3M0TA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 9.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0tA00
1WLPB 1YNZA 4RTTA 4ORZA 2YUOA 3NGPA 1ZUYA 3R6NA 1E7OA 1ZX6A 1VYUA 3M0UA 2KROA 3VS5A 2F2WA 2K7AA 4R0KA 2J6FA 2K6DA 1NEBA 2EGEA 2J7IA 3GBQA 2JS2A 4JJDA 2PTKA 1W70A 2LMJA 4HVVA 2RPNA 1AZEA 2B86A 2EYXA 2M51A 1WFWA 1NLPC 4WCIA 2SEMA 5L23A 1FYNA 1I07A 2HSPA 1J3TA 2CSQA 2EQIA 2YUPA 2GTJA 5IHKA 4M4ZA 3EG0A 3C0CA 1KSWA 5FWBA 4GLMA 1GCPA 1M3CA 2LJ0A 2PZ1A 1HSQA 1RLQC 2DM1A 3IQLA 2RQWA 4LN2A 1AWWA 1UG1A 1RI9A 1JU5C 1JQQA 3M0TA 1Y57A 3NMZC 2GGRA 2FEIA 2BZXA 2FPDA 2GBQA 4OMOA 4ZNXA 2L3SA 4OMNA 1NM7A 2JM9A 1E6HA 2CT4A 4D8DA 2F2XA 2A37A 1SHGA 4HVUA 1PRLC 2KXCA 4J9GA 1NYFA 4AFZC 1WI7A 3LH5A 4X1VA 2FPFA 4KRTA 1WA7A 3U23A 4JPBW 1RLPC 3ULRB 1QKXA 2HDAA 1B3QA 1SEMA 1GRIA 4IIOA 4IIMA 3I5RA 1WX6A 1K76A 1X6BA 3UATA 2ROLA 1TUCA 5HCKA 3FJ5A 2EYZA 5GJWB 1JXMA 4J9EA 4D8KA 2ENMA 2L2PA 1AOJA 1X6GA 1YN8A 1QKWA 1K0SA 2DL7A 2K9GA 3O5ZA 3M0SA 1QWFA 2M0YA 1PKTA 2KRNA 2MCNA 3EHRA 5IXBA 2BTTA 1BB9A 4AFUC 2GQIA 4AFSC 1WYXA 2GNCA 1AWOA 1M3BA 3A98A 1UE9A 2C0OA 2LZ6B 1Z9ZA 2V1RA 1GBRA 1BBZA 5FW9A 1X2QA 5ECAA 1PWTA 5IHNA 1GCQA 1IO6A 1K1ZA 1Z9QA 1ZBJA 4Z89A 2DBMA 1I0CA 1VYTA 4OMLA 1CSKA 2F2VA 1T0HA 1XOVA 1QLYA 2VKNA 2O9VA 2YDLA 2LX7A 2KYBA 2ABLA 1GFDA 3QWYA 1U3OA 2CDTA 2NWMA 1M3AA 2K79A 2OJ2A 3H41A 1YP5A 4FSSA 5FWCA 1UUEA 1ZUUA 1UJ0A 3UA7A 2DYBA 4J9CA 2MOXA 4AG2C 2DX1A 1OEBA 1M8MA 2CUBA 2YUNA 2EVRA 1PKSA 4RTXA 3I5SA 1WDXA 4J9IA 2DRMA 1E6GA 2L3PA 2KT1A 1TG0A 1VA7A 1UFFA 3VS2A 2J6OA 3I35A 2DE0X 2D8HA 1GCQC 2DRKA 4QT7A 2LJ1A 1JEGA 4RUGA 1S1NA 4ESRA 5IH2A 2KE9A 2LQWA 4LUDA 3VS4A 5IXFA 1AD5A 2KT8A 3EHQA 1WXBA 1H3HA 1KIKA 2DILA 4OMPA 4K11A 1PRMC 2H8HA 2HEQA 1X43A 3I9QA 5IHIA 1W1FA 3RBBB 2JS0A 4HVWA 2JMAA 3KFVA 4F14A 1AWJA 4DEXA 2JW4A 2E5KA 2ECZA 2W0ZA 1AVZC 4JZ4A 1QCFA 3H0IA 4LE9A 4RTZA 1UGVA 4HXJA 2AK5A 1SSHA 5I22A 3JV3A 3EG2A 1YWOA 1OPKA 2HBWA 1AEYA 2DL5A 2DMOA 1NG2A 1U5SA 2P4RA 2RQVA 3M0RA 5GJVB 2KR3A 2DLPA 2EGAA 1MUZA 1X27A 2CREA 2D0NA 3TSWA 1K4US 3SHWA 1X2KA 2A28A 1ABOA 2RN8A 1A0NB 1K9AA 3H0HA 1Y0MA 1UHCA 2JMCA 2ED1A 2KGTA 3UA6A 3M0PA 1M27C 1K0XA 4OMQA 1UHFA 1MV3A 2DL3A 4RTVA 1OOTA 3NPFA 4J9FA 4J9BA 1NEGA 3QWXX 4HCKA 2D1XA 2JXBA 2KEAA 3UF4A 2RQTA 4F16A 5I11A 1MV0B 3VS6A 2DL4A 2VVKA 4Z88A 1WIEA 2V1QA 1CKBA 1SPKA 2D8JA 1T3LA 1M30A 1QWEA 3M0QA 3RNJA 1YCSB 2W10A 2A36A 3SEMA 2AZVA 3TSZA 2OI3A 2CUDA 4J9DA 1YWPA 4Z8AA 2AKLA 4RTUA 1T3SA 2O9SA 3ZL7C 2DVJA 2YT6A 1WXTA 2HCKA 2DL8A 2LNHB 4JJCA 3PVLA 2X3XD 1HD3A 1KFZA 1JXOA 3VRYA 4CC2A 4AFQC 2G6FX 2VWFA 3REAB 2CT3A 3VS1A 2DA9A 2L3QA 2LJ3A 3VS0A 2O2OA 2RQRA 4F17A 2FPEA 2YSQA 2NUZA 5EC7A 2EW3A 1HJDA 4CC3A 2FO0A 2LQNA 2RF0A 2CSIA 2DBKA 1OPLA 1V1CA 2C0IA 1G83A 2KRMA 1GBQA 4CC4B 2AZSA 1ZUKA 2GTOA 2J05A 1PHTA 1ARKA 3NHNA 3VS3A 2AKKA 2BZYA 4RTYA 2RMOA 3EG3A 2PNIA 4A63B 1I1JA 1ABQA 3REBB 1W6XA 2DJQA 3CQTA 4E6RA 2MIOA 4GBQA 2OAWA 2J06A 2KBTA 2EYWA 2RQUA 2C0TA 2KNBB 1GFCA 2K3BA 1PNJA 1SRLA 2DF6A 1JO8A 3EGUA 2ED0A 2FRWA 2X3WD 1B07A 2A08A 2JT4A 3PVQA 1NLOC 2FRYA 1H8KA 3TVTA 1T0JA 1AZGB 1WXUA 1H92A 1EFNA 3PE0A 3THKA 2QDLA 1CKAA 1LCKA 1U06A 2KRSA 2I0NA 1SHFA 2XMFA 1GL5A 2DNUA 2BZ8A 4JJBA 2EGCA 2KYMA 4JZ3A 1BK2A 3VRZA 2LCSA 1ZSGA 4J9HA 2YUQA 4OMMA 2EPDA 4Y92A 1UJYA 2KXDA 1AWXA 1ZLMA 1UDLA 2JTEA 2LP5A 1UECA 3EG1A 4LNPA 4CC7A 1RUWA 2K2MA 2SRCA 1X69A 2CH4W 1G2BA 1NYGA 2JM8A 1UTIA 1FMKA 1TUDA 2J6KA 2FG0A 2CH4A 2O88A 2L0AA 1VYVA 4DEYA 1SRMA 2EBPA 2ROTA 2RNAA 4LUEA 1OV3A 1N5ZA 3H0FA 2EYYA 2O31A 4EIKA 1BU1A 3VS7A 1KJWA 4AG1C 2ESWA 2EKHA 4RTWA 2IIMA
chains in the Genus database with same CATH superfamily
2EYQA 1WLPB 3CCMA 2EQJA 2CZ7B 2YUOA 1RACB 3MEAA 3NGPA 5GAMj 1I4K1 1ZUYA 1XQHA 1K9MR 3LYIA 1VYUA 3JCMb 5M9OA 2KROA 3OB9A 2J7IA 4BACA 1BYMA 1D3BB 3RMQA 2K3XA 3CCLQ 1HXDA 4A53A 2QQBA 4HVVA 3RKWA 1WQWA 2EYXA 3C94A 2SEMA 1FYNA 4M78E 3URGA 2HSPA 1J3TA 2HSEB 4LDVA 1U8RA 2GTJA 5IHKA 3CXCA 1EZZB 4M4ZA 3EG0A 3P8HA 1KQ2A 3C0CA 4C5GA 1KSWA 1VQ7T 3QKJA 3A8GB 4FT4A 4GLMA 4VUBA 4EPCA 4E7SA 3FEOA 4P5NA 1WJQA 2LJ0A 1YCYA 3D7SB 1RLQC 4FW1A 3IQLA 5HKCA 1UG1A 4C92F 3OYJA 2CP7A 3JCMJ 2ZPBB 4PJMA 4OMOA 4OMNA 1NM7A 3CD6Q 2RD1A 2WSCE 3EFOA 2JM9A 1E6HA 2OTJQ 4D8DA 2E70A 1FWZA 2A37A 1ZSZC 1YI2A 3DB3A 3CCQA 4J9GA 2DIQA 2RB6A 1N8RR 4X1VA 3U23A 3ULRB 2QA4T 4J6WA 1AHJB 1VQOQ 4AMCA 1G3YA 1WX6A 2KQWA 4M77E 4C8QG 1VQ6Q 4FU6A 1ZQ1A 2COYA 2ENMA 3OS0A 1X6GA 1YN8A 4JLIA 5GAN3 2FZKB 3SWNB 2K9GA 4PJOF 4DA4A 1PG5B 4EMKA 1PKTA 3M58A 2HNIA 4IURA 2MCNA 2BTTA 1D0YA 1WYXA 3QDFA 2CZ6B 5GANd 4HT8A 1QCNA 3F70A 4KUIA 3CMEQ 1Z9ZA 2V1RA 2VYTA 4C92E 3OSVA 4A4GA 3A1PA 1IO6A 4J83A 1ZA1B 1MHNA 4FCYA 2PVOB 3CC2A 1WHMA 1YITQ 4Z89A 2GFUA 2YRVA 4IUVA 4ZGJB 3OMGA 1BI3A 4E7KA 2O4XA 4OMLA 1CSKA 3I56Q 2VKNA 3MEUA 2YDLA 1Q81C 2XDBA 1SKUB 5CCAA 3QWYA 4QKUA 1U3OA 1PSFA 1RL2A 4FSSA 5FWCA 2E41A 2AIRB 2OTLT 2VASA 1VQKA 4EMHA 1ZUUA 2JNGA 2B8AA 3OYYA 2MOXA 5FU7B 1TTHB 3CCJQ 3VU3C 1M1KC 4HCBA 2EKOA 4KGVB 2EQUA 3CBPA 2EVRA 4ZGEB 2JTMA 1PKSA 2MWPA 3I5SA 1Q86C 5GAMe 3KXTA 1KD1U 5D6WA 1ZSZA 3MKDA 1TU0B 1W2BA 3G71Q 2O4XB 3JCMc 3CMEA 2KT1A 1VA7A 2HKNA 5J3BA 1LPLA 2J6OA 3VS2A 2DE0X 2KI7A 3V8KA 1GCQC 2LJ1A 1JEGA 4RUGA 4BY6B 3VS4A 3CPWA 1AD5A 1WXBA 1KQ1A 2M1HA 4K11A 2YHTA 4DEXA 4JZ4A 2ECZA 2W0ZA 1AVZC 3CC4T 1I8FA 4RTZA 2P4TA 3CC4A 4E47A 3PMIA 3X20B 4M7AG 2HBWA 5LJ5j 3BY7A 3EH1A 4EMKC 2DMOA 1U5SA 3OBYA 4PLLA 2KR3A 2RHZA 2EGAA 1X27A 3TSWA 3ZBDA 4E2FB 4M78G 3SHWA 5LJ3h 2RI5A 3JCMd 3LGFA 3UA6A 4IUUA 1Y0MA 1UHCA 2E12A 1BI1A 2LDMA 3OYFA 3GPLA 4OB1B 2A7YA 1SG5A 3CCLA 4BUGA 1JJ2A 4RCCA 2FYKA 3JB9F 4OP0A 1K8AU 1MMAA 5D6XA 4A4FA 4C8QF 3OYDA 1V29B 4XQ3A 2VXFA 3LWHA 2KEAA 3WVEB 2HL3A 2RQTA 2JN0A 2OX7A 1Y71A 1WIEA 2V1QA 2E4HA 3PNWC 3OW2S 1SPKA 1T3LA 1WJSA 3GNFB 3RNJA 3X26B 1YCSB 4HCCA 2LRQA 4QQGA 1QP2A 2ZPHB 1F1BB 3TSZA 2EFIA 2RHXA 2OI3A 2OTJT 3MCAB 2DPPB 4RTUA 2O9SA 2DJZA 2QAZA 3UT1A 5CQXA 1NBEB 1LVKA 1KD1R 1VQ8Q 4LXCA 3REAB 1BIBA 1YJWT 2XD0A 2CP2A 3VS0A 3OYIA 4C0FA 2P0PA 3SDZA 3QJYA 4F17A 4JLGA 1WHHA 2MK5A 3I55Q 4WF2A 1OPLA 2DBKA 5GAN7 2AT1B 2VUBA 1KC8R 2RK1A 2NUPA 2AZSA 1TXQA 4X34A 4C8QE 1PHTA 1ARKA 2CKKA 4EDUA 3MP6A 1X01A 4RTYA 2K4YA 2LVMA 2MI6A 1M1GA 1W6XA 4E6RA 2PQWA 2EYWA 3OYNA 2RQUA 2C0TA 5KYXA 4BDZA 1PNJA 1TOVA 2MWOA 1NJIU 4OMFB 2FRWA 2X3WD 1WQ7A 5GAN2 4C0DB 3PVQA 3E9GA 1YHQT 2FRYA 1H8KA 1M5Q1 3J81E 2QEXA 1CKAA 1VQMA 2I0NA 2ZPEB 1SHFA 4JDSA 3H8ZA 3UDCA 4EMGA 4JJBA 1QQJA 3JB9J 5LJ5d 2DXTA 5LJ3e 4JZ3A 1M2OA 4NS5A 5GMKe 2R58A 3A5ZB 4PFPA 4J9HA 4M78F 2YUQA 4XTUA 1N27A 2EPDA 1UJYA 5KYXB 2JTEA 1UECA 3CCEQ 2E3HA 5IAYA 1NJIR 1RUWA 1MNEA 3C95A 2XIDA 3JCMX 3JB9G 3CCRQ 4PL6A 4BI4A 1QVGS 4M75G 4LDYA 1TUDA 2FG0A 2NUTB 5GAOp 1Q7YC 5CKDA 2QEXQ 2EBPA 2RNAA 1N5ZA 2MF2A 2QQAA 3CCMT 3VS7A 4M75D 5KYYB 4BE1A 2IIMA 2XG8D 3FC3A 1JJ2P 1D0XA 3R6NA 3M5AA 1RAIB 1E7OA 5KYUB 1UB4A 1KQSP 3VS5A 4R0KA 5GAMd 2J6FA 1MMDA 4L6V5 2V26A 4LDWA 1OX9A 5KYWA 1OU9A 3E9FA 2A3LA 1AZEA 3AT1B 3G7ZA 1Q82U 3G71A 1RADB 3CD6A 2ZGWA 1RABB 3VKIA 1I07A 3FIFA 1W4SA 3RUXA 3BE3A 4PKCC 3JCMf 5FWBA 4JRQA 3HKSA 2K5LA 4OB2B 2FVUA 1D1CA 1FMWA 3DLMA 1M9SA 2RQWA 4LN2A 1AWWA 1XJWB 2LT4A 1IGQA 2COZA 2EQMA 3EGDB 1JQQA 3M0TA 1B34B 1K8AR 2R5AA 2FPDA 4BB7A 1Q95G 2L3SA 3CEYA 4BI3A 3I56A 4C0ZA 1B7TA 2CT4A 1P92A 2YRCA 5GANe 2CP0A 4KUDK 3OYLA 2KXCA 3GNGA 4M75F 2QDYB 2XU8A 3CCEA 1WI7A 1N6AA 2VC8A 3HSBA 4KRTA 1WA7A 1M2VB 1EIFA 1SEMA 4OGCA 4IIOA 1QVFP 3GP8A 4ZTJA 3G1JA 1K76A 5LJ3j 3OSSC 4L5GA 2ROLA 2PVGB 5HCKA 1YJ9T 3HPWA 5GJWB 3MJXA 4DBHA 1AOJA 2G3RA 1YFNA 3O5ZA 3RKXA 5IT9E 2KRNA 1QVGP 5IXBA 1VQ6A 5A0GA 1YJNA 2H3EB 1QMCA 2D9TA 1M3BA 3EG9A 1JJ2S 2LZ6B 4F7UE 4KH0B 1K1ZA 4R55A 5GAOn 3LLRA 1Q7YR 1Z9QA 1Q82C 2DKGA 5D7UA 2EAYA 4RMOA 2F2VA 4LD6A 3EH2A 2QI2A 1VQMT 1KC8C 2LX7A 4B9XA 2ABLA 3LH0A 2DD4A 2NWMA 3JCMg 2KAFA 1M3AA 5KYYA 2OJ2A 3H41A 3NTIA 2DFUA 2QK0A 2DX1A 3H9NA 4D6WA 1YIJA 1KHIA 2CUBA 8AT1B 2XK0A 4RTXA 4Z02A 2ZCFB 4PLIA 1WDXA 3CMET 3L2VA 2DRMA 3X25B 3FLGA 2KDSA 5KYWB 1OI1A 1TG0A 5A2QE 3VYGA 4PJOB 2E3IA 3CCJA 1M1KR 1C1AA 1HYOA 4JRKA 3CCRT 4ESRA 2LQWA 2C06A 1QVFA 1VQLA 2DILA 1YBYA 2PU9B 3RBBB 1VQ4A 4HVWA 4TVRA 4C8QA 2JW4A 4QW2A 1QCFA 3JCMP 3INZA 1UGVA 4HXJA 3PTAA 2AK5A 4V2SA 4N0AC 1YWOA 3MO8A 1VUBA 3VV0A 1JB0E 3RMSA 1YITA 1NG2A 3G6EQ 3M0RA 2RK2A 2YWWA 4DBFA 5GJVB 1N9RA 5GMKl 3OY9A 2DLPA 5DLOA 2CREA 2D0NA 4A54A 1K4US 1FX7A 3PIOA 1FXXA 1A0NB 2RJEA 2AHJB 5L8RE 1K9AA 2JMCA 2LTOA 4LDUA 3OS1A 5A0DA 3RERA 1K0XA 4OMQA 2F5TX 1VQ8T 1MGQA 3NPFA 2XI9A 4J9FA 4O6JA 3DLLA 2QGFB 1NEGA 2K2VA 3QWXX 5DLQE 2GFAA 4BI8B 3LWIA 1M2VA 1MV0B 4RG2A 4Z88A 1H3ZA 1IRXA 2QQRA 1QVFS 3V7CA 1CKBA 4PJOG 1TUGB 3FJPA 3M0QA 4FM4B 1M90R 2RH2A 2HZYA 1NJIC 4LD9K 2DERA 2CUDA 1ZA2B 4J9DA 4KULA 2A0FB 4Q5WA 3Q1JA 1YWPA 4Z8AA 2AKLA 4ZN3A 3CCVQ 2DVJA 1WXTA 2JZ2A 5FLXE 4JJCA 3PVLA 1HD3A 4C5EA 2G6FX 2CT3A 1VQOT 3VS1A 2DA9A 2L3QA 2CP5A 1D1AA 4C5IA 5DM7R 2D6FA 3VJPA 3OYGA 2YSQA 2RO0A 2NUZA 1HJDA 3NTKA 1I5LA 3TREA 3S6WA 2FO0A 3FB9A 1YJ9Q 4XK8E 2RF0A 1VQ4Q 3M56A 2XDPA 2L5QA 1GBQA 4N0AA 5GANh 1Y96B 2R57A 3NHNA 3VS3A 4J6YA 3CXCS 2MPXC 3M4YA 1PD1A 2BZYA 3EG9B 1VQOA 4KH1B 3CPWS 3MP1A 4M78A 4OB0B 3G4SA 1N9SA 2XDDA 1GXIE 5GANj 1LJOA 2DJQA 4M75A 3CQTA 2QQ9A 3TQ7P 4GBQA 3CCVA 1OQKA 4JUVA 2E65A 1YI2Q 1SRLA 2BE9B 4PJOE 4L59A 3EGUA 2ED0A 2X4XA 1B07A 2OTLA 2LCLA 3OYAA 1WHKA 4BDYA 3M54A 3THKA 5GAN5 2K5IA 2QTXA 1U06A 2NUTA 2XMFA 4C5HA 1GL5A 4JJNK 3OA6A 2DNUA 5GAMg 2L8DA 2Y4XA 1Q86R 2EGCA 2IVWA 1R77A 4HKEA 2CZ1B 3VRZA 2RHYA 5GANf 1NPRA 2EIFA 3L42A 3QSUA 4OMMA 4PJOD 4NOYA 2M9UA 4YTLA 1AWXA 5LJ5f 1ZLMA 4CC7A 3CCST 2CZ0B 1PSEA 2L3RA 2K2MA 2SRCA 3QJ6A 4B9WA 2CYZB 4OF1A 1K73C 1FMKA 2CH4A 1IB8A 5GAOl 2O88A 2ZZDA 4C92C 2CGHA 2L0AA 4F7UB 4RKUE 1BU1A 1VIEA 3T9NA 4M77B 4AG1C 4M7AC 2OAUA 2X4WA 1YNZA 4ORZA 4AT1B 1ZX6A 2RJFA 3OS5A 3M0UA 3G6ET 3JCMh 2F2WA 3GBQA 1NEBA 2H3JA 5GAOq 2WSEE 1WHGA 3CCQT 2JS2A 5I21A 1UEBA 1BKBA 2JTFA 3MEWA 4IUQA 1UGPB 2B86A 2M51A 2X4YA 4WCIA 5GMKj 5L23A 4N4GA 3HP9A 1M8VA 2YUPA 2X35A 1OX8A 3RIRA 3QIIA 5J26A 1GCPA 5HY6A 1M3CA 2HAXA 2QGGA 2ZPGB 2PZ1A 2BE7D 2HBPA 1VQNT 3L2WA 2FZCB 3S3MA 3L1AA 1RI9A 4IKFA 2DXCA 2FHDA 1Y7XA 2L89A 2FEIA 2BZXA 1BCMA 4XTXA 5GAMf 4ZNXA 4NL3A 1VQ5A 4QQDA 1SHGA 4M78B 1RAHB 1G3TA 1AT1B 4DBRA 5CK9A 5KE3A 2FZGB 4J5YA 1VQ5T 3SWNC 2FL7A 4NL2A 4JPBW 1RLPC 2MAMA 1QKXA 2HDAA 1B3QA 1U1TA 4M7DE 3PT9A 2CP3A 3I5RA 1UGQB 3CC7T 4CI0C 1D3BA 3UATA 1ZBXA 4FYWB 3FJ5A 4B6MA 3J7AF 4D8KA 3HRTA 5LJ3d 5LJ5e 2DL7A 3EFSA 2YRDA 4M77G 4ELZC 5CKHA 2DO3A 2X51A 1KK7A 1OZ3A 4II1A 2GQIA 4AFSC 4ZGDB 3QYGB 1AWOA 1VQPQ 1UE9A 5CKBA 4C0DC 1GBRA 3JSCA 5FW9A 3G4SQ 5IN1A 3G6EA 5IHNA 1GCQA 3M55A 2BKDN 3N5BB 1VQ9A 3DKMA 1ZBJA 1I0CA 1PCXA 2RI2A 4PJNA 2IPOB 2Y4YA 1YHQQ 1T0HA 2K57A 3BW1A 2O9VA 4FL6A 1D1BA 2KYBA 3OMCA 1Q82R 2E5QA 4ELYC 3E1SA 2K79A 3QHSA 2RHIA 4M77A 2R5MA 1VQLQ 1UUEA 4E7IA 4PJJA 4BD3A 2XHCA 1UJ0A 3UA7A 1K73U 5KCOA 3GIBA 4J6XA 1VQ9T 3EGXA 2GQVA 2JUFA 4IUTA 5J39A 4J9IA 4PFOA 1E6GA 5GAOm 2L3PA 4M78C 4M7AD 3CCSQ 2CP6A 4JS4A 1VQPA 5LJ3f 3WVDB 2D8HA 3SWNA 4QT7A 4LUDA 4M77D 2DXUA 1QW1A 2DVEA 2KT8A 4MMLA 3OW2A 1KQSS 4OMPA 1PRMC 2HEQA 1N8RU 3JRZA 3SB2A 2JS0A 4OVAA 2JMAA 3KFVA 4F14A 5C0MA 2E5KA 4LE9A 1K9MU 1VQNA 3EG2A 2HKQB 1K8AC 1AEYA 1QVGA 3RKYA 4X9CA 4ZTFA 4ME7A 7AT1B 4FYVB 4ATOA 1WJRA 2X9HA 4M7DD 1OU8A 5GAOr 3PMTA 1X2KA 4E7JA 1ABOA 2RN8A 3CCUT 3CCLT 3CBMA 1EX4A 2QASA 2ED1A 5GAMh 1TWBA 4KT0E 1RAAB 3JCMQ 1YJNQ 4MZMA 3HRUA 5CVIA 2DL3A 4RTVA 4DOWA 1OOTA 3JCMe 4MDWA 1JBMA 2D1XA 5A0LA 3UF4A 5LL6S 2DTHA 4F16A 3OYHA 2DL4A 2E1HA 5KYUA 2V8KA 2QYZA 1QP3A 1O9SA 4FYYB 3MHXA 1K73R 2EJFA 2D8JA 2DK3A 2E6ZA 1QWEA 3EAEA 2V8JA 4M77F 4F7UG 3UWNA 1XTDA 2W10A 3SEMA 2AZVA 3JCMV 1KG1A 3SD4A 1KC8U 3P8BB 5FRMA 3SFMA 1RAGB 3NFCA 1T3SA 1I5OB 4X9DA 1M4ZA 2HCKA 5FROA 3R6OA 3ME9A 4C0GA 2X3XD 2VV5A 1KFZA 1JXOA 3VRYA 4AFQC 2VWFA 4XTZA 3CPWP 5GMKi 3OYCA 2LJ3A 2RJCA 2O2OA 5EG2A 2RQRA 1NZ9A 2FPEA 1SSFA 4KGZB 5KH6A 5EC7A 2EW3A 4CC3A 1M1FA 4C8QC 5KYNA 4MDXA 2CSIA 2RJDA 4J8OA 2C0IA 2KMTA 1G83A 2KRMA 8ATCB 4XU1A 1ZUKA 1BI0A 1M1KU 3NTHA 2AKKA 2HQHA 4GY5A 3L2QA 1XNIA 3QZ9B 2PNIA 1YJWA 3C12A 3OYBA 3CCSA 2E64A 1G8XA 3CC2T 3CMAQ 3CCVT 1ABQA 3QXEB 5KE2A 4PNOA 1S72T 3EGXB 2M02A 2DEQA 3G4ST 3MP8A 1D09B 2KNBB 1YITT 3L2UA 2DF6A 1JO8A 3CXCP 5I2SA 2JT4A 2LT1A 4BE2A 1T0JA 1WXUA 3OBWA 4OGEA 4C8QB 3E19A 1H92A 3X24B 2F69A 2ATCB 3PE0A 3JAME 1VQ4T 2QDLA 1LCKA 4OB3B 1G3SA 4CRIA 3GLXA 4HA8A 3PIPA 5GAN8 3OYMA 1VQLT 1JRIA 2OTLQ 2DIGA 4F7UA 3CCRA 2KYMA 4FT2A 1DJ7B 3OYEA 4Y92A 4M75E 2KXDA 1UDLA 4E7ZA 2COWA 2LP5A 4XAXB 3EG1A 4LNPA 1IREB 5FRNA 5I2MA 1OULA 4C92D 3VUBA 1YI2T 1NYGA 1G3WA 2JM8A 2XKOC 3VYHB 2LX9A 2J6KA 5DY9A 4Y91A 3L2RA 3A8OB 2DAQA 1VYVA 4DEYA 1RI0A 4LUEA 1VQ7Q 4KBMB 2O31A 2DTOA 4EIKA 1KJWA 2QQSA 3CC4Q 2EKHA 5GMKh 4PJOC 4IUPA 2HMAA 4LDXA 4DQ2A 4RTTA 1C6VX 2DEUA 1UGSB 3QZ5B 1VQ7A 1ZSZB 5LJ5g 1O75A 3M9QA 2K7AA 4M7DF 2K6DA 2QXFA 2EGEA 4A4KA 4MMKA 5HK0A 1W2BS 1Q7YU 4JJDA 4A4HA 2PTKA 2WSFE 1W70A 3M57A 3CCUQ 2LMJA 3GF5A 2RPNA 1MNDA 2HQEA 4ZN1A 3TU4K 3O8VA 3RDVA 4XTYA 1VQ5Q 3A8MB 1WFWA 4PJLA 1NLPC 3TEEA 4M7DB 2Y90A 3QUIA 3HHTB 3BFMA 5CKEA 1WPYA 2KVQG 2CSQA 2EQIA 4PFZA 1WNLA 5GAN4 2DXBA 3HFNA 4XU0A 5LJ3g 5AT1B 4N4IA 3CC7Q 3HFOA 2NLUA 4KGXB 4QVDA 3A8HB 1R0BG 1VQKT 1HSQA 2DM1A 3V7RA 3TCJA 1JU5C 3M4GA 1C0MA 3NMZC 1Y57A 2GGRA 2GBQA 1VIFA 3C4SA 1OYXA 3CCQQ 2F2XA 2DTIA 1FMVA 2RM4A 4BE0A 4HVUA 1IHVA 1UGRB 1PRLC 2X4JA 2QG9B 2JOYA 1D0ZA 1NYFA 4AFZC 5CR2A 5AYFA 3LH5A 2FPFA 2LQKA 2XICA 1PC0A 2P0QA 1GRIA 4IIMA 3OW2P 4C92A 2HD0A 4R56A 1X6BA 1TUCA 2QTVA 1V76A 2RI3A 4M7AF 3X28B 2EYZA 1JXMA 4J9EA 3I55T 2L2PA 4M7AA 3JB9H 1QKWA 1K0SA 1R0CB 3M0SA 1QWFA 2M0YA 5CKFA 3EHRA 1RAFB 3A8LB 1BB9A 3P8DA 4AFUC 3OS2A 3CCJT 4JRPA 1MMNA 5D6YA 2LNVA 2GNCA 2QA4A 4BY6C 2MMPA 5CO7A 1HK9A 3A98A 1PM3A 2C0OA 4M75B 1BBZA 3L2ZA 5FU6C 1X2QA 2BUDA 5ECAA 2K3YA 1PWTA 2JJ9A 2E10A 5GANg 3QG1A 4FYXB 1LNXA 1SF9A 1B34A 2DBMA 2QA4Q 1YIJT 1VYTA 2O01E 1XOVA 1QLYA 2YLBA 3S3NA 1KHCA 2GCXA 1VQ6T 2M0OA 3KBGA 1GFDA 1NPPA 1IXDA 2CDTA 1IGUA 1Y07A 2NUPB 1BCOA 2DETA 1K9MC 1YP5A 4F04B 2DZ9A 3EFRA 3QDRB 2DYBA 3HTRA 4J9CA 3V8LA 2VGMA 2DYIA 4AG2C 1OEBA 3FDRA 2PUOB 3HRSA 2YLCA 4C8QD 1U1SA 4XTVA 1M8MA 2YUNA 2M16A 1S72A 3MPUB 1VQ8A 1IHWA 1BIAA 3VUZA 3DB4A 3CPFA 2LCCA 4J7FA 1WHLA 1WZOA 3V8JA 1MMGA 1ACMB 1QCOA 1UFFA 4WTOB 4M75C 3I35A 2GF7A 1YJNT 2DRKA 1QVPA 1S1NA 5CAIA 5IH2A 2KE9A 4C92G 2PUKB 2EJGA 3RR6A 2F1LA 5IXFA 2P0KA 3EHQA 3RESA 1H3HA 3OQ5A 1N8RC 3AHUA 1KIKA 4UC4A 1X75C 2H8HA 1X43A 3I9QA 5IHIA 1W1FA 3S3OA 1TS9A 2QEXT 3BDLA 1AWJA 2VB6A 5GMKm 3OYKA 1RAEB 3H0IA 3CCMQ 4DBQA 3ZFJA 4Y28E 1SSHA 2DD5A 3JV3A 5I22A 1OPKA 2LC4A 1M90U 2DL5A 1VQ9Q 2P4RA 2RQVA 4A4EA 1MUZA 4J7IA 2A28A 5GAN6 3G71T 2VXEA 4M7DG 3H0HA 2F5KA 2KGTA 5CIUA 4XTWA 4E7HA 3M0PA 1M27C 3M59A 3QYHB 1UHFA 1MV3A 1M90C 4O5VA 4PK4A 1X6OA 3FRNA 4RCBA 1I81A 2NYSA 4J9BA 4HCKA 1KD1C 2PVDB 3ASKA 2JXBA 2EQKA 1VQNQ 5I11A 3VS6A 3PGGA 2VVKA 2HL5C 4N4HA 1VQKQ 2YXYA 3CC7A 4C92B 4E7LA 4PJOA 1M30A 2KY9A 4ANJA 3CD6T 2FB7A 3ZEHA 2A36A 4FW2A 4M7DA 1Q81U 2IG0A 3J80E 2RA2A 3LW5E 3META 3CCUA 4EMKB 3CC2Q 3ZL7C 4XU2A 3CBOA 3CMAT 1G5VA 5FU6B 2YT6A 3KUFA 2DL8A 2LNHB 4FIBA 3MEVA 2KSSA 2I2LA 4CC2A 2E6NA 4M78D 2V8IA 2WACA 3V7SA 2DZCA 1H641 3M53A 2ZPFB 2LQNA 1WGSA 4M7AB 1V1CA 3HL8A 4QVZA 5LJ5h 1R8OB 1Q81R 1YJ9A 4CC4B 4MZTA 5HK3A 2GTOA 2ZPIB 2J05A 1YHQA 3JB9D 4JS5A 1KQSA 4QVCA 3QO3A 1TSFA 3EFOB 4F7UF 1VQPT 2RMOA 3E2UA 4XU3A 3EG3A 2ZAEA 4A63B 2K5FA 1I1JA 3REBB 4GLKA 3CCET 1OZ2A 2MIOA 3CMAA 3H6ZA 3EGDA 2OAWA 2J06A 2KBTA 1YJWQ 4JRIA 1GFCA 2K3BA 4HCZA 2LQ8A 1YIJQ 3UPUA 3I56T 1IZ6A 2A08A 2MYSA 1NLOC 3TVTA 1AZGB 4FSXA 1VQMQ 4DOVA 3GOXA 1EFNA 1W2BP 2D0QB 1VOMA 2KRSA 3I55A 2EJ9A 2VGNA 5CQYA 2BZ8A 5C6SA 1ZHIA 3QPHA 1NE8A 1BK2A 9ATCB 2LCSA 1ZSGA 3JB9I 3QBYA 1PD0A 2BIVA 3LGLA 4M7DC 3ER0A 3PFSA 5KCHA 1TH7A 1S72Q 2RHUA 4MZPA 1X69A 2CH4W 1G2BA 2OTJA 1UTIA 1Y96A 5FU7C 4RG8A 4M7AE 3WXMB 1SRMA 2ROTA 2HQXA 4QQ6A 3BDUA 1OV3A 1WHJA 3LX7A 2JVVA 2EWNA 2CS7A 3H0FA 1Q86U 1BI2A 2P84A 2EYYA 4HT9A 2Z0WA 3JCMW 6AT1B 2KK4A 1LOJA 2ESWA 4M77C 4RTWA
chains in the Genus database with same CATH topology
1WLPB 1YNZA 4RTTA 4ORZA 2YUOA 3NGPA 1ZUYA 3R6NA 1E7OA 1ZX6A 1VYUA 3M0UA 2KROA 3VS5A 2F2WA 2K7AA 4R0KA 2J6FA 2K6DA 1NEBA 2EGEA 2J7IA 3GBQA 2JS2A 4JJDA 2PTKA 1W70A 2LMJA 4HVVA 2RPNA 1AZEA 2B86A 2EYXA 2M51A 1WFWA 1NLPC 4WCIA 2SEMA 5L23A 1FYNA 1I07A 2HSPA 1J3TA 2CSQA 2EQIA 2YUPA 2GTJA 5IHKA 4M4ZA 3EG0A 3C0CA 1KSWA 5FWBA 4GLMA 1GCPA 1M3CA 2LJ0A 2PZ1A 1HSQA 1RLQC 2DM1A 3IQLA 2RQWA 4LN2A 1AWWA 1UG1A 1RI9A 1JU5C 1JQQA 3M0TA 1Y57A 3NMZC 2GGRA 2FEIA 2BZXA 2FPDA 2GBQA 4OMOA 4ZNXA 2L3SA 4OMNA 1NM7A 2JM9A 1E6HA 2CT4A 4D8DA 2F2XA 2A37A 1SHGA 4HVUA 1PRLC 2KXCA 4J9GA 1NYFA 4AFZC 1WI7A 3LH5A 4X1VA 2FPFA 4KRTA 1WA7A 3U23A 4JPBW 1RLPC 3ULRB 1QKXA 2HDAA 1B3QA 1SEMA 1GRIA 4IIOA 4IIMA 3I5RA 1WX6A 1K76A 1X6BA 3UATA 2ROLA 1TUCA 5HCKA 3FJ5A 2EYZA 5GJWB 1JXMA 4J9EA 4D8KA 2ENMA 2L2PA 1AOJA 1X6GA 1YN8A 1QKWA 1K0SA 2DL7A 2K9GA 3O5ZA 3M0SA 1QWFA 2M0YA 1PKTA 2KRNA 2MCNA 3EHRA 5IXBA 2BTTA 1BB9A 4AFUC 2GQIA 4AFSC 1WYXA 2GNCA 1AWOA 1M3BA 3A98A 1UE9A 2C0OA 2LZ6B 1Z9ZA 2V1RA 1GBRA 1BBZA 5FW9A 1X2QA 5ECAA 1PWTA 5IHNA 1GCQA 1IO6A 1K1ZA 1Z9QA 1ZBJA 4Z89A 2DBMA 1I0CA 1VYTA 4OMLA 1CSKA 2F2VA 1T0HA 1XOVA 1QLYA 2VKNA 2O9VA 2YDLA 2LX7A 2KYBA 2ABLA 1GFDA 3QWYA 1U3OA 2CDTA 2NWMA 1M3AA 2K79A 2OJ2A 3H41A 1YP5A 4FSSA 5FWCA 1UUEA 1ZUUA 1UJ0A 3UA7A 2DYBA 4J9CA 2MOXA 4AG2C 2DX1A 1OEBA 1M8MA 2CUBA 2YUNA 2EVRA 1PKSA 4RTXA 3I5SA 1WDXA 4J9IA 2DRMA 1E6GA 2L3PA 2KT1A 1TG0A 1VA7A 1UFFA 3VS2A 2J6OA 3I35A 2DE0X 2D8HA 1GCQC 2DRKA 4QT7A 2LJ1A 1JEGA 4RUGA 1S1NA 4ESRA 5IH2A 2KE9A 2LQWA 4LUDA 3VS4A 5IXFA 1AD5A 2KT8A 3EHQA 1WXBA 1H3HA 1KIKA 2DILA 4OMPA 4K11A 1PRMC 2H8HA 2HEQA 1X43A 3I9QA 5IHIA 1W1FA 3RBBB 2JS0A 4HVWA 2JMAA 3KFVA 4F14A 1AWJA 4DEXA 2JW4A 2E5KA 2ECZA 2W0ZA 1AVZC 4JZ4A 1QCFA 3H0IA 4LE9A 4RTZA 1UGVA 4HXJA 2AK5A 1SSHA 5I22A 3JV3A 3EG2A 1YWOA 1OPKA 2HBWA 1AEYA 2DL5A 2DMOA 1NG2A 1U5SA 2P4RA 2RQVA 3M0RA 5GJVB 2KR3A 2DLPA 2EGAA 1MUZA 1X27A 2CREA 2D0NA 3TSWA 1K4US 3SHWA 1X2KA 2A28A 1ABOA 2RN8A 1A0NB 1K9AA 3H0HA 1Y0MA 1UHCA 2JMCA 2ED1A 2KGTA 3UA6A 3M0PA 1M27C 1K0XA 4OMQA 1UHFA 1MV3A 2DL3A 4RTVA 1OOTA 3NPFA 4J9FA 4J9BA 1NEGA 3QWXX 4HCKA 2D1XA 2JXBA 2KEAA 3UF4A 2RQTA 4F16A 5I11A 1MV0B 3VS6A 2DL4A 2VVKA 4Z88A 1WIEA 2V1QA 1CKBA 1SPKA 2D8JA 1T3LA 1M30A 1QWEA 3M0QA 3RNJA 1YCSB 2W10A 2A36A 3SEMA 2AZVA 3TSZA 2OI3A 2CUDA 4J9DA 1YWPA 4Z8AA 2AKLA 4RTUA 1T3SA 2O9SA 3ZL7C 2DVJA 2YT6A 1WXTA 2HCKA 2DL8A 2LNHB 4JJCA 3PVLA 2X3XD 1HD3A 1KFZA 1JXOA 3VRYA 4CC2A 4AFQC 2G6FX 2VWFA 3REAB 2CT3A 3VS1A 2DA9A 2L3QA 2LJ3A 3VS0A 2O2OA 2RQRA 4F17A 2FPEA 2YSQA 2NUZA 5EC7A 2EW3A 1HJDA 4CC3A 2FO0A 2LQNA 2RF0A 2CSIA 2DBKA 1OPLA 1V1CA 2C0IA 1G83A 2KRMA 1GBQA 4CC4B 2AZSA 1ZUKA 2GTOA 2J05A 1PHTA 1ARKA 3NHNA 3VS3A 2AKKA 2BZYA 4RTYA 2RMOA 3EG3A 2PNIA 4A63B 1I1JA 1ABQA 3REBB 1W6XA 2DJQA 3CQTA 4E6RA 2MIOA 4GBQA 2OAWA 2J06A 2KBTA 2EYWA 2RQUA 2C0TA 2KNBB 1GFCA 2K3BA 1PNJA 1SRLA 2DF6A 1JO8A 3EGUA 2ED0A 2FRWA 2X3WD 1B07A 2A08A 2JT4A 3PVQA 1NLOC 2FRYA 1H8KA 3TVTA 1T0JA 1AZGB 1WXUA 1H92A 1EFNA 3PE0A 3THKA 2QDLA 1CKAA 1LCKA 1U06A 2KRSA 2I0NA 1SHFA 2XMFA 1GL5A 2DNUA 2BZ8A 4JJBA 2EGCA 2KYMA 4JZ3A 1BK2A 3VRZA 2LCSA 1ZSGA 4J9HA 2YUQA 4OMMA 2EPDA 4Y92A 1UJYA 2KXDA 1AWXA 1ZLMA 1UDLA 2JTEA 2LP5A 1UECA 3EG1A 4LNPA 4CC7A 1RUWA 2K2MA 2SRCA 1X69A 2CH4W 1G2BA 1NYGA 2JM8A 1UTIA 1FMKA 1TUDA 2J6KA 2FG0A 2CH4A 2O88A 2L0AA 1VYVA 4DEYA 1SRMA 2EBPA 2ROTA 2RNAA 4LUEA 1OV3A 1N5ZA 3H0FA 2EYYA 2O31A 4EIKA 1BU1A 3VS7A 1KJWA 4AG1C 2ESWA 2EKHA 4RTWA 2IIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLP B;  1YNZ A;  4RTT A;  4ORZ A;  2YUO A;  3NGP A;  1ZUY A;  3R6N A;  1E7O A;  1ZX6 A;  1VYU A;  3M0U A;  2KRO A;  3VS5 A;  2F2W A;  2K7A A;  4R0K A;  2J6F A;  2K6D A;  1NEB A;  2EGE A;  2J7I A;  3GBQ A;  2JS2 A;  4JJD A;  2PTK A;  1W70 A;  2LMJ A;  4HVV A;  2RPN A;  1AZE A;  2B86 A;  2EYX A;  2M51 A;  1WFW A;  1NLP C;  4WCI A;  2SEM A;  5L23 A;  1FYN A;  1I07 A;  2HSP A;  1J3T A;  2CSQ A;  2EQI A;  2YUP A;  2GTJ A;  5IHK A;  4M4Z A;  3EG0 A;  3C0C A;  1KSW A;  5FWB A;  4GLM A;  1GCP A;  1M3C A;  2LJ0 A;  2PZ1 A;  1HSQ A;  1RLQ C;  2DM1 A;  3IQL A;  2RQW A;  4LN2 A;  1AWW A;  1UG1 A;  1RI9 A;  1JU5 C;  1JQQ A;  3M0T A;  1Y57 A;  3NMZ C;  2GGR A;  2FEI A;  2BZX A;  2FPD A;  2GBQ A;  4OMO A;  4ZNX A;  2L3S A;  4OMN A;  1NM7 A;  2JM9 A;  1E6H A;  2CT4 A;  4D8D A;  2F2X A;  2A37 A;  1SHG A;  4HVU A;  1PRL C;  2KXC A;  4J9G A;  1NYF A;  4AFZ C;  1WI7 A;  3LH5 A;  4X1V A;  2FPF A;  4KRT A;  1WA7 A;  3U23 A;  4JPB W;  1RLP C;  3ULR B;  1QKX A;  2HDA A;  1B3Q A;  1SEM A;  1GRI A;  4IIO A;  4IIM A;  3I5R A;  1WX6 A;  1K76 A;  1X6B A;  3UAT A;  2ROL A;  1TUC A;  5HCK A;  3FJ5 A;  2EYZ A;  5GJW B;  1JXM A;  4J9E A;  4D8K A;  2ENM A;  2L2P A;  1AOJ A;  1X6G A;  1YN8 A;  1QKW A;  1K0S A;  2DL7 A;  2K9G A;  3O5Z A;  3M0S A;  1QWF A;  2M0Y A;  1PKT A;  2KRN A;  2MCN A;  3EHR A;  5IXB A;  2BTT A;  1BB9 A;  4AFU C;  2GQI A;  4AFS C;  1WYX A;  2GNC A;  1AWO A;  1M3B A;  3A98 A;  1UE9 A;  2C0O A;  2LZ6 B;  1Z9Z A;  2V1R A;  1GBR A;  1BBZ A;  5FW9 A;  1X2Q A;  5ECA A;  1PWT A;  5IHN A;  1GCQ A;  1IO6 A;  1K1Z A;  1Z9Q A;  1ZBJ A;  4Z89 A;  2DBM A;  1I0C A;  1VYT A;  4OML A;  1CSK A;  2F2V A;  1T0H A;  1XOV A;  1QLY A;  2VKN A;  2O9V A;  2YDL A;  2LX7 A;  2KYB A;  2ABL A;  1GFD A;  3QWY A;  1U3O A;  2CDT A;  2NWM A;  1M3A A;  2K79 A;  2OJ2 A;  3H41 A;  1YP5 A;  4FSS A;  5FWC A;  1UUE A;  1ZUU A;  1UJ0 A;  3UA7 A;  2DYB A;  4J9C A;  2MOX A;  4AG2 C;  2DX1 A;  1OEB A;  1M8M A;  2CUB A;  2YUN A;  2EVR A;  1PKS A;  4RTX A;  3I5S A;  1WDX A;  4J9I A;  2DRM A;  1E6G A;  2L3P A;  2KT1 A;  1TG0 A;  1VA7 A;  1UFF A;  3VS2 A;  2J6O A;  3I35 A;  2DE0 X;  2D8H A;  1GCQ C;  2DRK A;  4QT7 A;  2LJ1 A;  1JEG A;  4RUG A;  1S1N A;  4ESR A;  5IH2 A;  2KE9 A;  2LQW A;  4LUD A;  3VS4 A;  5IXF A;  1AD5 A;  2KT8 A;  3EHQ A;  1WXB A;  1H3H A;  1KIK A;  2DIL A;  4OMP A;  4K11 A;  1PRM C;  2H8H A;  2HEQ A;  1X43 A;  3I9Q A;  5IHI A;  1W1F A;  3RBB B;  2JS0 A;  4HVW A;  2JMA A;  3KFV A;  4F14 A;  1AWJ A;  4DEX A;  2JW4 A;  2E5K A;  2ECZ A;  2W0Z A;  1AVZ C;  4JZ4 A;  1QCF A;  3H0I A;  4LE9 A;  4RTZ A;  1UGV A;  4HXJ A;  2AK5 A;  1SSH A;  5I22 A;  3JV3 A;  3EG2 A;  1YWO A;  1OPK A;  2HBW A;  1AEY A;  2DL5 A;  2DMO A;  1NG2 A;  1U5S A;  2P4R A;  2RQV A;  3M0R A;  5GJV B;  2KR3 A;  2DLP A;  2EGA A;  1MUZ A;  1X27 A;  2CRE A;  2D0N A;  3TSW A;  1K4U S;  3SHW A;  1X2K A;  2A28 A;  1ABO A;  2RN8 A;  1A0N B;  1K9A A;  3H0H A;  1Y0M A;  1UHC A;  2JMC A;  2ED1 A;  2KGT A;  3UA6 A;  3M0P A;  1M27 C;  1K0X A;  4OMQ A;  1UHF A;  1MV3 A;  2DL3 A;  4RTV A;  1OOT A;  3NPF A;  4J9F A;  4J9B A;  1NEG A;  3QWX X;  4HCK A;  2D1X A;  2JXB A;  2KEA A;  3UF4 A;  2RQT A;  4F16 A;  5I11 A;  1MV0 B;  3VS6 A;  2DL4 A;  2VVK A;  4Z88 A;  1WIE A;  2V1Q A;  1CKB A;  1SPK A;  2D8J A;  1T3L A;  1M30 A;  1QWE A;  3M0Q A;  3RNJ A;  1YCS B;  2W10 A;  2A36 A;  3SEM A;  2AZV A;  3TSZ A;  2OI3 A;  2CUD A;  4J9D A;  1YWP A;  4Z8A A;  2AKL A;  4RTU A;  1T3S A;  2O9S A;  3ZL7 C;  2DVJ A;  2YT6 A;  1WXT A;  2HCK A;  2DL8 A;  2LNH B;  4JJC A;  3PVL A;  2X3X D;  1HD3 A;  1KFZ A;  1JXO A;  3VRY A;  4CC2 A;  4AFQ C;  2G6F X;  2VWF A;  3REA B;  2CT3 A;  3VS1 A;  2DA9 A;  2L3Q A;  2LJ3 A;  3VS0 A;  2O2O A;  2RQR A;  4F17 A;  2FPE A;  2YSQ A;  2NUZ A;  5EC7 A;  2EW3 A;  1HJD A;  4CC3 A;  2FO0 A;  2LQN A;  2RF0 A;  2CSI A;  2DBK A;  1OPL A;  1V1C A;  2C0I A;  1G83 A;  2KRM A;  1GBQ A;  4CC4 B;  2AZS A;  1ZUK A;  2GTO A;  2J05 A;  1PHT A;  1ARK A;  3NHN A;  3VS3 A;  2AKK A;  2BZY A;  4RTY A;  2RMO A;  3EG3 A;  2PNI A;  4A63 B;  1I1J A;  1ABQ A;  3REB B;  1W6X A;  2DJQ A;  3CQT A;  4E6R A;  2MIO A;  4GBQ A;  2OAW A;  2J06 A;  2KBT A;  2EYW A;  2RQU A;  2C0T A;  2KNB B;  1GFC A;  2K3B A;  1PNJ A;  1SRL A;  2DF6 A;  1JO8 A;  3EGU A;  2ED0 A;  2FRW A;  2X3W D;  1B07 A;  2A08 A;  2JT4 A;  3PVQ A;  1NLO C;  2FRY A;  1H8K A;  3TVT A;  1T0J A;  1AZG B;  1WXU A;  1H92 A;  1EFN A;  3PE0 A;  3THK A;  2QDL A;  1CKA A;  1LCK A;  1U06 A;  2KRS A;  2I0N A;  1SHF A;  2XMF A;  1GL5 A;  2DNU A;  2BZ8 A;  4JJB A;  2EGC A;  2KYM A;  4JZ3 A;  1BK2 A;  3VRZ A;  2LCS A;  1ZSG A;  4J9H A;  2YUQ A;  4OMM A;  2EPD A;  4Y92 A;  1UJY A;  2KXD A;  1AWX A;  1ZLM A;  1UDL A;  2JTE A;  2LP5 A;  1UEC A;  3EG1 A;  4LNP A;  4CC7 A;  1RUW A;  2K2M A;  2SRC A;  1X69 A;  2CH4 W;  1G2B A;  1NYG A;  2JM8 A;  1UTI A;  1FMK A;  1TUD A;  2J6K A;  2FG0 A;  2CH4 A;  2O88 A;  2L0A A;  1VYV A;  4DEY A;  1SRM A;  2EBP A;  2ROT A;  2RNA A;  4LUE A;  1OV3 A;  1N5Z A;  3H0F A;  2EYY A;  2O31 A;  4EIK A;  1BU1 A;  3VS7 A;  1KJW A;  4AG1 C;  2ESW A;  2EKH A;  4RTW A;  2IIM A; 
#chains in the Genus database with same CATH topology
 2EYQ A;  1WLP B;  3CCM A;  2EQJ A;  2CZ7 B;  2YUO A;  1RAC B;  3MEA A;  3NGP A;  5GAM j;  1I4K 1;  1ZUY A;  1XQH A;  1K9M R;  3LYI A;  1VYU A;  3JCM b;  5M9O A;  2KRO A;  3OB9 A;  2J7I A;  4BAC A;  1BYM A;  1D3B B;  3RMQ A;  2K3X A;  3CCL Q;  1HXD A;  4A53 A;  2QQB A;  4HVV A;  3RKW A;  1WQW A;  2EYX A;  3C94 A;  2SEM A;  1FYN A;  4M78 E;  3URG A;  2HSP A;  1J3T A;  2HSE B;  4LDV A;  1U8R A;  2GTJ A;  5IHK A;  3CXC A;  1EZZ B;  4M4Z A;  3EG0 A;  3P8H A;  1KQ2 A;  3C0C A;  4C5G A;  1KSW A;  1VQ7 T;  3QKJ A;  3A8G B;  4FT4 A;  4GLM A;  4VUB A;  4EPC A;  4E7S A;  3FEO A;  4P5N A;  1WJQ A;  2LJ0 A;  1YCY A;  3D7S B;  1RLQ C;  4FW1 A;  3IQL A;  5HKC A;  1UG1 A;  4C92 F;  3OYJ A;  2CP7 A;  3JCM J;  2ZPB B;  4PJM A;  4OMO A;  4OMN A;  1NM7 A;  3CD6 Q;  2RD1 A;  2WSC E;  3EFO A;  2JM9 A;  1E6H A;  2OTJ Q;  4D8D A;  2E70 A;  1FWZ A;  2A37 A;  1ZSZ C;  1YI2 A;  3DB3 A;  3CCQ A;  4J9G A;  2DIQ A;  2RB6 A;  1N8R R;  4X1V A;  3U23 A;  3ULR B;  2QA4 T;  4J6W A;  1AHJ B;  1VQO Q;  4AMC A;  1G3Y A;  1WX6 A;  2KQW A;  4M77 E;  4C8Q G;  1VQ6 Q;  4FU6 A;  1ZQ1 A;  2COY A;  2ENM A;  3OS0 A;  1X6G A;  1YN8 A;  4JLI A;  5GAN 3;  2FZK B;  3SWN B;  2K9G A;  4PJO F;  4DA4 A;  1PG5 B;  4EMK A;  1PKT A;  3M58 A;  2HNI A;  4IUR A;  2MCN A;  2BTT A;  1D0Y A;  1WYX A;  3QDF A;  2CZ6 B;  5GAN d;  4HT8 A;  1QCN A;  3F70 A;  4KUI A;  3CME Q;  1Z9Z A;  2V1R A;  2VYT A;  4C92 E;  3OSV A;  4A4G A;  3A1P A;  1IO6 A;  4J83 A;  1ZA1 B;  1MHN A;  4FCY A;  2PVO B;  3CC2 A;  1WHM A;  1YIT Q;  4Z89 A;  2GFU A;  2YRV A;  4IUV A;  4ZGJ B;  3OMG A;  1BI3 A;  4E7K A;  2O4X A;  4OML A;  1CSK A;  3I56 Q;  2VKN A;  3MEU A;  2YDL A;  1Q81 C;  2XDB A;  1SKU B;  5CCA A;  3QWY A;  4QKU A;  1U3O A;  1PSF A;  1RL2 A;  4FSS A;  5FWC A;  2E41 A;  2AIR B;  2OTL T;  2VAS A;  1VQK A;  4EMH A;  1ZUU A;  2JNG A;  2B8A A;  3OYY A;  2MOX A;  5FU7 B;  1TTH B;  3CCJ Q;  3VU3 C;  1M1K C;  4HCB A;  2EKO A;  4KGV B;  2EQU A;  3CBP A;  2EVR A;  4ZGE B;  2JTM A;  1PKS A;  2MWP A;  3I5S A;  1Q86 C;  5GAM e;  3KXT A;  1KD1 U;  5D6W A;  1ZSZ A;  3MKD A;  1TU0 B;  1W2B A;  3G71 Q;  2O4X B;  3JCM c;  3CME A;  2KT1 A;  1VA7 A;  2HKN A;  5J3B A;  1LPL A;  2J6O A;  3VS2 A;  2DE0 X;  2KI7 A;  3V8K A;  1GCQ C;  2LJ1 A;  1JEG A;  4RUG A;  4BY6 B;  3VS4 A;  3CPW A;  1AD5 A;  1WXB A;  1KQ1 A;  2M1H A;  4K11 A;  2YHT A;  4DEX A;  4JZ4 A;  2ECZ A;  2W0Z A;  1AVZ C;  3CC4 T;  1I8F A;  4RTZ A;  2P4T A;  3CC4 A;  4E47 A;  3PMI A;  3X20 B;  4M7A G;  2HBW A;  5LJ5 j;  3BY7 A;  3EH1 A;  4EMK C;  2DMO A;  1U5S A;  3OBY A;  4PLL A;  2KR3 A;  2RHZ A;  2EGA A;  1X27 A;  3TSW A;  3ZBD A;  4E2F B;  4M78 G;  3SHW A;  5LJ3 h;  2RI5 A;  3JCM d;  3LGF A;  3UA6 A;  4IUU A;  1Y0M A;  1UHC A;  2E12 A;  1BI1 A;  2LDM A;  3OYF A;  3GPL A;  4OB1 B;  2A7Y A;  1SG5 A;  3CCL A;  4BUG A;  1JJ2 A;  4RCC A;  2FYK A;  3JB9 F;  4OP0 A;  1K8A U;  1MMA A;  5D6X A;  4A4F A;  4C8Q F;  3OYD A;  1V29 B;  4XQ3 A;  2VXF A;  3LWH A;  2KEA A;  3WVE B;  2HL3 A;  2RQT A;  2JN0 A;  2OX7 A;  1Y71 A;  1WIE A;  2V1Q A;  2E4H A;  3PNW C;  3OW2 S;  1SPK A;  1T3L A;  1WJS A;  3GNF B;  3RNJ A;  3X26 B;  1YCS B;  4HCC A;  2LRQ A;  4QQG A;  1QP2 A;  2ZPH B;  1F1B B;  3TSZ A;  2EFI A;  2RHX A;  2OI3 A;  2OTJ T;  3MCA B;  2DPP B;  4RTU A;  2O9S A;  2DJZ A;  2QAZ A;  3UT1 A;  5CQX A;  1NBE B;  1LVK A;  1KD1 R;  1VQ8 Q;  4LXC A;  3REA B;  1BIB A;  1YJW T;  2XD0 A;  2CP2 A;  3VS0 A;  3OYI A;  4C0F A;  2P0P A;  3SDZ A;  3QJY A;  4F17 A;  4JLG A;  1WHH A;  2MK5 A;  3I55 Q;  4WF2 A;  1OPL A;  2DBK A;  5GAN 7;  2AT1 B;  2VUB A;  1KC8 R;  2RK1 A;  2NUP A;  2AZS A;  1TXQ A;  4X34 A;  4C8Q E;  1PHT A;  1ARK A;  2CKK A;  4EDU A;  3MP6 A;  1X01 A;  4RTY A;  2K4Y A;  2LVM A;  2MI6 A;  1M1G A;  1W6X A;  4E6R A;  2PQW A;  2EYW A;  3OYN A;  2RQU A;  2C0T A;  5KYX A;  4BDZ A;  1PNJ A;  1TOV A;  2MWO A;  1NJI U;  4OMF B;  2FRW A;  2X3W D;  1WQ7 A;  5GAN 2;  4C0D B;  3PVQ A;  3E9G A;  1YHQ T;  2FRY A;  1H8K A;  1M5Q 1;  3J81 E;  2QEX A;  1CKA A;  1VQM A;  2I0N A;  2ZPE B;  1SHF A;  4JDS A;  3H8Z A;  3UDC A;  4EMG A;  4JJB A;  1QQJ A;  3JB9 J;  5LJ5 d;  2DXT A;  5LJ3 e;  4JZ3 A;  1M2O A;  4NS5 A;  5GMK e;  2R58 A;  3A5Z B;  4PFP A;  4J9H A;  4M78 F;  2YUQ A;  4XTU A;  1N27 A;  2EPD A;  1UJY A;  5KYX B;  2JTE A;  1UEC A;  3CCE Q;  2E3H A;  5IAY A;  1NJI R;  1RUW A;  1MNE A;  3C95 A;  2XID A;  3JCM X;  3JB9 G;  3CCR Q;  4PL6 A;  4BI4 A;  1QVG S;  4M75 G;  4LDY A;  1TUD A;  2FG0 A;  2NUT B;  5GAO p;  1Q7Y C;  5CKD A;  2QEX Q;  2EBP A;  2RNA A;  1N5Z A;  2MF2 A;  2QQA A;  3CCM T;  3VS7 A;  4M75 D;  5KYY B;  4BE1 A;  2IIM A;  2XG8 D;  3FC3 A;  1JJ2 P;  1D0X A;  3R6N A;  3M5A A;  1RAI B;  1E7O A;  5KYU B;  1UB4 A;  1KQS P;  3VS5 A;  4R0K A;  5GAM d;  2J6F A;  1MMD A;  4L6V 5;  2V26 A;  4LDW A;  1OX9 A;  5KYW A;  1OU9 A;  3E9F A;  2A3L A;  1AZE A;  3AT1 B;  3G7Z A;  1Q82 U;  3G71 A;  1RAD B;  3CD6 A;  2ZGW A;  1RAB B;  3VKI A;  1I07 A;  3FIF A;  1W4S A;  3RUX A;  3BE3 A;  4PKC C;  3JCM f;  5FWB A;  4JRQ A;  3HKS A;  2K5L A;  4OB2 B;  2FVU A;  1D1C A;  1FMW A;  3DLM A;  1M9S A;  2RQW A;  4LN2 A;  1AWW A;  1XJW B;  2LT4 A;  1IGQ A;  2COZ A;  2EQM A;  3EGD B;  1JQQ A;  3M0T A;  1B34 B;  1K8A R;  2R5A A;  2FPD A;  4BB7 A;  1Q95 G;  2L3S A;  3CEY A;  4BI3 A;  3I56 A;  4C0Z A;  1B7T A;  2CT4 A;  1P92 A;  2YRC A;  5GAN e;  2CP0 A;  4KUD K;  3OYL A;  2KXC A;  3GNG A;  4M75 F;  2QDY B;  2XU8 A;  3CCE A;  1WI7 A;  1N6A A;  2VC8 A;  3HSB A;  4KRT A;  1WA7 A;  1M2V B;  1EIF A;  1SEM A;  4OGC A;  4IIO A;  1QVF P;  3GP8 A;  4ZTJ A;  3G1J A;  1K76 A;  5LJ3 j;  3OSS C;  4L5G A;  2ROL A;  2PVG B;  5HCK A;  1YJ9 T;  3HPW A;  5GJW B;  3MJX A;  4DBH A;  1AOJ A;  2G3R A;  1YFN A;  3O5Z A;  3RKX A;  5IT9 E;  2KRN A;  1QVG P;  5IXB A;  1VQ6 A;  5A0G A;  1YJN A;  2H3E B;  1QMC A;  2D9T A;  1M3B A;  3EG9 A;  1JJ2 S;  2LZ6 B;  4F7U E;  4KH0 B;  1K1Z A;  4R55 A;  5GAO n;  3LLR A;  1Q7Y R;  1Z9Q A;  1Q82 C;  2DKG A;  5D7U A;  2EAY A;  4RMO A;  2F2V A;  4LD6 A;  3EH2 A;  2QI2 A;  1VQM T;  1KC8 C;  2LX7 A;  4B9X A;  2ABL A;  3LH0 A;  2DD4 A;  2NWM A;  3JCM g;  2KAF A;  1M3A A;  5KYY A;  2OJ2 A;  3H41 A;  3NTI A;  2DFU A;  2QK0 A;  2DX1 A;  3H9N A;  4D6W A;  1YIJ A;  1KHI A;  2CUB A;  8AT1 B;  2XK0 A;  4RTX A;  4Z02 A;  2ZCF B;  4PLI A;  1WDX A;  3CME T;  3L2V A;  2DRM A;  3X25 B;  3FLG A;  2KDS A;  5KYW B;  1OI1 A;  1TG0 A;  5A2Q E;  3VYG A;  4PJO B;  2E3I A;  3CCJ A;  1M1K R;  1C1A A;  1HYO A;  4JRK A;  3CCR T;  4ESR A;  2LQW A;  2C06 A;  1QVF A;  1VQL A;  2DIL A;  1YBY A;  2PU9 B;  3RBB B;  1VQ4 A;  4HVW A;  4TVR A;  4C8Q A;  2JW4 A;  4QW2 A;  1QCF A;  3JCM P;  3INZ A;  1UGV A;  4HXJ A;  3PTA A;  2AK5 A;  4V2S A;  4N0A C;  1YWO A;  3MO8 A;  1VUB A;  3VV0 A;  1JB0 E;  3RMS A;  1YIT A;  1NG2 A;  3G6E Q;  3M0R A;  2RK2 A;  2YWW A;  4DBF A;  5GJV B;  1N9R A;  5GMK l;  3OY9 A;  2DLP A;  5DLO A;  2CRE A;  2D0N A;  4A54 A;  1K4U S;  1FX7 A;  3PIO A;  1FXX A;  1A0N B;  2RJE A;  2AHJ B;  5L8R E;  1K9A A;  2JMC A;  2LTO A;  4LDU A;  3OS1 A;  5A0D A;  3RER A;  1K0X A;  4OMQ A;  2F5T X;  1VQ8 T;  1MGQ A;  3NPF A;  2XI9 A;  4J9F A;  4O6J A;  3DLL A;  2QGF B;  1NEG A;  2K2V A;  3QWX X;  5DLQ E;  2GFA A;  4BI8 B;  3LWI A;  1M2V A;  1MV0 B;  4RG2 A;  4Z88 A;  1H3Z A;  1IRX A;  2QQR A;  1QVF S;  3V7C A;  1CKB A;  4PJO G;  1TUG B;  3FJP A;  3M0Q A;  4FM4 B;  1M90 R;  2RH2 A;  2HZY A;  1NJI C;  4LD9 K;  2DER A;  2CUD A;  1ZA2 B;  4J9D A;  4KUL A;  2A0F B;  4Q5W A;  3Q1J A;  1YWP A;  4Z8A A;  2AKL A;  4ZN3 A;  3CCV Q;  2DVJ A;  1WXT A;  2JZ2 A;  5FLX E;  4JJC A;  3PVL A;  1HD3 A;  4C5E A;  2G6F X;  2CT3 A;  1VQO T;  3VS1 A;  2DA9 A;  2L3Q A;  2CP5 A;  1D1A A;  4C5I A;  5DM7 R;  2D6F A;  3VJP A;  3OYG A;  2YSQ A;  2RO0 A;  2NUZ A;  1HJD A;  3NTK A;  1I5L A;  3TRE A;  3S6W A;  2FO0 A;  3FB9 A;  1YJ9 Q;  4XK8 E;  2RF0 A;  1VQ4 Q;  3M56 A;  2XDP A;  2L5Q A;  1GBQ A;  4N0A A;  5GAN h;  1Y96 B;  2R57 A;  3NHN A;  3VS3 A;  4J6Y A;  3CXC S;  2MPX C;  3M4Y A;  1PD1 A;  2BZY A;  3EG9 B;  1VQO A;  4KH1 B;  3CPW S;  3MP1 A;  4M78 A;  4OB0 B;  3G4S A;  1N9S A;  2XDD A;  1GXI E;  5GAN j;  1LJO A;  2DJQ A;  4M75 A;  3CQT A;  2QQ9 A;  3TQ7 P;  4GBQ A;  3CCV A;  1OQK A;  4JUV A;  2E65 A;  1YI2 Q;  1SRL A;  2BE9 B;  4PJO E;  4L59 A;  3EGU A;  2ED0 A;  2X4X A;  1B07 A;  2OTL A;  2LCL A;  3OYA A;  1WHK A;  4BDY A;  3M54 A;  3THK A;  5GAN 5;  2K5I A;  2QTX A;  1U06 A;  2NUT A;  2XMF A;  4C5H A;  1GL5 A;  4JJN K;  3OA6 A;  2DNU A;  5GAM g;  2L8D A;  2Y4X A;  1Q86 R;  2EGC A;  2IVW A;  1R77 A;  4HKE A;  2CZ1 B;  3VRZ A;  2RHY A;  5GAN f;  1NPR A;  2EIF A;  3L42 A;  3QSU A;  4OMM A;  4PJO D;  4NOY A;  2M9U A;  4YTL A;  1AWX A;  5LJ5 f;  1ZLM A;  4CC7 A;  3CCS T;  2CZ0 B;  1PSE A;  2L3R A;  2K2M A;  2SRC A;  3QJ6 A;  4B9W A;  2CYZ B;  4OF1 A;  1K73 C;  1FMK A;  2CH4 A;  1IB8 A;  5GAO l;  2O88 A;  2ZZD A;  4C92 C;  2CGH A;  2L0A A;  4F7U B;  4RKU E;  1BU1 A;  1VIE A;  3T9N A;  4M77 B;  4AG1 C;  4M7A C;  2OAU A;  2X4W A;  1YNZ A;  4ORZ A;  4AT1 B;  1ZX6 A;  2RJF A;  3OS5 A;  3M0U A;  3G6E T;  3JCM h;  2F2W A;  3GBQ A;  1NEB A;  2H3J A;  5GAO q;  2WSE E;  1WHG A;  3CCQ T;  2JS2 A;  5I21 A;  1UEB A;  1BKB A;  2JTF A;  3MEW A;  4IUQ A;  1UGP B;  2B86 A;  2M51 A;  2X4Y A;  4WCI A;  5GMK j;  5L23 A;  4N4G A;  3HP9 A;  1M8V A;  2YUP A;  2X35 A;  1OX8 A;  3RIR A;  3QII A;  5J26 A;  1GCP A;  5HY6 A;  1M3C A;  2HAX A;  2QGG A;  2ZPG B;  2PZ1 A;  2BE7 D;  2HBP A;  1VQN T;  3L2W A;  2FZC B;  3S3M A;  3L1A A;  1RI9 A;  4IKF A;  2DXC A;  2FHD A;  1Y7X A;  2L89 A;  2FEI A;  2BZX A;  1BCM A;  4XTX A;  5GAM f;  4ZNX A;  4NL3 A;  1VQ5 A;  4QQD A;  1SHG A;  4M78 B;  1RAH B;  1G3T A;  1AT1 B;  4DBR A;  5CK9 A;  5KE3 A;  2FZG B;  4J5Y A;  1VQ5 T;  3SWN C;  2FL7 A;  4NL2 A;  4JPB W;  1RLP C;  2MAM A;  1QKX A;  2HDA A;  1B3Q A;  1U1T A;  4M7D E;  3PT9 A;  2CP3 A;  3I5R A;  1UGQ B;  3CC7 T;  4CI0 C;  1D3B A;  3UAT A;  1ZBX A;  4FYW B;  3FJ5 A;  4B6M A;  3J7A F;  4D8K A;  3HRT A;  5LJ3 d;  5LJ5 e;  2DL7 A;  3EFS A;  2YRD A;  4M77 G;  4ELZ C;  5CKH A;  2DO3 A;  2X51 A;  1KK7 A;  1OZ3 A;  4II1 A;  2GQI A;  4AFS C;  4ZGD B;  3QYG B;  1AWO A;  1VQP Q;  1UE9 A;  5CKB A;  4C0D C;  1GBR A;  3JSC A;  5FW9 A;  3G4S Q;  5IN1 A;  3G6E A;  5IHN A;  1GCQ A;  3M55 A;  2BKD N;  3N5B B;  1VQ9 A;  3DKM A;  1ZBJ A;  1I0C A;  1PCX A;  2RI2 A;  4PJN A;  2IPO B;  2Y4Y A;  1YHQ Q;  1T0H A;  2K57 A;  3BW1 A;  2O9V A;  4FL6 A;  1D1B A;  2KYB A;  3OMC A;  1Q82 R;  2E5Q A;  4ELY C;  3E1S A;  2K79 A;  3QHS A;  2RHI A;  4M77 A;  2R5M A;  1VQL Q;  1UUE A;  4E7I A;  4PJJ A;  4BD3 A;  2XHC A;  1UJ0 A;  3UA7 A;  1K73 U;  5KCO A;  3GIB A;  4J6X A;  1VQ9 T;  3EGX A;  2GQV A;  2JUF A;  4IUT A;  5J39 A;  4J9I A;  4PFO A;  1E6G A;  5GAO m;  2L3P A;  4M78 C;  4M7A D;  3CCS Q;  2CP6 A;  4JS4 A;  1VQP A;  5LJ3 f;  3WVD B;  2D8H A;  3SWN A;  4QT7 A;  4LUD A;  4M77 D;  2DXU A;  1QW1 A;  2DVE A;  2KT8 A;  4MML A;  3OW2 A;  1KQS S;  4OMP A;  1PRM C;  2HEQ A;  1N8R U;  3JRZ A;  3SB2 A;  2JS0 A;  4OVA A;  2JMA A;  3KFV A;  4F14 A;  5C0M A;  2E5K A;  4LE9 A;  1K9M U;  1VQN A;  3EG2 A;  2HKQ B;  1K8A C;  1AEY A;  1QVG A;  3RKY A;  4X9C A;  4ZTF A;  4ME7 A;  7AT1 B;  4FYV B;  4ATO A;  1WJR A;  2X9H A;  4M7D D;  1OU8 A;  5GAO r;  3PMT A;  1X2K A;  4E7J A;  1ABO A;  2RN8 A;  3CCU T;  3CCL T;  3CBM A;  1EX4 A;  2QAS A;  2ED1 A;  5GAM h;  1TWB A;  4KT0 E;  1RAA B;  3JCM Q;  1YJN Q;  4MZM A;  3HRU A;  5CVI A;  2DL3 A;  4RTV A;  4DOW A;  1OOT A;  3JCM e;  4MDW A;  1JBM A;  2D1X A;  5A0L A;  3UF4 A;  5LL6 S;  2DTH A;  4F16 A;  3OYH A;  2DL4 A;  2E1H A;  5KYU A;  2V8K A;  2QYZ A;  1QP3 A;  1O9S A;  4FYY B;  3MHX A;  1K73 R;  2EJF A;  2D8J A;  2DK3 A;  2E6Z A;  1QWE A;  3EAE A;  2V8J A;  4M77 F;  4F7U G;  3UWN A;  1XTD A;  2W10 A;  3SEM A;  2AZV A;  3JCM V;  1KG1 A;  3SD4 A;  1KC8 U;  3P8B B;  5FRM A;  3SFM A;  1RAG B;  3NFC A;  1T3S A;  1I5O B;  4X9D A;  1M4Z A;  2HCK A;  5FRO A;  3R6O A;  3ME9 A;  4C0G A;  2X3X D;  2VV5 A;  1KFZ A;  1JXO A;  3VRY A;  4AFQ C;  2VWF A;  4XTZ A;  3CPW P;  5GMK i;  3OYC A;  2LJ3 A;  2RJC A;  2O2O A;  5EG2 A;  2RQR A;  1NZ9 A;  2FPE A;  1SSF A;  4KGZ B;  5KH6 A;  5EC7 A;  2EW3 A;  4CC3 A;  1M1F A;  4C8Q C;  5KYN A;  4MDX A;  2CSI A;  2RJD A;  4J8O A;  2C0I A;  2KMT A;  1G83 A;  2KRM A;  8ATC B;  4XU1 A;  1ZUK A;  1BI0 A;  1M1K U;  3NTH A;  2AKK A;  2HQH A;  4GY5 A;  3L2Q A;  1XNI A;  3QZ9 B;  2PNI A;  1YJW A;  3C12 A;  3OYB A;  3CCS A;  2E64 A;  1G8X A;  3CC2 T;  3CMA Q;  3CCV T;  1ABQ A;  3QXE B;  5KE2 A;  4PNO A;  1S72 T;  3EGX B;  2M02 A;  2DEQ A;  3G4S T;  3MP8 A;  1D09 B;  2KNB B;  1YIT T;  3L2U A;  2DF6 A;  1JO8 A;  3CXC P;  5I2S A;  2JT4 A;  2LT1 A;  4BE2 A;  1T0J A;  1WXU A;  3OBW A;  4OGE A;  4C8Q B;  3E19 A;  1H92 A;  3X24 B;  2F69 A;  2ATC B;  3PE0 A;  3JAM E;  1VQ4 T;  2QDL A;  1LCK A;  4OB3 B;  1G3S A;  4CRI A;  3GLX A;  4HA8 A;  3PIP A;  5GAN 8;  3OYM A;  1VQL T;  1JRI A;  2OTL Q;  2DIG A;  4F7U A;  3CCR A;  2KYM A;  4FT2 A;  1DJ7 B;  3OYE A;  4Y92 A;  4M75 E;  2KXD A;  1UDL A;  4E7Z A;  2COW A;  2LP5 A;  4XAX B;  3EG1 A;  4LNP A;  1IRE B;  5FRN A;  5I2M A;  1OUL A;  4C92 D;  3VUB A;  1YI2 T;  1NYG A;  1G3W A;  2JM8 A;  2XKO C;  3VYH B;  2LX9 A;  2J6K A;  5DY9 A;  4Y91 A;  3L2R A;  3A8O B;  2DAQ A;  1VYV A;  4DEY A;  1RI0 A;  4LUE A;  1VQ7 Q;  4KBM B;  2O31 A;  2DTO A;  4EIK A;  1KJW A;  2QQS A;  3CC4 Q;  2EKH A;  5GMK h;  4PJO C;  4IUP A;  2HMA A;  4LDX A;  4DQ2 A;  4RTT A;  1C6V X;  2DEU A;  1UGS B;  3QZ5 B;  1VQ7 A;  1ZSZ B;  5LJ5 g;  1O75 A;  3M9Q A;  2K7A A;  4M7D F;  2K6D A;  2QXF A;  2EGE A;  4A4K A;  4MMK A;  5HK0 A;  1W2B S;  1Q7Y U;  4JJD A;  4A4H A;  2PTK A;  2WSF E;  1W70 A;  3M57 A;  3CCU Q;  2LMJ A;  3GF5 A;  2RPN A;  1MND A;  2HQE A;  4ZN1 A;  3TU4 K;  3O8V A;  3RDV A;  4XTY A;  1VQ5 Q;  3A8M B;  1WFW A;  4PJL A;  1NLP C;  3TEE A;  4M7D B;  2Y90 A;  3QUI A;  3HHT B;  3BFM A;  5CKE A;  1WPY A;  2KVQ G;  2CSQ A;  2EQI A;  4PFZ A;  1WNL A;  5GAN 4;  2DXB A;  3HFN A;  4XU0 A;  5LJ3 g;  5AT1 B;  4N4I A;  3CC7 Q;  3HFO A;  2NLU A;  4KGX B;  4QVD A;  3A8H B;  1R0B G;  1VQK T;  1HSQ A;  2DM1 A;  3V7R A;  3TCJ A;  1JU5 C;  3M4G A;  1C0M A;  3NMZ C;  1Y57 A;  2GGR A;  2GBQ A;  1VIF A;  3C4S A;  1OYX A;  3CCQ Q;  2F2X A;  2DTI A;  1FMV A;  2RM4 A;  4BE0 A;  4HVU A;  1IHV A;  1UGR B;  1PRL C;  2X4J A;  2QG9 B;  2JOY A;  1D0Z A;  1NYF A;  4AFZ C;  5CR2 A;  5AYF A;  3LH5 A;  2FPF A;  2LQK A;  2XIC A;  1PC0 A;  2P0Q A;  1GRI A;  4IIM A;  3OW2 P;  4C92 A;  2HD0 A;  4R56 A;  1X6B A;  1TUC A;  2QTV A;  1V76 A;  2RI3 A;  4M7A F;  3X28 B;  2EYZ A;  1JXM A;  4J9E A;  3I55 T;  2L2P A;  4M7A A;  3JB9 H;  1QKW A;  1K0S A;  1R0C B;  3M0S A;  1QWF A;  2M0Y A;  5CKF A;  3EHR A;  1RAF B;  3A8L B;  1BB9 A;  3P8D A;  4AFU C;  3OS2 A;  3CCJ T;  4JRP A;  1MMN A;  5D6Y A;  2LNV A;  2GNC A;  2QA4 A;  4BY6 C;  2MMP A;  5CO7 A;  1HK9 A;  3A98 A;  1PM3 A;  2C0O A;  4M75 B;  1BBZ A;  3L2Z A;  5FU6 C;  1X2Q A;  2BUD A;  5ECA A;  2K3Y A;  1PWT A;  2JJ9 A;  2E10 A;  5GAN g;  3QG1 A;  4FYX B;  1LNX A;  1SF9 A;  1B34 A;  2DBM A;  2QA4 Q;  1YIJ T;  1VYT A;  2O01 E;  1XOV A;  1QLY A;  2YLB A;  3S3N A;  1KHC A;  2GCX A;  1VQ6 T;  2M0O A;  3KBG A;  1GFD A;  1NPP A;  1IXD A;  2CDT A;  1IGU A;  1Y07 A;  2NUP B;  1BCO A;  2DET A;  1K9M C;  1YP5 A;  4F04 B;  2DZ9 A;  3EFR A;  3QDR B;  2DYB A;  3HTR A;  4J9C A;  3V8L A;  2VGM A;  2DYI A;  4AG2 C;  1OEB A;  3FDR A;  2PUO B;  3HRS A;  2YLC A;  4C8Q D;  1U1S A;  4XTV A;  1M8M A;  2YUN A;  2M16 A;  1S72 A;  3MPU B;  1VQ8 A;  1IHW A;  1BIA A;  3VUZ A;  3DB4 A;  3CPF A;  2LCC A;  4J7F A;  1WHL A;  1WZO A;  3V8J A;  1MMG A;  1ACM B;  1QCO A;  1UFF A;  4WTO B;  4M75 C;  3I35 A;  2GF7 A;  1YJN T;  2DRK A;  1QVP A;  1S1N A;  5CAI A;  5IH2 A;  2KE9 A;  4C92 G;  2PUK B;  2EJG A;  3RR6 A;  2F1L A;  5IXF A;  2P0K A;  3EHQ A;  3RES A;  1H3H A;  3OQ5 A;  1N8R C;  3AHU A;  1KIK A;  4UC4 A;  1X75 C;  2H8H A;  1X43 A;  3I9Q A;  5IHI A;  1W1F A;  3S3O A;  1TS9 A;  2QEX T;  3BDL A;  1AWJ A;  2VB6 A;  5GMK m;  3OYK A;  1RAE B;  3H0I A;  3CCM Q;  4DBQ A;  3ZFJ A;  4Y28 E;  1SSH A;  2DD5 A;  3JV3 A;  5I22 A;  1OPK A;  2LC4 A;  1M90 U;  2DL5 A;  1VQ9 Q;  2P4R A;  2RQV A;  4A4E A;  1MUZ A;  4J7I A;  2A28 A;  5GAN 6;  3G71 T;  2VXE A;  4M7D G;  3H0H A;  2F5K A;  2KGT A;  5CIU A;  4XTW A;  4E7H A;  3M0P A;  1M27 C;  3M59 A;  3QYH B;  1UHF A;  1MV3 A;  1M90 C;  4O5V A;  4PK4 A;  1X6O A;  3FRN A;  4RCB A;  1I81 A;  2NYS A;  4J9B A;  4HCK A;  1KD1 C;  2PVD B;  3ASK A;  2JXB A;  2EQK A;  1VQN Q;  5I11 A;  3VS6 A;  3PGG A;  2VVK A;  2HL5 C;  4N4H A;  1VQK Q;  2YXY A;  3CC7 A;  4C92 B;  4E7L A;  4PJO A;  1M30 A;  2KY9 A;  4ANJ A;  3CD6 T;  2FB7 A;  3ZEH A;  2A36 A;  4FW2 A;  4M7D A;  1Q81 U;  2IG0 A;  3J80 E;  2RA2 A;  3LW5 E;  3MET A;  3CCU A;  4EMK B;  3CC2 Q;  3ZL7 C;  4XU2 A;  3CBO A;  3CMA T;  1G5V A;  5FU6 B;  2YT6 A;  3KUF A;  2DL8 A;  2LNH B;  4FIB A;  3MEV A;  2KSS A;  2I2L A;  4CC2 A;  2E6N A;  4M78 D;  2V8I A;  2WAC A;  3V7S A;  2DZC A;  1H64 1;  3M53 A;  2ZPF B;  2LQN A;  1WGS A;  4M7A B;  1V1C A;  3HL8 A;  4QVZ A;  5LJ5 h;  1R8O B;  1Q81 R;  1YJ9 A;  4CC4 B;  4MZT A;  5HK3 A;  2GTO A;  2ZPI B;  2J05 A;  1YHQ A;  3JB9 D;  4JS5 A;  1KQS A;  4QVC A;  3QO3 A;  1TSF A;  3EFO B;  4F7U F;  1VQP T;  2RMO A;  3E2U A;  4XU3 A;  3EG3 A;  2ZAE A;  4A63 B;  2K5F A;  1I1J A;  3REB B;  4GLK A;  3CCE T;  1OZ2 A;  2MIO A;  3CMA A;  3H6Z A;  3EGD A;  2OAW A;  2J06 A;  2KBT A;  1YJW Q;  4JRI A;  1GFC A;  2K3B A;  4HCZ A;  2LQ8 A;  1YIJ Q;  3UPU A;  3I56 T;  1IZ6 A;  2A08 A;  2MYS A;  1NLO C;  3TVT A;  1AZG B;  4FSX A;  1VQM Q;  4DOV A;  3GOX A;  1EFN A;  1W2B P;  2D0Q B;  1VOM A;  2KRS A;  3I55 A;  2EJ9 A;  2VGN A;  5CQY A;  2BZ8 A;  5C6S A;  1ZHI A;  3QPH A;  1NE8 A;  1BK2 A;  9ATC B;  2LCS A;  1ZSG A;  3JB9 I;  3QBY A;  1PD0 A;  2BIV A;  3LGL A;  4M7D C;  3ER0 A;  3PFS A;  5KCH A;  1TH7 A;  1S72 Q;  2RHU A;  4MZP A;  1X69 A;  2CH4 W;  1G2B A;  2OTJ A;  1UTI A;  1Y96 A;  5FU7 C;  4RG8 A;  4M7A E;  3WXM B;  1SRM A;  2ROT A;  2HQX A;  4QQ6 A;  3BDU A;  1OV3 A;  1WHJ A;  3LX7 A;  2JVV A;  2EWN A;  2CS7 A;  3H0F A;  1Q86 U;  1BI2 A;  2P84 A;  2EYY A;  4HT9 A;  2Z0W A;  3JCM W;  6AT1 B;  2KK4 A;  1LOJ A;  2ESW A;  4M77 C;  4RTW A; 
#chains in the Genus database with same CATH homology
 1WLP B;  1YNZ A;  4RTT A;  4ORZ A;  2YUO A;  3NGP A;  1ZUY A;  3R6N A;  1E7O A;  1ZX6 A;  1VYU A;  3M0U A;  2KRO A;  3VS5 A;  2F2W A;  2K7A A;  4R0K A;  2J6F A;  2K6D A;  1NEB A;  2EGE A;  2J7I A;  3GBQ A;  2JS2 A;  4JJD A;  2PTK A;  1W70 A;  2LMJ A;  4HVV A;  2RPN A;  1AZE A;  2B86 A;  2EYX A;  2M51 A;  1WFW A;  1NLP C;  4WCI A;  2SEM A;  5L23 A;  1FYN A;  1I07 A;  2HSP A;  1J3T A;  2CSQ A;  2EQI A;  2YUP A;  2GTJ A;  5IHK A;  4M4Z A;  3EG0 A;  3C0C A;  1KSW A;  5FWB A;  4GLM A;  1GCP A;  1M3C A;  2LJ0 A;  2PZ1 A;  1HSQ A;  1RLQ C;  2DM1 A;  3IQL A;  2RQW A;  4LN2 A;  1AWW A;  1UG1 A;  1RI9 A;  1JU5 C;  1JQQ A;  3M0T A;  1Y57 A;  3NMZ C;  2GGR A;  2FEI A;  2BZX A;  2FPD A;  2GBQ A;  4OMO A;  4ZNX A;  2L3S A;  4OMN A;  1NM7 A;  2JM9 A;  1E6H A;  2CT4 A;  4D8D A;  2F2X A;  2A37 A;  1SHG A;  4HVU A;  1PRL C;  2KXC A;  4J9G A;  1NYF A;  4AFZ C;  1WI7 A;  3LH5 A;  4X1V A;  2FPF A;  4KRT A;  1WA7 A;  3U23 A;  4JPB W;  1RLP C;  3ULR B;  1QKX A;  2HDA A;  1B3Q A;  1SEM A;  1GRI A;  4IIO A;  4IIM A;  3I5R A;  1WX6 A;  1K76 A;  1X6B A;  3UAT A;  2ROL A;  1TUC A;  5HCK A;  3FJ5 A;  2EYZ A;  5GJW B;  1JXM A;  4J9E A;  4D8K A;  2ENM A;  2L2P A;  1AOJ A;  1X6G A;  1YN8 A;  1QKW A;  1K0S A;  2DL7 A;  2K9G A;  3O5Z A;  3M0S A;  1QWF A;  2M0Y A;  1PKT A;  2KRN A;  2MCN A;  3EHR A;  5IXB A;  2BTT A;  1BB9 A;  4AFU C;  2GQI A;  4AFS C;  1WYX A;  2GNC A;  1AWO A;  1M3B A;  3A98 A;  1UE9 A;  2C0O A;  2LZ6 B;  1Z9Z A;  2V1R A;  1GBR A;  1BBZ A;  5FW9 A;  1X2Q A;  5ECA A;  1PWT A;  5IHN A;  1GCQ A;  1IO6 A;  1K1Z A;  1Z9Q A;  1ZBJ A;  4Z89 A;  2DBM A;  1I0C A;  1VYT A;  4OML A;  1CSK A;  2F2V A;  1T0H A;  1XOV A;  1QLY A;  2VKN A;  2O9V A;  2YDL A;  2LX7 A;  2KYB A;  2ABL A;  1GFD A;  3QWY A;  1U3O A;  2CDT A;  2NWM A;  1M3A A;  2K79 A;  2OJ2 A;  3H41 A;  1YP5 A;  4FSS A;  5FWC A;  1UUE A;  1ZUU A;  1UJ0 A;  3UA7 A;  2DYB A;  4J9C A;  2MOX A;  4AG2 C;  2DX1 A;  1OEB A;  1M8M A;  2CUB A;  2YUN A;  2EVR A;  1PKS A;  4RTX A;  3I5S A;  1WDX A;  4J9I A;  2DRM A;  1E6G A;  2L3P A;  2KT1 A;  1TG0 A;  1VA7 A;  1UFF A;  3VS2 A;  2J6O A;  3I35 A;  2DE0 X;  2D8H A;  1GCQ C;  2DRK A;  4QT7 A;  2LJ1 A;  1JEG A;  4RUG A;  1S1N A;  4ESR A;  5IH2 A;  2KE9 A;  2LQW A;  4LUD A;  3VS4 A;  5IXF A;  1AD5 A;  2KT8 A;  3EHQ A;  1WXB A;  1H3H A;  1KIK A;  2DIL A;  4OMP A;  4K11 A;  1PRM C;  2H8H A;  2HEQ A;  1X43 A;  3I9Q A;  5IHI A;  1W1F A;  3RBB B;  2JS0 A;  4HVW A;  2JMA A;  3KFV A;  4F14 A;  1AWJ A;  4DEX A;  2JW4 A;  2E5K A;  2ECZ A;  2W0Z A;  1AVZ C;  4JZ4 A;  1QCF A;  3H0I A;  4LE9 A;  4RTZ A;  1UGV A;  4HXJ A;  2AK5 A;  1SSH A;  5I22 A;  3JV3 A;  3EG2 A;  1YWO A;  1OPK A;  2HBW A;  1AEY A;  2DL5 A;  2DMO A;  1NG2 A;  1U5S A;  2P4R A;  2RQV A;  3M0R A;  5GJV B;  2KR3 A;  2DLP A;  2EGA A;  1MUZ A;  1X27 A;  2CRE A;  2D0N A;  3TSW A;  1K4U S;  3SHW A;  1X2K A;  2A28 A;  1ABO A;  2RN8 A;  1A0N B;  1K9A A;  3H0H A;  1Y0M A;  1UHC A;  2JMC A;  2ED1 A;  2KGT A;  3UA6 A;  3M0P A;  1M27 C;  1K0X A;  4OMQ A;  1UHF A;  1MV3 A;  2DL3 A;  4RTV A;  1OOT A;  3NPF A;  4J9F A;  4J9B A;  1NEG A;  3QWX X;  4HCK A;  2D1X A;  2JXB A;  2KEA A;  3UF4 A;  2RQT A;  4F16 A;  5I11 A;  1MV0 B;  3VS6 A;  2DL4 A;  2VVK A;  4Z88 A;  1WIE A;  2V1Q A;  1CKB A;  1SPK A;  2D8J A;  1T3L A;  1M30 A;  1QWE A;  3M0Q A;  3RNJ A;  1YCS B;  2W10 A;  2A36 A;  3SEM A;  2AZV A;  3TSZ A;  2OI3 A;  2CUD A;  4J9D A;  1YWP A;  4Z8A A;  2AKL A;  4RTU A;  1T3S A;  2O9S A;  3ZL7 C;  2DVJ A;  2YT6 A;  1WXT A;  2HCK A;  2DL8 A;  2LNH B;  4JJC A;  3PVL A;  2X3X D;  1HD3 A;  1KFZ A;  1JXO A;  3VRY A;  4CC2 A;  4AFQ C;  2G6F X;  2VWF A;  3REA B;  2CT3 A;  3VS1 A;  2DA9 A;  2L3Q A;  2LJ3 A;  3VS0 A;  2O2O A;  2RQR A;  4F17 A;  2FPE A;  2YSQ A;  2NUZ A;  5EC7 A;  2EW3 A;  1HJD A;  4CC3 A;  2FO0 A;  2LQN A;  2RF0 A;  2CSI A;  2DBK A;  1OPL A;  1V1C A;  2C0I A;  1G83 A;  2KRM A;  1GBQ A;  4CC4 B;  2AZS A;  1ZUK A;  2GTO A;  2J05 A;  1PHT A;  1ARK A;  3NHN A;  3VS3 A;  2AKK A;  2BZY A;  4RTY A;  2RMO A;  3EG3 A;  2PNI A;  4A63 B;  1I1J A;  1ABQ A;  3REB B;  1W6X A;  2DJQ A;  3CQT A;  4E6R A;  2MIO A;  4GBQ A;  2OAW A;  2J06 A;  2KBT A;  2EYW A;  2RQU A;  2C0T A;  2KNB B;  1GFC A;  2K3B A;  1PNJ A;  1SRL A;  2DF6 A;  1JO8 A;  3EGU A;  2ED0 A;  2FRW A;  2X3W D;  1B07 A;  2A08 A;  2JT4 A;  3PVQ A;  1NLO C;  2FRY A;  1H8K A;  3TVT A;  1T0J A;  1AZG B;  1WXU A;  1H92 A;  1EFN A;  3PE0 A;  3THK A;  2QDL A;  1CKA A;  1LCK A;  1U06 A;  2KRS A;  2I0N A;  1SHF A;  2XMF A;  1GL5 A;  2DNU A;  2BZ8 A;  4JJB A;  2EGC A;  2KYM A;  4JZ3 A;  1BK2 A;  3VRZ A;  2LCS A;  1ZSG A;  4J9H A;  2YUQ A;  4OMM A;  2EPD A;  4Y92 A;  1UJY A;  2KXD A;  1AWX A;  1ZLM A;  1UDL A;  2JTE A;  2LP5 A;  1UEC A;  3EG1 A;  4LNP A;  4CC7 A;  1RUW A;  2K2M A;  2SRC A;  1X69 A;  2CH4 W;  1G2B A;  1NYG A;  2JM8 A;  1UTI A;  1FMK A;  1TUD A;  2J6K A;  2FG0 A;  2CH4 A;  2O88 A;  2L0A A;  1VYV A;  4DEY A;  1SRM A;  2EBP A;  2ROT A;  2RNA A;  4LUE A;  1OV3 A;  1N5Z A;  3H0F A;  2EYY A;  2O31 A;  4EIK A;  1BU1 A;  3VS7 A;  1KJW A;  4AG1 C;  2ESW A;  2EKH A;  4RTW A;  2IIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...