3M0TA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 9.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0tA00
4J9GA 1KIKA 2L3SA 4HXJA 1QKWA 1AWXA 3UA6A 2X3WD 1WXTA 2ENMA 1ZUKA 2FRYA 1AEYA 1HJDA 2CH4W 4CC3A 1OEBA 2O88A 2DL5A 2KROA 1UFFA 2FRWA 4JPBW 3PE0A 1GRIA 1I1JA 1PNJA 2YUQA 1G2BA 2QDLA 1WLPB 1CKBA 2LX7A 2P4RA 2OI3A 2BZ8A 4J9BA 2HDAA 1E6HA 2DF6A 1U5SA 2NUZA 1UTIA 2LZ6B 4LUEA 2J05A 1SEMA 1GCQC 1MV0B 2K9GA 1ARKA 2F2XA 3C0CA 2FO0A 3M0RA 4RTTA 2FEIA 2D0NA 1SHFA 2EKHA 1NEGA 2VWFA 2DMOA 2RNAA 4DEXA 4F16A 1K0SA 2JMAA 1B3QA 2A37A 3M0SA 1W1FA 1LCKA 1Z9QA 2O2OA 3RBBB 4OMQA 2RQRA 3LH5A 1OPLA 1UUEA 1SSHA 3VS1A 4AG1C 3EHRA 2W10A 2GTOA 2M0YA 1VYTA 2RQUA 1QCFA 4EIKA 2DBMA 1OOTA 1SPKA 4FSSA 1PRMC 2PNIA 4AFZC 1GBRA 2KE9A 1SRMA 2CUDA 2I0NA 2GQIA 1AD5A 2XMFA 2EW3A 1YWPA 4Y92A 1AVZC 1CKAA 3I5RA 3M0QA 1G83A 4LUDA 2RQVA 4RTZA 3FJ5A 1B07A 2JS2A 2K79A 4AFSC 1H92A 1TUCA 2EPDA 5IXFA 3REAB 2C0IA 1UECA 1M30A 1AZGB 1WFWA 1UJ0A 1M3AA 3H0IA 1A0NB 2RN8A 4RTYA 3A98A 2EGEA 1U06A 4CC2A 4Z88A 1UE9A 5IH2A 1H3HA 1Y57A 1CSKA 2GGRA 1QWFA 3H41A 2JT4A 2C0TA 1KSWA 2BZXA 2H8HA 2LQWA 2EBPA 2JTEA 1N5ZA 1QKXA 3EG3A 4M4ZA 2CDTA 1NLPC 1X6GA 5IHNA 1NYFA 1PKTA 2CSQA 1YNZA 2DNUA 2GNCA 2K2MA 2ABLA 4DEYA 2J6KA 1ABQA 3ZL7C 4OMPA 4CC7A 5IHKA 1NG2A 2HCKA 2GTJA 3VRZA 1IO6A 1U3OA 1E6GA 3O5ZA 1RUWA 2IIMA 2YUPA 5GJVB 2KBTA 3RNJA 4JZ3A 4J9EA 5ECAA 2AZSA 4LNPA 2MCNA 2E5KA 3M0PA 2LNHB 1WI7A 1M3CA 3EGUA 2EGAA 2MOXA 4LN2A 2DYBA 3EG1A 4D8DA 2FPEA 1K1ZA 4F14A 2DA9A 5L23A 1X6BA 3SHWA 1ZUUA 2PTKA 3PVLA 1EFNA 2EQIA 2DJQA 1ZLMA 4OMOA 3EHQA 2VKNA 3VS2A 4JZ4A 2FG0A 1W6XA 1M3BA 1X27A 1Z9ZA 4QT7A 2K7AA 1AZEA 1ZX6A 2KR3A 2LP5A 4HCKA 1M8MA 4JJBA 2FPDA 2JXBA 2F2VA 2JW4A 2D1XA 3UA7A 2RQTA 2V1QA 2L2PA 5IXBA 2NWMA 1PWTA 1FYNA 4J9HA 1UDLA 2YUOA 3SEMA 1HSQA 3VS7A 4RTXA 2DRMA 2ED1A 2K3BA 1WYXA 4LE9A 1TG0A 2DE0X 5GJWB 4Z89A 4ESRA 4ORZA 3GBQA 2KRSA 2O31A 1YWOA 3JV3A 3UF4A 5FWCA 2L3PA 1AWOA 3TSWA 1GCPA 4X1VA 3UATA 3VS0A 1T3LA 1BB9A 2G6FX 2EVRA 2OAWA 4J9IA 2EYZA 1PHTA 1RLQC 5HCKA 1JO8A 1JQQA 1MV3A 1YP5A 4Z8AA 4ZNXA 1OV3A 2D8HA 2DILA 1ABOA 1YN8A 1FMKA 2CH4A 1S1NA 2RPNA 1I07A 2O9VA 2YUNA 1V1CA 2F2WA 4RTVA 2J6OA 1J3TA 2LMJA 2KXDA 2KYBA 1JXMA 2C0OA 3M0UA 3TVTA 2L3QA 2KEAA 3TSZA 2KRMA 2V1RA 1GFCA 5FWBA 1GCQA 2CT3A 1I0CA 1X43A 2DL8A 2DLPA 2KYMA 2K6DA 1GL5A 4A63B 1TUDA 2J7IA 4HVVA 2JM9A 2SRCA 1AWWA 2D8JA 1UG1A 2PZ1A 2B86A 2RQWA 2RF0A 1XOVA 2HBWA 1WIEA 2EGCA 3NHNA 2KT1A 2AZVA 2M51A 1UGVA 2DBKA 1KFZA 1QLYA 3EG2A 1PKSA 1UHFA 1QWEA 2ROLA 2HSPA 1X69A 2CSIA 2ECZA 4J9CA 3R6NA 1GBQA 1UHCA 3EG0A 1JEGA 1WA7A 5FW9A 1T3SA 4AFUC 2BZYA 2KNBB 2SEMA 1ZSGA 2LJ3A 3QWYA 1JXOA 2RMOA 4F17A 4JJDA 1NM7A 1NLOC 1BU1A 5I11A 3NPFA 2JMCA 2YSQA 1VA7A 2KXCA 1ZBJA 4RUGA 3IQLA 1SRLA 1NYGA 4GLMA 3CQTA 2BTTA 1HD3A 3QWXX 3NGPA 4RTUA 4D8KA 4E6RA 2A28A 2EYXA 1ZUYA 2KT8A 3I35A 5EC7A 2KGTA 1BK2A 2KRNA 1K0XA 4OMNA 1X2QA 4GBQA 2FPFA 1T0JA 1YCSB 1W70A 3VS4A 1MUZA 3VS3A 2LJ0A 4IIOA 2DL7A 2ED0A 4HVUA 3H0FA 1E7OA 4WCIA 1RI9A 1SHGA 2O9SA 4IIMA 1VYUA 2OJ2A 2J06A 1M27C 1AOJA 1WXUA 2JM8A 3U23A 3VS6A 4HVWA 4RTWA 1X2KA 2HEQA 4OMMA 1H8KA 3THKA 1WDXA 2AK5A 5IHIA 2DVJA 2DL4A 2EYYA 2DM1A 2LCSA 1JU5C 3NMZC 1K9AA 2EYWA 1WX6A 3VS5A 3I9QA 1WXBA 2CT4A 4J9DA 1UJYA 1Y0MA 2LQNA 1BBZA 2A36A 4CC4B 2L0AA 2CUBA 4AG2C 3KFVA 1GFDA 3VRYA 2CREA 2W0ZA 2ROTA 3I5SA 2LJ1A 2YT6A 2DRKA 2AKKA 2DL3A 1K76A 4J9FA 5I22A 2ESWA 2J6FA 2MIOA 2YDLA 1RLPC 1AWJA 1PRLC 2JS0A 4OMLA 3M0TA 2A08A 3PVQA 4R0KA 4K11A 1OPKA 4AFQC 1KJWA 2AKLA 1K4US 3H0HA 3REBB 1T0HA 4KRTA 1NEBA 3ULRB 1VYVA 2DX1A 2X3XD 2VVKA 2GBQA 4JJCA
chains in the Genus database with same CATH superfamily
3RKYA 2YLBA 2QGGA 2E12A 5CKDA 4PLIA 2EIFA 3UA6A 5GAMj 4BDYA 2X3WD 1OZ3A 4QVZA 1WXTA 1RAFB 2FRYA 3EGDA 4M77A 2HAXA 3NFCA 3EFSA 5EG2A 1NPRA 5A0DA 2CP3A 5GMKe 1PNJA 2YUQA 1FMVA 1G2BA 2V8KA 4LDWA 4ZGDB 2P4RA 2KY9A 4IUTA 2DF6A 3LWHA 5GAN2 2DZ9A 1ACMB 2NUZA 1WHKA 1SEMA 1UB4A 3A8LB 2DETA 3V8KA 8ATCB 1QVFP 2E5QA 3C0CA 2F5TX 4XU1A 1BCMA 1NEGA 3CCRT 2JMAA 1D3BB 2PUOB 1VQ5T 2HNIA 3M5AA 3LH5A 1UUEA 5KYXB 4AG1C 3KUFA 4XK8E 1IREB 2JTMA 4KULA 4QVDA 2Z0WA 2MAMA 3TEEA 5GAOm 2L89A 4M75D 2RD1A 3MO8A 3CXCS 1VQMT 2OTJA 2F69A 1S72A 4A54A 3CCUA 1PRMC 3MP1A 4OGCA 2GQIA 3CD6T 1AD5A 3MEVA 3SB2A 3JB9I 5FLXE 2RA2A 5CAIA 1TUGB 1QQJA 3QUIA 1VQLQ 1G83A 4M7AE 4J7FA 1VQ7Q 1V29B 2VV5A 4M7AB 4ZN3A 3RERA 2JS2A 2DTOA 1H92A 5D6XA 1TUCA 2JVVA 2CKKA 4MZMA 2EPDA 5GAN8 4GLKA 1VQPA 5LJ5d 4XTUA 2C0IA 4PJOA 1WJSA 2DEUA 1A0NB 4RTYA 3SFMA 5GAMg 3PGGA 3JCMV 1YIJA 4DOVA 4CC2A 3OS5A 1UE9A 2QAZA 2GGRA 4JRQA 2JT4A 4C8QG 2LT1A 3EG3A 4M4ZA 2CDTA 2QI2A 5IHNA 2RB6A 1PKTA 3BFMA 3CCLQ 4DEYA 1VQ4A 1O9SA 5GANd 4OMPA 3BY7A 2ZGWA 3TREA 2HCKA 4E7SA 2JTFA 3VRZA 3QZ9B 2D0QB 2V8IA 4LNPA 1QP2A 3KBGA 2E5KA 4IURA 1WI7A 2DK3A 2MOXA 4PJJA 3CPWA 4LN2A 2M9UA 3I55A 1YITT 1M2VA 4A4FA 4NL2A 5L23A 3M55A 1WQWA 2RHUA 1QP3A 3PVLA 1EFNA 1BI1A 1WJRA 1ZQ1A 5LJ3e 3CCEA 2BKDN 3EGXA 3EHQA 2QA4Q 2LCLA 1YFNA 5HK0A 3JCMf 1UGSB 2CP6A 1U1SA 3RDVA 2K2VA 1VQLT 1Y7XA 1VQ7T 4HCKA 1M8MA 4A4EA 5KH6A 4XQ3A 1M1KR 1QVGP 5CQYA 3P8DA 2F2VA 4IKFA 2D1XA 4M77F 2P0KA 4C92D 3SWNB 2XG8D 1PWTA 1FYNA 5LJ5h 1VQKA 1UDLA 2YUOA 3LLRA 1RAGB 2RM4A 1VQOA 4OB2B 2K3BA 2GFAA 1TG0A 1D0ZA 2AHJB 4Z89A 4ESRA 1BKBA 2O31A 3HFOA 5FWCA 3TSWA 3CCMQ 4X1VA 4PK4A 3OYHA 3G6ET 3VYHB 1BB9A 3ASKA 2DPPB 3H8ZA 5GANh 3CCJQ 1RLQC 5HCKA 4IUVA 4LDYA 3CBMA 4Z8AA 4XU3A 3DB4A 3JCMc 2H3JA 4OB1B 2YRCA 1I07A 2YUNA 4M75B 2IG0A 2LX9A 2F2WA 3QG1A 2LMJA 2KXDA 2YLCA 4C5HA 5FU6C 1I81A 2ZPEB 4MMKA 4PLLA 5CK9A 1NZ9A 2LQKA 3L42A 3E2UA 1NJIR 2DXCA 1K73C 3S6WA 5FWBA 5LJ3h 2CT3A 1I0CA 3A8OB 1IHWA 3QPHA 2QA4T 4JRKA 3PIPA 4C5IA 4BB7A 2LTOA 3H9NA 2JM9A 4HVVA 2RQWA 2ZCFB 1ZHIA 1M1GA 2COZA 4PL6A 2QEXA 3OS2A 4F04B 4PJOF 3RIRA 4M78A 2HBWA 5IAYA 1WIEA 1Q7YR 4OB0B 4HA8A 4YTLA 3LW5E 2M51A 1UHFA 1HYOA 2HSPA 4BD3A 3GPLA 3FEOA 1NE8A 5LJ5j 1UHCA 1TOVA 3S3OA 3CC7Q 5FW9A 3PT9A 1R0BG 3CCSA 2KNBB 1PSFA 2PQWA 1ZSGA 4JS5A 2Y90A 2QQSA 4N4HA 3INZA 5GAOq 4F17A 1X75C 4KUDK 1N27A 1BU1A 3EFOA 2DXBA 3VU3C 1MMNA 1ZBJA 5C6SA 1KG1A 2IVWA 4GLMA 2E10A 3CCMT 1OX8A 1F1BB 3FB9A 4FYXB 5DLQE 5GANj 4D8KA 2EYXA 2HBPA 2KT8A 3I35A 2NYSA 1BK2A 3L2VA 4ZTFA 1X2QA 1X01A 2FPFA 1BIAA 3C4SA 1YCSB 4LXCA 3VS4A 4QQ6A 5I2MA 1E7OA 2E3IA 2DD4A 4WCIA 1RI9A 4GY5A 2MMPA 3LGFA 4M75F 3X25B 1WXUA 1AOJA 4L5GA 4TVRA 1YJNA 3JB9J 3RKWA 3VS6A 2DYIA 1Q82R 3J7AF 5GAOn 3URGA 2HEQA 2X35A 4M7AC 2LVMA 3CCLA 1WDXA 2AK5A 2B8AA 3QYGB 2NUPA 3FDRA 2DM1A 2LCSA 5IN1A 4LDUA 4J6YA 1I4K1 1D1AA 3P8HA 4RKUE 5GAMe 3VYGA 4C92E 3VS5A 3JB9F 3I9QA 5CKEA 3N5BB 1AT1B 4C92B 4J6XA 2RI3A 1YI2A 3OS0A 5KCOA 1OZ2A 1YHQA 2OTJQ 3RESA 3X24B 2NUTB 4EMGA 4F7UA 1JB0E 1JBMA 5LJ5g 2VGNA 2DRKA 2EQKA 4WTOB 1ZSZC 4J9FA 2CP7A 4JUVA 3I56Q 4CRIA 2M1HA 3HRTA 2LT4A 3QDFA 3H6ZA 3QSUA 2JS0A 4OMLA 3X20B 3GNGA 1UGQB 3M57A 1VQPQ 1T0HA 3J80E 1KQSS 1VYVA 2DX1A 2X3XD 5LJ5f 5DY9A 4A4GA 1VUBA 5GANg 2YXYA 1KIKA 2QXFA 4HXJA 1R0CB 1YIJQ 3HRUA 2PUKB 4LDVA 2E65A 1ZUKA 2A7YA 1Q86R 1MNEA 2CZ6B 1M9SA 1OEBA 2E64A 3PE0A 1I1JA 1VQ4Q 2O4XA 2K5FA 4EMKC 2HDAA 2P0QA 1U5SA 5HKCA 1WHLA 4JJNK 4DBHA 1ARKA 1VQNA 2F2XA 5FRMA 4M77D 3OYBA 4M78F 3CCJA 3SWNC 4KH0B 1LCKA 1B34A 3EH2A 2RHIA 3I55Q 2GTOA 2M0YA 5LJ3f 1G8XA 2HQHA 1S72T 1VYTA 1MGQA 3CCEQ 1G3YA 3CCUT 1QCFA 4EIKA 1SPKA 1K8AC 2ZPBB 4FSSA 1VQ8A 2HZYA 2X9HA 1M1FA 3L2WA 3CC2Q 1G3SA 1SRMA 2I0NA 1PSEA 5KCHA 2EW3A 3X28B 1YWPA 4Y92A 1AVZC 1BI2A 1CKAA 3I5RA 4LUDA 4DBFA 2RQVA 2MK5A 3SD4A 4RTZA 2K79A 4AFSC 5J39A 4QQDA 2YWWA 4M7DG 4E7LA 1WZOA 4MDXA 2LC4A 2RJEA 3G7ZA 1WFWA 2ZPGB 1YIJT 1IB8A 3QIIA 1VQOQ 4XTYA 3A98A 3LX7A 2GFUA 2DIQA 2QYZA 3CC7A 3OW2A 1QWFA 3H41A 1R8OB 2C0TA 2BZXA 2DO3A 3OYKA 1M90R 1I5LA 2EBPA 1PG5B 1N5ZA 1VQ4T 1D3BA 1WQ7A 2VB6A 1NYFA 2RJDA 2HL3A 2K2MA 2DNUA 1ABQA 4PJOD 4LD9K 3OYLA 5IHKA 1M1KC 1N8RC 3JRZA 4PFZA 2GTJA 1QVFS 3EG9B 1AHJB 1SF9A 3V7SA 1U3OA 1E6GA 1RUWA 2IIMA 5KYWB 1RABB 5GJVB 2KBTA 4KT0E 1Q81R 5ECAA 1PD1A 4C8QA 4N4GA 4BI8B 3I55T 4N0AC 1V76A 4F7UF 2KMTA 4ZN1A 4AT1B 4EPCA 3EG1A 1TTHB 1H3ZA 4Q5WA 1OI1A 4HCCA 2FPEA 3CCET 3UT1A 2QQ9A 1X6BA 2L8DA 3CPWS 1C6VX 1TWBA 5GAOp 4OMOA 4NS5A 2X4XA 4JZ4A 3DB3A 2FG0A 1M3BA 3RR6A 1Z9ZA 3O8VA 2QEXQ 4QT7A 1JJ2P 2K7AA 2RO0A 2KR3A 3OYYA 2FPDA 5KYYB 2JXBA 2R5MA 3QZ5B 1C1AA 2GCXA 2JW4A 1OYXA 3GLXA 1VQKT 4E7ZA 3CPWP 3CCSQ 3QJ6A 5IXBA 2NWMA 2P0PA 1VQOT 1NJIC 3QXEB 1ZSZA 3VS7A 2ED1A 4LE9A 2DE0X 2FZCB 3CCVQ 3M56A 3QDRB 1YWOA 2PU9B 3I56A 1Y96A 4M77E 2QQAA 2KDSA 1AWOA 3DKMA 3JB9D 4DOWA 3EGDB 1GCPA 4M77B 4FW2A 1Q7YC 3G71A 4C92C 4J9IA 1ZBXA 3L2QA 3JCMJ 2JNGA 1ABOA 1YN8A 5LJ5e 5A2QE 1NPPA 1N9SA 2FB7A 3LYIA 1V1CA 1G5VA 3UWNA 1YJ9Q 4A53A 4RTVA 1FX7A 3QKJA 1JXMA 1YJNQ 2FVUA 1I5OB 4EMKA 4RMOA 3CMEA 2L3QA 1K8AR 2KEAA 3TSZA 2KRMA 2M16A 4N4IA 5GAMf 4XTVA 1GL5A 1JJ2A 3OYDA 2J7IA 5GANe 3JCMW 4M7AG 2R5AA 3OS1A 2QEXT 4QW2A 4KH1B 2B86A 3HRSA 1YI2Q 1YHQQ 1QVGS 4BE2A 3NHNA 2GF7A 2DZCA 4E2FB 1BI3A 3OYFA 4BI3A 2AZVA 1D09B 1D0XA 2DBKA 1KFZA 5FROA 1QWEA 2ROLA 5CCAA 1X69A 4X34A 3CCST 2ECZA 2DKGA 5GAOr 2CP5A 4E7HA 3BW1A 4XTXA 2BZYA 1VIFA 1Q82C 1U1TA 2MPXC 2LJ3A 4BI4A 1JXOA 2RMOA 4KBMB 4PJOE 1UGRB 3CC2A 3JCMb 4M78D 4PJOB 5I11A 4P5NA 2JMCA 1VA7A 3Q1JA 4RUGA 3GIBA 4M7DC 1N8RR 2A0FB 3CQTA 2BTTA 4OF1A 4PKCC 4BE1A 3QWXX 4RTUA 4E6RA 2A28A 3UDCA 1ZUYA 2K3YA 3OSSC 1XQHA 5CIUA 4C8QF 1K0XA 4OMNA 3M58A 2IPOB 4HT9A 4GBQA 4O5VA 1T0JA 1W70A 2VASA 1H641 1QVPA 3VS3A 2BE7D 2LJ0A 4IIOA 2DFUA 2DL7A 2ED0A 2MYSA 3PFSA 5D7UA 3VKIA 4JRPA 3H0FA 3MPUB 4C0DB 1YJNT 4OGEA 2XI9A 3CCLT 1W2BA 3L1AA 2JM8A 1VQNQ 5KYNA 3E9GA 4OMMA 1WJQA 5IHIA 4C0FA 2EYYA 2FYKA 4V2SA 2Y4YA 2KQWA 1K9AA 3PMTA 3RMQA 1XNIA 4HCZA 4M75E 1B7TA 1YI2T 1YJWA 1OX9A 1Q86C 3GF5A 3EGXB 2CT4A 2FL7A 2ZZDA 1UJYA 2RHYA 1VQ6Q 2X4WA 2ZAEA 2CZ7B 4HT8A 1VQ8Q 1NJIU 3OYCA 1D0YA 4NOYA 3JCMQ 2E70A 1FMWA 1RL2A 2P4TA 2W0ZA 3PMIA 4RCCA 2LJ1A 2YT6A 2AKKA 3G1JA 2CP0A 4IUUA 2YDLA 3CCQQ 1AWJA 3M4GA 5GAN6 4A4HA 3RKXA 5KE2A 2RK1A 4PJNA 3PVQA 1Q7YU 2AKLA 3REBB 4KRTA 1NEBA 2VVKA 2GBQA 2DERA 4WF2A 2P84A 4JJCA 3OYJA 4J9GA 4BDZA 4MMLA 3CMAA 3OYEA 1AWXA 4ANJA 2XKOC 2LDMA 4C5EA 2VC8A 2ENMA 1OULA 2EJ9A 4FCYA 3HSBA 1AEYA 4CC3A 1KD1R 2O88A 2DL5A 2KROA 2FRWA 4JPBW 3ZEHA 2QDLA 4Y91A 2LX7A 2XD0A 2OI3A 5A0LA 2DXUA 1E6HA 4AMCA 3CCVA 1YITA 4OB3B 1UTIA 4LUEA 3HFNA 4C92A 2K9GA 3JB9H 2JUFA 2FEIA 4RTTA 3CCJT 3AHUA 1SHFA 2EKHA 2VWFA 2RNAA 4DEXA 2E6ZA 2AIRB 1WPYA 4FYYB 2A37A 1Z9QA 2O2OA 4OMQA 2XDBA 1OPLA 2W10A 2E41A 3C12A 4B9XA 1YJ9A 1M90C 1VQ8T 1TXQA 5AT1B 4DBQA 3BDUA 2M0OA 4JRIA 1OOTA 5GMKm 4M78E 2DD5A 3FIFA 2K5LA 4M78B 2KE9A 4AFZC 1GBRA 3LH0A 4M77C 3E9FA 3M4YA 2EJFA 5GAN5 3OBYA 1LVKA 2EKOA 3L2UA 5CKFA 3M0QA 3EAEA 1MMDA 1Q81C 3FJ5A 2HQEA 1B07A 3V7CA 1IGUA 2H3EB 5CR2A 1K9MR 1KC8C 1UECA 3G6EA 1AZGB 1JRIA 1UJ0A 3EFOB 3H0IA 2XU8A 2XICA 4PFOA 2RN8A 3L2RA 3CC7T 1OU9A 3S3NA 1RI0A 2EGEA 1U06A 3OMCA 2KAFA 5IH2A 1Y57A 3GOXA 1CSKA 4L6V5 3OMGA 1PC0A 2JTEA 3JCMP 4M7DA 2CSQA 5KYUA 1NBEB 3HPWA 2PVOB 3G71Q 2ABLA 3ZL7C 4CC7A 4DA4A 8AT1B 4FT2A 4BY6B 2E4HA 4J5YA 5GMKi 4C92G 9ATCB 2CZ0B 2F5KA 1RACB 4JZ3A 4J9EA 1Q86U 3JCMd 2MI6A 4EMHA 1BCOA 1LJOA 3M0PA 1VQ9A 3QO3A 4Z02A 2K57A 1M3CA 4B9WA 3EGUA 2EGAA 2EJGA 1MMAA 1KHCA 3CMEQ 3OW2P 1K73U 1K1ZA 2I2LA 4C5GA 5GANf 2DA9A 4PJOC 2OX7A 1ZUUA 2KK4A 1BIBA 5GAN3 1ZLMA 3PTAA 3M53A 2VXFA 2KVQG 1PD0A 1W6XA 5DM7R 1Y07A 3FJPA 4PNOA 4C8QD 2O01E 4PJMA 1MHNA 4ELZC 2V26A 4F7UE 5M9OA 2PVGB 3FC3A 1IRXA 1KQ1A 2CP2A 4F7UB 1GXIE 4BACA 3CEYA 4FM4B 2Y4XA 2QQRA 5D6WA 2OTJT 4XTZA 1P92A 2VGMA 2EQMA 2RQTA 2V1QA 1VQ6A 3GP8A 3SEMA 2LRQA 1HSQA 3RUXA 4RTXA 1WYXA 3GNFB 1FXXA 3M59A 4KUIA 5GJWB 3I56T 4UC4A 1LOJA 2KRSA 1VIEA 3ER0A 1TH7A 3G71T 2WSCE 3CCQA 1VQPT 2RHXA 3VS0A 1T3LA 2OTLA 1EIFA 1G3WA 2XDDA 4M75C 2G6FX 2EVRA 1RAAB 4LDXA 3C94A 3CBPA 1JO8A 3MHXA 2O4XB 1D1BA 1YP5A 1IGQA 3C95A 3CCRQ 1VQ5Q 1FMKA 2CH4A 4C0GA 5HK3A 1N6AA 2RPNA 2XK0A 2O9VA 4ZGJB 3J81E 3HKSA 3M54A 5DLOA 4FSXA 1M90U 3JCMh 3CMET 1J3TA 2KYBA 3V8JA 1MMGA 1X6OA 1ZA1B 4A4KA 3TVTA 2DJZA 3MEAA 2F1LA 3VUBA 4D6WA 2V1RA 1B34B 5KYXA 1GFCA 4ATOA 3MKDA 2VUBA 2DL8A 2PVDB 2ZPIB 2DLPA 2KYMA 2CGHA 3CD6Q 3HP9A 2SRCA 2D8JA 1YJWQ 1Q81U 2PZ1A 1JJ2S 4EDUA 1KQSA 2WSFE 2HQXA 2RF0A 1XOVA 2EGCA 2JOYA 2X4JA 1KC8R 4L59A 3V8LA 3NTKA 2HSEB 2XDPA 5FU7B 2QASA 1PKSA 3EG2A 1U8RA 3S3MA 4KGZB 5J3BA 2FHDA 5I2SA 4J9CA 3R6NA 3EG0A 1JEGA 2FZGB 1WA7A 2QDYB 4M7AA 1T3SA 3OY9A 3PNWC 2SEMA 3CC2T 2YHTA 4M7DF 4FT4A 3JAME 2DIGA 2HKNA 4JJDA 1NM7A 3NPFA 1QCNA 2YSQA 2K5IA 1M2OA 3ME9A 2DVEA 1WHGA 1SRLA 1HD3A 3CMAQ 3NGPA 1R77A 5EC7A 3X26B 1QMCA 4QKUA 2GQVA 3OYGA 1MNDA 4XU2A 4HVUA 4XAXB 4M78C 1SHGA 2O9SA 1YITQ 1VYUA 2MF2A 2OJ2A 2J06A 4C8QE 3U23A 3CPFA 1X2KA 4C8QB 2COWA 3OA6A 1H8KA 1LNXA 5LL6S 2DL4A 1W2BS 3CC4A 2R58A 1PCXA 3OYNA 2D9TA 1YJWT 1HK9A 3NMZC 2EYWA 4FL6A 1WX6A 4BE0A 2E3HA 3HL8A 1RAHB 1KD1C 4PJLA 2A36A 4KGVB 2QQBA 1K8AU 2CUBA 2HL5C 3A8HB 3CXCP 1WHJA 4AG2C 3KFVA 1GFDA 3VRYA 2CREA 2ZPHB 1I8FA 4BUGA 4JLGA 1WGSA 2ROTA 3VV0A 1W2BP 3G4SA 1K76A 3WVEB 4LD6A 3OYAA 5GMKh 4M77G 1SG5A 2ESWA 3SWNA 2EAYA 2MIOA 4BY6C 1RLPC 3M0TA 4FU6A 4R0KA 3KXTA 4K11A 1OPKA 4AFQC 1QVFA 1KJWA 1RAIB 3ULRB 3OSVA 1ZSZB 3G6EQ 3CMAT 3VUZA 2A3LA 2L3SA 2BIVA 5IT9E 1QKWA 4OMFB 3A8MB 5J26A 1SSFA 2QTXA 2CZ1B 3TCJA 2LCCA 1Y96B 1HJDA 2CH4W 2HMAA 1UFFA 3JCMg 2EQJA 1GRIA 3CCVT 4QVCA 4R56A 1WLPB 1CKBA 3HTRA 3MP6A 3SDZA 5LJ3d 3FLGA 1M1KU 3A1PA 2BZ8A 1RAEB 4J9BA 4ME7A 1N8RU 4E7JA 1BI0A 4E7IA 2LZ6B 4JS4A 3LWIA 2J05A 4M75A 4O6JA 1HXDA 1GCQC 1MV0B 1TS9A 2FO0A 3M0RA 2D0NA 1K9MC 3T9NA 2VYTA 2DMOA 4EMKB 4F16A 1VQ9Q 1K0SA 1B3QA 1WHHA 3M0SA 1W1FA 3A5ZB 1G3TA 1C0MA 3RBBB 1TSFA 2EFIA 3CCRA 1KQ2A 2RQRA 1SSHA 3VS1A 1VQ5A 3EHRA 1YJ9T 2BE9B 3LGLA 3CXCA 4M7AF 4B6MA 3META 4QQGA 3TQ7P 2RQUA 2ZPFB 2DBMA 7AT1B 3PIOA 1IZ6A 5I21A 4PJOG 3MEWA 4KGXB 2PNIA 1VQMA 1Q95G 2CUDA 5GMKj 1PM3A 2XMFA 3QYHB 1M2VB 5D6YA 1KHIA 3CD6A 3QBYA 4FIBA 5GAN4 2AT1B 4DQ2A 4N0AA 5FRNA 1YHQT 2JN0A 2FZKB 5IXFA 2DTIA 3REAB 2RJCA 1M30A 1M3AA 2RHZA 2V8JA 2OAUA 1SKUB 1QCOA 4FW1A 2RJFA 5GMKl 3EH1A 4Z88A 1H3HA 1YBYA 1KSWA 2H8HA 2LQWA 2LQ8A 3EFRA 1QKXA 1NLPC 1X6GA 5L8RE 2OTLQ 1BYMA 1YNZA 2GNCA 5CKHA 4E7KA 2ATCB 2YRVA 2J6KA 3OBWA 1NG2A 3BE3A 2RI5A 1IO6A 3O5ZA 4M75G 5FU7C 1VQ9T 3WVDB 5KE3A 1QVGA 2YUPA 4NL3A 3E1SA 3RNJA 3OYMA 2AZSA 1VOMA 2MCNA 5A0GA 1KD1U 2LNHB 2EYQA 2C06A 4M7DD 5CKBA 1EX4A 6AT1B 3QHSA 2DYBA 4D8DA 2E6NA 1DJ7B 4F14A 1XTDA 3SHWA 1VQNT 2PTKA 5CVIA 2EQIA 3JB9G 2DJQA 2COYA 5AYFA 3FRNA 1UGPB 2VKNA 3VS2A 4J83A 1X27A 2NUTA 1N9RA 4J6WA 1AZEA 1ZX6A 4HCBA 2LP5A 3OYIA 4JJBA 2WACA 3D7SB 1LPLA 1VQLA 1WHMA 2QK0A 1VQ7A 3HHTB 1VQ6T 4IUQA 2JJ9A 1O75A 2QG9B 4OVAA 3UA7A 3NTHA 2L2PA 1Q82U 4J9HA 1M4ZA 2VXEA 3VJPA 4ELYC 3MP8A 2DRMA 4C8QC 1W4SA 2JZ2A 1OQKA 4JLIA 4IUPA 1M8VA 4ORZA 3CCQT 2DTHA 2L3RA 3GBQA 4MZTA 4XTWA 2OTLT 2E1HA 3JV3A 3UF4A 2L3PA 5CQXA 5LJ3j 3UATA 1K9MU 1QW1A 2G3RA 5GAMd 2OAWA 5C0MA 2EYZA 3WXMB 4J7IA 1PHTA 3M9QA 1TU0B 1JQQA 1MV3A 4R55A 4ZNXA 4II1A 1OV3A 2D8HA 2DILA 3QJYA 1S1NA 4MDWA 2RI2A 2J6OA 4DBRA 1EZZB 2C0OA 2RH2A 3M0UA 1S72Q 3OW2S 4M78G 2HD0A 2QGFB 3CCUQ 3RMSA 1GCQA 1KK7A 1X43A 3CC4Q 2K6DA 2RK2A 1OU8A 2KI7A 3E19A 3ZFJA 4A63B 1TUDA 2X4YA 4RG2A 3OQ5A 2M02A 3MJXA 1AWWA 2QA4A 1UG1A 2BUDA 2DXTA 1M5Q1 1IXDA 2KT1A 3JCMe 3NTIA 1Y71A 2NUPB 1UGVA 3L2ZA 1QLYA 4OP0A 2DEQA 2CSIA 3P8BB 3G4SQ 1GBQA 4E47A 2MWPA 2QTVA 4Y28E 4AFUC 3JSCA 3QWYA 4FYWB 2KSSA 1NLOC 3BDLA 2EQUA 4PFPA 2WSEE 1K73R 2KXCA 3IQLA 1NYGA 5LJ3g 1KQSP 3MEUA 4ZGEB 4CI0C 4M7AD 3CCMA 2KGTA 2KRNA 2X51A 4FYVB 1ZA2B 4C0DC 4M7DE 2CYZB 4M7DB 5KYUB 5GAMh 4XU0A 4VUBA 3DLLA 1MUZA 3AT1B 4J8OA 3EG9A 3OB9A 3TU4K 2EWNA 5GAN7 1RADB 3CBOA 1UEBA 4IIMA 4X9DA 5KYWA 4C92F 2YRDA 5CO7A 1M27C 2NLUA 1FWZA 3A8GB 1D1CA 4X9CA 2L5QA 4HVWA 4RTWA 1YCYA 2CS7A 3R6OA 1WNLA 2MWOA 3CC4T 3THKA 4F7UG 2DVJA 4HKEA 4ZTJA 3V7RA 4C0ZA 1JU5C 3DLMA 2DAQA 4JDSA 2K4YA 2D6FA 1IHVA 2HKQB 1WXBA 4J9DA 3ZBDA 1Y0MA 2LQNA 5HY6A 1BBZA 3F70A 2XHCA 4CC4B 1VQKQ 2L0AA 3MCAB 5GAOl 3UPUA 1VQMQ 3G4ST 5KYYA 3I5SA 2K3XA 2DL3A 5FU6B 2LNVA 5I22A 4MZPA 2J6FA 2XIDA 1PRLC 2A08A 2R57A 1XJWB 4RCBA 1K4US 3H0HA 3JCMX 1KC8U 4RG8A
chains in the Genus database with same CATH topology
4J9GA 1KIKA 2L3SA 4HXJA 1QKWA 1AWXA 3UA6A 2X3WD 1WXTA 2ENMA 1ZUKA 2FRYA 1AEYA 1HJDA 2CH4W 4CC3A 1OEBA 2O88A 2DL5A 2KROA 1UFFA 2FRWA 4JPBW 3PE0A 1GRIA 1I1JA 1PNJA 2YUQA 1G2BA 2QDLA 1WLPB 1CKBA 2LX7A 2P4RA 2OI3A 2BZ8A 4J9BA 2HDAA 1E6HA 2DF6A 1U5SA 2NUZA 1UTIA 2LZ6B 4LUEA 2J05A 1SEMA 1GCQC 1MV0B 2K9GA 1ARKA 2F2XA 3C0CA 2FO0A 3M0RA 4RTTA 2FEIA 2D0NA 1SHFA 2EKHA 1NEGA 2VWFA 2DMOA 2RNAA 4DEXA 4F16A 1K0SA 2JMAA 1B3QA 2A37A 3M0SA 1W1FA 1LCKA 1Z9QA 2O2OA 3RBBB 4OMQA 2RQRA 3LH5A 1OPLA 1UUEA 1SSHA 3VS1A 4AG1C 3EHRA 2W10A 2GTOA 2M0YA 1VYTA 2RQUA 1QCFA 4EIKA 2DBMA 1OOTA 1SPKA 4FSSA 1PRMC 2PNIA 4AFZC 1GBRA 2KE9A 1SRMA 2CUDA 2I0NA 2GQIA 1AD5A 2XMFA 2EW3A 1YWPA 4Y92A 1AVZC 1CKAA 3I5RA 3M0QA 1G83A 4LUDA 2RQVA 4RTZA 3FJ5A 1B07A 2JS2A 2K79A 4AFSC 1H92A 1TUCA 2EPDA 5IXFA 3REAB 2C0IA 1UECA 1M30A 1AZGB 1WFWA 1UJ0A 1M3AA 3H0IA 1A0NB 2RN8A 4RTYA 3A98A 2EGEA 1U06A 4CC2A 4Z88A 1UE9A 5IH2A 1H3HA 1Y57A 1CSKA 2GGRA 1QWFA 3H41A 2JT4A 2C0TA 1KSWA 2BZXA 2H8HA 2LQWA 2EBPA 2JTEA 1N5ZA 1QKXA 3EG3A 4M4ZA 2CDTA 1NLPC 1X6GA 5IHNA 1NYFA 1PKTA 2CSQA 1YNZA 2DNUA 2GNCA 2K2MA 2ABLA 4DEYA 2J6KA 1ABQA 3ZL7C 4OMPA 4CC7A 5IHKA 1NG2A 2HCKA 2GTJA 3VRZA 1IO6A 1U3OA 1E6GA 3O5ZA 1RUWA 2IIMA 2YUPA 5GJVB 2KBTA 3RNJA 4JZ3A 4J9EA 5ECAA 2AZSA 4LNPA 2MCNA 2E5KA 3M0PA 2LNHB 1WI7A 1M3CA 3EGUA 2EGAA 2MOXA 4LN2A 2DYBA 3EG1A 4D8DA 2FPEA 1K1ZA 4F14A 2DA9A 5L23A 1X6BA 3SHWA 1ZUUA 2PTKA 3PVLA 1EFNA 2EQIA 2DJQA 1ZLMA 4OMOA 3EHQA 2VKNA 3VS2A 4JZ4A 2FG0A 1W6XA 1M3BA 1X27A 1Z9ZA 4QT7A 2K7AA 1AZEA 1ZX6A 2KR3A 2LP5A 4HCKA 1M8MA 4JJBA 2FPDA 2JXBA 2F2VA 2JW4A 2D1XA 3UA7A 2RQTA 2V1QA 2L2PA 5IXBA 2NWMA 1PWTA 1FYNA 4J9HA 1UDLA 2YUOA 3SEMA 1HSQA 3VS7A 4RTXA 2DRMA 2ED1A 2K3BA 1WYXA 4LE9A 1TG0A 2DE0X 5GJWB 4Z89A 4ESRA 4ORZA 3GBQA 2KRSA 2O31A 1YWOA 3JV3A 3UF4A 5FWCA 2L3PA 1AWOA 3TSWA 1GCPA 4X1VA 3UATA 3VS0A 1T3LA 1BB9A 2G6FX 2EVRA 2OAWA 4J9IA 2EYZA 1PHTA 1RLQC 5HCKA 1JO8A 1JQQA 1MV3A 1YP5A 4Z8AA 4ZNXA 1OV3A 2D8HA 2DILA 1ABOA 1YN8A 1FMKA 2CH4A 1S1NA 2RPNA 1I07A 2O9VA 2YUNA 1V1CA 2F2WA 4RTVA 2J6OA 1J3TA 2LMJA 2KXDA 2KYBA 1JXMA 2C0OA 3M0UA 3TVTA 2L3QA 2KEAA 3TSZA 2KRMA 2V1RA 1GFCA 5FWBA 1GCQA 2CT3A 1I0CA 1X43A 2DL8A 2DLPA 2KYMA 2K6DA 1GL5A 4A63B 1TUDA 2J7IA 4HVVA 2JM9A 2SRCA 1AWWA 2D8JA 1UG1A 2PZ1A 2B86A 2RQWA 2RF0A 1XOVA 2HBWA 1WIEA 2EGCA 3NHNA 2KT1A 2AZVA 2M51A 1UGVA 2DBKA 1KFZA 1QLYA 3EG2A 1PKSA 1UHFA 1QWEA 2ROLA 2HSPA 1X69A 2CSIA 2ECZA 4J9CA 3R6NA 1GBQA 1UHCA 3EG0A 1JEGA 1WA7A 5FW9A 1T3SA 4AFUC 2BZYA 2KNBB 2SEMA 1ZSGA 2LJ3A 3QWYA 1JXOA 2RMOA 4F17A 4JJDA 1NM7A 1NLOC 1BU1A 5I11A 3NPFA 2JMCA 2YSQA 1VA7A 2KXCA 1ZBJA 4RUGA 3IQLA 1SRLA 1NYGA 4GLMA 3CQTA 2BTTA 1HD3A 3QWXX 3NGPA 4RTUA 4D8KA 4E6RA 2A28A 2EYXA 1ZUYA 2KT8A 3I35A 5EC7A 2KGTA 1BK2A 2KRNA 1K0XA 4OMNA 1X2QA 4GBQA 2FPFA 1T0JA 1YCSB 1W70A 3VS4A 1MUZA 3VS3A 2LJ0A 4IIOA 2DL7A 2ED0A 4HVUA 3H0FA 1E7OA 4WCIA 1RI9A 1SHGA 2O9SA 4IIMA 1VYUA 2OJ2A 2J06A 1M27C 1AOJA 1WXUA 2JM8A 3U23A 3VS6A 4HVWA 4RTWA 1X2KA 2HEQA 4OMMA 1H8KA 3THKA 1WDXA 2AK5A 5IHIA 2DVJA 2DL4A 2EYYA 2DM1A 2LCSA 1JU5C 3NMZC 1K9AA 2EYWA 1WX6A 3VS5A 3I9QA 1WXBA 2CT4A 4J9DA 1UJYA 1Y0MA 2LQNA 1BBZA 2A36A 4CC4B 2L0AA 2CUBA 4AG2C 3KFVA 1GFDA 3VRYA 2CREA 2W0ZA 2ROTA 3I5SA 2LJ1A 2YT6A 2DRKA 2AKKA 2DL3A 1K76A 4J9FA 5I22A 2ESWA 2J6FA 2MIOA 2YDLA 1RLPC 1AWJA 1PRLC 2JS0A 4OMLA 3M0TA 2A08A 3PVQA 4R0KA 4K11A 1OPKA 4AFQC 1KJWA 2AKLA 1K4US 3H0HA 3REBB 1T0HA 4KRTA 1NEBA 3ULRB 1VYVA 2DX1A 2X3XD 2VVKA 2GBQA 4JJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9G A;  1KIK A;  2L3S A;  4HXJ A;  1QKW A;  1AWX A;  3UA6 A;  2X3W D;  1WXT A;  2ENM A;  1ZUK A;  2FRY A;  1AEY A;  1HJD A;  2CH4 W;  4CC3 A;  1OEB A;  2O88 A;  2DL5 A;  2KRO A;  1UFF A;  2FRW A;  4JPB W;  3PE0 A;  1GRI A;  1I1J A;  1PNJ A;  2YUQ A;  1G2B A;  2QDL A;  1WLP B;  1CKB A;  2LX7 A;  2P4R A;  2OI3 A;  2BZ8 A;  4J9B A;  2HDA A;  1E6H A;  2DF6 A;  1U5S A;  2NUZ A;  1UTI A;  2LZ6 B;  4LUE A;  2J05 A;  1SEM A;  1GCQ C;  1MV0 B;  2K9G A;  1ARK A;  2F2X A;  3C0C A;  2FO0 A;  3M0R A;  4RTT A;  2FEI A;  2D0N A;  1SHF A;  2EKH A;  1NEG A;  2VWF A;  2DMO A;  2RNA A;  4DEX A;  4F16 A;  1K0S A;  2JMA A;  1B3Q A;  2A37 A;  3M0S A;  1W1F A;  1LCK A;  1Z9Q A;  2O2O A;  3RBB B;  4OMQ A;  2RQR A;  3LH5 A;  1OPL A;  1UUE A;  1SSH A;  3VS1 A;  4AG1 C;  3EHR A;  2W10 A;  2GTO A;  2M0Y A;  1VYT A;  2RQU A;  1QCF A;  4EIK A;  2DBM A;  1OOT A;  1SPK A;  4FSS A;  1PRM C;  2PNI A;  4AFZ C;  1GBR A;  2KE9 A;  1SRM A;  2CUD A;  2I0N A;  2GQI A;  1AD5 A;  2XMF A;  2EW3 A;  1YWP A;  4Y92 A;  1AVZ C;  1CKA A;  3I5R A;  3M0Q A;  1G83 A;  4LUD A;  2RQV A;  4RTZ A;  3FJ5 A;  1B07 A;  2JS2 A;  2K79 A;  4AFS C;  1H92 A;  1TUC A;  2EPD A;  5IXF A;  3REA B;  2C0I A;  1UEC A;  1M30 A;  1AZG B;  1WFW A;  1UJ0 A;  1M3A A;  3H0I A;  1A0N B;  2RN8 A;  4RTY A;  3A98 A;  2EGE A;  1U06 A;  4CC2 A;  4Z88 A;  1UE9 A;  5IH2 A;  1H3H A;  1Y57 A;  1CSK A;  2GGR A;  1QWF A;  3H41 A;  2JT4 A;  2C0T A;  1KSW A;  2BZX A;  2H8H A;  2LQW A;  2EBP A;  2JTE A;  1N5Z A;  1QKX A;  3EG3 A;  4M4Z A;  2CDT A;  1NLP C;  1X6G A;  5IHN A;  1NYF A;  1PKT A;  2CSQ A;  1YNZ A;  2DNU A;  2GNC A;  2K2M A;  2ABL A;  4DEY A;  2J6K A;  1ABQ A;  3ZL7 C;  4OMP A;  4CC7 A;  5IHK A;  1NG2 A;  2HCK A;  2GTJ A;  3VRZ A;  1IO6 A;  1U3O A;  1E6G A;  3O5Z A;  1RUW A;  2IIM A;  2YUP A;  5GJV B;  2KBT A;  3RNJ A;  4JZ3 A;  4J9E A;  5ECA A;  2AZS A;  4LNP A;  2MCN A;  2E5K A;  3M0P A;  2LNH B;  1WI7 A;  1M3C A;  3EGU A;  2EGA A;  2MOX A;  4LN2 A;  2DYB A;  3EG1 A;  4D8D A;  2FPE A;  1K1Z A;  4F14 A;  2DA9 A;  5L23 A;  1X6B A;  3SHW A;  1ZUU A;  2PTK A;  3PVL A;  1EFN A;  2EQI A;  2DJQ A;  1ZLM A;  4OMO A;  3EHQ A;  2VKN A;  3VS2 A;  4JZ4 A;  2FG0 A;  1W6X A;  1M3B A;  1X27 A;  1Z9Z A;  4QT7 A;  2K7A A;  1AZE A;  1ZX6 A;  2KR3 A;  2LP5 A;  4HCK A;  1M8M A;  4JJB A;  2FPD A;  2JXB A;  2F2V A;  2JW4 A;  2D1X A;  3UA7 A;  2RQT A;  2V1Q A;  2L2P A;  5IXB A;  2NWM A;  1PWT A;  1FYN A;  4J9H A;  1UDL A;  2YUO A;  3SEM A;  1HSQ A;  3VS7 A;  4RTX A;  2DRM A;  2ED1 A;  2K3B A;  1WYX A;  4LE9 A;  1TG0 A;  2DE0 X;  5GJW B;  4Z89 A;  4ESR A;  4ORZ A;  3GBQ A;  2KRS A;  2O31 A;  1YWO A;  3JV3 A;  3UF4 A;  5FWC A;  2L3P A;  1AWO A;  3TSW A;  1GCP A;  4X1V A;  3UAT A;  3VS0 A;  1T3L A;  1BB9 A;  2G6F X;  2EVR A;  2OAW A;  4J9I A;  2EYZ A;  1PHT A;  1RLQ C;  5HCK A;  1JO8 A;  1JQQ A;  1MV3 A;  1YP5 A;  4Z8A A;  4ZNX A;  1OV3 A;  2D8H A;  2DIL A;  1ABO A;  1YN8 A;  1FMK A;  2CH4 A;  1S1N A;  2RPN A;  1I07 A;  2O9V A;  2YUN A;  1V1C A;  2F2W A;  4RTV A;  2J6O A;  1J3T A;  2LMJ A;  2KXD A;  2KYB A;  1JXM A;  2C0O A;  3M0U A;  3TVT A;  2L3Q A;  2KEA A;  3TSZ A;  2KRM A;  2V1R A;  1GFC A;  5FWB A;  1GCQ A;  2CT3 A;  1I0C A;  1X43 A;  2DL8 A;  2DLP A;  2KYM A;  2K6D A;  1GL5 A;  4A63 B;  1TUD A;  2J7I A;  4HVV A;  2JM9 A;  2SRC A;  1AWW A;  2D8J A;  1UG1 A;  2PZ1 A;  2B86 A;  2RQW A;  2RF0 A;  1XOV A;  2HBW A;  1WIE A;  2EGC A;  3NHN A;  2KT1 A;  2AZV A;  2M51 A;  1UGV A;  2DBK A;  1KFZ A;  1QLY A;  3EG2 A;  1PKS A;  1UHF A;  1QWE A;  2ROL A;  2HSP A;  1X69 A;  2CSI A;  2ECZ A;  4J9C A;  3R6N A;  1GBQ A;  1UHC A;  3EG0 A;  1JEG A;  1WA7 A;  5FW9 A;  1T3S A;  4AFU C;  2BZY A;  2KNB B;  2SEM A;  1ZSG A;  2LJ3 A;  3QWY A;  1JXO A;  2RMO A;  4F17 A;  4JJD A;  1NM7 A;  1NLO C;  1BU1 A;  5I11 A;  3NPF A;  2JMC A;  2YSQ A;  1VA7 A;  2KXC A;  1ZBJ A;  4RUG A;  3IQL A;  1SRL A;  1NYG A;  4GLM A;  3CQT A;  2BTT A;  1HD3 A;  3QWX X;  3NGP A;  4RTU A;  4D8K A;  4E6R A;  2A28 A;  2EYX A;  1ZUY A;  2KT8 A;  3I35 A;  5EC7 A;  2KGT A;  1BK2 A;  2KRN A;  1K0X A;  4OMN A;  1X2Q A;  4GBQ A;  2FPF A;  1T0J A;  1YCS B;  1W70 A;  3VS4 A;  1MUZ A;  3VS3 A;  2LJ0 A;  4IIO A;  2DL7 A;  2ED0 A;  4HVU A;  3H0F A;  1E7O A;  4WCI A;  1RI9 A;  1SHG A;  2O9S A;  4IIM A;  1VYU A;  2OJ2 A;  2J06 A;  1M27 C;  1AOJ A;  1WXU A;  2JM8 A;  3U23 A;  3VS6 A;  4HVW A;  4RTW A;  1X2K A;  2HEQ A;  4OMM A;  1H8K A;  3THK A;  1WDX A;  2AK5 A;  5IHI A;  2DVJ A;  2DL4 A;  2EYY A;  2DM1 A;  2LCS A;  1JU5 C;  3NMZ C;  1K9A A;  2EYW A;  1WX6 A;  3VS5 A;  3I9Q A;  1WXB A;  2CT4 A;  4J9D A;  1UJY A;  1Y0M A;  2LQN A;  1BBZ A;  2A36 A;  4CC4 B;  2L0A A;  2CUB A;  4AG2 C;  3KFV A;  1GFD A;  3VRY A;  2CRE A;  2W0Z A;  2ROT A;  3I5S A;  2LJ1 A;  2YT6 A;  2DRK A;  2AKK A;  2DL3 A;  1K76 A;  4J9F A;  5I22 A;  2ESW A;  2J6F A;  2MIO A;  2YDL A;  1RLP C;  1AWJ A;  1PRL C;  2JS0 A;  4OML A;  3M0T A;  2A08 A;  3PVQ A;  4R0K A;  4K11 A;  1OPK A;  4AFQ C;  1KJW A;  2AKL A;  1K4U S;  3H0H A;  3REB B;  1T0H A;  4KRT A;  1NEB A;  3ULR B;  1VYV A;  2DX1 A;  2X3X D;  2VVK A;  2GBQ A;  4JJC A; 
#chains in the Genus database with same CATH topology
 3RKY A;  2YLB A;  2QGG A;  2E12 A;  5CKD A;  4PLI A;  2EIF A;  3UA6 A;  5GAM j;  4BDY A;  2X3W D;  1OZ3 A;  4QVZ A;  1WXT A;  1RAF B;  2FRY A;  3EGD A;  4M77 A;  2HAX A;  3NFC A;  3EFS A;  5EG2 A;  1NPR A;  5A0D A;  2CP3 A;  5GMK e;  1PNJ A;  2YUQ A;  1FMV A;  1G2B A;  2V8K A;  4LDW A;  4ZGD B;  2P4R A;  2KY9 A;  4IUT A;  2DF6 A;  3LWH A;  5GAN 2;  2DZ9 A;  1ACM B;  2NUZ A;  1WHK A;  1SEM A;  1UB4 A;  3A8L B;  2DET A;  3V8K A;  8ATC B;  1QVF P;  2E5Q A;  3C0C A;  2F5T X;  4XU1 A;  1BCM A;  1NEG A;  3CCR T;  2JMA A;  1D3B B;  2PUO B;  1VQ5 T;  2HNI A;  3M5A A;  3LH5 A;  1UUE A;  5KYX B;  4AG1 C;  3KUF A;  4XK8 E;  1IRE B;  2JTM A;  4KUL A;  4QVD A;  2Z0W A;  2MAM A;  3TEE A;  5GAO m;  2L89 A;  4M75 D;  2RD1 A;  3MO8 A;  3CXC S;  1VQM T;  2OTJ A;  2F69 A;  1S72 A;  4A54 A;  3CCU A;  1PRM C;  3MP1 A;  4OGC A;  2GQI A;  3CD6 T;  1AD5 A;  3MEV A;  3SB2 A;  3JB9 I;  5FLX E;  2RA2 A;  5CAI A;  1TUG B;  1QQJ A;  3QUI A;  1VQL Q;  1G83 A;  4M7A E;  4J7F A;  1VQ7 Q;  1V29 B;  2VV5 A;  4M7A B;  4ZN3 A;  3RER A;  2JS2 A;  2DTO A;  1H92 A;  5D6X A;  1TUC A;  2JVV A;  2CKK A;  4MZM A;  2EPD A;  5GAN 8;  4GLK A;  1VQP A;  5LJ5 d;  4XTU A;  2C0I A;  4PJO A;  1WJS A;  2DEU A;  1A0N B;  4RTY A;  3SFM A;  5GAM g;  3PGG A;  3JCM V;  1YIJ A;  4DOV A;  4CC2 A;  3OS5 A;  1UE9 A;  2QAZ A;  2GGR A;  4JRQ A;  2JT4 A;  4C8Q G;  2LT1 A;  3EG3 A;  4M4Z A;  2CDT A;  2QI2 A;  5IHN A;  2RB6 A;  1PKT A;  3BFM A;  3CCL Q;  4DEY A;  1VQ4 A;  1O9S A;  5GAN d;  4OMP A;  3BY7 A;  2ZGW A;  3TRE A;  2HCK A;  4E7S A;  2JTF A;  3VRZ A;  3QZ9 B;  2D0Q B;  2V8I A;  4LNP A;  1QP2 A;  3KBG A;  2E5K A;  4IUR A;  1WI7 A;  2DK3 A;  2MOX A;  4PJJ A;  3CPW A;  4LN2 A;  2M9U A;  3I55 A;  1YIT T;  1M2V A;  4A4F A;  4NL2 A;  5L23 A;  3M55 A;  1WQW A;  2RHU A;  1QP3 A;  3PVL A;  1EFN A;  1BI1 A;  1WJR A;  1ZQ1 A;  5LJ3 e;  3CCE A;  2BKD N;  3EGX A;  3EHQ A;  2QA4 Q;  2LCL A;  1YFN A;  5HK0 A;  3JCM f;  1UGS B;  2CP6 A;  1U1S A;  3RDV A;  2K2V A;  1VQL T;  1Y7X A;  1VQ7 T;  4HCK A;  1M8M A;  4A4E A;  5KH6 A;  4XQ3 A;  1M1K R;  1QVG P;  5CQY A;  3P8D A;  2F2V A;  4IKF A;  2D1X A;  4M77 F;  2P0K A;  4C92 D;  3SWN B;  2XG8 D;  1PWT A;  1FYN A;  5LJ5 h;  1VQK A;  1UDL A;  2YUO A;  3LLR A;  1RAG B;  2RM4 A;  1VQO A;  4OB2 B;  2K3B A;  2GFA A;  1TG0 A;  1D0Z A;  2AHJ B;  4Z89 A;  4ESR A;  1BKB A;  2O31 A;  3HFO A;  5FWC A;  3TSW A;  3CCM Q;  4X1V A;  4PK4 A;  3OYH A;  3G6E T;  3VYH B;  1BB9 A;  3ASK A;  2DPP B;  3H8Z A;  5GAN h;  3CCJ Q;  1RLQ C;  5HCK A;  4IUV A;  4LDY A;  3CBM A;  4Z8A A;  4XU3 A;  3DB4 A;  3JCM c;  2H3J A;  4OB1 B;  2YRC A;  1I07 A;  2YUN A;  4M75 B;  2IG0 A;  2LX9 A;  2F2W A;  3QG1 A;  2LMJ A;  2KXD A;  2YLC A;  4C5H A;  5FU6 C;  1I81 A;  2ZPE B;  4MMK A;  4PLL A;  5CK9 A;  1NZ9 A;  2LQK A;  3L42 A;  3E2U A;  1NJI R;  2DXC A;  1K73 C;  3S6W A;  5FWB A;  5LJ3 h;  2CT3 A;  1I0C A;  3A8O B;  1IHW A;  3QPH A;  2QA4 T;  4JRK A;  3PIP A;  4C5I A;  4BB7 A;  2LTO A;  3H9N A;  2JM9 A;  4HVV A;  2RQW A;  2ZCF B;  1ZHI A;  1M1G A;  2COZ A;  4PL6 A;  2QEX A;  3OS2 A;  4F04 B;  4PJO F;  3RIR A;  4M78 A;  2HBW A;  5IAY A;  1WIE A;  1Q7Y R;  4OB0 B;  4HA8 A;  4YTL A;  3LW5 E;  2M51 A;  1UHF A;  1HYO A;  2HSP A;  4BD3 A;  3GPL A;  3FEO A;  1NE8 A;  5LJ5 j;  1UHC A;  1TOV A;  3S3O A;  3CC7 Q;  5FW9 A;  3PT9 A;  1R0B G;  3CCS A;  2KNB B;  1PSF A;  2PQW A;  1ZSG A;  4JS5 A;  2Y90 A;  2QQS A;  4N4H A;  3INZ A;  5GAO q;  4F17 A;  1X75 C;  4KUD K;  1N27 A;  1BU1 A;  3EFO A;  2DXB A;  3VU3 C;  1MMN A;  1ZBJ A;  5C6S A;  1KG1 A;  2IVW A;  4GLM A;  2E10 A;  3CCM T;  1OX8 A;  1F1B B;  3FB9 A;  4FYX B;  5DLQ E;  5GAN j;  4D8K A;  2EYX A;  2HBP A;  2KT8 A;  3I35 A;  2NYS A;  1BK2 A;  3L2V A;  4ZTF A;  1X2Q A;  1X01 A;  2FPF A;  1BIA A;  3C4S A;  1YCS B;  4LXC A;  3VS4 A;  4QQ6 A;  5I2M A;  1E7O A;  2E3I A;  2DD4 A;  4WCI A;  1RI9 A;  4GY5 A;  2MMP A;  3LGF A;  4M75 F;  3X25 B;  1WXU A;  1AOJ A;  4L5G A;  4TVR A;  1YJN A;  3JB9 J;  3RKW A;  3VS6 A;  2DYI A;  1Q82 R;  3J7A F;  5GAO n;  3URG A;  2HEQ A;  2X35 A;  4M7A C;  2LVM A;  3CCL A;  1WDX A;  2AK5 A;  2B8A A;  3QYG B;  2NUP A;  3FDR A;  2DM1 A;  2LCS A;  5IN1 A;  4LDU A;  4J6Y A;  1I4K 1;  1D1A A;  3P8H A;  4RKU E;  5GAM e;  3VYG A;  4C92 E;  3VS5 A;  3JB9 F;  3I9Q A;  5CKE A;  3N5B B;  1AT1 B;  4C92 B;  4J6X A;  2RI3 A;  1YI2 A;  3OS0 A;  5KCO A;  1OZ2 A;  1YHQ A;  2OTJ Q;  3RES A;  3X24 B;  2NUT B;  4EMG A;  4F7U A;  1JB0 E;  1JBM A;  5LJ5 g;  2VGN A;  2DRK A;  2EQK A;  4WTO B;  1ZSZ C;  4J9F A;  2CP7 A;  4JUV A;  3I56 Q;  4CRI A;  2M1H A;  3HRT A;  2LT4 A;  3QDF A;  3H6Z A;  3QSU A;  2JS0 A;  4OML A;  3X20 B;  3GNG A;  1UGQ B;  3M57 A;  1VQP Q;  1T0H A;  3J80 E;  1KQS S;  1VYV A;  2DX1 A;  2X3X D;  5LJ5 f;  5DY9 A;  4A4G A;  1VUB A;  5GAN g;  2YXY A;  1KIK A;  2QXF A;  4HXJ A;  1R0C B;  1YIJ Q;  3HRU A;  2PUK B;  4LDV A;  2E65 A;  1ZUK A;  2A7Y A;  1Q86 R;  1MNE A;  2CZ6 B;  1M9S A;  1OEB A;  2E64 A;  3PE0 A;  1I1J A;  1VQ4 Q;  2O4X A;  2K5F A;  4EMK C;  2HDA A;  2P0Q A;  1U5S A;  5HKC A;  1WHL A;  4JJN K;  4DBH A;  1ARK A;  1VQN A;  2F2X A;  5FRM A;  4M77 D;  3OYB A;  4M78 F;  3CCJ A;  3SWN C;  4KH0 B;  1LCK A;  1B34 A;  3EH2 A;  2RHI A;  3I55 Q;  2GTO A;  2M0Y A;  5LJ3 f;  1G8X A;  2HQH A;  1S72 T;  1VYT A;  1MGQ A;  3CCE Q;  1G3Y A;  3CCU T;  1QCF A;  4EIK A;  1SPK A;  1K8A C;  2ZPB B;  4FSS A;  1VQ8 A;  2HZY A;  2X9H A;  1M1F A;  3L2W A;  3CC2 Q;  1G3S A;  1SRM A;  2I0N A;  1PSE A;  5KCH A;  2EW3 A;  3X28 B;  1YWP A;  4Y92 A;  1AVZ C;  1BI2 A;  1CKA A;  3I5R A;  4LUD A;  4DBF A;  2RQV A;  2MK5 A;  3SD4 A;  4RTZ A;  2K79 A;  4AFS C;  5J39 A;  4QQD A;  2YWW A;  4M7D G;  4E7L A;  1WZO A;  4MDX A;  2LC4 A;  2RJE A;  3G7Z A;  1WFW A;  2ZPG B;  1YIJ T;  1IB8 A;  3QII A;  1VQO Q;  4XTY A;  3A98 A;  3LX7 A;  2GFU A;  2DIQ A;  2QYZ A;  3CC7 A;  3OW2 A;  1QWF A;  3H41 A;  1R8O B;  2C0T A;  2BZX A;  2DO3 A;  3OYK A;  1M90 R;  1I5L A;  2EBP A;  1PG5 B;  1N5Z A;  1VQ4 T;  1D3B A;  1WQ7 A;  2VB6 A;  1NYF A;  2RJD A;  2HL3 A;  2K2M A;  2DNU A;  1ABQ A;  4PJO D;  4LD9 K;  3OYL A;  5IHK A;  1M1K C;  1N8R C;  3JRZ A;  4PFZ A;  2GTJ A;  1QVF S;  3EG9 B;  1AHJ B;  1SF9 A;  3V7S A;  1U3O A;  1E6G A;  1RUW A;  2IIM A;  5KYW B;  1RAB B;  5GJV B;  2KBT A;  4KT0 E;  1Q81 R;  5ECA A;  1PD1 A;  4C8Q A;  4N4G A;  4BI8 B;  3I55 T;  4N0A C;  1V76 A;  4F7U F;  2KMT A;  4ZN1 A;  4AT1 B;  4EPC A;  3EG1 A;  1TTH B;  1H3Z A;  4Q5W A;  1OI1 A;  4HCC A;  2FPE A;  3CCE T;  3UT1 A;  2QQ9 A;  1X6B A;  2L8D A;  3CPW S;  1C6V X;  1TWB A;  5GAO p;  4OMO A;  4NS5 A;  2X4X A;  4JZ4 A;  3DB3 A;  2FG0 A;  1M3B A;  3RR6 A;  1Z9Z A;  3O8V A;  2QEX Q;  4QT7 A;  1JJ2 P;  2K7A A;  2RO0 A;  2KR3 A;  3OYY A;  2FPD A;  5KYY B;  2JXB A;  2R5M A;  3QZ5 B;  1C1A A;  2GCX A;  2JW4 A;  1OYX A;  3GLX A;  1VQK T;  4E7Z A;  3CPW P;  3CCS Q;  3QJ6 A;  5IXB A;  2NWM A;  2P0P A;  1VQO T;  1NJI C;  3QXE B;  1ZSZ A;  3VS7 A;  2ED1 A;  4LE9 A;  2DE0 X;  2FZC B;  3CCV Q;  3M56 A;  3QDR B;  1YWO A;  2PU9 B;  3I56 A;  1Y96 A;  4M77 E;  2QQA A;  2KDS A;  1AWO A;  3DKM A;  3JB9 D;  4DOW A;  3EGD B;  1GCP A;  4M77 B;  4FW2 A;  1Q7Y C;  3G71 A;  4C92 C;  4J9I A;  1ZBX A;  3L2Q A;  3JCM J;  2JNG A;  1ABO A;  1YN8 A;  5LJ5 e;  5A2Q E;  1NPP A;  1N9S A;  2FB7 A;  3LYI A;  1V1C A;  1G5V A;  3UWN A;  1YJ9 Q;  4A53 A;  4RTV A;  1FX7 A;  3QKJ A;  1JXM A;  1YJN Q;  2FVU A;  1I5O B;  4EMK A;  4RMO A;  3CME A;  2L3Q A;  1K8A R;  2KEA A;  3TSZ A;  2KRM A;  2M16 A;  4N4I A;  5GAM f;  4XTV A;  1GL5 A;  1JJ2 A;  3OYD A;  2J7I A;  5GAN e;  3JCM W;  4M7A G;  2R5A A;  3OS1 A;  2QEX T;  4QW2 A;  4KH1 B;  2B86 A;  3HRS A;  1YI2 Q;  1YHQ Q;  1QVG S;  4BE2 A;  3NHN A;  2GF7 A;  2DZC A;  4E2F B;  1BI3 A;  3OYF A;  4BI3 A;  2AZV A;  1D09 B;  1D0X A;  2DBK A;  1KFZ A;  5FRO A;  1QWE A;  2ROL A;  5CCA A;  1X69 A;  4X34 A;  3CCS T;  2ECZ A;  2DKG A;  5GAO r;  2CP5 A;  4E7H A;  3BW1 A;  4XTX A;  2BZY A;  1VIF A;  1Q82 C;  1U1T A;  2MPX C;  2LJ3 A;  4BI4 A;  1JXO A;  2RMO A;  4KBM B;  4PJO E;  1UGR B;  3CC2 A;  3JCM b;  4M78 D;  4PJO B;  5I11 A;  4P5N A;  2JMC A;  1VA7 A;  3Q1J A;  4RUG A;  3GIB A;  4M7D C;  1N8R R;  2A0F B;  3CQT A;  2BTT A;  4OF1 A;  4PKC C;  4BE1 A;  3QWX X;  4RTU A;  4E6R A;  2A28 A;  3UDC A;  1ZUY A;  2K3Y A;  3OSS C;  1XQH A;  5CIU A;  4C8Q F;  1K0X A;  4OMN A;  3M58 A;  2IPO B;  4HT9 A;  4GBQ A;  4O5V A;  1T0J A;  1W70 A;  2VAS A;  1H64 1;  1QVP A;  3VS3 A;  2BE7 D;  2LJ0 A;  4IIO A;  2DFU A;  2DL7 A;  2ED0 A;  2MYS A;  3PFS A;  5D7U A;  3VKI A;  4JRP A;  3H0F A;  3MPU B;  4C0D B;  1YJN T;  4OGE A;  2XI9 A;  3CCL T;  1W2B A;  3L1A A;  2JM8 A;  1VQN Q;  5KYN A;  3E9G A;  4OMM A;  1WJQ A;  5IHI A;  4C0F A;  2EYY A;  2FYK A;  4V2S A;  2Y4Y A;  2KQW A;  1K9A A;  3PMT A;  3RMQ A;  1XNI A;  4HCZ A;  4M75 E;  1B7T A;  1YI2 T;  1YJW A;  1OX9 A;  1Q86 C;  3GF5 A;  3EGX B;  2CT4 A;  2FL7 A;  2ZZD A;  1UJY A;  2RHY A;  1VQ6 Q;  2X4W A;  2ZAE A;  2CZ7 B;  4HT8 A;  1VQ8 Q;  1NJI U;  3OYC A;  1D0Y A;  4NOY A;  3JCM Q;  2E70 A;  1FMW A;  1RL2 A;  2P4T A;  2W0Z A;  3PMI A;  4RCC A;  2LJ1 A;  2YT6 A;  2AKK A;  3G1J A;  2CP0 A;  4IUU A;  2YDL A;  3CCQ Q;  1AWJ A;  3M4G A;  5GAN 6;  4A4H A;  3RKX A;  5KE2 A;  2RK1 A;  4PJN A;  3PVQ A;  1Q7Y U;  2AKL A;  3REB B;  4KRT A;  1NEB A;  2VVK A;  2GBQ A;  2DER A;  4WF2 A;  2P84 A;  4JJC A;  3OYJ A;  4J9G A;  4BDZ A;  4MML A;  3CMA A;  3OYE A;  1AWX A;  4ANJ A;  2XKO C;  2LDM A;  4C5E A;  2VC8 A;  2ENM A;  1OUL A;  2EJ9 A;  4FCY A;  3HSB A;  1AEY A;  4CC3 A;  1KD1 R;  2O88 A;  2DL5 A;  2KRO A;  2FRW A;  4JPB W;  3ZEH A;  2QDL A;  4Y91 A;  2LX7 A;  2XD0 A;  2OI3 A;  5A0L A;  2DXU A;  1E6H A;  4AMC A;  3CCV A;  1YIT A;  4OB3 B;  1UTI A;  4LUE A;  3HFN A;  4C92 A;  2K9G A;  3JB9 H;  2JUF A;  2FEI A;  4RTT A;  3CCJ T;  3AHU A;  1SHF A;  2EKH A;  2VWF A;  2RNA A;  4DEX A;  2E6Z A;  2AIR B;  1WPY A;  4FYY B;  2A37 A;  1Z9Q A;  2O2O A;  4OMQ A;  2XDB A;  1OPL A;  2W10 A;  2E41 A;  3C12 A;  4B9X A;  1YJ9 A;  1M90 C;  1VQ8 T;  1TXQ A;  5AT1 B;  4DBQ A;  3BDU A;  2M0O A;  4JRI A;  1OOT A;  5GMK m;  4M78 E;  2DD5 A;  3FIF A;  2K5L A;  4M78 B;  2KE9 A;  4AFZ C;  1GBR A;  3LH0 A;  4M77 C;  3E9F A;  3M4Y A;  2EJF A;  5GAN 5;  3OBY A;  1LVK A;  2EKO A;  3L2U A;  5CKF A;  3M0Q A;  3EAE A;  1MMD A;  1Q81 C;  3FJ5 A;  2HQE A;  1B07 A;  3V7C A;  1IGU A;  2H3E B;  5CR2 A;  1K9M R;  1KC8 C;  1UEC A;  3G6E A;  1AZG B;  1JRI A;  1UJ0 A;  3EFO B;  3H0I A;  2XU8 A;  2XIC A;  4PFO A;  2RN8 A;  3L2R A;  3CC7 T;  1OU9 A;  3S3N A;  1RI0 A;  2EGE A;  1U06 A;  3OMC A;  2KAF A;  5IH2 A;  1Y57 A;  3GOX A;  1CSK A;  4L6V 5;  3OMG A;  1PC0 A;  2JTE A;  3JCM P;  4M7D A;  2CSQ A;  5KYU A;  1NBE B;  3HPW A;  2PVO B;  3G71 Q;  2ABL A;  3ZL7 C;  4CC7 A;  4DA4 A;  8AT1 B;  4FT2 A;  4BY6 B;  2E4H A;  4J5Y A;  5GMK i;  4C92 G;  9ATC B;  2CZ0 B;  2F5K A;  1RAC B;  4JZ3 A;  4J9E A;  1Q86 U;  3JCM d;  2MI6 A;  4EMH A;  1BCO A;  1LJO A;  3M0P A;  1VQ9 A;  3QO3 A;  4Z02 A;  2K57 A;  1M3C A;  4B9W A;  3EGU A;  2EGA A;  2EJG A;  1MMA A;  1KHC A;  3CME Q;  3OW2 P;  1K73 U;  1K1Z A;  2I2L A;  4C5G A;  5GAN f;  2DA9 A;  4PJO C;  2OX7 A;  1ZUU A;  2KK4 A;  1BIB A;  5GAN 3;  1ZLM A;  3PTA A;  3M53 A;  2VXF A;  2KVQ G;  1PD0 A;  1W6X A;  5DM7 R;  1Y07 A;  3FJP A;  4PNO A;  4C8Q D;  2O01 E;  4PJM A;  1MHN A;  4ELZ C;  2V26 A;  4F7U E;  5M9O A;  2PVG B;  3FC3 A;  1IRX A;  1KQ1 A;  2CP2 A;  4F7U B;  1GXI E;  4BAC A;  3CEY A;  4FM4 B;  2Y4X A;  2QQR A;  5D6W A;  2OTJ T;  4XTZ A;  1P92 A;  2VGM A;  2EQM A;  2RQT A;  2V1Q A;  1VQ6 A;  3GP8 A;  3SEM A;  2LRQ A;  1HSQ A;  3RUX A;  4RTX A;  1WYX A;  3GNF B;  1FXX A;  3M59 A;  4KUI A;  5GJW B;  3I56 T;  4UC4 A;  1LOJ A;  2KRS A;  1VIE A;  3ER0 A;  1TH7 A;  3G71 T;  2WSC E;  3CCQ A;  1VQP T;  2RHX A;  3VS0 A;  1T3L A;  2OTL A;  1EIF A;  1G3W A;  2XDD A;  4M75 C;  2G6F X;  2EVR A;  1RAA B;  4LDX A;  3C94 A;  3CBP A;  1JO8 A;  3MHX A;  2O4X B;  1D1B A;  1YP5 A;  1IGQ A;  3C95 A;  3CCR Q;  1VQ5 Q;  1FMK A;  2CH4 A;  4C0G A;  5HK3 A;  1N6A A;  2RPN A;  2XK0 A;  2O9V A;  4ZGJ B;  3J81 E;  3HKS A;  3M54 A;  5DLO A;  4FSX A;  1M90 U;  3JCM h;  3CME T;  1J3T A;  2KYB A;  3V8J A;  1MMG A;  1X6O A;  1ZA1 B;  4A4K A;  3TVT A;  2DJZ A;  3MEA A;  2F1L A;  3VUB A;  4D6W A;  2V1R A;  1B34 B;  5KYX A;  1GFC A;  4ATO A;  3MKD A;  2VUB A;  2DL8 A;  2PVD B;  2ZPI B;  2DLP A;  2KYM A;  2CGH A;  3CD6 Q;  3HP9 A;  2SRC A;  2D8J A;  1YJW Q;  1Q81 U;  2PZ1 A;  1JJ2 S;  4EDU A;  1KQS A;  2WSF E;  2HQX A;  2RF0 A;  1XOV A;  2EGC A;  2JOY A;  2X4J A;  1KC8 R;  4L59 A;  3V8L A;  3NTK A;  2HSE B;  2XDP A;  5FU7 B;  2QAS A;  1PKS A;  3EG2 A;  1U8R A;  3S3M A;  4KGZ B;  5J3B A;  2FHD A;  5I2S A;  4J9C A;  3R6N A;  3EG0 A;  1JEG A;  2FZG B;  1WA7 A;  2QDY B;  4M7A A;  1T3S A;  3OY9 A;  3PNW C;  2SEM A;  3CC2 T;  2YHT A;  4M7D F;  4FT4 A;  3JAM E;  2DIG A;  2HKN A;  4JJD A;  1NM7 A;  3NPF A;  1QCN A;  2YSQ A;  2K5I A;  1M2O A;  3ME9 A;  2DVE A;  1WHG A;  1SRL A;  1HD3 A;  3CMA Q;  3NGP A;  1R77 A;  5EC7 A;  3X26 B;  1QMC A;  4QKU A;  2GQV A;  3OYG A;  1MND A;  4XU2 A;  4HVU A;  4XAX B;  4M78 C;  1SHG A;  2O9S A;  1YIT Q;  1VYU A;  2MF2 A;  2OJ2 A;  2J06 A;  4C8Q E;  3U23 A;  3CPF A;  1X2K A;  4C8Q B;  2COW A;  3OA6 A;  1H8K A;  1LNX A;  5LL6 S;  2DL4 A;  1W2B S;  3CC4 A;  2R58 A;  1PCX A;  3OYN A;  2D9T A;  1YJW T;  1HK9 A;  3NMZ C;  2EYW A;  4FL6 A;  1WX6 A;  4BE0 A;  2E3H A;  3HL8 A;  1RAH B;  1KD1 C;  4PJL A;  2A36 A;  4KGV B;  2QQB A;  1K8A U;  2CUB A;  2HL5 C;  3A8H B;  3CXC P;  1WHJ A;  4AG2 C;  3KFV A;  1GFD A;  3VRY A;  2CRE A;  2ZPH B;  1I8F A;  4BUG A;  4JLG A;  1WGS A;  2ROT A;  3VV0 A;  1W2B P;  3G4S A;  1K76 A;  3WVE B;  4LD6 A;  3OYA A;  5GMK h;  4M77 G;  1SG5 A;  2ESW A;  3SWN A;  2EAY A;  2MIO A;  4BY6 C;  1RLP C;  3M0T A;  4FU6 A;  4R0K A;  3KXT A;  4K11 A;  1OPK A;  4AFQ C;  1QVF A;  1KJW A;  1RAI B;  3ULR B;  3OSV A;  1ZSZ B;  3G6E Q;  3CMA T;  3VUZ A;  2A3L A;  2L3S A;  2BIV A;  5IT9 E;  1QKW A;  4OMF B;  3A8M B;  5J26 A;  1SSF A;  2QTX A;  2CZ1 B;  3TCJ A;  2LCC A;  1Y96 B;  1HJD A;  2CH4 W;  2HMA A;  1UFF A;  3JCM g;  2EQJ A;  1GRI A;  3CCV T;  4QVC A;  4R56 A;  1WLP B;  1CKB A;  3HTR A;  3MP6 A;  3SDZ A;  5LJ3 d;  3FLG A;  1M1K U;  3A1P A;  2BZ8 A;  1RAE B;  4J9B A;  4ME7 A;  1N8R U;  4E7J A;  1BI0 A;  4E7I A;  2LZ6 B;  4JS4 A;  3LWI A;  2J05 A;  4M75 A;  4O6J A;  1HXD A;  1GCQ C;  1MV0 B;  1TS9 A;  2FO0 A;  3M0R A;  2D0N A;  1K9M C;  3T9N A;  2VYT A;  2DMO A;  4EMK B;  4F16 A;  1VQ9 Q;  1K0S A;  1B3Q A;  1WHH A;  3M0S A;  1W1F A;  3A5Z B;  1G3T A;  1C0M A;  3RBB B;  1TSF A;  2EFI A;  3CCR A;  1KQ2 A;  2RQR A;  1SSH A;  3VS1 A;  1VQ5 A;  3EHR A;  1YJ9 T;  2BE9 B;  3LGL A;  3CXC A;  4M7A F;  4B6M A;  3MET A;  4QQG A;  3TQ7 P;  2RQU A;  2ZPF B;  2DBM A;  7AT1 B;  3PIO A;  1IZ6 A;  5I21 A;  4PJO G;  3MEW A;  4KGX B;  2PNI A;  1VQM A;  1Q95 G;  2CUD A;  5GMK j;  1PM3 A;  2XMF A;  3QYH B;  1M2V B;  5D6Y A;  1KHI A;  3CD6 A;  3QBY A;  4FIB A;  5GAN 4;  2AT1 B;  4DQ2 A;  4N0A A;  5FRN A;  1YHQ T;  2JN0 A;  2FZK B;  5IXF A;  2DTI A;  3REA B;  2RJC A;  1M30 A;  1M3A A;  2RHZ A;  2V8J A;  2OAU A;  1SKU B;  1QCO A;  4FW1 A;  2RJF A;  5GMK l;  3EH1 A;  4Z88 A;  1H3H A;  1YBY A;  1KSW A;  2H8H A;  2LQW A;  2LQ8 A;  3EFR A;  1QKX A;  1NLP C;  1X6G A;  5L8R E;  2OTL Q;  1BYM A;  1YNZ A;  2GNC A;  5CKH A;  4E7K A;  2ATC B;  2YRV A;  2J6K A;  3OBW A;  1NG2 A;  3BE3 A;  2RI5 A;  1IO6 A;  3O5Z A;  4M75 G;  5FU7 C;  1VQ9 T;  3WVD B;  5KE3 A;  1QVG A;  2YUP A;  4NL3 A;  3E1S A;  3RNJ A;  3OYM A;  2AZS A;  1VOM A;  2MCN A;  5A0G A;  1KD1 U;  2LNH B;  2EYQ A;  2C06 A;  4M7D D;  5CKB A;  1EX4 A;  6AT1 B;  3QHS A;  2DYB A;  4D8D A;  2E6N A;  1DJ7 B;  4F14 A;  1XTD A;  3SHW A;  1VQN T;  2PTK A;  5CVI A;  2EQI A;  3JB9 G;  2DJQ A;  2COY A;  5AYF A;  3FRN A;  1UGP B;  2VKN A;  3VS2 A;  4J83 A;  1X27 A;  2NUT A;  1N9R A;  4J6W A;  1AZE A;  1ZX6 A;  4HCB A;  2LP5 A;  3OYI A;  4JJB A;  2WAC A;  3D7S B;  1LPL A;  1VQL A;  1WHM A;  2QK0 A;  1VQ7 A;  3HHT B;  1VQ6 T;  4IUQ A;  2JJ9 A;  1O75 A;  2QG9 B;  4OVA A;  3UA7 A;  3NTH A;  2L2P A;  1Q82 U;  4J9H A;  1M4Z A;  2VXE A;  3VJP A;  4ELY C;  3MP8 A;  2DRM A;  4C8Q C;  1W4S A;  2JZ2 A;  1OQK A;  4JLI A;  4IUP A;  1M8V A;  4ORZ A;  3CCQ T;  2DTH A;  2L3R A;  3GBQ A;  4MZT A;  4XTW A;  2OTL T;  2E1H A;  3JV3 A;  3UF4 A;  2L3P A;  5CQX A;  5LJ3 j;  3UAT A;  1K9M U;  1QW1 A;  2G3R A;  5GAM d;  2OAW A;  5C0M A;  2EYZ A;  3WXM B;  4J7I A;  1PHT A;  3M9Q A;  1TU0 B;  1JQQ A;  1MV3 A;  4R55 A;  4ZNX A;  4II1 A;  1OV3 A;  2D8H A;  2DIL A;  3QJY A;  1S1N A;  4MDW A;  2RI2 A;  2J6O A;  4DBR A;  1EZZ B;  2C0O A;  2RH2 A;  3M0U A;  1S72 Q;  3OW2 S;  4M78 G;  2HD0 A;  2QGF B;  3CCU Q;  3RMS A;  1GCQ A;  1KK7 A;  1X43 A;  3CC4 Q;  2K6D A;  2RK2 A;  1OU8 A;  2KI7 A;  3E19 A;  3ZFJ A;  4A63 B;  1TUD A;  2X4Y A;  4RG2 A;  3OQ5 A;  2M02 A;  3MJX A;  1AWW A;  2QA4 A;  1UG1 A;  2BUD A;  2DXT A;  1M5Q 1;  1IXD A;  2KT1 A;  3JCM e;  3NTI A;  1Y71 A;  2NUP B;  1UGV A;  3L2Z A;  1QLY A;  4OP0 A;  2DEQ A;  2CSI A;  3P8B B;  3G4S Q;  1GBQ A;  4E47 A;  2MWP A;  2QTV A;  4Y28 E;  4AFU C;  3JSC A;  3QWY A;  4FYW B;  2KSS A;  1NLO C;  3BDL A;  2EQU A;  4PFP A;  2WSE E;  1K73 R;  2KXC A;  3IQL A;  1NYG A;  5LJ3 g;  1KQS P;  3MEU A;  4ZGE B;  4CI0 C;  4M7A D;  3CCM A;  2KGT A;  2KRN A;  2X51 A;  4FYV B;  1ZA2 B;  4C0D C;  4M7D E;  2CYZ B;  4M7D B;  5KYU B;  5GAM h;  4XU0 A;  4VUB A;  3DLL A;  1MUZ A;  3AT1 B;  4J8O A;  3EG9 A;  3OB9 A;  3TU4 K;  2EWN A;  5GAN 7;  1RAD B;  3CBO A;  1UEB A;  4IIM A;  4X9D A;  5KYW A;  4C92 F;  2YRD A;  5CO7 A;  1M27 C;  2NLU A;  1FWZ A;  3A8G B;  1D1C A;  4X9C A;  2L5Q A;  4HVW A;  4RTW A;  1YCY A;  2CS7 A;  3R6O A;  1WNL A;  2MWO A;  3CC4 T;  3THK A;  4F7U G;  2DVJ A;  4HKE A;  4ZTJ A;  3V7R A;  4C0Z A;  1JU5 C;  3DLM A;  2DAQ A;  4JDS A;  2K4Y A;  2D6F A;  1IHV A;  2HKQ B;  1WXB A;  4J9D A;  3ZBD A;  1Y0M A;  2LQN A;  5HY6 A;  1BBZ A;  3F70 A;  2XHC A;  4CC4 B;  1VQK Q;  2L0A A;  3MCA B;  5GAO l;  3UPU A;  1VQM Q;  3G4S T;  5KYY A;  3I5S A;  2K3X A;  2DL3 A;  5FU6 B;  2LNV A;  5I22 A;  4MZP A;  2J6F A;  2XID A;  1PRL C;  2A08 A;  2R57 A;  1XJW B;  4RCB A;  1K4U S;  3H0H A;  3JCM X;  1KC8 U;  4RG8 A; 
#chains in the Genus database with same CATH homology
 4J9G A;  1KIK A;  2L3S A;  4HXJ A;  1QKW A;  1AWX A;  3UA6 A;  2X3W D;  1WXT A;  2ENM A;  1ZUK A;  2FRY A;  1AEY A;  1HJD A;  2CH4 W;  4CC3 A;  1OEB A;  2O88 A;  2DL5 A;  2KRO A;  1UFF A;  2FRW A;  4JPB W;  3PE0 A;  1GRI A;  1I1J A;  1PNJ A;  2YUQ A;  1G2B A;  2QDL A;  1WLP B;  1CKB A;  2LX7 A;  2P4R A;  2OI3 A;  2BZ8 A;  4J9B A;  2HDA A;  1E6H A;  2DF6 A;  1U5S A;  2NUZ A;  1UTI A;  2LZ6 B;  4LUE A;  2J05 A;  1SEM A;  1GCQ C;  1MV0 B;  2K9G A;  1ARK A;  2F2X A;  3C0C A;  2FO0 A;  3M0R A;  4RTT A;  2FEI A;  2D0N A;  1SHF A;  2EKH A;  1NEG A;  2VWF A;  2DMO A;  2RNA A;  4DEX A;  4F16 A;  1K0S A;  2JMA A;  1B3Q A;  2A37 A;  3M0S A;  1W1F A;  1LCK A;  1Z9Q A;  2O2O A;  3RBB B;  4OMQ A;  2RQR A;  3LH5 A;  1OPL A;  1UUE A;  1SSH A;  3VS1 A;  4AG1 C;  3EHR A;  2W10 A;  2GTO A;  2M0Y A;  1VYT A;  2RQU A;  1QCF A;  4EIK A;  2DBM A;  1OOT A;  1SPK A;  4FSS A;  1PRM C;  2PNI A;  4AFZ C;  1GBR A;  2KE9 A;  1SRM A;  2CUD A;  2I0N A;  2GQI A;  1AD5 A;  2XMF A;  2EW3 A;  1YWP A;  4Y92 A;  1AVZ C;  1CKA A;  3I5R A;  3M0Q A;  1G83 A;  4LUD A;  2RQV A;  4RTZ A;  3FJ5 A;  1B07 A;  2JS2 A;  2K79 A;  4AFS C;  1H92 A;  1TUC A;  2EPD A;  5IXF A;  3REA B;  2C0I A;  1UEC A;  1M30 A;  1AZG B;  1WFW A;  1UJ0 A;  1M3A A;  3H0I A;  1A0N B;  2RN8 A;  4RTY A;  3A98 A;  2EGE A;  1U06 A;  4CC2 A;  4Z88 A;  1UE9 A;  5IH2 A;  1H3H A;  1Y57 A;  1CSK A;  2GGR A;  1QWF A;  3H41 A;  2JT4 A;  2C0T A;  1KSW A;  2BZX A;  2H8H A;  2LQW A;  2EBP A;  2JTE A;  1N5Z A;  1QKX A;  3EG3 A;  4M4Z A;  2CDT A;  1NLP C;  1X6G A;  5IHN A;  1NYF A;  1PKT A;  2CSQ A;  1YNZ A;  2DNU A;  2GNC A;  2K2M A;  2ABL A;  4DEY A;  2J6K A;  1ABQ A;  3ZL7 C;  4OMP A;  4CC7 A;  5IHK A;  1NG2 A;  2HCK A;  2GTJ A;  3VRZ A;  1IO6 A;  1U3O A;  1E6G A;  3O5Z A;  1RUW A;  2IIM A;  2YUP A;  5GJV B;  2KBT A;  3RNJ A;  4JZ3 A;  4J9E A;  5ECA A;  2AZS A;  4LNP A;  2MCN A;  2E5K A;  3M0P A;  2LNH B;  1WI7 A;  1M3C A;  3EGU A;  2EGA A;  2MOX A;  4LN2 A;  2DYB A;  3EG1 A;  4D8D A;  2FPE A;  1K1Z A;  4F14 A;  2DA9 A;  5L23 A;  1X6B A;  3SHW A;  1ZUU A;  2PTK A;  3PVL A;  1EFN A;  2EQI A;  2DJQ A;  1ZLM A;  4OMO A;  3EHQ A;  2VKN A;  3VS2 A;  4JZ4 A;  2FG0 A;  1W6X A;  1M3B A;  1X27 A;  1Z9Z A;  4QT7 A;  2K7A A;  1AZE A;  1ZX6 A;  2KR3 A;  2LP5 A;  4HCK A;  1M8M A;  4JJB A;  2FPD A;  2JXB A;  2F2V A;  2JW4 A;  2D1X A;  3UA7 A;  2RQT A;  2V1Q A;  2L2P A;  5IXB A;  2NWM A;  1PWT A;  1FYN A;  4J9H A;  1UDL A;  2YUO A;  3SEM A;  1HSQ A;  3VS7 A;  4RTX A;  2DRM A;  2ED1 A;  2K3B A;  1WYX A;  4LE9 A;  1TG0 A;  2DE0 X;  5GJW B;  4Z89 A;  4ESR A;  4ORZ A;  3GBQ A;  2KRS A;  2O31 A;  1YWO A;  3JV3 A;  3UF4 A;  5FWC A;  2L3P A;  1AWO A;  3TSW A;  1GCP A;  4X1V A;  3UAT A;  3VS0 A;  1T3L A;  1BB9 A;  2G6F X;  2EVR A;  2OAW A;  4J9I A;  2EYZ A;  1PHT A;  1RLQ C;  5HCK A;  1JO8 A;  1JQQ A;  1MV3 A;  1YP5 A;  4Z8A A;  4ZNX A;  1OV3 A;  2D8H A;  2DIL A;  1ABO A;  1YN8 A;  1FMK A;  2CH4 A;  1S1N A;  2RPN A;  1I07 A;  2O9V A;  2YUN A;  1V1C A;  2F2W A;  4RTV A;  2J6O A;  1J3T A;  2LMJ A;  2KXD A;  2KYB A;  1JXM A;  2C0O A;  3M0U A;  3TVT A;  2L3Q A;  2KEA A;  3TSZ A;  2KRM A;  2V1R A;  1GFC A;  5FWB A;  1GCQ A;  2CT3 A;  1I0C A;  1X43 A;  2DL8 A;  2DLP A;  2KYM A;  2K6D A;  1GL5 A;  4A63 B;  1TUD A;  2J7I A;  4HVV A;  2JM9 A;  2SRC A;  1AWW A;  2D8J A;  1UG1 A;  2PZ1 A;  2B86 A;  2RQW A;  2RF0 A;  1XOV A;  2HBW A;  1WIE A;  2EGC A;  3NHN A;  2KT1 A;  2AZV A;  2M51 A;  1UGV A;  2DBK A;  1KFZ A;  1QLY A;  3EG2 A;  1PKS A;  1UHF A;  1QWE A;  2ROL A;  2HSP A;  1X69 A;  2CSI A;  2ECZ A;  4J9C A;  3R6N A;  1GBQ A;  1UHC A;  3EG0 A;  1JEG A;  1WA7 A;  5FW9 A;  1T3S A;  4AFU C;  2BZY A;  2KNB B;  2SEM A;  1ZSG A;  2LJ3 A;  3QWY A;  1JXO A;  2RMO A;  4F17 A;  4JJD A;  1NM7 A;  1NLO C;  1BU1 A;  5I11 A;  3NPF A;  2JMC A;  2YSQ A;  1VA7 A;  2KXC A;  1ZBJ A;  4RUG A;  3IQL A;  1SRL A;  1NYG A;  4GLM A;  3CQT A;  2BTT A;  1HD3 A;  3QWX X;  3NGP A;  4RTU A;  4D8K A;  4E6R A;  2A28 A;  2EYX A;  1ZUY A;  2KT8 A;  3I35 A;  5EC7 A;  2KGT A;  1BK2 A;  2KRN A;  1K0X A;  4OMN A;  1X2Q A;  4GBQ A;  2FPF A;  1T0J A;  1YCS B;  1W70 A;  3VS4 A;  1MUZ A;  3VS3 A;  2LJ0 A;  4IIO A;  2DL7 A;  2ED0 A;  4HVU A;  3H0F A;  1E7O A;  4WCI A;  1RI9 A;  1SHG A;  2O9S A;  4IIM A;  1VYU A;  2OJ2 A;  2J06 A;  1M27 C;  1AOJ A;  1WXU A;  2JM8 A;  3U23 A;  3VS6 A;  4HVW A;  4RTW A;  1X2K A;  2HEQ A;  4OMM A;  1H8K A;  3THK A;  1WDX A;  2AK5 A;  5IHI A;  2DVJ A;  2DL4 A;  2EYY A;  2DM1 A;  2LCS A;  1JU5 C;  3NMZ C;  1K9A A;  2EYW A;  1WX6 A;  3VS5 A;  3I9Q A;  1WXB A;  2CT4 A;  4J9D A;  1UJY A;  1Y0M A;  2LQN A;  1BBZ A;  2A36 A;  4CC4 B;  2L0A A;  2CUB A;  4AG2 C;  3KFV A;  1GFD A;  3VRY A;  2CRE A;  2W0Z A;  2ROT A;  3I5S A;  2LJ1 A;  2YT6 A;  2DRK A;  2AKK A;  2DL3 A;  1K76 A;  4J9F A;  5I22 A;  2ESW A;  2J6F A;  2MIO A;  2YDL A;  1RLP C;  1AWJ A;  1PRL C;  2JS0 A;  4OML A;  3M0T A;  2A08 A;  3PVQ A;  4R0K A;  4K11 A;  1OPK A;  4AFQ C;  1KJW A;  2AKL A;  1K4U S;  3H0H A;  3REB B;  1T0H A;  4KRT A;  1NEB A;  3ULR B;  1VYV A;  2DX1 A;  2X3X D;  2VVK A;  2GBQ A;  4JJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...