3M0TA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 9.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0tA00
1LCKA 4JJCA 1K0XA 2GNCA 1ABOA 3M0PA 5EC7A 2CUDA 2SEMA 1UE9A 3UATA 3NGPA 1SRLA 2AK5A 1PKTA 1T3SA 4FSSA 2O31A 4J9BA 4JZ3A 5L23A 2MIOA 1K9AA 3I35A 2W0ZA 1A0NB 1YNZA 1PRLC 2E5KA 2ENMA 1WA7A 1QCFA 2A37A 2P4RA 4HVVA 1CKBA 2C0OA 5IHNA 2D0NA 1WXTA 2YUNA 1QKWA 2DJQA 2SRCA 5HCKA 4CC7A 1OPLA 2F2VA 1KIKA 2L2PA 2FPFA 1OPKA 1UUEA 2DYBA 3PE0A 2KRMA 1G83A 2L3SA 1AZEA 1VYUA 4D8DA 1ZUYA 2CH4A 1M3BA 1X27A 3ZL7C 4F14A 2J05A 2CT3A 1Y57A 2L0AA 4RTXA 3VS2A 1BU1A 2EGCA 2RMOA 4AFUC 1SHGA 2FRWA 1U06A 1RUWA 3H41A 1BBZA 4LUEA 3EGUA 4J9IA 3M0SA 4LNPA 1OEBA 1K76A 2OI3A 4GLMA 3UA6A 1M3CA 2DMOA 2CSIA 2I0NA 1QWFA 4IIMA 2J06A 3EHRA 1NM7A 2K9GA 2QDLA 3GBQA 4J9FA 2NUZA 2DM1A 1KSWA 4ESRA 2FPDA 1UHCA 1M27C 1PNJA 3EG2A 1ZUKA 1M8MA 2DBMA 1GCPA 1JQQA 2FO0A 5IHIA 2A08A 3SEMA 2DX1A 4AG2C 3REAB 1PRMC 2O9VA 1NLOC 2LMJA 2AZSA 5GJVB 1S1NA 2V1QA 1JO8A 2EBPA 3IQLA 2DF6A 2C0IA 4JJDA 5I11A 2J6OA 4JZ4A 2B86A 1MV3A 2EGAA 1ZSGA 2EPDA 2M0YA 3NMZC 1BK2A 2JMAA 4HVUA 3CQTA 1H3HA 2KT8A 4J9CA 2EQIA 1GFDA 4HCKA 1M3AA 2LJ1A 1BB9A 2JXBA 4OMMA 2MCNA 1X6GA 5FW9A 1OOTA 1QWEA 1H92A 3NHNA 1WLPB 5IHKA 4J9DA 2KBTA 1JXOA 4DEYA 1CKAA 1SEMA 3VRZA 2C0TA 4ZNXA 4LN2A 1YWOA 4RTVA 4D8KA 1X2KA 2BZXA 2VKNA 1UG1A 2YT6A 2FEIA 4DEXA 5I22A 5ECAA 1B3QA 3SHWA 1E6HA 2PZ1A 4Z8AA 4OMNA 1PWTA 2EKHA 2RQRA 4QT7A 2L3PA 2ED0A 2RPNA 2YUOA 2M51A 1E6GA 1JU5C 2H8HA 2ROLA 3ULRB 1X43A 2KGTA 2YSQA 4E6RA 3UA7A 2O9SA 1YN8A 1WXBA 2KRNA 3M0TA 3H0HA 1SHFA 4CC4B 3TVTA 2HSPA 3QWYA 1GRIA 1K4US 1NEGA 1OV3A 2ED1A 1WXUA 2EW3A 1EFNA 2ABLA 2IIMA 1QLYA 3VS4A 2V1RA 2LNHB 2HDAA 3I9QA 1AWJA 1X6BA 5IXBA 2D1XA 2FG0A 2YDLA 3VS7A 2J7IA 1WIEA 1NYGA 2D8HA 1G2BA 2KROA 2GTOA 1FYNA 4J9EA 1I0CA 2JW4A 4ORZA 1UJ0A 2EYWA 2X3WD 2CUBA 1HD3A 2A36A 2NWMA 5FWBA 2O88A 5IH2A 4HVWA 2LZ6B 2RN8A 1NLPC 2O2OA 1VYVA 2JT4A 4J9GA 2W10A 1SPKA 3VS3A 4CC3A 3M0QA 1GBRA 1HJDA 1UJYA 4JPBW 2X3XD 1FMKA 2KYBA 3VS1A 2D8JA 4AFZC 2F2XA 3TSWA 1YWPA 1VA7A 4M4ZA 1KFZA 1H8KA 2KXCA 1V1CA 1X69A 1ZUUA 1MUZA 1PKSA 4RTYA 2K79A 1ABQA 3REBB 1WX6A 2LP5A 1J3TA 1JEGA 2FRYA 2HEQA 2K3BA 3M0UA 2OAWA 2EYZA 1K1ZA 2AKLA 2LX7A 2LCSA 2DBKA 3VS0A 1UECA 2JS0A 2GTJA 2ESWA 1NYFA 4OMLA 1JXMA 2PTKA 1YP5A 3U23A 2BZYA 2KRSA 1NG2A 2BZ8A 1W1FA 2DL8A 1RI9A 1AVZC 4RUGA 3VRYA 5GJWB 4RTWA 3C0CA 2VVKA 1ARKA 4RTZA 3EG1A 4K11A 4WCIA 2DRMA 2AKKA 2LQNA 4J9HA 1GFCA 5FWCA 1M30A 2RF0A 2DL3A 1U5SA 1WDXA 2A28A 4AFSC 3VS6A 4JJBA 2K6DA 2DL4A 1GCQC 1W70A 1Z9ZA 3EG3A 1AWOA 1AZGB 1UDLA 2GBQA 1UFFA 1CSKA 2LJ0A 4HXJA 2DVJA 4Y92A 2F2WA 1WI7A 2CREA 3PVQA 1T0JA 2DL7A 2EYXA 3EG0A 1T0HA 3NPFA 4KRTA 4AG1C 5IXFA 3I5RA 1W6XA 1GBQA 1HSQA 1PHTA 3UF4A 1TG0A 1U3OA 1ZLMA 1IO6A 2DL5A 3LH5A 4OMPA 2CDTA 3H0FA 1RLPC 2GQIA 2K2MA 1I07A 1QKXA 4AFQC 2DE0X 4A63B 4R0KA 3TSZA 1T3LA 1Y0MA 4F17A 2G6FX 2KEAA 2XMFA 1MV0B 4IIOA 1WFWA 3THKA 1AWWA 1NEBA 1GL5A 1GCQA 4Z88A 2GGRA 2J6KA 2JM8A 3M0RA 2EGEA 3A98A 1TUCA 2RQVA 2JS2A 3O5ZA 4GBQA 2ECZA 4F16A 4EIKA 1SRMA 1AOJA 4CC2A 1ZBJA 1X2QA 2KNBB 2ROTA 1SSHA 4LUDA 1E7OA 2L3QA 1AD5A 1UGVA 1XOVA 2EVRA 4RTUA 2DNUA 4RTTA 1B07A 2FPEA 2KE9A 1UTIA 2YUPA 2K7AA 2BTTA 2DLPA 3FJ5A 2KT1A 2KXDA 3EHQA 1Z9QA 3PVLA 2VWFA 4Z89A 3QWXX 2J6FA 2CH4W 2JM9A 1WYXA 1AEYA 2LQWA 1AWXA 1K0SA 3I5SA 4OMOA 2DILA 4X1VA 2RQTA 2DRKA 2CT4A 2MOXA 1KJWA 2RNAA 2DA9A 2LJ3A 1I1JA 3JV3A 2JTEA 1VYTA 1YCSB 4OMQA 3KFVA 2RQWA 2JMCA 2YUQA 3RBBB 1UHFA 2RQUA 1N5ZA 1RLQC 3VS5A 3RNJA 2KR3A 1TUDA 2HCKA 3R6NA 2PNIA 4LE9A 2OJ2A 2KYMA 2AZVA 1ZX6A 3H0IA 2HBWA 2EYYA 2CSQA
chains in the Genus database with same CATH superfamily
4ZN3A 1LCKA 1UGRB 2P0PA 4CRIA 1C6VX 2QA4Q 1ABOA 1D1BA 5EC7A 4FYWB 3GNFB 1C0MA 1SRLA 1Q86R 2AK5A 2E5QA 4MZTA 1PKTA 5AYFA 2ZPFB 2DTHA 4M78G 1M1GA 3J81E 3OS1A 3OYJA 1K9AA 4PFOA 2W0ZA 1PRLC 2ENMA 3CCSQ 1WA7A 4HVVA 1ZSZA 3A8GB 2RJFA 2XDBA 4II1A 4QW2A 1MMNA 2COWA 1GXIE 2OX7A 1QKWA 4A53A 4MMKA 5HCKA 3QKJA 1QVGP 1OPLA 3OSVA 2L2PA 3LX7A 1OPKA 2KRMA 1I8FA 2Y4YA 3M9QA 1G83A 2KMTA 2L3SA 1VYUA 1ZUYA 5GMKh 2A0FB 1WPYA 1X27A 2B8AA 2L0AA 3OW2P 2PUOB 5D6WA 4RTXA 3V8KA 3OYLA 3DB4A 4AFUC 2RMOA 1RABB 4B9WA 1RAAB 1H3ZA 1BBZA 1M1KC 1KD1R 3EGUA 2DO3A 3M0SA 4LNPA 5GAN2 1B34B 1YJ9A 3FC3A 3EHRA 3BDUA 1NM7A 2K9GA 3OBYA 3WVDB 1ZQ1A 1KSWA 2DTOA 4J8OA 5CQYA 2IPOB 1UHCA 1W2BA 1ZUKA 3S6WA 4NS5A 1M8MA 1SF9A 3ZBDA 2DBMA 1GCPA 3AT1B 3VYGA 1QP3A 1TXQA 2A08A 3SEMA 1VQMQ 4KGVB 5IT9E 1RAEB 2LMJA 2P4TA 3QIIA 2V1QA 3AHUA 2VC8A 1QQJA 2J6OA 1VQ6Q 1M9SA 2B86A 1MV3A 3MEVA 1VQ7Q 2M0YA 1BK2A 1TH7A 4KT0E 3QG1A 2EQMA 4OMFB 1WNLA 2P0QA 4HCKA 4C5EA 1H641 1BB9A 1VUBA 2JXBA 2ZAEA 5FW9A 5LJ5e 1OOTA 2M0OA 1QWEA 3JCMc 2KBTA 1JXOA 1Q82U 1CKAA 1I5LA 3EH2A 2C0TA 2COYA 3L2QA 2FZGB 4EMKC 1X2KA 1I5OB 4LDYA 1KHCA 4MZPA 1E6HA 2PZ1A 2HKQB 1X75C 1Y71A 2RQRA 4QT7A 2ED0A 4PJLA 4FT4A 2ROLA 4A4KA 4ATOA 3JCMX 5C0MA 1UGSB 3M0TA 3MO8A 3RMSA 1IB8A 3TVTA 2HSEB 1Q81R 2OTJA 2R58A 1GRIA 2ED1A 4PLIA 4LD9K 3I56Q 1WXUA 2HAXA 3OYBA 2K3YA 3CPFA 4OGCA 1QLYA 1KC8C 1NJIC 4C8QD 2HDAA 3I9QA 3CCET 3M59A 5IXBA 1K8AR 3EGXB 3JB9H 1HXDA 3WVEB 3CCJQ 2GTOA 1S72A 4NL2A 5KCOA 2HL5C 4JS5A 1G3WA 4C8QB 3H9NA 6AT1B 3MKDA 4XTVA 5KE3A 1QVGA 3UDCA 2DTIA 4Q5WA 1TUGB 4C8QA 2ZPEB 4J9GA 2FZKB 2GQVA 1N9SA 2RH2A 4M75A 4X9CA 5LJ3d 2DFUA 2JOYA 2VV5A 3CCQQ 3UWNA 3NTIA 5LJ3h 2MI6A 3N5BB 1WHGA 2FHDA 3CD6Q 1FMKA 2KYBA 4AFZC 3MHXA 2E65A 1YWPA 4M4ZA 1H8KA 2KXCA 2DXTA 1F1BB 1X69A 4PJOG 5IN1A 4O5VA 1JJ2A 2K79A 3CCMA 2HEQA 2K3BA 3G4SQ 3M0UA 3L2UA 1NE8A 1WQ7A 2LQ8A 4F7UE 1UECA 2JS0A 3P8HA 4E7KA 2GTJA 1YP5A 2BZYA 2EKOA 3ZFJA 1W1FA 5CKHA 3TEEA 1KQ1A 1VQ4Q 1AVZC 2PU9B 2XI9A 2YLCA 1VQ6T 3C0CA 2VVKA 1Y07A 1EZZB 2QTVA 4K11A 1MHNA 3JRZA 2DRMA 3M55A 4OB1B 4J9HA 5KH6A 1GFCA 2LT1A 1Q82C 4J6WA 3EG9A 3VU3C 5LJ3e 1W4SA 2M16A 1YI2T 4AFSC 4M7AA 2E70A 1IGQA 3CBOA 2MMPA 1QP2A 1Z9ZA 3EG3A 5GANj 1D3BB 3GOXA 1CSKA 1VQ7A 4HXJA 4HT9A 4XTZA 1WI7A 2CREA 3CCVQ 1D3BA 2EYXA 4IUQA 4AG1C 1KQSA 3E1SA 1W6XA 1GBQA 5GAN7 1PHTA 3CMEQ 1VIEA 1ZLMA 5A0GA 1IO6A 3G6ET 3OBWA 1RAIB 5KYWA 3CCRT 2K2MA 1I07A 3WXMB 2LX9A 1QKXA 3M4GA 4ZTFA 4C0ZA 3MEAA 4PFZA 3GP8A 1T3LA 2KEAA 2XMFA 2ZZDA 3PNWC 1KC8U 4C8QE 1MV0B 2QGFB 1AWWA 2WSCE 4FYVB 1N8RU 2J6KA 1OYXA 5GANe 4FYYB 4BI4A 2DAQA 3JB9F 4MMLA 1QMCA 3RMQA 2RQVA 3O5ZA 4GBQA 4F16A 1KHIA 1N8RR 2YXYA 1AOJA 4EMKB 1ZBJA 1D09B 2HZYA 2ROTA 3CCEQ 1SSHA 1UGVA 2O4XA 4N4GA 2CP5A 2DNUA 1B07A 5CKEA 1YIJQ 2K7AA 2BUDA 2DLPA 3FJ5A 2KT1A 2KXDA 1Z9QA 3G71A 4Z89A 3LYIA 1YJWA 4DOVA 2J6FA 3JCMJ 1UEBA 2HBPA 4ZGJB 3SWNC 3CXCP 4M7DD 2LQWA 3ZEHA 4OMOA 1BI3A 4MDXA 3PMTA 3J7AF 3CCLQ 2MOXA 1Q86U 1NJIU 5A0DA 3OYHA 3RKYA 1AHJB 1ACMB 1VQ9T 3QO3A 2JTEA 1VQOT 1VQOA 3CCQT 3JB9G 1VQ9A 3CMEA 2RHXA 1JJ2P 3JCMe 3VS5A 2HL3A 1RLQC 2AT1B 1M2OA 1TUDA 2AHJB 4NOYA 1WJQA 3V7RA 3PTAA 2PNIA 4LE9A 2OJ2A 1VQKA 3OQ5A 2RHYA 2LVMA 1PSFA 2F1LA 3M53A 5LJ5d 1VQLT 2JUFA 2CSQA 2KK4A 5KYXA 3GNGA 5HY6A 5FROA 1M5Q1 5IAYA 3PFSA 5GMKm 4BB7A 2F69A 9ATCB 2RK2A 3S3NA 2KAFA 3UATA 3NGPA 1K9MR 4ZN1A 1UB4A 1QCOA 1M1KU 1BIAA 4JZ3A 5L23A 4A4HA 3EFOA 1IRXA 3I35A 1A0NB 2DEQA 2E5KA 3G4ST 4B9XA 4M77B 2A37A 2P4RA 1VQKQ 4DBFA 3QSUA 1MMDA 3EFOB 2QEXQ 1YCYA 2SRCA 4C92A 4J5YA 1ZHIA 5FU7B 3DKMA 3DLMA 4FSXA 1U1TA 3I56A 4XU1A 1VQNQ 4D8DA 1X6OA 2A7YA 2CH4A 1M3BA 4RMOA 2QK0A 4E7HA 4F14A 3G6EA 4RCBA 5GMKl 5GAOm 3VS2A 3FDRA 1SHGA 1U06A 3HSBA 4KULA 1RUWA 3H41A 4LUEA 3M54A 1XJWB 3PGGA 4KBMB 5FLXE 1JJ2S 3OS5A 2OI3A 2I2LA 2CKKA 4A4EA 1M3CA 3S3OA 2OTJT 2MWPA 2DXUA 3INZA 4OGEA 4IIMA 2J06A 4QKUA 2LTOA 3CCVT 2L3RA 4ELZC 1R8OB 2FPDA 4QQ6A 1DJ7B 2JVVA 3EG2A 1YJ9Q 2V8IA 1TU0B 3OYKA 1HK9A 3C94A 2LDMA 4Z02A 1YHQQ 1JQQA 2BE7D 4XU3A 1PRMC 2MK5A 2O9VA 2AZSA 3BDLA 1S1NA 1D1AA 5GAOl 1JO8A 2EBPA 2NUTA 4JJDA 5A2QE 4V2SA 5I11A 1M8VA 2KI7A 4OB3B 4JZ4A 4QVCA 2EGAA 1M90R 3CC2A 2FVUA 3NMZC 3H8ZA 4JJNK 3JCMg 2G3RA 1H3HA 1PM3A 3OYAA 4LD6A 2LJ1A 1RAHB 3LW5E 2RJDA 2RHUA 1H92A 2EAYA 1W2BS 1SEMA 3VRZA 3LWIA 3VJPA 1YWOA 3QDRB 3LH0A 3NTHA 2RI5A 2EIFA 3URGA 5GANd 4M78D 1U1SA 1UG1A 2YT6A 3A8LB 4DEXA 5I22A 2Z0WA 2EQKA 2RA2A 1B3QA 3HFOA 3CCQA 2OTLA 1YFNA 4J6YA 4OMNA 1PWTA 4C0FA 3L1AA 2RPNA 4ZGDB 1E6GA 3CCLA 1X43A 3V7CA 4M7AE 1FXXA 4E6RA 3CCJT 4P5NA 4ANJA 2O9SA 1R0CB 1WXBA 2KRNA 3H0HA 1XTDA 4A54A 2F5TX 4AMCA 3QXEB 1O9SA 2CP6A 3M56A 1EIFA 5CO7A 1EFNA 2ABLA 2XK0A 5CR2A 2XG8D 2V1RA 2NLUA 2ZPBB 3MJXA 2JNGA 2LNHB 5GANg 1RL2A 2YRDA 5HKCA 1BI1A 2E64A 1NYGA 3CMAT 3OYIA 5CK9A 3QZ9B 1FYNA 2X4XA 1VQPT 4KGXB 2E3HA 4ORZA 2DVEA 1BIBA 2CUBA 2K57A 2X3WD 1HD3A 2A36A 2NUPB 5IH2A 1YJ9T 4OF1A 4OP0A 2E6NA 5GAMg 1NLPC 3UT1A 2O2OA 2JT4A 1G5VA 1SPKA 2NUPA 1AT1B 5KYUB 1B7TA 1YI2A 2JTMA 1ZSZC 2LRQA 1HJDA 1UJYA 2EWNA 1N27A 2QYZA 5J26A 3QDFA 3TSWA 2V8KA 1VA7A 4E2FB 1IHWA 1KFZA 2CZ1B 1G8XA 5LJ3g 1KQ2A 4RTYA 1K9MC 1JEGA 3REBB 5GAN4 2LP5A 3CPWA 4PL6A 5GAMh 3OMCA 5GAOr 1QVGS 2AKLA 2K3XA 2LX7A 3A1PA 2LCSA 1TS9A 4QQGA 1N6AA 3CCUQ 2X9HA 2ESWA 4OMLA 3OYMA 2PTKA 1Y96A 1NG2A 2BZ8A 2DL8A 1QW1A 1RI9A 1OX8A 5GAMe 3TQ7P 5GJWB 1ARKA 2PVOB 1Y96B 4A4FA 3EG1A 3I55Q 1Q82R 3FEOA 4M78A 3OYGA 1U5SA 3VS6A 2K6DA 5GAMf 1TOVA 3RR6A 1GCQC 1W70A 2QQ9A 3RKWA 1AZGB 1M4ZA 2GBQA 1B34A 2LJ0A 5I2MA 3CC4Q 2HQXA 2DL7A 1P92A 2L5QA 2RJEA 5LL6S 3EG0A 3A8HB 4BY6B 4N0AC 1TG0A 3V7SA 2PQWA 2VB6A 3LH5A 5GANf 2CDTA 4D6WA 3H0FA 1XQHA 2PUKB 1VQ8T 7AT1B 3D7SB 3LWHA 2YRVA 4R0KA 2AIRB 4JRKA 3UPUA 1ZBXA 3OYNA 3OA6A 2RB6A 5GAN6 2G6FX 5LJ5h 2QGGA 3G7ZA 2KVQG 1VQLA 4IIOA 3FJPA 4QVZA 1GCQA 4Z88A 2E3IA 2JM8A 1VQ5T 4C0DB 2QEXT 1TUCA 1KK7A 2JS2A 4E7ZA 2DK3A 3S3MA 1OZ3A 4PKCC 5GMKj 4C8QG 2EVRA 4RTTA 1YHQT 2FPEA 2YUPA 1UTIA 4GLKA 2LC4A 3MP1A 2QDYB 3EHQA 3PVLA 1VIFA 2LQKA 2EFIA 2FB7A 3M4YA 1QCNA 2JM9A 1WYXA 1AEYA 5D6XA 4WF2A 1VQ8Q 3CCRQ 1AWXA 2DILA 3JCMf 1KG1A 2HNIA 2DD5A 3BFMA 4BD3A 2CT4A 2JN0A 2CP0A 2RNAA 2WSFE 4DQ2A 2DA9A 2JTFA 1YHQA 1Q7YC 4JUVA 5LJ5g 1VYTA 2E41A 1YCSB 1VQ6A 4M75F 4OMQA 2CGHA 3KFVA 2IVWA 2RQWA 3E19A 2JMCA 5GMKe 5DM7R 1BKBA 2DPPB 3RNJA 3CC2Q 3EGXA 3QYHB 1D0YA 2AZVA 4PNOA 2R5MA 1YBYA 2X4YA 1ZX6A 3I55T 1LVKA 3G1JA 1M1KR 4E7SA 3RUXA 3G71T 3M5AA 4JJCA 2H3JA 3GPLA 1K0XA 1S72T 5KYYA 3M0PA 2CUDA 1Y7XA 1UE9A 4B6MA 3FLGA 2QTXA 3RIRA 5I2SA 3HPWA 5J39A 4J9BA 4N0AA 4ZTJA 1PCXA 1G3TA 2QA4T 2K5IA 2DEUA 1CKBA 2C0OA 3CD6A 5IHNA 2X4JA 2YUNA 3I55A 2DJQA 4HKEA 2JZ2A 2RI3A 4LDWA 4CC7A 2F2VA 3PT9A 4J7FA 2DYBA 3PE0A 2CP2A 2XHCA 3ASKA 4DBRA 1AZEA 3HTRA 3QBYA 1M1FA 4HT8A 4M77E 2J05A 2CT3A 1Y57A 2RO0A 4PJOC 2EGCA 3OW2A 2FRWA 1K73R 3QHSA 4J9IA 3SD4A 2K5LA 1YITA 4FIBA 1OEBA 1K76A 4M77F 3VUZA 4F7UG 2ZGWA 1M90C 3OSSC 2DMOA 1O75A 2FL7A 1QWFA 2QG9B 2DM1A 2CP3A 3KBGA 4M7AB 4PJOF 4ESRA 3PMIA 1M27C 1VQ4T 1VQKT 3JB9I 2QI2A 4KUDK 2D9TA 3GF5A 5IHIA 4PJOB 3CMAA 3REAB 2MYSA 1NLOC 5GJVB 4PJOE 4C92G 5LJ3j 3EFSA 1D0ZA 2DXCA 4E47A 5FU6C 2DD4A 8AT1B 2QEXA 2DZCA 1ZSGA 2EPDA 2HQHA 2BKDN 4HVUA 4M75E 5KYWB 2C06A 4ZGEB 1Q7YU 2KT8A 4J9CA 1M3AA 1YJWQ 1YJNA 4OMMA 1X6GA 3NHNA 4L6V5 4BE0A 1SSFA 1WLPB 5GAMj 1OULA 1BYMA 2RD1A 3C4SA 4EMHA 2E1HA 1R77A 3EGDB 2KDSA 4D8KA 2FEIA 3OS2A 5ECAA 2CZ7B 3SHWA 4Z8AA 2F5KA 4EMKA 2QXFA 4J6XA 2EKHA 4C8QC 2YUOA 4OVAA 4PJMA 2DIQA 4FW2A 3ULRB 2YSQA 3KUFA 1WZOA 2O4XB 4M7DF 3UA7A 3RDVA 5GMKi 4OB0B 4BDZA 4BE1A 1SHFA 4O6JA 4CC4B 5GAOp 2HSPA 1ZA2B 1K8AU 1NEGA 2EW3A 1OZ2A 5GANh 2YLBA 4X9DA 3M58A 1WJSA 3VS4A 1IZ6A 1W2BP 4A4GA 1AWJA 1X6BA 2QQRA 2XU8A 5EG2A 3VS7A 1PSEA 2GFUA 2J7IA 2D8HA 2R57A 4R55A 3CCST 2KROA 5GAOn 3P8DA 3JSCA 2JW4A 4L59A 1UJ0A 2ZPIB 2EYWA 5FWBA 2NWMA 4C92C 4XTYA 3CC2T 4HVWA 2LZ6B 2RN8A 5LJ5f 4CC3A 4ME7A 3SDZA 3LGFA 1GBRA 1M90U 3CC4A 5KYXB 2WSEE 4JPBW 2X3XD 5CAIA 4E7LA 1ZSZB 2VUBA 4WTOB 1FMWA 4M7DB 3SFMA 1V1CA 4QQDA 2DERA 1PKSA 1ABQA 1J3TA 2RI2A 4JRIA 4LXCA 4M7DA 2YRCA 2CZ0B 3CXCA 1VQ5A 4HCCA 1RACB 3NTKA 4XAXB 1NJIR 2OAWA 2EYQA 3OYYA 3JB9J 5KE2A 4M77A 2EYZA 1K1ZA 2VASA 3CBMA 2BE9B 2DBKA 3J80E 3L2VA 1VQPA 1YITT 4JDSA 2D0QB 3VS0A 1NYFA 4C92B 3CCLT 1JXMA 3SB2A 2K2VA 2KRSA 4MZMA 3GIBA 2LCCA 4RUGA 5LJ3f 5D6YA 4RTZA 4DBHA 4WCIA 4N4HA 3V8LA 3HRSA 5FWCA 3CCMQ 2GCXA 2RF0A 1K8AC 2DETA 5CKBA 3CPWS 2PVGB 2A28A 4JJBA 4IUTA 2DL4A 1AWOA 1QVFS 1UDLA 1TSFA 1UFFA 4FCYA 5CIUA 2DVJA 4Y92A 4OB2B 3PVQA 2VGMA 1T0JA 1XNIA 2P84A 4C0GA 3CC7A 4IUUA 3HKSA 3TREA 1I81A 1WHLA 2DIGA 1RI0A 1OU9A 4EDUA 1HSQA 1WHKA 3UF4A 1U8RA 1U3OA 4FT2A 2HD0A 4R56A 3EH1A 2DL5A 4FYXB 2XDPA 1RLPC 2RJCA 4AFQC 2DE0X 3A5ZB 4IUVA 3TSZA 1Y0MA 5DY9A 2NUTB 3X28B 1WFWA 4Y91A 4Y28E 3CCVA 1QVFP 3M0RA 3L42A 4F04B 4L5GA 2LCLA 1BI0A 3HRUA 2DYIA 3A98A 4RCCA 3CMAQ 2ECZA 3MEUA 1SRMA 4CC2A 1X2QA 3MEWA 2YHTA 4IURA 1G3YA 1TTHB 3MP8A 1R0BG 1E7OA 2L3QA 1AD5A 5FU7C 4RKUE 5DLOA 4M7AF 4RTUA 5HK3A 3ER0A 2KE9A 4XQ3A 1SG5A 3E9FA 1M2VB 2X35A 4XU2A 2BTTA 2VWFA 4KH0B 2HKNA 2K5FA 3CPWP 5J3BA 4BI8B 1M2VA 1KD1U 4J83A 1K0SA 3I5SA 4TVRA 4C0DC 1KJWA 5GAN8 3Q1JA 4M7AC 4M7DG 1RAFB 1I1JA 1D0XA 2LJ3A 2BIVA 4M77D 3EAEA 3QUIA 1VQ8A 2DJZA 4X34A 4M78F 2RHZA 3RBBB 4XTWA 4CI0C 1N5ZA 3JCMV 4EPCA 1V76A 4M75C 2HCKA 1D1CA 4XTUA 3R6NA 3JCMP 1YJNT 3HHTB 4M78E 4DBQA 1YIJT 2PVDB 2RK1A 2KYMA 4M75B 1NBEB 3H0IA 4N4IA 2HBWA 2EYYA 1Q81C 3L2WA 2XICA 2KSSA 1WJRA 1TWBA 2GNCA 1IGUA 4FW1A 3NFCA 3A8OB 4BUGA 2SEMA 3RKXA 1LPLA 3X24B 1PD0A 2E4HA 3H6ZA 2OAUA 2OTLT 1VQ5Q 5KYUA 3CCUT 1T3SA 4FSSA 1N8RC 4VUBA 2O31A 1JBMA 2DZ9A 2OTLQ 1VQPQ 4M7AG 1WHJA 2MIOA 4M77G 1K73C 1YNZA 4DA4A 1QCFA 4PFPA 2ATCB 4J7IA 4C5GA 5DLQE 2GF7A 2ZPHB 1VQ4A 4M75D 1MNEA 3E2UA 2D0NA 1WXTA 3META 2JJ9A 2Y4XA 2QQSA 2OTJQ 4DOWA 4C5HA 1KIKA 3QZ5B 2FPFA 1N9RA 1UUEA 2QQBA 3BW1A 5AT1B 1FWZA 1UGPB 4JS4A 4F7UF 2EJ9A 2QASA 3KXTA 3ZL7C 2MPXC 2K4YA 1WHMA 1BU1A 4EMGA 3CCSA 3F70A 3EG9B 1IXDA 4JRQA 4BE2A 1VQNT 2FYKA 3BY7A 4GLMA 3UA6A 5KYNA 5CKFA 5L8RE 4C92E 3V8JA 2CSIA 2I0NA 3GBQA 2QDLA 4J9FA 4M78B 4M77C 1MMAA 1BCOA 2NUZA 3VUBA 3FB9A 1VQMA 5GAOq 2COZA 1FMVA 4M75G 3CEYA 3RESA 2EQUA 2VGNA 1PNJA 3BE3A 1MMGA 2QA4A 4C5IA 5D7UA 3CCRA 1YITQ 2FO0A 5A0LA 2E6ZA 2DX1A 3OW2S 3LLRA 4AG2C 4M7DE 1ZA1B 3TCJA 3HP9A 3IQLA 5FRMA 2WACA 2C0IA 2DF6A 3OB9A 3DB3A 2E12A 4RG8A 2MF2A 2FZCB 5C6SA 2JMAA 3CQTA 1SKUB 3X26B 3C12A 1OU8A 1GFDA 2EQIA 1VQMT 4FM4B 3X20B 2P0KA 2EJGA 2HQEA 2MCNA 3TU4K 3CD6T 3C95A 3OY9A 5IHKA 1HYOA 4J9DA 4DEYA 1YIJA 1K9MU 3L2RA 4ZNXA 4LN2A 4HCBA 1G3SA 1QVPA 4RTVA 2BZXA 1Q7YR 2VKNA 4JLGA 3M57A 3G6EQ 1X01A 2XKOC 3OYCA 2GFAA 3JCMQ 1Q81U 2LT4A 5FU6B 2L3PA 2M51A 2QQAA 1JU5C 2H8HA 2LNVA 2KGTA 1VQ7T 1YN8A 3CCJA 2CP7A 2X4WA 2DXBA 1WQWA 4MDWA 4XU0A 2VYTA 3QWYA 1K4US 4LDVA 1OV3A 3CC7Q 1Q86C 1IHVA 4KGZB 1K73U 2IIMA 4ELYC 3A8MB 3MP6A 2HMAA 3HL8A 2Y90A 2D1XA 2EQJA 3CCUA 2FG0A 2YDLA 8ATCB 2VXEA 1I4K1 1WIEA 5KCHA 1G2BA 4J9EA 2R5AA 3OMGA 3JCMb 1I0CA 4F7UA 4YTLA 3GLXA 5CKDA 2CS7A 1LJOA 1WGSA 2MWOA 3I56T 5GAN5 1KQSP 2O88A 4LDXA 4F7UB 2RM4A 5LJ5j 1VYVA 1S72Q 2E10A 2W10A 3QJ6A 4C92F 5I21A 1WHHA 3O8VA 3VS3A 2XDDA 3M0QA 4XTXA 1KC8R 5FRNA 5CVIA 3PIPA 1V29B 1VQOQ 4PJJA 4C92D 2M9UA 3FRNA 1NPPA 3VYHB 3RERA 1C1AA 3VS1A 2D8JA 5CQXA 2MAMA 5KYYB 2F2XA 3E9GA 4GY5A 4HA8A 2A3LA 4NL3A 1VOMA 1ZUUA 2ZCFB 1MUZA 3HFNA 2NYSA 1WX6A 1NPRA 2FRYA 2DKGA 2YWWA 3X25B 4BDYA 2ZPGB 4IUPA 3PIOA 1YI2Q 2V26A 1FX7A 4PLLA 3U23A 2QAZA 3QJYA 2M02A 3EFRA 1UGQB 2O01E 2RHIA 3VRYA 4RG2A 4RTWA 3QPHA 3OYEA 3DLLA 2H3EB 3FIFA 2AKKA 2LQNA 5GAN3 1LOJA 1M30A 3CCEA 2DL3A 2KY9A 1NZ9A 1WDXA 3CXCS 3L2ZA 2V8JA 5CCAA 3JCMh 2VXFA 2F2WA 5GAMd 4JRPA 1T0HA 3CMET 3NPFA 4E7JA 4M7AD 4KRTA 5IXFA 3JB9D 3I5RA 2D6FA 3ME9A 4JLIA 3JAME 3MCAB 1BCMA 1OI1A 4OMPA 3CC4T 2GQIA 4PJOA 2M1HA 3SWNB 4A63B 4HCZA 5HK0A 4F17A 4E7IA 1OQKA 2CYZB 1IREB 3SWNA 3THKA 1QVFA 4IKFA 1NEBA 1GL5A 2GGRA 1MGQA 1YJWT 1PC0A 2EGEA 2L8DA 3CCMT 4LDUA 4M7DC 4QVDA 1LNXA 4EIKA 1KQSS 3OYFA 3G71Q 3LGLA 4C8QF 1VQLQ 2KNBB 3P8BB 4LUDA 2CZ6B 4PJNA 4BY6C 4BACA 3EGDA 1XOVA 3VV0A 1OX9A 3CBPA 2EJFA 1BI2A 1PD1A 4FL6A 5M9OA 3CC7T 1YJNQ 3HRTA 4FU6A 3QWXX 3JCMd 2CH4W 3VKIA 2X51A 4PJOD 4X1VA 2RQTA 4KH1B 1VQ9Q 2DRKA 4M78C 4BI3A 3G4SA 1MNDA 3JV3A 4XK8E 1VQNA 2IG0A 2L89A 1PG5B 2XIDA 4AT1B 1EX4A 2YUQA 1UHFA 2RQUA 3QYGB 4KUIA 4UC4A 2XD0A 2KR3A 3JCMW 3OS0A 1RAGB 3R6OA 1JB0E 2KQWA 4PK4A 3OYDA 3MPUB 1Q95G 1RADB 3T9NA 1JRIA 1KD1C
chains in the Genus database with same CATH topology
1LCKA 4JJCA 1K0XA 2GNCA 1ABOA 3M0PA 5EC7A 2CUDA 2SEMA 1UE9A 3UATA 3NGPA 1SRLA 2AK5A 1PKTA 1T3SA 4FSSA 2O31A 4J9BA 4JZ3A 5L23A 2MIOA 1K9AA 3I35A 2W0ZA 1A0NB 1YNZA 1PRLC 2E5KA 2ENMA 1WA7A 1QCFA 2A37A 2P4RA 4HVVA 1CKBA 2C0OA 5IHNA 2D0NA 1WXTA 2YUNA 1QKWA 2DJQA 2SRCA 5HCKA 4CC7A 1OPLA 2F2VA 1KIKA 2L2PA 2FPFA 1OPKA 1UUEA 2DYBA 3PE0A 2KRMA 1G83A 2L3SA 1AZEA 1VYUA 4D8DA 1ZUYA 2CH4A 1M3BA 1X27A 3ZL7C 4F14A 2J05A 2CT3A 1Y57A 2L0AA 4RTXA 3VS2A 1BU1A 2EGCA 2RMOA 4AFUC 1SHGA 2FRWA 1U06A 1RUWA 3H41A 1BBZA 4LUEA 3EGUA 4J9IA 3M0SA 4LNPA 1OEBA 1K76A 2OI3A 4GLMA 3UA6A 1M3CA 2DMOA 2CSIA 2I0NA 1QWFA 4IIMA 2J06A 3EHRA 1NM7A 2K9GA 2QDLA 3GBQA 4J9FA 2NUZA 2DM1A 1KSWA 4ESRA 2FPDA 1UHCA 1M27C 1PNJA 3EG2A 1ZUKA 1M8MA 2DBMA 1GCPA 1JQQA 2FO0A 5IHIA 2A08A 3SEMA 2DX1A 4AG2C 3REAB 1PRMC 2O9VA 1NLOC 2LMJA 2AZSA 5GJVB 1S1NA 2V1QA 1JO8A 2EBPA 3IQLA 2DF6A 2C0IA 4JJDA 5I11A 2J6OA 4JZ4A 2B86A 1MV3A 2EGAA 1ZSGA 2EPDA 2M0YA 3NMZC 1BK2A 2JMAA 4HVUA 3CQTA 1H3HA 2KT8A 4J9CA 2EQIA 1GFDA 4HCKA 1M3AA 2LJ1A 1BB9A 2JXBA 4OMMA 2MCNA 1X6GA 5FW9A 1OOTA 1QWEA 1H92A 3NHNA 1WLPB 5IHKA 4J9DA 2KBTA 1JXOA 4DEYA 1CKAA 1SEMA 3VRZA 2C0TA 4ZNXA 4LN2A 1YWOA 4RTVA 4D8KA 1X2KA 2BZXA 2VKNA 1UG1A 2YT6A 2FEIA 4DEXA 5I22A 5ECAA 1B3QA 3SHWA 1E6HA 2PZ1A 4Z8AA 4OMNA 1PWTA 2EKHA 2RQRA 4QT7A 2L3PA 2ED0A 2RPNA 2YUOA 2M51A 1E6GA 1JU5C 2H8HA 2ROLA 3ULRB 1X43A 2KGTA 2YSQA 4E6RA 3UA7A 2O9SA 1YN8A 1WXBA 2KRNA 3M0TA 3H0HA 1SHFA 4CC4B 3TVTA 2HSPA 3QWYA 1GRIA 1K4US 1NEGA 1OV3A 2ED1A 1WXUA 2EW3A 1EFNA 2ABLA 2IIMA 1QLYA 3VS4A 2V1RA 2LNHB 2HDAA 3I9QA 1AWJA 1X6BA 5IXBA 2D1XA 2FG0A 2YDLA 3VS7A 2J7IA 1WIEA 1NYGA 2D8HA 1G2BA 2KROA 2GTOA 1FYNA 4J9EA 1I0CA 2JW4A 4ORZA 1UJ0A 2EYWA 2X3WD 2CUBA 1HD3A 2A36A 2NWMA 5FWBA 2O88A 5IH2A 4HVWA 2LZ6B 2RN8A 1NLPC 2O2OA 1VYVA 2JT4A 4J9GA 2W10A 1SPKA 3VS3A 4CC3A 3M0QA 1GBRA 1HJDA 1UJYA 4JPBW 2X3XD 1FMKA 2KYBA 3VS1A 2D8JA 4AFZC 2F2XA 3TSWA 1YWPA 1VA7A 4M4ZA 1KFZA 1H8KA 2KXCA 1V1CA 1X69A 1ZUUA 1MUZA 1PKSA 4RTYA 2K79A 1ABQA 3REBB 1WX6A 2LP5A 1J3TA 1JEGA 2FRYA 2HEQA 2K3BA 3M0UA 2OAWA 2EYZA 1K1ZA 2AKLA 2LX7A 2LCSA 2DBKA 3VS0A 1UECA 2JS0A 2GTJA 2ESWA 1NYFA 4OMLA 1JXMA 2PTKA 1YP5A 3U23A 2BZYA 2KRSA 1NG2A 2BZ8A 1W1FA 2DL8A 1RI9A 1AVZC 4RUGA 3VRYA 5GJWB 4RTWA 3C0CA 2VVKA 1ARKA 4RTZA 3EG1A 4K11A 4WCIA 2DRMA 2AKKA 2LQNA 4J9HA 1GFCA 5FWCA 1M30A 2RF0A 2DL3A 1U5SA 1WDXA 2A28A 4AFSC 3VS6A 4JJBA 2K6DA 2DL4A 1GCQC 1W70A 1Z9ZA 3EG3A 1AWOA 1AZGB 1UDLA 2GBQA 1UFFA 1CSKA 2LJ0A 4HXJA 2DVJA 4Y92A 2F2WA 1WI7A 2CREA 3PVQA 1T0JA 2DL7A 2EYXA 3EG0A 1T0HA 3NPFA 4KRTA 4AG1C 5IXFA 3I5RA 1W6XA 1GBQA 1HSQA 1PHTA 3UF4A 1TG0A 1U3OA 1ZLMA 1IO6A 2DL5A 3LH5A 4OMPA 2CDTA 3H0FA 1RLPC 2GQIA 2K2MA 1I07A 1QKXA 4AFQC 2DE0X 4A63B 4R0KA 3TSZA 1T3LA 1Y0MA 4F17A 2G6FX 2KEAA 2XMFA 1MV0B 4IIOA 1WFWA 3THKA 1AWWA 1NEBA 1GL5A 1GCQA 4Z88A 2GGRA 2J6KA 2JM8A 3M0RA 2EGEA 3A98A 1TUCA 2RQVA 2JS2A 3O5ZA 4GBQA 2ECZA 4F16A 4EIKA 1SRMA 1AOJA 4CC2A 1ZBJA 1X2QA 2KNBB 2ROTA 1SSHA 4LUDA 1E7OA 2L3QA 1AD5A 1UGVA 1XOVA 2EVRA 4RTUA 2DNUA 4RTTA 1B07A 2FPEA 2KE9A 1UTIA 2YUPA 2K7AA 2BTTA 2DLPA 3FJ5A 2KT1A 2KXDA 3EHQA 1Z9QA 3PVLA 2VWFA 4Z89A 3QWXX 2J6FA 2CH4W 2JM9A 1WYXA 1AEYA 2LQWA 1AWXA 1K0SA 3I5SA 4OMOA 2DILA 4X1VA 2RQTA 2DRKA 2CT4A 2MOXA 1KJWA 2RNAA 2DA9A 2LJ3A 1I1JA 3JV3A 2JTEA 1VYTA 1YCSB 4OMQA 3KFVA 2RQWA 2JMCA 2YUQA 3RBBB 1UHFA 2RQUA 1N5ZA 1RLQC 3VS5A 3RNJA 2KR3A 1TUDA 2HCKA 3R6NA 2PNIA 4LE9A 2OJ2A 2KYMA 2AZVA 1ZX6A 3H0IA 2HBWA 2EYYA 2CSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCK A;  4JJC A;  1K0X A;  2GNC A;  1ABO A;  3M0P A;  5EC7 A;  2CUD A;  2SEM A;  1UE9 A;  3UAT A;  3NGP A;  1SRL A;  2AK5 A;  1PKT A;  1T3S A;  4FSS A;  2O31 A;  4J9B A;  4JZ3 A;  5L23 A;  2MIO A;  1K9A A;  3I35 A;  2W0Z A;  1A0N B;  1YNZ A;  1PRL C;  2E5K A;  2ENM A;  1WA7 A;  1QCF A;  2A37 A;  2P4R A;  4HVV A;  1CKB A;  2C0O A;  5IHN A;  2D0N A;  1WXT A;  2YUN A;  1QKW A;  2DJQ A;  2SRC A;  5HCK A;  4CC7 A;  1OPL A;  2F2V A;  1KIK A;  2L2P A;  2FPF A;  1OPK A;  1UUE A;  2DYB A;  3PE0 A;  2KRM A;  1G83 A;  2L3S A;  1AZE A;  1VYU A;  4D8D A;  1ZUY A;  2CH4 A;  1M3B A;  1X27 A;  3ZL7 C;  4F14 A;  2J05 A;  2CT3 A;  1Y57 A;  2L0A A;  4RTX A;  3VS2 A;  1BU1 A;  2EGC A;  2RMO A;  4AFU C;  1SHG A;  2FRW A;  1U06 A;  1RUW A;  3H41 A;  1BBZ A;  4LUE A;  3EGU A;  4J9I A;  3M0S A;  4LNP A;  1OEB A;  1K76 A;  2OI3 A;  4GLM A;  3UA6 A;  1M3C A;  2DMO A;  2CSI A;  2I0N A;  1QWF A;  4IIM A;  2J06 A;  3EHR A;  1NM7 A;  2K9G A;  2QDL A;  3GBQ A;  4J9F A;  2NUZ A;  2DM1 A;  1KSW A;  4ESR A;  2FPD A;  1UHC A;  1M27 C;  1PNJ A;  3EG2 A;  1ZUK A;  1M8M A;  2DBM A;  1GCP A;  1JQQ A;  2FO0 A;  5IHI A;  2A08 A;  3SEM A;  2DX1 A;  4AG2 C;  3REA B;  1PRM C;  2O9V A;  1NLO C;  2LMJ A;  2AZS A;  5GJV B;  1S1N A;  2V1Q A;  1JO8 A;  2EBP A;  3IQL A;  2DF6 A;  2C0I A;  4JJD A;  5I11 A;  2J6O A;  4JZ4 A;  2B86 A;  1MV3 A;  2EGA A;  1ZSG A;  2EPD A;  2M0Y A;  3NMZ C;  1BK2 A;  2JMA A;  4HVU A;  3CQT A;  1H3H A;  2KT8 A;  4J9C A;  2EQI A;  1GFD A;  4HCK A;  1M3A A;  2LJ1 A;  1BB9 A;  2JXB A;  4OMM A;  2MCN A;  1X6G A;  5FW9 A;  1OOT A;  1QWE A;  1H92 A;  3NHN A;  1WLP B;  5IHK A;  4J9D A;  2KBT A;  1JXO A;  4DEY A;  1CKA A;  1SEM A;  3VRZ A;  2C0T A;  4ZNX A;  4LN2 A;  1YWO A;  4RTV A;  4D8K A;  1X2K A;  2BZX A;  2VKN A;  1UG1 A;  2YT6 A;  2FEI A;  4DEX A;  5I22 A;  5ECA A;  1B3Q A;  3SHW A;  1E6H A;  2PZ1 A;  4Z8A A;  4OMN A;  1PWT A;  2EKH A;  2RQR A;  4QT7 A;  2L3P A;  2ED0 A;  2RPN A;  2YUO A;  2M51 A;  1E6G A;  1JU5 C;  2H8H A;  2ROL A;  3ULR B;  1X43 A;  2KGT A;  2YSQ A;  4E6R A;  3UA7 A;  2O9S A;  1YN8 A;  1WXB A;  2KRN A;  3M0T A;  3H0H A;  1SHF A;  4CC4 B;  3TVT A;  2HSP A;  3QWY A;  1GRI A;  1K4U S;  1NEG A;  1OV3 A;  2ED1 A;  1WXU A;  2EW3 A;  1EFN A;  2ABL A;  2IIM A;  1QLY A;  3VS4 A;  2V1R A;  2LNH B;  2HDA A;  3I9Q A;  1AWJ A;  1X6B A;  5IXB A;  2D1X A;  2FG0 A;  2YDL A;  3VS7 A;  2J7I A;  1WIE A;  1NYG A;  2D8H A;  1G2B A;  2KRO A;  2GTO A;  1FYN A;  4J9E A;  1I0C A;  2JW4 A;  4ORZ A;  1UJ0 A;  2EYW A;  2X3W D;  2CUB A;  1HD3 A;  2A36 A;  2NWM A;  5FWB A;  2O88 A;  5IH2 A;  4HVW A;  2LZ6 B;  2RN8 A;  1NLP C;  2O2O A;  1VYV A;  2JT4 A;  4J9G A;  2W10 A;  1SPK A;  3VS3 A;  4CC3 A;  3M0Q A;  1GBR A;  1HJD A;  1UJY A;  4JPB W;  2X3X D;  1FMK A;  2KYB A;  3VS1 A;  2D8J A;  4AFZ C;  2F2X A;  3TSW A;  1YWP A;  1VA7 A;  4M4Z A;  1KFZ A;  1H8K A;  2KXC A;  1V1C A;  1X69 A;  1ZUU A;  1MUZ A;  1PKS A;  4RTY A;  2K79 A;  1ABQ A;  3REB B;  1WX6 A;  2LP5 A;  1J3T A;  1JEG A;  2FRY A;  2HEQ A;  2K3B A;  3M0U A;  2OAW A;  2EYZ A;  1K1Z A;  2AKL A;  2LX7 A;  2LCS A;  2DBK A;  3VS0 A;  1UEC A;  2JS0 A;  2GTJ A;  2ESW A;  1NYF A;  4OML A;  1JXM A;  2PTK A;  1YP5 A;  3U23 A;  2BZY A;  2KRS A;  1NG2 A;  2BZ8 A;  1W1F A;  2DL8 A;  1RI9 A;  1AVZ C;  4RUG A;  3VRY A;  5GJW B;  4RTW A;  3C0C A;  2VVK A;  1ARK A;  4RTZ A;  3EG1 A;  4K11 A;  4WCI A;  2DRM A;  2AKK A;  2LQN A;  4J9H A;  1GFC A;  5FWC A;  1M30 A;  2RF0 A;  2DL3 A;  1U5S A;  1WDX A;  2A28 A;  4AFS C;  3VS6 A;  4JJB A;  2K6D A;  2DL4 A;  1GCQ C;  1W70 A;  1Z9Z A;  3EG3 A;  1AWO A;  1AZG B;  1UDL A;  2GBQ A;  1UFF A;  1CSK A;  2LJ0 A;  4HXJ A;  2DVJ A;  4Y92 A;  2F2W A;  1WI7 A;  2CRE A;  3PVQ A;  1T0J A;  2DL7 A;  2EYX A;  3EG0 A;  1T0H A;  3NPF A;  4KRT A;  4AG1 C;  5IXF A;  3I5R A;  1W6X A;  1GBQ A;  1HSQ A;  1PHT A;  3UF4 A;  1TG0 A;  1U3O A;  1ZLM A;  1IO6 A;  2DL5 A;  3LH5 A;  4OMP A;  2CDT A;  3H0F A;  1RLP C;  2GQI A;  2K2M A;  1I07 A;  1QKX A;  4AFQ C;  2DE0 X;  4A63 B;  4R0K A;  3TSZ A;  1T3L A;  1Y0M A;  4F17 A;  2G6F X;  2KEA A;  2XMF A;  1MV0 B;  4IIO A;  1WFW A;  3THK A;  1AWW A;  1NEB A;  1GL5 A;  1GCQ A;  4Z88 A;  2GGR A;  2J6K A;  2JM8 A;  3M0R A;  2EGE A;  3A98 A;  1TUC A;  2RQV A;  2JS2 A;  3O5Z A;  4GBQ A;  2ECZ A;  4F16 A;  4EIK A;  1SRM A;  1AOJ A;  4CC2 A;  1ZBJ A;  1X2Q A;  2KNB B;  2ROT A;  1SSH A;  4LUD A;  1E7O A;  2L3Q A;  1AD5 A;  1UGV A;  1XOV A;  2EVR A;  4RTU A;  2DNU A;  4RTT A;  1B07 A;  2FPE A;  2KE9 A;  1UTI A;  2YUP A;  2K7A A;  2BTT A;  2DLP A;  3FJ5 A;  2KT1 A;  2KXD A;  3EHQ A;  1Z9Q A;  3PVL A;  2VWF A;  4Z89 A;  3QWX X;  2J6F A;  2CH4 W;  2JM9 A;  1WYX A;  1AEY A;  2LQW A;  1AWX A;  1K0S A;  3I5S A;  4OMO A;  2DIL A;  4X1V A;  2RQT A;  2DRK A;  2CT4 A;  2MOX A;  1KJW A;  2RNA A;  2DA9 A;  2LJ3 A;  1I1J A;  3JV3 A;  2JTE A;  1VYT A;  1YCS B;  4OMQ A;  3KFV A;  2RQW A;  2JMC A;  2YUQ A;  3RBB B;  1UHF A;  2RQU A;  1N5Z A;  1RLQ C;  3VS5 A;  3RNJ A;  2KR3 A;  1TUD A;  2HCK A;  3R6N A;  2PNI A;  4LE9 A;  2OJ2 A;  2KYM A;  2AZV A;  1ZX6 A;  3H0I A;  2HBW A;  2EYY A;  2CSQ A; 
#chains in the Genus database with same CATH topology
 4ZN3 A;  1LCK A;  1UGR B;  2P0P A;  4CRI A;  1C6V X;  2QA4 Q;  1ABO A;  1D1B A;  5EC7 A;  4FYW B;  3GNF B;  1C0M A;  1SRL A;  1Q86 R;  2AK5 A;  2E5Q A;  4MZT A;  1PKT A;  5AYF A;  2ZPF B;  2DTH A;  4M78 G;  1M1G A;  3J81 E;  3OS1 A;  3OYJ A;  1K9A A;  4PFO A;  2W0Z A;  1PRL C;  2ENM A;  3CCS Q;  1WA7 A;  4HVV A;  1ZSZ A;  3A8G B;  2RJF A;  2XDB A;  4II1 A;  4QW2 A;  1MMN A;  2COW A;  1GXI E;  2OX7 A;  1QKW A;  4A53 A;  4MMK A;  5HCK A;  3QKJ A;  1QVG P;  1OPL A;  3OSV A;  2L2P A;  3LX7 A;  1OPK A;  2KRM A;  1I8F A;  2Y4Y A;  3M9Q A;  1G83 A;  2KMT A;  2L3S A;  1VYU A;  1ZUY A;  5GMK h;  2A0F B;  1WPY A;  1X27 A;  2B8A A;  2L0A A;  3OW2 P;  2PUO B;  5D6W A;  4RTX A;  3V8K A;  3OYL A;  3DB4 A;  4AFU C;  2RMO A;  1RAB B;  4B9W A;  1RAA B;  1H3Z A;  1BBZ A;  1M1K C;  1KD1 R;  3EGU A;  2DO3 A;  3M0S A;  4LNP A;  5GAN 2;  1B34 B;  1YJ9 A;  3FC3 A;  3EHR A;  3BDU A;  1NM7 A;  2K9G A;  3OBY A;  3WVD B;  1ZQ1 A;  1KSW A;  2DTO A;  4J8O A;  5CQY A;  2IPO B;  1UHC A;  1W2B A;  1ZUK A;  3S6W A;  4NS5 A;  1M8M A;  1SF9 A;  3ZBD A;  2DBM A;  1GCP A;  3AT1 B;  3VYG A;  1QP3 A;  1TXQ A;  2A08 A;  3SEM A;  1VQM Q;  4KGV B;  5IT9 E;  1RAE B;  2LMJ A;  2P4T A;  3QII A;  2V1Q A;  3AHU A;  2VC8 A;  1QQJ A;  2J6O A;  1VQ6 Q;  1M9S A;  2B86 A;  1MV3 A;  3MEV A;  1VQ7 Q;  2M0Y A;  1BK2 A;  1TH7 A;  4KT0 E;  3QG1 A;  2EQM A;  4OMF B;  1WNL A;  2P0Q A;  4HCK A;  4C5E A;  1H64 1;  1BB9 A;  1VUB A;  2JXB A;  2ZAE A;  5FW9 A;  5LJ5 e;  1OOT A;  2M0O A;  1QWE A;  3JCM c;  2KBT A;  1JXO A;  1Q82 U;  1CKA A;  1I5L A;  3EH2 A;  2C0T A;  2COY A;  3L2Q A;  2FZG B;  4EMK C;  1X2K A;  1I5O B;  4LDY A;  1KHC A;  4MZP A;  1E6H A;  2PZ1 A;  2HKQ B;  1X75 C;  1Y71 A;  2RQR A;  4QT7 A;  2ED0 A;  4PJL A;  4FT4 A;  2ROL A;  4A4K A;  4ATO A;  3JCM X;  5C0M A;  1UGS B;  3M0T A;  3MO8 A;  3RMS A;  1IB8 A;  3TVT A;  2HSE B;  1Q81 R;  2OTJ A;  2R58 A;  1GRI A;  2ED1 A;  4PLI A;  4LD9 K;  3I56 Q;  1WXU A;  2HAX A;  3OYB A;  2K3Y A;  3CPF A;  4OGC A;  1QLY A;  1KC8 C;  1NJI C;  4C8Q D;  2HDA A;  3I9Q A;  3CCE T;  3M59 A;  5IXB A;  1K8A R;  3EGX B;  3JB9 H;  1HXD A;  3WVE B;  3CCJ Q;  2GTO A;  1S72 A;  4NL2 A;  5KCO A;  2HL5 C;  4JS5 A;  1G3W A;  4C8Q B;  3H9N A;  6AT1 B;  3MKD A;  4XTV A;  5KE3 A;  1QVG A;  3UDC A;  2DTI A;  4Q5W A;  1TUG B;  4C8Q A;  2ZPE B;  4J9G A;  2FZK B;  2GQV A;  1N9S A;  2RH2 A;  4M75 A;  4X9C A;  5LJ3 d;  2DFU A;  2JOY A;  2VV5 A;  3CCQ Q;  3UWN A;  3NTI A;  5LJ3 h;  2MI6 A;  3N5B B;  1WHG A;  2FHD A;  3CD6 Q;  1FMK A;  2KYB A;  4AFZ C;  3MHX A;  2E65 A;  1YWP A;  4M4Z A;  1H8K A;  2KXC A;  2DXT A;  1F1B B;  1X69 A;  4PJO G;  5IN1 A;  4O5V A;  1JJ2 A;  2K79 A;  3CCM A;  2HEQ A;  2K3B A;  3G4S Q;  3M0U A;  3L2U A;  1NE8 A;  1WQ7 A;  2LQ8 A;  4F7U E;  1UEC A;  2JS0 A;  3P8H A;  4E7K A;  2GTJ A;  1YP5 A;  2BZY A;  2EKO A;  3ZFJ A;  1W1F A;  5CKH A;  3TEE A;  1KQ1 A;  1VQ4 Q;  1AVZ C;  2PU9 B;  2XI9 A;  2YLC A;  1VQ6 T;  3C0C A;  2VVK A;  1Y07 A;  1EZZ B;  2QTV A;  4K11 A;  1MHN A;  3JRZ A;  2DRM A;  3M55 A;  4OB1 B;  4J9H A;  5KH6 A;  1GFC A;  2LT1 A;  1Q82 C;  4J6W A;  3EG9 A;  3VU3 C;  5LJ3 e;  1W4S A;  2M16 A;  1YI2 T;  4AFS C;  4M7A A;  2E70 A;  1IGQ A;  3CBO A;  2MMP A;  1QP2 A;  1Z9Z A;  3EG3 A;  5GAN j;  1D3B B;  3GOX A;  1CSK A;  1VQ7 A;  4HXJ A;  4HT9 A;  4XTZ A;  1WI7 A;  2CRE A;  3CCV Q;  1D3B A;  2EYX A;  4IUQ A;  4AG1 C;  1KQS A;  3E1S A;  1W6X A;  1GBQ A;  5GAN 7;  1PHT A;  3CME Q;  1VIE A;  1ZLM A;  5A0G A;  1IO6 A;  3G6E T;  3OBW A;  1RAI B;  5KYW A;  3CCR T;  2K2M A;  1I07 A;  3WXM B;  2LX9 A;  1QKX A;  3M4G A;  4ZTF A;  4C0Z A;  3MEA A;  4PFZ A;  3GP8 A;  1T3L A;  2KEA A;  2XMF A;  2ZZD A;  3PNW C;  1KC8 U;  4C8Q E;  1MV0 B;  2QGF B;  1AWW A;  2WSC E;  4FYV B;  1N8R U;  2J6K A;  1OYX A;  5GAN e;  4FYY B;  4BI4 A;  2DAQ A;  3JB9 F;  4MML A;  1QMC A;  3RMQ A;  2RQV A;  3O5Z A;  4GBQ A;  4F16 A;  1KHI A;  1N8R R;  2YXY A;  1AOJ A;  4EMK B;  1ZBJ A;  1D09 B;  2HZY A;  2ROT A;  3CCE Q;  1SSH A;  1UGV A;  2O4X A;  4N4G A;  2CP5 A;  2DNU A;  1B07 A;  5CKE A;  1YIJ Q;  2K7A A;  2BUD A;  2DLP A;  3FJ5 A;  2KT1 A;  2KXD A;  1Z9Q A;  3G71 A;  4Z89 A;  3LYI A;  1YJW A;  4DOV A;  2J6F A;  3JCM J;  1UEB A;  2HBP A;  4ZGJ B;  3SWN C;  3CXC P;  4M7D D;  2LQW A;  3ZEH A;  4OMO A;  1BI3 A;  4MDX A;  3PMT A;  3J7A F;  3CCL Q;  2MOX A;  1Q86 U;  1NJI U;  5A0D A;  3OYH A;  3RKY A;  1AHJ B;  1ACM B;  1VQ9 T;  3QO3 A;  2JTE A;  1VQO T;  1VQO A;  3CCQ T;  3JB9 G;  1VQ9 A;  3CME A;  2RHX A;  1JJ2 P;  3JCM e;  3VS5 A;  2HL3 A;  1RLQ C;  2AT1 B;  1M2O A;  1TUD A;  2AHJ B;  4NOY A;  1WJQ A;  3V7R A;  3PTA A;  2PNI A;  4LE9 A;  2OJ2 A;  1VQK A;  3OQ5 A;  2RHY A;  2LVM A;  1PSF A;  2F1L A;  3M53 A;  5LJ5 d;  1VQL T;  2JUF A;  2CSQ A;  2KK4 A;  5KYX A;  3GNG A;  5HY6 A;  5FRO A;  1M5Q 1;  5IAY A;  3PFS A;  5GMK m;  4BB7 A;  2F69 A;  9ATC B;  2RK2 A;  3S3N A;  2KAF A;  3UAT A;  3NGP A;  1K9M R;  4ZN1 A;  1UB4 A;  1QCO A;  1M1K U;  1BIA A;  4JZ3 A;  5L23 A;  4A4H A;  3EFO A;  1IRX A;  3I35 A;  1A0N B;  2DEQ A;  2E5K A;  3G4S T;  4B9X A;  4M77 B;  2A37 A;  2P4R A;  1VQK Q;  4DBF A;  3QSU A;  1MMD A;  3EFO B;  2QEX Q;  1YCY A;  2SRC A;  4C92 A;  4J5Y A;  1ZHI A;  5FU7 B;  3DKM A;  3DLM A;  4FSX A;  1U1T A;  3I56 A;  4XU1 A;  1VQN Q;  4D8D A;  1X6O A;  2A7Y A;  2CH4 A;  1M3B A;  4RMO A;  2QK0 A;  4E7H A;  4F14 A;  3G6E A;  4RCB A;  5GMK l;  5GAO m;  3VS2 A;  3FDR A;  1SHG A;  1U06 A;  3HSB A;  4KUL A;  1RUW A;  3H41 A;  4LUE A;  3M54 A;  1XJW B;  3PGG A;  4KBM B;  5FLX E;  1JJ2 S;  3OS5 A;  2OI3 A;  2I2L A;  2CKK A;  4A4E A;  1M3C A;  3S3O A;  2OTJ T;  2MWP A;  2DXU A;  3INZ A;  4OGE A;  4IIM A;  2J06 A;  4QKU A;  2LTO A;  3CCV T;  2L3R A;  4ELZ C;  1R8O B;  2FPD A;  4QQ6 A;  1DJ7 B;  2JVV A;  3EG2 A;  1YJ9 Q;  2V8I A;  1TU0 B;  3OYK A;  1HK9 A;  3C94 A;  2LDM A;  4Z02 A;  1YHQ Q;  1JQQ A;  2BE7 D;  4XU3 A;  1PRM C;  2MK5 A;  2O9V A;  2AZS A;  3BDL A;  1S1N A;  1D1A A;  5GAO l;  1JO8 A;  2EBP A;  2NUT A;  4JJD A;  5A2Q E;  4V2S A;  5I11 A;  1M8V A;  2KI7 A;  4OB3 B;  4JZ4 A;  4QVC A;  2EGA A;  1M90 R;  3CC2 A;  2FVU A;  3NMZ C;  3H8Z A;  4JJN K;  3JCM g;  2G3R A;  1H3H A;  1PM3 A;  3OYA A;  4LD6 A;  2LJ1 A;  1RAH B;  3LW5 E;  2RJD A;  2RHU A;  1H92 A;  2EAY A;  1W2B S;  1SEM A;  3VRZ A;  3LWI A;  3VJP A;  1YWO A;  3QDR B;  3LH0 A;  3NTH A;  2RI5 A;  2EIF A;  3URG A;  5GAN d;  4M78 D;  1U1S A;  1UG1 A;  2YT6 A;  3A8L B;  4DEX A;  5I22 A;  2Z0W A;  2EQK A;  2RA2 A;  1B3Q A;  3HFO A;  3CCQ A;  2OTL A;  1YFN A;  4J6Y A;  4OMN A;  1PWT A;  4C0F A;  3L1A A;  2RPN A;  4ZGD B;  1E6G A;  3CCL A;  1X43 A;  3V7C A;  4M7A E;  1FXX A;  4E6R A;  3CCJ T;  4P5N A;  4ANJ A;  2O9S A;  1R0C B;  1WXB A;  2KRN A;  3H0H A;  1XTD A;  4A54 A;  2F5T X;  4AMC A;  3QXE B;  1O9S A;  2CP6 A;  3M56 A;  1EIF A;  5CO7 A;  1EFN A;  2ABL A;  2XK0 A;  5CR2 A;  2XG8 D;  2V1R A;  2NLU A;  2ZPB B;  3MJX A;  2JNG A;  2LNH B;  5GAN g;  1RL2 A;  2YRD A;  5HKC A;  1BI1 A;  2E64 A;  1NYG A;  3CMA T;  3OYI A;  5CK9 A;  3QZ9 B;  1FYN A;  2X4X A;  1VQP T;  4KGX B;  2E3H A;  4ORZ A;  2DVE A;  1BIB A;  2CUB A;  2K57 A;  2X3W D;  1HD3 A;  2A36 A;  2NUP B;  5IH2 A;  1YJ9 T;  4OF1 A;  4OP0 A;  2E6N A;  5GAM g;  1NLP C;  3UT1 A;  2O2O A;  2JT4 A;  1G5V A;  1SPK A;  2NUP A;  1AT1 B;  5KYU B;  1B7T A;  1YI2 A;  2JTM A;  1ZSZ C;  2LRQ A;  1HJD A;  1UJY A;  2EWN A;  1N27 A;  2QYZ A;  5J26 A;  3QDF A;  3TSW A;  2V8K A;  1VA7 A;  4E2F B;  1IHW A;  1KFZ A;  2CZ1 B;  1G8X A;  5LJ3 g;  1KQ2 A;  4RTY A;  1K9M C;  1JEG A;  3REB B;  5GAN 4;  2LP5 A;  3CPW A;  4PL6 A;  5GAM h;  3OMC A;  5GAO r;  1QVG S;  2AKL A;  2K3X A;  2LX7 A;  3A1P A;  2LCS A;  1TS9 A;  4QQG A;  1N6A A;  3CCU Q;  2X9H A;  2ESW A;  4OML A;  3OYM A;  2PTK A;  1Y96 A;  1NG2 A;  2BZ8 A;  2DL8 A;  1QW1 A;  1RI9 A;  1OX8 A;  5GAM e;  3TQ7 P;  5GJW B;  1ARK A;  2PVO B;  1Y96 B;  4A4F A;  3EG1 A;  3I55 Q;  1Q82 R;  3FEO A;  4M78 A;  3OYG A;  1U5S A;  3VS6 A;  2K6D A;  5GAM f;  1TOV A;  3RR6 A;  1GCQ C;  1W70 A;  2QQ9 A;  3RKW A;  1AZG B;  1M4Z A;  2GBQ A;  1B34 A;  2LJ0 A;  5I2M A;  3CC4 Q;  2HQX A;  2DL7 A;  1P92 A;  2L5Q A;  2RJE A;  5LL6 S;  3EG0 A;  3A8H B;  4BY6 B;  4N0A C;  1TG0 A;  3V7S A;  2PQW A;  2VB6 A;  3LH5 A;  5GAN f;  2CDT A;  4D6W A;  3H0F A;  1XQH A;  2PUK B;  1VQ8 T;  7AT1 B;  3D7S B;  3LWH A;  2YRV A;  4R0K A;  2AIR B;  4JRK A;  3UPU A;  1ZBX A;  3OYN A;  3OA6 A;  2RB6 A;  5GAN 6;  2G6F X;  5LJ5 h;  2QGG A;  3G7Z A;  2KVQ G;  1VQL A;  4IIO A;  3FJP A;  4QVZ A;  1GCQ A;  4Z88 A;  2E3I A;  2JM8 A;  1VQ5 T;  4C0D B;  2QEX T;  1TUC A;  1KK7 A;  2JS2 A;  4E7Z A;  2DK3 A;  3S3M A;  1OZ3 A;  4PKC C;  5GMK j;  4C8Q G;  2EVR A;  4RTT A;  1YHQ T;  2FPE A;  2YUP A;  1UTI A;  4GLK A;  2LC4 A;  3MP1 A;  2QDY B;  3EHQ A;  3PVL A;  1VIF A;  2LQK A;  2EFI A;  2FB7 A;  3M4Y A;  1QCN A;  2JM9 A;  1WYX A;  1AEY A;  5D6X A;  4WF2 A;  1VQ8 Q;  3CCR Q;  1AWX A;  2DIL A;  3JCM f;  1KG1 A;  2HNI A;  2DD5 A;  3BFM A;  4BD3 A;  2CT4 A;  2JN0 A;  2CP0 A;  2RNA A;  2WSF E;  4DQ2 A;  2DA9 A;  2JTF A;  1YHQ A;  1Q7Y C;  4JUV A;  5LJ5 g;  1VYT A;  2E41 A;  1YCS B;  1VQ6 A;  4M75 F;  4OMQ A;  2CGH A;  3KFV A;  2IVW A;  2RQW A;  3E19 A;  2JMC A;  5GMK e;  5DM7 R;  1BKB A;  2DPP B;  3RNJ A;  3CC2 Q;  3EGX A;  3QYH B;  1D0Y A;  2AZV A;  4PNO A;  2R5M A;  1YBY A;  2X4Y A;  1ZX6 A;  3I55 T;  1LVK A;  3G1J A;  1M1K R;  4E7S A;  3RUX A;  3G71 T;  3M5A A;  4JJC A;  2H3J A;  3GPL A;  1K0X A;  1S72 T;  5KYY A;  3M0P A;  2CUD A;  1Y7X A;  1UE9 A;  4B6M A;  3FLG A;  2QTX A;  3RIR A;  5I2S A;  3HPW A;  5J39 A;  4J9B A;  4N0A A;  4ZTJ A;  1PCX A;  1G3T A;  2QA4 T;  2K5I A;  2DEU A;  1CKB A;  2C0O A;  3CD6 A;  5IHN A;  2X4J A;  2YUN A;  3I55 A;  2DJQ A;  4HKE A;  2JZ2 A;  2RI3 A;  4LDW A;  4CC7 A;  2F2V A;  3PT9 A;  4J7F A;  2DYB A;  3PE0 A;  2CP2 A;  2XHC A;  3ASK A;  4DBR A;  1AZE A;  3HTR A;  3QBY A;  1M1F A;  4HT8 A;  4M77 E;  2J05 A;  2CT3 A;  1Y57 A;  2RO0 A;  4PJO C;  2EGC A;  3OW2 A;  2FRW A;  1K73 R;  3QHS A;  4J9I A;  3SD4 A;  2K5L A;  1YIT A;  4FIB A;  1OEB A;  1K76 A;  4M77 F;  3VUZ A;  4F7U G;  2ZGW A;  1M90 C;  3OSS C;  2DMO A;  1O75 A;  2FL7 A;  1QWF A;  2QG9 B;  2DM1 A;  2CP3 A;  3KBG A;  4M7A B;  4PJO F;  4ESR A;  3PMI A;  1M27 C;  1VQ4 T;  1VQK T;  3JB9 I;  2QI2 A;  4KUD K;  2D9T A;  3GF5 A;  5IHI A;  4PJO B;  3CMA A;  3REA B;  2MYS A;  1NLO C;  5GJV B;  4PJO E;  4C92 G;  5LJ3 j;  3EFS A;  1D0Z A;  2DXC A;  4E47 A;  5FU6 C;  2DD4 A;  8AT1 B;  2QEX A;  2DZC A;  1ZSG A;  2EPD A;  2HQH A;  2BKD N;  4HVU A;  4M75 E;  5KYW B;  2C06 A;  4ZGE B;  1Q7Y U;  2KT8 A;  4J9C A;  1M3A A;  1YJW Q;  1YJN A;  4OMM A;  1X6G A;  3NHN A;  4L6V 5;  4BE0 A;  1SSF A;  1WLP B;  5GAM j;  1OUL A;  1BYM A;  2RD1 A;  3C4S A;  4EMH A;  2E1H A;  1R77 A;  3EGD B;  2KDS A;  4D8K A;  2FEI A;  3OS2 A;  5ECA A;  2CZ7 B;  3SHW A;  4Z8A A;  2F5K A;  4EMK A;  2QXF A;  4J6X A;  2EKH A;  4C8Q C;  2YUO A;  4OVA A;  4PJM A;  2DIQ A;  4FW2 A;  3ULR B;  2YSQ A;  3KUF A;  1WZO A;  2O4X B;  4M7D F;  3UA7 A;  3RDV A;  5GMK i;  4OB0 B;  4BDZ A;  4BE1 A;  1SHF A;  4O6J A;  4CC4 B;  5GAO p;  2HSP A;  1ZA2 B;  1K8A U;  1NEG A;  2EW3 A;  1OZ2 A;  5GAN h;  2YLB A;  4X9D A;  3M58 A;  1WJS A;  3VS4 A;  1IZ6 A;  1W2B P;  4A4G A;  1AWJ A;  1X6B A;  2QQR A;  2XU8 A;  5EG2 A;  3VS7 A;  1PSE A;  2GFU A;  2J7I A;  2D8H A;  2R57 A;  4R55 A;  3CCS T;  2KRO A;  5GAO n;  3P8D A;  3JSC A;  2JW4 A;  4L59 A;  1UJ0 A;  2ZPI B;  2EYW A;  5FWB A;  2NWM A;  4C92 C;  4XTY A;  3CC2 T;  4HVW A;  2LZ6 B;  2RN8 A;  5LJ5 f;  4CC3 A;  4ME7 A;  3SDZ A;  3LGF A;  1GBR A;  1M90 U;  3CC4 A;  5KYX B;  2WSE E;  4JPB W;  2X3X D;  5CAI A;  4E7L A;  1ZSZ B;  2VUB A;  4WTO B;  1FMW A;  4M7D B;  3SFM A;  1V1C A;  4QQD A;  2DER A;  1PKS A;  1ABQ A;  1J3T A;  2RI2 A;  4JRI A;  4LXC A;  4M7D A;  2YRC A;  2CZ0 B;  3CXC A;  1VQ5 A;  4HCC A;  1RAC B;  3NTK A;  4XAX B;  1NJI R;  2OAW A;  2EYQ A;  3OYY A;  3JB9 J;  5KE2 A;  4M77 A;  2EYZ A;  1K1Z A;  2VAS A;  3CBM A;  2BE9 B;  2DBK A;  3J80 E;  3L2V A;  1VQP A;  1YIT T;  4JDS A;  2D0Q B;  3VS0 A;  1NYF A;  4C92 B;  3CCL T;  1JXM A;  3SB2 A;  2K2V A;  2KRS A;  4MZM A;  3GIB A;  2LCC A;  4RUG A;  5LJ3 f;  5D6Y A;  4RTZ A;  4DBH A;  4WCI A;  4N4H A;  3V8L A;  3HRS A;  5FWC A;  3CCM Q;  2GCX A;  2RF0 A;  1K8A C;  2DET A;  5CKB A;  3CPW S;  2PVG B;  2A28 A;  4JJB A;  4IUT A;  2DL4 A;  1AWO A;  1QVF S;  1UDL A;  1TSF A;  1UFF A;  4FCY A;  5CIU A;  2DVJ A;  4Y92 A;  4OB2 B;  3PVQ A;  2VGM A;  1T0J A;  1XNI A;  2P84 A;  4C0G A;  3CC7 A;  4IUU A;  3HKS A;  3TRE A;  1I81 A;  1WHL A;  2DIG A;  1RI0 A;  1OU9 A;  4EDU A;  1HSQ A;  1WHK A;  3UF4 A;  1U8R A;  1U3O A;  4FT2 A;  2HD0 A;  4R56 A;  3EH1 A;  2DL5 A;  4FYX B;  2XDP A;  1RLP C;  2RJC A;  4AFQ C;  2DE0 X;  3A5Z B;  4IUV A;  3TSZ A;  1Y0M A;  5DY9 A;  2NUT B;  3X28 B;  1WFW A;  4Y91 A;  4Y28 E;  3CCV A;  1QVF P;  3M0R A;  3L42 A;  4F04 B;  4L5G A;  2LCL A;  1BI0 A;  3HRU A;  2DYI A;  3A98 A;  4RCC A;  3CMA Q;  2ECZ A;  3MEU A;  1SRM A;  4CC2 A;  1X2Q A;  3MEW A;  2YHT A;  4IUR A;  1G3Y A;  1TTH B;  3MP8 A;  1R0B G;  1E7O A;  2L3Q A;  1AD5 A;  5FU7 C;  4RKU E;  5DLO A;  4M7A F;  4RTU A;  5HK3 A;  3ER0 A;  2KE9 A;  4XQ3 A;  1SG5 A;  3E9F A;  1M2V B;  2X35 A;  4XU2 A;  2BTT A;  2VWF A;  4KH0 B;  2HKN A;  2K5F A;  3CPW P;  5J3B A;  4BI8 B;  1M2V A;  1KD1 U;  4J83 A;  1K0S A;  3I5S A;  4TVR A;  4C0D C;  1KJW A;  5GAN 8;  3Q1J A;  4M7A C;  4M7D G;  1RAF B;  1I1J A;  1D0X A;  2LJ3 A;  2BIV A;  4M77 D;  3EAE A;  3QUI A;  1VQ8 A;  2DJZ A;  4X34 A;  4M78 F;  2RHZ A;  3RBB B;  4XTW A;  4CI0 C;  1N5Z A;  3JCM V;  4EPC A;  1V76 A;  4M75 C;  2HCK A;  1D1C A;  4XTU A;  3R6N A;  3JCM P;  1YJN T;  3HHT B;  4M78 E;  4DBQ A;  1YIJ T;  2PVD B;  2RK1 A;  2KYM A;  4M75 B;  1NBE B;  3H0I A;  4N4I A;  2HBW A;  2EYY A;  1Q81 C;  3L2W A;  2XIC A;  2KSS A;  1WJR A;  1TWB A;  2GNC A;  1IGU A;  4FW1 A;  3NFC A;  3A8O B;  4BUG A;  2SEM A;  3RKX A;  1LPL A;  3X24 B;  1PD0 A;  2E4H A;  3H6Z A;  2OAU A;  2OTL T;  1VQ5 Q;  5KYU A;  3CCU T;  1T3S A;  4FSS A;  1N8R C;  4VUB A;  2O31 A;  1JBM A;  2DZ9 A;  2OTL Q;  1VQP Q;  4M7A G;  1WHJ A;  2MIO A;  4M77 G;  1K73 C;  1YNZ A;  4DA4 A;  1QCF A;  4PFP A;  2ATC B;  4J7I A;  4C5G A;  5DLQ E;  2GF7 A;  2ZPH B;  1VQ4 A;  4M75 D;  1MNE A;  3E2U A;  2D0N A;  1WXT A;  3MET A;  2JJ9 A;  2Y4X A;  2QQS A;  2OTJ Q;  4DOW A;  4C5H A;  1KIK A;  3QZ5 B;  2FPF A;  1N9R A;  1UUE A;  2QQB A;  3BW1 A;  5AT1 B;  1FWZ A;  1UGP B;  4JS4 A;  4F7U F;  2EJ9 A;  2QAS A;  3KXT A;  3ZL7 C;  2MPX C;  2K4Y A;  1WHM A;  1BU1 A;  4EMG A;  3CCS A;  3F70 A;  3EG9 B;  1IXD A;  4JRQ A;  4BE2 A;  1VQN T;  2FYK A;  3BY7 A;  4GLM A;  3UA6 A;  5KYN A;  5CKF A;  5L8R E;  4C92 E;  3V8J A;  2CSI A;  2I0N A;  3GBQ A;  2QDL A;  4J9F A;  4M78 B;  4M77 C;  1MMA A;  1BCO A;  2NUZ A;  3VUB A;  3FB9 A;  1VQM A;  5GAO q;  2COZ A;  1FMV A;  4M75 G;  3CEY A;  3RES A;  2EQU A;  2VGN A;  1PNJ A;  3BE3 A;  1MMG A;  2QA4 A;  4C5I A;  5D7U A;  3CCR A;  1YIT Q;  2FO0 A;  5A0L A;  2E6Z A;  2DX1 A;  3OW2 S;  3LLR A;  4AG2 C;  4M7D E;  1ZA1 B;  3TCJ A;  3HP9 A;  3IQL A;  5FRM A;  2WAC A;  2C0I A;  2DF6 A;  3OB9 A;  3DB3 A;  2E12 A;  4RG8 A;  2MF2 A;  2FZC B;  5C6S A;  2JMA A;  3CQT A;  1SKU B;  3X26 B;  3C12 A;  1OU8 A;  1GFD A;  2EQI A;  1VQM T;  4FM4 B;  3X20 B;  2P0K A;  2EJG A;  2HQE A;  2MCN A;  3TU4 K;  3CD6 T;  3C95 A;  3OY9 A;  5IHK A;  1HYO A;  4J9D A;  4DEY A;  1YIJ A;  1K9M U;  3L2R A;  4ZNX A;  4LN2 A;  4HCB A;  1G3S A;  1QVP A;  4RTV A;  2BZX A;  1Q7Y R;  2VKN A;  4JLG A;  3M57 A;  3G6E Q;  1X01 A;  2XKO C;  3OYC A;  2GFA A;  3JCM Q;  1Q81 U;  2LT4 A;  5FU6 B;  2L3P A;  2M51 A;  2QQA A;  1JU5 C;  2H8H A;  2LNV A;  2KGT A;  1VQ7 T;  1YN8 A;  3CCJ A;  2CP7 A;  2X4W A;  2DXB A;  1WQW A;  4MDW A;  4XU0 A;  2VYT A;  3QWY A;  1K4U S;  4LDV A;  1OV3 A;  3CC7 Q;  1Q86 C;  1IHV A;  4KGZ B;  1K73 U;  2IIM A;  4ELY C;  3A8M B;  3MP6 A;  2HMA A;  3HL8 A;  2Y90 A;  2D1X A;  2EQJ A;  3CCU A;  2FG0 A;  2YDL A;  8ATC B;  2VXE A;  1I4K 1;  1WIE A;  5KCH A;  1G2B A;  4J9E A;  2R5A A;  3OMG A;  3JCM b;  1I0C A;  4F7U A;  4YTL A;  3GLX A;  5CKD A;  2CS7 A;  1LJO A;  1WGS A;  2MWO A;  3I56 T;  5GAN 5;  1KQS P;  2O88 A;  4LDX A;  4F7U B;  2RM4 A;  5LJ5 j;  1VYV A;  1S72 Q;  2E10 A;  2W10 A;  3QJ6 A;  4C92 F;  5I21 A;  1WHH A;  3O8V A;  3VS3 A;  2XDD A;  3M0Q A;  4XTX A;  1KC8 R;  5FRN A;  5CVI A;  3PIP A;  1V29 B;  1VQO Q;  4PJJ A;  4C92 D;  2M9U A;  3FRN A;  1NPP A;  3VYH B;  3RER A;  1C1A A;  3VS1 A;  2D8J A;  5CQX A;  2MAM A;  5KYY B;  2F2X A;  3E9G A;  4GY5 A;  4HA8 A;  2A3L A;  4NL3 A;  1VOM A;  1ZUU A;  2ZCF B;  1MUZ A;  3HFN A;  2NYS A;  1WX6 A;  1NPR A;  2FRY A;  2DKG A;  2YWW A;  3X25 B;  4BDY A;  2ZPG B;  4IUP A;  3PIO A;  1YI2 Q;  2V26 A;  1FX7 A;  4PLL A;  3U23 A;  2QAZ A;  3QJY A;  2M02 A;  3EFR A;  1UGQ B;  2O01 E;  2RHI A;  3VRY A;  4RG2 A;  4RTW A;  3QPH A;  3OYE A;  3DLL A;  2H3E B;  3FIF A;  2AKK A;  2LQN A;  5GAN 3;  1LOJ A;  1M30 A;  3CCE A;  2DL3 A;  2KY9 A;  1NZ9 A;  1WDX A;  3CXC S;  3L2Z A;  2V8J A;  5CCA A;  3JCM h;  2VXF A;  2F2W A;  5GAM d;  4JRP A;  1T0H A;  3CME T;  3NPF A;  4E7J A;  4M7A D;  4KRT A;  5IXF A;  3JB9 D;  3I5R A;  2D6F A;  3ME9 A;  4JLI A;  3JAM E;  3MCA B;  1BCM A;  1OI1 A;  4OMP A;  3CC4 T;  2GQI A;  4PJO A;  2M1H A;  3SWN B;  4A63 B;  4HCZ A;  5HK0 A;  4F17 A;  4E7I A;  1OQK A;  2CYZ B;  1IRE B;  3SWN A;  3THK A;  1QVF A;  4IKF A;  1NEB A;  1GL5 A;  2GGR A;  1MGQ A;  1YJW T;  1PC0 A;  2EGE A;  2L8D A;  3CCM T;  4LDU A;  4M7D C;  4QVD A;  1LNX A;  4EIK A;  1KQS S;  3OYF A;  3G71 Q;  3LGL A;  4C8Q F;  1VQL Q;  2KNB B;  3P8B B;  4LUD A;  2CZ6 B;  4PJN A;  4BY6 C;  4BAC A;  3EGD A;  1XOV A;  3VV0 A;  1OX9 A;  3CBP A;  2EJF A;  1BI2 A;  1PD1 A;  4FL6 A;  5M9O A;  3CC7 T;  1YJN Q;  3HRT A;  4FU6 A;  3QWX X;  3JCM d;  2CH4 W;  3VKI A;  2X51 A;  4PJO D;  4X1V A;  2RQT A;  4KH1 B;  1VQ9 Q;  2DRK A;  4M78 C;  4BI3 A;  3G4S A;  1MND A;  3JV3 A;  4XK8 E;  1VQN A;  2IG0 A;  2L89 A;  1PG5 B;  2XID A;  4AT1 B;  1EX4 A;  2YUQ A;  1UHF A;  2RQU A;  3QYG B;  4KUI A;  4UC4 A;  2XD0 A;  2KR3 A;  3JCM W;  3OS0 A;  1RAG B;  3R6O A;  1JB0 E;  2KQW A;  4PK4 A;  3OYD A;  3MPU B;  1Q95 G;  1RAD B;  3T9N A;  1JRI A;  1KD1 C; 
#chains in the Genus database with same CATH homology
 1LCK A;  4JJC A;  1K0X A;  2GNC A;  1ABO A;  3M0P A;  5EC7 A;  2CUD A;  2SEM A;  1UE9 A;  3UAT A;  3NGP A;  1SRL A;  2AK5 A;  1PKT A;  1T3S A;  4FSS A;  2O31 A;  4J9B A;  4JZ3 A;  5L23 A;  2MIO A;  1K9A A;  3I35 A;  2W0Z A;  1A0N B;  1YNZ A;  1PRL C;  2E5K A;  2ENM A;  1WA7 A;  1QCF A;  2A37 A;  2P4R A;  4HVV A;  1CKB A;  2C0O A;  5IHN A;  2D0N A;  1WXT A;  2YUN A;  1QKW A;  2DJQ A;  2SRC A;  5HCK A;  4CC7 A;  1OPL A;  2F2V A;  1KIK A;  2L2P A;  2FPF A;  1OPK A;  1UUE A;  2DYB A;  3PE0 A;  2KRM A;  1G83 A;  2L3S A;  1AZE A;  1VYU A;  4D8D A;  1ZUY A;  2CH4 A;  1M3B A;  1X27 A;  3ZL7 C;  4F14 A;  2J05 A;  2CT3 A;  1Y57 A;  2L0A A;  4RTX A;  3VS2 A;  1BU1 A;  2EGC A;  2RMO A;  4AFU C;  1SHG A;  2FRW A;  1U06 A;  1RUW A;  3H41 A;  1BBZ A;  4LUE A;  3EGU A;  4J9I A;  3M0S A;  4LNP A;  1OEB A;  1K76 A;  2OI3 A;  4GLM A;  3UA6 A;  1M3C A;  2DMO A;  2CSI A;  2I0N A;  1QWF A;  4IIM A;  2J06 A;  3EHR A;  1NM7 A;  2K9G A;  2QDL A;  3GBQ A;  4J9F A;  2NUZ A;  2DM1 A;  1KSW A;  4ESR A;  2FPD A;  1UHC A;  1M27 C;  1PNJ A;  3EG2 A;  1ZUK A;  1M8M A;  2DBM A;  1GCP A;  1JQQ A;  2FO0 A;  5IHI A;  2A08 A;  3SEM A;  2DX1 A;  4AG2 C;  3REA B;  1PRM C;  2O9V A;  1NLO C;  2LMJ A;  2AZS A;  5GJV B;  1S1N A;  2V1Q A;  1JO8 A;  2EBP A;  3IQL A;  2DF6 A;  2C0I A;  4JJD A;  5I11 A;  2J6O A;  4JZ4 A;  2B86 A;  1MV3 A;  2EGA A;  1ZSG A;  2EPD A;  2M0Y A;  3NMZ C;  1BK2 A;  2JMA A;  4HVU A;  3CQT A;  1H3H A;  2KT8 A;  4J9C A;  2EQI A;  1GFD A;  4HCK A;  1M3A A;  2LJ1 A;  1BB9 A;  2JXB A;  4OMM A;  2MCN A;  1X6G A;  5FW9 A;  1OOT A;  1QWE A;  1H92 A;  3NHN A;  1WLP B;  5IHK A;  4J9D A;  2KBT A;  1JXO A;  4DEY A;  1CKA A;  1SEM A;  3VRZ A;  2C0T A;  4ZNX A;  4LN2 A;  1YWO A;  4RTV A;  4D8K A;  1X2K A;  2BZX A;  2VKN A;  1UG1 A;  2YT6 A;  2FEI A;  4DEX A;  5I22 A;  5ECA A;  1B3Q A;  3SHW A;  1E6H A;  2PZ1 A;  4Z8A A;  4OMN A;  1PWT A;  2EKH A;  2RQR A;  4QT7 A;  2L3P A;  2ED0 A;  2RPN A;  2YUO A;  2M51 A;  1E6G A;  1JU5 C;  2H8H A;  2ROL A;  3ULR B;  1X43 A;  2KGT A;  2YSQ A;  4E6R A;  3UA7 A;  2O9S A;  1YN8 A;  1WXB A;  2KRN A;  3M0T A;  3H0H A;  1SHF A;  4CC4 B;  3TVT A;  2HSP A;  3QWY A;  1GRI A;  1K4U S;  1NEG A;  1OV3 A;  2ED1 A;  1WXU A;  2EW3 A;  1EFN A;  2ABL A;  2IIM A;  1QLY A;  3VS4 A;  2V1R A;  2LNH B;  2HDA A;  3I9Q A;  1AWJ A;  1X6B A;  5IXB A;  2D1X A;  2FG0 A;  2YDL A;  3VS7 A;  2J7I A;  1WIE A;  1NYG A;  2D8H A;  1G2B A;  2KRO A;  2GTO A;  1FYN A;  4J9E A;  1I0C A;  2JW4 A;  4ORZ A;  1UJ0 A;  2EYW A;  2X3W D;  2CUB A;  1HD3 A;  2A36 A;  2NWM A;  5FWB A;  2O88 A;  5IH2 A;  4HVW A;  2LZ6 B;  2RN8 A;  1NLP C;  2O2O A;  1VYV A;  2JT4 A;  4J9G A;  2W10 A;  1SPK A;  3VS3 A;  4CC3 A;  3M0Q A;  1GBR A;  1HJD A;  1UJY A;  4JPB W;  2X3X D;  1FMK A;  2KYB A;  3VS1 A;  2D8J A;  4AFZ C;  2F2X A;  3TSW A;  1YWP A;  1VA7 A;  4M4Z A;  1KFZ A;  1H8K A;  2KXC A;  1V1C A;  1X69 A;  1ZUU A;  1MUZ A;  1PKS A;  4RTY A;  2K79 A;  1ABQ A;  3REB B;  1WX6 A;  2LP5 A;  1J3T A;  1JEG A;  2FRY A;  2HEQ A;  2K3B A;  3M0U A;  2OAW A;  2EYZ A;  1K1Z A;  2AKL A;  2LX7 A;  2LCS A;  2DBK A;  3VS0 A;  1UEC A;  2JS0 A;  2GTJ A;  2ESW A;  1NYF A;  4OML A;  1JXM A;  2PTK A;  1YP5 A;  3U23 A;  2BZY A;  2KRS A;  1NG2 A;  2BZ8 A;  1W1F A;  2DL8 A;  1RI9 A;  1AVZ C;  4RUG A;  3VRY A;  5GJW B;  4RTW A;  3C0C A;  2VVK A;  1ARK A;  4RTZ A;  3EG1 A;  4K11 A;  4WCI A;  2DRM A;  2AKK A;  2LQN A;  4J9H A;  1GFC A;  5FWC A;  1M30 A;  2RF0 A;  2DL3 A;  1U5S A;  1WDX A;  2A28 A;  4AFS C;  3VS6 A;  4JJB A;  2K6D A;  2DL4 A;  1GCQ C;  1W70 A;  1Z9Z A;  3EG3 A;  1AWO A;  1AZG B;  1UDL A;  2GBQ A;  1UFF A;  1CSK A;  2LJ0 A;  4HXJ A;  2DVJ A;  4Y92 A;  2F2W A;  1WI7 A;  2CRE A;  3PVQ A;  1T0J A;  2DL7 A;  2EYX A;  3EG0 A;  1T0H A;  3NPF A;  4KRT A;  4AG1 C;  5IXF A;  3I5R A;  1W6X A;  1GBQ A;  1HSQ A;  1PHT A;  3UF4 A;  1TG0 A;  1U3O A;  1ZLM A;  1IO6 A;  2DL5 A;  3LH5 A;  4OMP A;  2CDT A;  3H0F A;  1RLP C;  2GQI A;  2K2M A;  1I07 A;  1QKX A;  4AFQ C;  2DE0 X;  4A63 B;  4R0K A;  3TSZ A;  1T3L A;  1Y0M A;  4F17 A;  2G6F X;  2KEA A;  2XMF A;  1MV0 B;  4IIO A;  1WFW A;  3THK A;  1AWW A;  1NEB A;  1GL5 A;  1GCQ A;  4Z88 A;  2GGR A;  2J6K A;  2JM8 A;  3M0R A;  2EGE A;  3A98 A;  1TUC A;  2RQV A;  2JS2 A;  3O5Z A;  4GBQ A;  2ECZ A;  4F16 A;  4EIK A;  1SRM A;  1AOJ A;  4CC2 A;  1ZBJ A;  1X2Q A;  2KNB B;  2ROT A;  1SSH A;  4LUD A;  1E7O A;  2L3Q A;  1AD5 A;  1UGV A;  1XOV A;  2EVR A;  4RTU A;  2DNU A;  4RTT A;  1B07 A;  2FPE A;  2KE9 A;  1UTI A;  2YUP A;  2K7A A;  2BTT A;  2DLP A;  3FJ5 A;  2KT1 A;  2KXD A;  3EHQ A;  1Z9Q A;  3PVL A;  2VWF A;  4Z89 A;  3QWX X;  2J6F A;  2CH4 W;  2JM9 A;  1WYX A;  1AEY A;  2LQW A;  1AWX A;  1K0S A;  3I5S A;  4OMO A;  2DIL A;  4X1V A;  2RQT A;  2DRK A;  2CT4 A;  2MOX A;  1KJW A;  2RNA A;  2DA9 A;  2LJ3 A;  1I1J A;  3JV3 A;  2JTE A;  1VYT A;  1YCS B;  4OMQ A;  3KFV A;  2RQW A;  2JMC A;  2YUQ A;  3RBB B;  1UHF A;  2RQU A;  1N5Z A;  1RLQ C;  3VS5 A;  3RNJ A;  2KR3 A;  1TUD A;  2HCK A;  3R6N A;  2PNI A;  4LE9 A;  2OJ2 A;  2KYM A;  2AZV A;  1ZX6 A;  3H0I A;  2HBW A;  2EYY A;  2CSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...