1GCQ C;  1X6B A;  4F17 A;  4DEY A;  2FG0 A;  4Z8A A;  1UG1 A;  4J9I A;  2PTK A;  2DIL A;  2RQR A;  1VA7 A;  2GTJ A;  1JQQ A;  5IHN A;  2ROT A;  2YT6 A;  1W6X A;  1JXM A;  4R0K A;  2KT8 A;  3R6N A;  2EYZ A;  5IH2 A;  2W10 A;  3TSZ A;  3NMZ C;  1KJW A;  3VS7 A;  4DEX A;  1W70 A;  2EPD A;  2L2P A;  1GBQ A;  1H8K A;  1ZUU A;  1AWX A;  3CQT A;  1Z9Q A;  2VKN A;  1UE9 A;  1X2Q A;  2BTT A;  2C0T A;  1K0S A;  2CRE A;  1GL5 A;  2LJ0 A;  2ENM A;  1RLP C;  1Y0M A;  2FRY A;  2F2V A;  2O88 A;  1I1J A;  1B07 A;  3VS3 A;  1UHC A;  3NPF A;  2K79 A;  1NM7 A;  1PNJ A;  1UDL A;  4WCI A;  3VS0 A;  1HSQ A;  1AOJ A;  2JMC A;  2DRM A;  1UUE A;  1SEM A;  4D8D A;  1QWF A;  1OPK A;  3ZL7 C;  2I0N A;  1XOV A;  4JJD A;  1BBZ A;  1U06 A;  1OPL A;  1YWO A;  2GQI A;  1RUW A;  2H8H A;  1AWW A;  2EYY A;  2EGA A;  1YCS B;  2DF6 A;  2JM8 A;  1NEB A;  2KXC A;  1H3H A;  4ZNX A;  4HCK A;  4J9D A;  2HBW A;  2D0N A;  3H0F A;  2KRO A;  1OEB A;  1Y57 A;  1X6G A;  2AKL A;  1FMK A;  2KYM A;  2YSQ A;  2A28 A;  2VVK A;  3I5S A;  4OMM A;  1UEC A;  1RI9 A;  1I07 A;  1M3B A;  2DE0 X;  4A63 B;  2DRK A;  2ESW A;  1T0H A;  4AFZ C;  3KFV A;  4HVU A;  1QLY A;  2L3P A;  2ROL A;  3ULR B;  2A36 A;  2BZX A;  1K0X A;  3I9Q A;  1KFZ A;  2KE9 A;  2KRM A;  2JMA A;  3EG2 A;  2J06 A;  2LQW A;  2HEQ A;  3UAT A;  4RTX A;  4RTT A;  2SRC A;  1ZBJ A;  1SPK A;  4CC3 A;  2SEM A;  3RNJ A;  2GBQ A;  2K9G A;  1IO6 A;  4AFQ C;  1NG2 A;  1UHF A;  1TUD A;  2J6F A;  2EKH A;  4RTY A;  2KBT A;  1ZSG A;  1UJ0 A;  1GCP A;  1VYU A;  2LJ3 A;  4CC7 A;  1GFD A;  3M0S A;  1AVZ C;  2GNC A;  4JPB W;  2DNU A;  1CSK A;  5IXF A;  2DYB A;  4J9B A;  2BZ8 A;  2EQI A;  4OMO A;  4D8K A;  1PRM C;  2LNH B;  2J6O A;  1AD5 A;  2DBK A;  2HSP A;  2X3W D;  4RTU A;  2HDA A;  4CC2 A;  1G83 A;  3RBB B;  3NGP A;  1WYX A;  1AZG B;  2DLP A;  1T3L A;  2JTE A;  3VS1 A;  1PKS A;  4AFS C;  4JZ4 A;  3QWY A;  2KXD A;  3C0C A;  2OI3 A;  1A0N B;  1H92 A;  1NYF A;  4JZ3 A;  1JXO A;  1T0J A;  3PVL A;  2RQT A;  1X43 A;  3M0U A;  2O31 A;  1K4U S;  2DVJ A;  2CT4 A;  4J9H A;  3M0T A;  1JEG A;  1SRM A;  1UGV A;  1PWT A;  1J3T A;  1Z9Z A;  2O9V A;  4AG1 C;  2ED1 A;  4Z89 A;  1WXT A;  2RMO A;  2CH4 A;  2RF0 A;  5L23 A;  1B3Q A;  2EGC A;  1M8M A;  1MV0 B;  4FSS A;  2HCK A;  1ZUY A;  4LN2 A;  1K9A A;  1X69 A;  4E6R A;  1SSH A;  3SHW A;  2FPF A;  2O2O A;  1MV3 A;  2K6D A;  2DX1 A;  4F16 A;  2A37 A;  1X2K A;  2AZS A;  1WI7 A;  2B86 A;  2F2W A;  2GGR A;  1GFC A;  2C0O A;  2D8J A;  1YWP A;  4OML A;  2LX7 A;  4HVW A;  1CKA A;  1BK2 A;  2DBM A;  3H0I A;  4QT7 A;  1U3O A;  1HJD A;  1QKX A;  1T3S A;  2CUB A;  2YDL A;  4X1V A;  3I5R A;  5IHI A;  4OMN A;  2K7A A;  2CSI A;  2LCS A;  3NHN A;  2K2M A;  4LE9 A;  3VS5 A;  3REB B;  2FO0 A;  1RLQ C;  5IHK A;  2KRS A;  2F2X A;  4F14 A;  1ZUK A;  1YN8 A;  3I35 A;  1GBR A;  1WIE A;  2DJQ A;  3H41 A;  2EYX A;  1UFF A;  2NUZ A;  2W0Z A;  4AFU C;  2ABL A;  5ECA A;  2LP5 A;  1M3A A;  3VRZ A;  2X3X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...