3M0TA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 9.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
b'KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0tA00
4Z88A 1PWTA 1NLOC 2ABLA 1SHGA 2G6FX 4RUGA 2XMFA 3VRZA 3JV3A 2RQVA 1WA7A 1RLPC 2EYZA 1TUCA 4AFSC 3NGPA 4IIOA 2B86A 3UATA 1NEGA 1QWFA 2EW3A 2JS0A 3EG0A 2KT1A 2LQNA 1Z9ZA 1WYXA 2J05A 1YWPA 1HD3A 2DYBA 4Z89A 2YDLA 2KRSA 3VS3A 2K7AA 1WXTA 2DRKA 1ARKA 2M0YA 1M3AA 1ZUUA 2GBQA 2FPFA 2KR3A 2M51A 4JJDA 1TG0A 1KSWA 1WXUA 2PTKA 2FRWA 4OMLA 2DNUA 1T0HA 4F17A 1OV3A 1I07A 4JZ3A 2ESWA 1W1FA 3A98A 2DLPA 4J9BA 4LUDA 4HCKA 2O9VA 2EBPA 1ZUYA 1ZSGA 2JS2A 2NWMA 1H8KA 1ZLMA 2CT4A 3EHQA 1BK2A 2K9GA 1FMKA 4CC2A 1T3LA 2F2VA 1UHCA 3EGUA 3LH5A 4AG2C 1GFCA 2LJ0A 2D0NA 2GTOA 1RUWA 1PKTA 2SEMA 1VYTA 2A08A 1QKWA 4JJBA 2EQIA 4GLMA 2OJ2A 3GBQA 4RTWA 2FPDA 1YNZA 3I35A 1KJWA 3QWYA 4R0KA 4AFZC 3EHRA 4OMNA 1BB9A 1SSHA 4QT7A 2A28A 1X6GA 2ECZA 1OPKA 1G2BA 4HVWA 1WIEA 2DE0X 2MOXA 3H41A 2AKKA 3PVLA 4CC7A 1UHFA 1H3HA 4GBQA 4J9FA 2DM1A 2EYXA 2JXBA 2K6DA 1UGVA 1VYVA 4ESRA 1M3BA 2KRMA 4A63B 2DL5A 3UA6A 1GBQA 3IQLA 3EG1A 1ZUKA 1EFNA 1Z9QA 3M0UA 1ABOA 1V1CA 3REAB 4D8DA 1PRMC 2CSIA 1K4US 1WX6A 1UDLA 1T0JA 4Y92A 3VS5A 1N5ZA 2I0NA 2IIMA 2D1XA 2HDAA 2O31A 3UF4A 2DRMA 2RPNA 1KFZA 2EYYA 3H0IA 1AVZC 2KT8A 4LE9A 1ZX6A 2W10A 4AFUC 2JTEA 2A37A 2RN8A 3THKA 1S1NA 4J9GA 1NLPC 2QDLA 1UG1A 4FSSA 2ROTA 5IHKA 2OAWA 3ZL7C 2AZSA 4KRTA 2DL4A 1M8MA 2P4RA 2EGCA 2L0AA 2KGTA 1NYFA 1MUZA 2JMAA 1OOTA 2AKLA 3REBB 4J9EA 4RTYA 1SPKA 2DMOA 2CT3A 1B07A 1IO6A 2PNIA 1I1JA 2OI3A 3M0PA 2JW4A 3M0TA 4DEXA 3NHNA 5FWCA 4Z8AA 1K1ZA 1QKXA 3EG3A 5ECAA 1X2QA 1HJDA 1K9AA 1E6HA 2BZXA 2LMJA 1X6BA 3NMZC 1JQQA 2RQWA 3SEMA 1U06A 2F2XA 1VYUA 4J9DA 1UFFA 2A36A 2YT6A 3TSZA 5IXFA 3M0SA 1AZGB 2K3BA 2CUDA 1YN8A 4M4ZA 1JU5C 2DX1A 4RTXA 1PNJA 2RMOA 2LQWA 2SRCA 4HVUA 2J6OA 1FYNA 4RTVA 3CQTA 4CC3A 2EKHA 5GJWB 1NG2A 1X27A 2AZVA 2J6FA 3I9QA 4AFQC 1X43A 2ENMA 1W70A 2KYMA 2LZ6B 2L3QA 1X2KA 1AWJA 2H8HA 2ED0A 4JJCA 2EGAA 1AWOA 1BU1A 2DJQA 3U23A 1PRLC 1GFDA 5EC7A 1QLYA 1WDXA 1M3CA 4F16A 5IHIA 3R6NA 3EG2A 2KXDA 2J7IA 3I5RA 3M0QA 1GL5A 1K0XA 2LCSA 2C0OA 2V1QA 2BZ8A 2CDTA 2ROLA 1ZBJA 3RNJA 5IXBA 2GQIA 2L3PA 2D8JA 2EVRA 3ULRB 1Y57A 2CSQA 4X1VA 3H0FA 3KFVA 4J9IA 1WXBA 1U3OA 2RNAA 4LUEA 1GCQC 1JEGA 1MV3A 2EGEA 1JXMA 3VS4A 2KEAA 2RQUA 2MIOA 2KRNA 1XOVA 1AD5A 2KE9A 1WFWA 5I11A 5IHNA 2JM9A 4IIMA 2DVJA 2KROA 2C0TA 4JZ4A 5FW9A 2GNCA 1JO8A 1CKBA 1UUEA 1NM7A 1X69A 1LCKA 1E6GA 1T3SA 1B3QA 3VRYA 2DA9A 4AG1C 3H0HA 2KNBB 2YUOA 2EPDA 1AOJA 1AWXA 3QWXX 1BBZA 3VS6A 4EIKA 5GJVB 1RI9A 1JXOA 2X3WD 4DEYA 2J6KA 5I22A 1SHFA 1M30A 1UJYA 1YCSB 1SRMA 2KXCA 1PHTA 2YUNA 3VS7A 4F14A 5FWBA 2HEQA 2D8HA 1WLPB 1G83A 2VVKA 4ORZA 1H92A 3TVTA 2LNHB 2YSQA 1OEBA 1A0NB 1TUDA 2AK5A 3PVQA 2LX7A 1GBRA 1ABQA 2YUQA 2E5KA 2ED1A 2FEIA 4RTUA 2DF6A 1GRIA 4HVVA 1NEBA 1J3TA 1CSKA 2DL3A 3FJ5A 2CH4W 2FPEA 2X3XD 1AWWA 1SRLA 2DBMA 2FO0A 1PKSA 4ZNXA 2LJ3A 2GGRA 4D8KA 2K79A 3VS1A 3C0CA 2HBWA 4LN2A 4RTTA 5IH2A 2VWFA 3TSWA 3O5ZA 1K0SA 2JMCA 2CUBA 2K2MA 1SEMA 1GCQA 1GCPA 1W6XA 2O88A 2O9SA 2RF0A 4OMPA 1YP5A 2MCNA 1AZEA 3M0RA 2HSPA 1NYGA 2L2PA 4OMQA 1K76A 3UA7A 2KYBA 1U5SA 2LJ1A 2LP5A 1HSQA 2PZ1A 2RQTA 3VS2A 1RLQC 2BZYA 2KBTA 4J9CA 2RQRA 4CC4B 1E7OA 2NUZA 2DBKA 4HXJA 5HCKA 2HCKA 1M27C 3I5SA 2C0IA 4OMMA 2L3SA 1QWEA 2DL7A 2VKNA 1I0CA 3NPFA 3PE0A 2FRYA 2JT4A 5L23A 2CREA 4J9HA 1CKAA 4RTZA 4K11A 2O2OA 4LNPA 1OPLA 3VS0A 2JM8A 2W0ZA 2YUPA 2EYWA 4OMOA 1VA7A 1QCFA 2DILA 1UECA 2V1RA 4E6RA 1UE9A 2FG0A 1Y0MA 4WCIA 1KIKA 3SHWA 2GTJA 4JPBW 1YWOA 1UTIA 2DL8A 2J06A 1AEYA 2CH4A 2BTTA 2F2WA 1MV0B 3RBBB 1WI7A 1UJ0A
chains in the Genus database with same CATH superfamily
3PMTA 2LDMA 2R58A 1B7TA 1SHGA 4RUGA 2XMFA 2X51A 4RMOA 4J6YA 3JV3A 2D9TA 2RQVA 1AHJB 2HD0A 3QJ6A 2DEQA 2PQWA 3JCMJ 2B86A 5CKFA 2R5AA 1PG5B 1Z9ZA 1WYXA 2J05A 5KYNA 3DB4A 3QBYA 2YDLA 3L2RA 4JS4A 1C6VX 2FPFA 2KR3A 2M51A 2VGNA 4JJDA 4NL3A 4BE2A 3CXCP 1TG0A 2PTKA 4F17A 3M4YA 1W1FA 3A98A 3VYHB 4QQGA 2NWMA 1G3SA 4OB2B 2CT4A 4ME7A 3VJPA 1Q7YU 1T3LA 2F2VA 3QIIA 4FYXB 3OW2P 4TVRA 3JB9I 2NUTB 2RB6A 4J6WA 4N4GA 4R55A 1ZSZC 2A08A 4FSXA 4GLMA 3GBQA 1ZSZB 3M5AA 3I56Q 1RACB 3QWYA 5J3BA 4QT7A 1X6GA 1YJWQ 5GAOp 1OPKA 1QVFP 1WIEA 3JCMf 2D0QB 3QDRB 3H41A 2DD4A 4CC7A 3L2WA 1H3HA 1D0YA 2L5QA 4J9FA 8AT1B 3CCUA 1R0CB 1UGQB 5GAMe 5GAOr 1Y07A 1JJ2P 4ESRA 4Y91A 1WHHA 2IG0A 3OYDA 1WQ7A 1VQ4T 5GAMj 3OS2A 2CKKA 3G4SQ 1MNDA 1ZUKA 2PVOB 5LJ5h 1ABOA 3REAB 2LRQA 1PRMC 1LVKA 4HCZA 2EIFA 1K4US 4M7AG 4ELYC 4Y92A 3V8JA 5HKCA 3OYKA 4FCYA 2D1XA 1BI3A 2HL5C 3A8OB 2DRMA 1LJOA 2HSEB 2CP3A 1KD1C 2QAZA 2NUTA 1V76A 1AVZC 2KT8A 2HL3A 2W10A 3OYJA 4LD6A 3CMET 1ZSZA 2RN8A 1S1NA 4J9GA 1NLPC 4PJLA 2GFUA 2EYQA 4PFOA 4JS5A 2RHUA 2XICA 1KG1A 4HCBA 1YI2A 3CCQQ 1OOTA 3REBB 5GAOl 4M75G 5KH6A 1VQMQ 5GAN8 1I1JA 1VQ6A 2XI9A 3EFSA 2ZPFB 2XD0A 1LOJA 2JNGA 4M7DF 3JB9H 1QKXA 1MMNA 1X2QA 1K9AA 3MJXA 4F7UF 2EQJA 3JCMb 3HP9A 2YXYA 1TSFA 5CKHA 2F2XA 3LX7A 2A36A 4J9DA 3TSZA 4EMKB 3M0SA 2K3BA 1M9SA 2CUDA 5LJ5d 1VQLT 2DX1A 2ATCB 4KGVB 3A8HB 2LQWA 4MMLA 4FIBA 4BE0A 3I9QA 1X43A 5CKEA 4UC4A 2KYMA 1Y71A 2BKDN 2ED0A 4JJCA 5CO7A 5GANh 2EGAA 1BU1A 3CD6Q 1PRLC 3QJYA 4PFPA 1WDXA 4O6JA 3JCMW 5A0DA 3OYLA 4X9DA 1LNXA 2C0OA 3OYMA 4KH0B 3RNJA 3CCMA 4NS5A 4XTXA 3LYIA 1YJ9T 5GMKj 1Y96B 1FMWA 3ULRB 3L2QA 4X1VA 3H0FA 2MI6A 3N5BB 2RNAA 2V8KA 4KULA 5KCHA 3LWHA 1JEGA 1WPYA 1KC8U 2DTIA 1QVGP 2JUFA 2KROA 3UDCA 4M7AE 3OYEA 4EMKA 2GNCA 1CKBA 3D7SB 3BY7A 1VQ7A 1B3QA 3VRYA 4IUQA 4R56A 3H0HA 1D3BA 1AWXA 1BBZA 2KI7A 2X35A 3VS6A 5GMKm 4C5EA 4C0ZA 3L2VA 1JXOA 4M7DC 1FX7A 4JDSA 4M7DB 1M30A 1NE8A 3CCRQ 2OTJA 4F7UB 2YUNA 4KUIA 2BIVA 2VVKA 4ORZA 1H92A 3TVTA 2XIDA 5LJ3e 4IURA 4M75E 3CBPA 1OEBA 4BY6C 1TUDA 2AK5A 4PJOD 4RCCA 2DJZA 1K9MU 4BY6B 2QEXQ 3J81E 2ED1A 3JCMh 1GRIA 1CSKA 1S72T 2CYZB 2CGHA 2X3XD 1Y96A 3L2UA 2XG8D 3CCST 1PKSA 4ZNXA 3QSUA 2LJ3A 3MP8A 5AYFA 1NZ9A 2K79A 3VS1A 2HBWA 5IH2A 3EGDB 3O5ZA 2QI2A 1K0SA 2CUBA 1Q95G 1SEMA 1GCPA 1W6XA 1IGQA 2O9SA 1FXXA 2QG9B 4FT4A 4XK8E 1YP5A 1TU0B 3JB9D 2M9UA 1YITA 4AT1B 2L2PA 2GF7A 1U1SA 4B9XA 2DERA 3V7RA 3OMGA 2LP5A 4DOVA 1VQKA 3KUFA 2E10A 2PZ1A 1BYMA 2P84A 3I55Q 2JTMA 4KGXB 3CCJA 2BZYA 3EGXB 4IUPA 4M7DA 1MHNA 1G3WA 2QXFA 1E7OA 1NJIC 4F7UA 1W2BS 5HCKA 2RJDA 3CC7Q 4C8QB 5A0LA 1U8RA 3FJPA 2COWA 3HSBA 2RD1A 4OMMA 1UB4A 2YLCA 2VKNA 2CZ7B 5GAOn 2OTLA 5L23A 1VQOQ 2CREA 3MP1A 4J6XA 4IKFA 3V8KA 1OPLA 2YUPA 4JRQA 2PVGB 4ZGDB 3CMEQ 3VYGA 1O75A 4A54A 3URGA 4QQDA 2V1RA 2RI2A 3EGDA 1D1BA 4E7JA 4WCIA 1KIKA 3SHWA 4JJNK 2GTJA 2VB6A 4JPBW 1KQSA 3M57A 1ZA2B 1UTIA 2DL8A 2J06A 3MEWA 4XTVA 1YJNA 1SG5A 2BTTA 2F2WA 1M5Q1 1WI7A 3RBBB 3QYGB 1MMAA 3F70A 1PWTA 3CCEA 2DTOA 2ABLA 1RLPC 2FZKB 2M0OA 2ZAEA 2EYZA 1TUCA 4M78E 4AFSC 3M4GA 4DBRA 2YLBA 3UATA 4WTOB 2FL7A 1NEGA 1QWFA 2EW3A 3EGXA 4RG2A 1YWPA 3CCUT 4C8QD 3P8DA 1KK7A 2O01E 5IAYA 3A1PA 2NLUA 1IRXA 3VS3A 4C8QA 5GAN7 3LH0A 1I8FA 4E7HA 1M3AA 2P0KA 1N6AA 1KSWA 4OMLA 2FYKA 1OV3A 1I07A 4JZ3A 2FVUA 4PLLA 2HBPA 2DLPA 3X20B 4HCKA 2EBPA 1ZSGA 4J7IA 3UT1A 3META 9ATCB 3WXMB 3LH5A 2LJ0A 1PKTA 1UGSB 1VYTA 3CCLQ 5D6WA 1YHQA 2MAMA 1QKWA 4PKCC 1VQ5A 1MNEA 1KJWA 1RL2A 3CMAQ 4OMNA 1BB9A 3OYBA 1JB0E 2RK2A 2E1HA 2H3JA 1BKBA 2E65A 1KHIA 4B6MA 3OYFA 1VQ6T 3PVLA 5CQXA 1N8RC 2DYIA 3EH1A 3OA6A 2K6DA 1UGVA 1VYVA 1BIAA 3NTKA 5CVIA 2KRMA 3HTRA 2LT4A 2DXTA 2EFIA 1C1AA 2E64A 3G6EQ 3C4SA 4NL2A 3OS5A 2V26A 4IUTA 2DKGA 1QCOA 1UDLA 1KQSS 2EKOA 3C94A 1I5OB 3X25B 3E2UA 2EJGA 2V8JA 1KFZA 1M2VB 3H0IA 2RA2A 3CPWA 4PJNA 1S72Q 2L8DA 4LE9A 1WHLA 1I4K1 2ZCFB 1HK9A 3PNWC 3THKA 2QDLA 1UG1A 2KMTA 2EGCA 3CCMT 1OZ2A 2KGTA 2PUOB 3CPFA 1JJ2A 4N4HA 3SDZA 2DMOA 3JB9J 1PD0A 2CT3A 1IO6A 3M0PA 2JW4A 3NHNA 5FWCA 2M1HA 2YRVA 2HQEA 3LW5E 2LC4A 5ECAA 1KQ2A 3OBYA 3NMZC 2RQWA 1VQPT 1QP3A 3SEMA 1OZ3A 1UFFA 5FU6C 1VQ7T 4ZN3A 2CS7A 5FU6B 2EJFA 2RHZA 5KYUB 1GXIE 5LL6S 3I56A 3KXTA 1D1CA 2H3EB 2VXFA 2YRCA 3E9GA 1FYNA 3DLMA 1YJWA 1TOVA 3ZFJA 1NG2A 1TS9A 2J6FA 2ENMA 3CCVQ 2LZ6B 3T9NA 5GMKl 2OTJT 1WHJA 3S6WA 3U23A 1M2VA 2EJ9A 3QYHB 4A53A 2E6NA 5LJ3h 3I5RA 4KBMB 1OI1A 1ZBXA 3G4SA 1KQ1A 4XTZA 1JBMA 4FM4B 1VQNA 2F5TX 5IXBA 3L1AA 2GQIA 1NPRA 2DTHA 1RAFB 2RHIA 2D8JA 2EVRA 1Y57A 2CSQA 2JZ2A 3J7AF 1QVPA 1IXDA 3OSSC 1H641 2EGEA 1R8OB 2KEAA 1X01A 1D0XA 1V29B 2L3RA 3OW2S 1WFWA 4PJOF 2RHYA 2DVJA 3CBOA 4EMGA 2O4XB 1KD1R 1YITT 4KGZB 3CCUQ 2HKNA 1UUEA 5KYUA 3BE3A 3EFRA 3FLGA 3X28B 3M53A 3CBMA 4BI3A 5DLOA 1K8AR 1VQKT 4M7DG 2X9HA 4AG1C 3FB9A 3V8LA 2YUOA 2VASA 4F7UG 3CCQA 5GJVB 3CPWS 3CCJT 2X3WD 1K8AC 1QVFS 3PIPA 1SHFA 1UJYA 3JB9F 5KE3A 4ELZC 2DZ9A 1PHTA 4J7FA 2E3IA 5FWBA 2HEQA 5C0MA 1WLPB 3OYYA 3E19A 1JJ2S 2LNHB 5CIUA 2OTLT 3MCAB 1WJRA 3BFMA 4LDUA 4JUVA 2FB7A 1XNIA 3TQ7P 4RTUA 1SF9A 1NEBA 4HVVA 3G71Q 4EMKC 2DK3A 2QQ9A 5A2QE 2FPEA 1AWWA 1TTHB 2DBMA 2GGRA 3SFMA 3C0CA 4RTTA 3TSWA 3MHXA 1YI2Q 2JMCA 4BACA 4HT8A 5KYYB 1MMDA 1RABB 5LJ5g 5J39A 1YJNT 2O88A 4OMPA 2K5LA 3CD6A 4VUBA 3CC4A 2MCNA 2O4XA 2F69A 1VQ6Q 2HSPA 2MYSA 3M58A 3CCET 4OF1A 5IT9E 1K76A 3BDUA 3QO3A 5GAMf 3DKMA 3BDLA 5J26A 2JOYA 1YBYA 4C8QG 4C0GA 4FL6A 2E70A 3RMSA 5GMKe 5CKDA 3C12A 1VQ9Q 1W2BA 4CC4B 3VUBA 4ZGEB 4PJOC 3JCMV 3CC2Q 4C5GA 1KHCA 2LQ8A 2HCKA 4PJOB 4JLIA 3RKWA 2RJFA 4BB7A 2XDDA 2Z0WA 5FLXE 1VOMA 1DJ7B 4XU1A 2DEUA 3OYHA 2L3SA 1QWEA 4MZTA 2C06A 4A4FA 2QA4A 4Y28E 3PE0A 4AMCA 3X24B 2FRYA 1RADB 4J9HA 2ZPGB 2HNIA 2O2OA 2EQMA 4LNPA 1WHKA 4C8QF 1VQPA 2IVWA 4RCBA 1VQ8T 3FEOA 4XU0A 2COZA 3G7ZA 4C92C 4LDWA 4C92B 4QW2A 3CCMQ 1VIEA 1WJQA 5KYYA 3CCRA 1IB8A 1YHQT 4M7DE 1AEYA 1VQ5T 3VKIA 1MV0B 4F7UE 4J8OA 4Z88A 4JLGA 4BDZA 3VRZA 2ZPEB 5GANd 1WA7A 4OGCA 3MPUB 2DVEA 4PNOA 4OB1B 2KVQG 2HZYA 2QQRA 2QEXA 2XDBA 1I81A 5GANg 6AT1B 2X4YA 2DYBA 1BCOA 2P4TA 5HY6A 3EAEA 3HRSA 2GFAA 3UWNA 2K7AA 4PJOA 2DRKA 2M0YA 2D6FA 2EQUA 1ZUUA 2CZ6B 2GBQA 5DY9A 1M90R 2QGGA 1QVGS 4P5NA 2FRWA 3PGGA 1YIJA 2DNUA 1BI2A 3S3OA 3TEEA 2ESWA 5DM7R 1M90C 4J9BA 4DOWA 1HXDA 2O9VA 3MEVA 1TXQA 1H8KA 4C92D 1ZLMA 3I55A 1BK2A 4QVDA 1FMKA 5LJ5e 1UHCA 3EGUA 1TWBA 1WJSA 4M77C 4C92A 2HAXA 2VC8A 2RHXA 4M77B 2D0NA 2GTOA 2XDPA 1RUWA 3P8HA 1M1FA 1NJIR 5LJ5j 1VQ4Q 3CC7A 1OU9A 4JJBA 2OJ2A 4RTWA 2FPDA 4M7AD 4C5HA 3S3MA 3EHRA 4C8QC 1PD1A 2A28A 1VQOA 1G3TA 2AKKA 2K2VA 1UHFA 2DM1A 2JXBA 2K57A 2QQSA 1IHWA 3JCMd 4A63B 4DBFA 2DXCA 1YFNA 4LDVA 1KC8C 4L6V5 4MMKA 1GBQA 2P0PA 4GY5A 5EG2A 3IQLA 2V8IA 3JCMg 4M75D 3I56T 1EFNA 1Z9QA 1V1CA 2DIGA 3OS1A 3DB3A 3OYNA 3V7CA 4LD9K 1YJWT 3GNGA 1WX6A 5AT1B 4DBHA 5M9OA 1UGPB 1XQHA 1N5ZA 3MP6A 4M77D 5LJ3f 1G5VA 2HDAA 2X4WA 2O31A 3UF4A 3J80E 2RPNA 3KBGA 2DD5A 2A0FB 3INZA 4M77A 1W4SA 3GOXA 1M1KR 3QUIA 1LPLA 4BDYA 2L89A 2RH2A 2VYTA 1ZX6A 2A37A 1M1KC 1VQLQ 3G4ST 4FSSA 5IHKA 3QG1A 2WACA 2OAWA 4DQ2A 2AZSA 3A8GB 5GAMh 2DL4A 1VQNT 2P4RA 4XQ3A 2LCLA 1NYFA 1MUZA 3MO8A 3GPLA 4QQ6A 4DBQA 1YJNQ 2LQKA 4J9EA 2GQVA 4E7SA 2E4HA 1B07A 2ZZDA 4C5IA 2PNIA 2OI3A 5GANj 3M0TA 4M78B 4DEXA 1O9SA 4PL6A 1K1ZA 3EG3A 2R5MA 3ZBDA 4N4IA 2LMJA 1X6BA 1JQQA 5KYXB 1U06A 1UGRB 1VYUA 1VQ8A 4RG8A 3CCLA 4GLKA 4J5YA 1YN8A 3HFNA 5C6SA 1PNJA 2XU8A 1K73R 3OS0A 4XTWA 3OYCA 3CMAA 1Q81R 4HVUA 3CQTA 3LLRA 1YJ9Q 5GJWB 3CCQT 2X4XA 1X27A 4L5GA 3PIOA 1K73C 2AZVA 5A0GA 1Q81C 2VXEA 1AWJA 4MDXA 5GAN5 1N8RR 1AWOA 1D0ZA 3E9FA 1OU8A 2KSSA 5EC7A 3RKYA 1C0MA 1M3CA 1OULA 4F16A 2VV5A 5IHIA 2KXDA 1BI1A 1FMVA 3M0QA 4BE1A 3CXCA 3M56A 3QKJA 1H3ZA 2LCSA 1ZQ1A 5GAMd 2V1QA 1Q82R 3G6EA 2BZ8A 2CDTA 1M4ZA 1ZBJA 1YHQQ 3SWNC 4EMHA 2L3PA 2CP0A 3E1SA 2CP2A 3OQ5A 4M78D 5FRMA 1VQ5Q 1Q82C 2BE7D 3SWNB 3QDFA 3P8BB 4ZN1A 1Q86R 8ATCB 4M78A 4J9IA 2NYSA 4KH1B 4DA4A 4LUEA 4OMFB 1GCQC 1MV3A 3VS4A 1JXMA 3OW2A 2RQUA 2MIOA 2KRNA 4BUGA 3DLLA 2KY9A 1AD5A 1P92A 2KE9A 1Q86C 4D6WA 5KYXA 4JRIA 5I11A 3CD6T 3NTHA 2JM9A 3CC4T 4IUUA 2C0TA 4XU3A 4JZ4A 4FYYB 5FW9A 1BCMA 1LCKA 1JRIA 2XHCA 2A7YA 2EPDA 2DXUA 1AOJA 4FW2A 3QWXX 1XTDA 3OB9A 4EIKA 1QVFA 1WQWA 3CCSQ 4NOYA 1UEBA 4A4EA 1KD1U 1M1GA 5GMKh 2F5KA 5I22A 1NPPA 3PTAA 2KXCA 2XK0A 2JTFA 4X9CA 1OX9A 3OYGA 1K8AU 2D8HA 1R0BG 2VUBA 2BUDA 4OGEA 3QZ9B 2YSQA 3GLXA 2QA4T 2R57A 2E6ZA 2LX7A 1GBRA 1ABQA 2E5KA 4FYWB 2FEIA 2KDSA 2DF6A 3TREA 3LWIA 2WSCE 3FJ5A 4E47A 2CH4W 3SWNA 3ZEHA 1XJWB 3MEUA 3OBWA 5FRNA 3TCJA 3CCVA 1N9RA 1RAGB 2K2MA 2PUKB 2JN0A 3CCRT 1GCQA 5I21A 2AT1B 3M0RA 4PFZA 2AIRB 1NYGA 5KYWB 2DXBA 2FHDA 5GAN3 3PT9A 3UA7A 3TU4K 1IZ6A 2QGFB 2KYBA 3HRTA 2RM4A 1WGSA 4RKUE 2QEXT 2KAFA 2MMPA 4MZMA 2RQTA 3HRUA 4PJOG 4WF2A 1IREB 1EZZB 4J9CA 3FDRA 2NUZA 2DBKA 3CXCS 4HXJA 4A4KA 1M27C 2MWOA 3CPWP 1N9SA 4FW1A 2QDYB 3GNFB 3I5SA 3JSCA 5D7UA 3RIRA 2DL7A 4IUVA 1YIJT 4FU6A 1TH7A 3QHSA 3QPHA 4ZTJA 4RTZA 3JB9G 5GAOq 4F04B 3MKDA 3VS0A 1G8XA 4C92G 2JM8A 2W0ZA 4OMOA 1VA7A 2DILA 3I55T 3BW1A 3G1JA 4E6RA 1MGQA 1VQNQ 3RMQA 2I2LA 2DAQA 4L59A 1QQJA 3CC7T 1YWOA 2CH4A 5GAN6 2YRDA 3O8VA 5HK0A 1VQMA 1UJ0A 3X26B 5KYWA 1OX8A 1NLOC 1ACMB 2G6FX 3OYAA 4C92F 1VQOT 3FIFA 1R77A 1QW1A 1FWZA 3NGPA 4IIOA 4PK4A 3G71A 2JS0A 5LJ3d 3EG0A 1F1BB 2KT1A 2LQNA 4II1A 1HD3A 4Z89A 2KRSA 1HYOA 5LJ3g 4M7AF 1WXTA 2M02A 2CP6A 1ARKA 4Z02A 2Y90A 1ZHIA 4LXCA 1QVGA 1Q7YR 4XU2A 2K5IA 3H6ZA 3PMIA 1WXUA 1T0HA 1PM3A 2GCXA 2DZCA 1Q7YC 1I5LA 3UPUA 3H9NA 1VUBA 4MDWA 1PSFA 4LUDA 1D1AA 1NBEB 2LNVA 2ZPBB 4M77G 1ZUYA 3FC3A 2JS2A 5DLQE 1WHGA 3EHQA 1WZOA 2HKQB 2K9GA 4CC2A 7AT1B 2RJEA 1M90U 3L42A 4E7ZA 1IHVA 4QVZA 4AG2C 1VQ9A 1GFCA 2DIQA 1WHMA 1MMGA 3WVDB 4M75F 2QK0A 3WVEB 3CC2A 2SEMA 1D3BB 5GMKi 1D09B 2EQIA 4HA8A 4CI0C 1YNZA 3I35A 3PFSA 4PJOE 2EQKA 2YHTA 4R0KA 4AFZC 1SSHA 2DETA 4KT0E 1QCNA 3AHUA 2ECZA 4M77F 2LT1A 5GAN2 3CC4Q 1G2BA 3RESA 4HVWA 2DE0X 3M9QA 3A8MB 2MOXA 1NJIU 3LGLA 3M59A 4GBQA 4E7LA 5CK9A 4XTYA 2EYXA 5KCOA 4V2SA 2Y4YA 1M3BA 1RAHB 1X6OA 2E5QA 3HHTB 2DL5A 4C92E 3CCLT 3UA6A 2E3HA 4FYVB 2A3LA 3M55A 5KE2A 3S3NA 3EG1A 3M0UA 3H8ZA 2E12A 3CMAT 4N0AC 5FU7C 4D8DA 2CSIA 5FU7B 3RR6A 1T0JA 4YTLA 4EDUA 3VS5A 1RI0A 4QVCA 2QA4Q 2I0NA 2G3RA 2IIMA 5D6XA 4M7AC 3OY9A 3OYIA 4M7AB 3RDVA 4FT2A 1VQPQ 2EYYA 2OAUA 2LVMA 4AFUC 2JTEA 1M2OA 1VQ7Q 4E2FB 2ROTA 2MK5A 3ZL7C 3G6ET 4KRTA 3MEAA 1M8MA 2PU9B 2L0AA 4M78G 1AT1B 2JMAA 2AHJB 2AKLA 1M1KU 4RTYA 1SPKA 5CKBA 4EPCA 1SSFA 4JRPA 1W2BP 5GAN4 2OTJQ 4M75C 1BIBA 4Z8AA 2BE9B 1HJDA 4M75B 1E6HA 2BZXA 2OX7A 1WNLA 4XAXB 5LJ3j 3M54A 2M16A 4XTUA 2YT6A 1VQ4A 3ME9A 5IXFA 4M77E 1Y7XA 1AZGB 4M4ZA 1JU5C 4RTXA 4M78F 4C0DC 2LTOA 5D6YA 2HMAA 1BI0A 1PC0A 2QASA 2RMOA 2SRCA 4C0DB 4E7IA 2J6OA 4N0AA 4RTVA 4CC3A 2EKHA 2DFUA 4BD3A 1PSEA 3JCMQ 2K3YA 2FZGB 4AFQC 2B8AA 3HFOA 4C8QE 1W70A 2JVVA 3EH2A 1YIJQ 2NUPB 2L3QA 1X2KA 1RAAB 2QYZA 2H8HA 4M7AA 5HK3A 4CRIA 1K73U 2DJQA 2KK4A 2YWWA 1GFDA 1Q81U 1QLYA 4OB0B 2RJCA 5I2MA 1G3YA 4A4HA 4M7DD 1YITQ 3R6NA 1U1TA 3ER0A 5CAIA 3EG2A 3CMEA 2J7IA 1GL5A 1K0XA 2RO0A 5GAOm 4BI4A 1KC8R 1VQKQ 2JJ9A 2ROLA 4C0FA 1N8RU 2QTVA 3HL8A 5CR2A 1ZA1B 3CCJQ 3Q1JA 2P0QA 4HT9A 1N27A 2K3XA 3KFVA 3CCVT 1WXBA 1U3OA 1QP2A 2EAYA 4M75A 1Q82U 1XOVA 3SB2A 3NTIA 5CQYA 2DPPB 3HKSA 5IHNA 4IIMA 5I2SA 4HCCA 3EFOB 3JCMP 2EWNA 2OTLQ 1JO8A 1Q86U 1NM7A 1X69A 4MZPA 2KQWA 3C95A 1E6GA 1T3SA 1VQLA 2Y4XA 1OQKA 2DA9A 1PCXA 3LGFA 2KNBB 2K4YA 1RI9A 4DEYA 2J6KA 1VIFA 3OMCA 2DO3A 4ANJA 2NUPA 2F1LA 2HQXA 2QQAA 1K9MR 1YCSB 4JRKA 1SRMA 4LDYA 1OYXA 3GP8A 5GANe 4ZTFA 4OVAA 3VS7A 3GF5A 4F14A 2K5FA 1G83A 2XKOC 1K9MC 3RERA 3CCEQ 4M78C 5FROA 3EG9B 3NFCA 4ZGJB 1A0NB 3QXEB 1TUGB 2MWPA 3PVQA 2LX9A 5LJ5f 4OB3B 2WSFE 2YUQA 3AT1B 1X75C 1J3TA 2DL3A 3OSVA 4PLIA 1YJ9A 1SRLA 5L8RE 4Q5WA 2FO0A 1IGUA 4D8KA 3VU3C 2FZCB 4LN2A 2VWFA 4OP0A 2RK1A 2MPXC 4KUDK 4E7KA 3JCMX 3CEYA 2CP5A 2RF0A 1VQMT 2CP7A 3EFOA 1AZEA 3L2ZA 1B34B 2RI5A 2E41A 2ZGWA 3VV0A 4OMQA 5CCAA 2VGMA 2X4JA 1U5SA 3HPWA 1KQSP 2LJ1A 2RI3A 2CZ0B 1VQ8Q 2COYA 3A8LB 4PJJA 3ASKA 1HSQA 3G71T 3VS2A 2QQBA 1SKUB 3JRZA 1EX4A 2IPOB 1RLQC 2KBTA 2RQRA 1EIFA 1YI2T 2CZ1B 4PJMA 3RKXA 2WSEE 5GAMg 2MF2A 2C0IA 2QTXA 3GIBA 2ZPHB 3JAME 2PVDB 1RAEB 3JCMc 3FRNA 4B9WA 3EG9A 1I0CA 1RAIB 3NPFA 2JT4A 4ATOA 1CKAA 4K11A 3VUZA 4BI8B 2ZPIB 3JCMe 3RUXA 2EYWA 4J83A 1QCFA 1S72A 1UECA 3A5ZB 3QZ5B 3CCSA 1UE9A 4HKEA 2FG0A 1Y0MA 1VQ9T 1QMCA 1YCYA 2LCCA 3CC2T 5IN1A 3R6OA 1M8VA 4O5VA 5GANf 4QKUA 3V7SA 4A4GA 2HQHA 3SD4A 4LDXA 4X34A 1B34A
chains in the Genus database with same CATH topology
4Z88A 1PWTA 1NLOC 2ABLA 1SHGA 2G6FX 4RUGA 2XMFA 3VRZA 3JV3A 2RQVA 1WA7A 1RLPC 2EYZA 1TUCA 4AFSC 3NGPA 4IIOA 2B86A 3UATA 1NEGA 1QWFA 2EW3A 2JS0A 3EG0A 2KT1A 2LQNA 1Z9ZA 1WYXA 2J05A 1YWPA 1HD3A 2DYBA 4Z89A 2YDLA 2KRSA 3VS3A 2K7AA 1WXTA 2DRKA 1ARKA 2M0YA 1M3AA 1ZUUA 2GBQA 2FPFA 2KR3A 2M51A 4JJDA 1TG0A 1KSWA 1WXUA 2PTKA 2FRWA 4OMLA 2DNUA 1T0HA 4F17A 1OV3A 1I07A 4JZ3A 2ESWA 1W1FA 3A98A 2DLPA 4J9BA 4LUDA 4HCKA 2O9VA 2EBPA 1ZUYA 1ZSGA 2JS2A 2NWMA 1H8KA 1ZLMA 2CT4A 3EHQA 1BK2A 2K9GA 1FMKA 4CC2A 1T3LA 2F2VA 1UHCA 3EGUA 3LH5A 4AG2C 1GFCA 2LJ0A 2D0NA 2GTOA 1RUWA 1PKTA 2SEMA 1VYTA 2A08A 1QKWA 4JJBA 2EQIA 4GLMA 2OJ2A 3GBQA 4RTWA 2FPDA 1YNZA 3I35A 1KJWA 3QWYA 4R0KA 4AFZC 3EHRA 4OMNA 1BB9A 1SSHA 4QT7A 2A28A 1X6GA 2ECZA 1OPKA 1G2BA 4HVWA 1WIEA 2DE0X 2MOXA 3H41A 2AKKA 3PVLA 4CC7A 1UHFA 1H3HA 4GBQA 4J9FA 2DM1A 2EYXA 2JXBA 2K6DA 1UGVA 1VYVA 4ESRA 1M3BA 2KRMA 4A63B 2DL5A 3UA6A 1GBQA 3IQLA 3EG1A 1ZUKA 1EFNA 1Z9QA 3M0UA 1ABOA 1V1CA 3REAB 4D8DA 1PRMC 2CSIA 1K4US 1WX6A 1UDLA 1T0JA 4Y92A 3VS5A 1N5ZA 2I0NA 2IIMA 2D1XA 2HDAA 2O31A 3UF4A 2DRMA 2RPNA 1KFZA 2EYYA 3H0IA 1AVZC 2KT8A 4LE9A 1ZX6A 2W10A 4AFUC 2JTEA 2A37A 2RN8A 3THKA 1S1NA 4J9GA 1NLPC 2QDLA 1UG1A 4FSSA 2ROTA 5IHKA 2OAWA 3ZL7C 2AZSA 4KRTA 2DL4A 1M8MA 2P4RA 2EGCA 2L0AA 2KGTA 1NYFA 1MUZA 2JMAA 1OOTA 2AKLA 3REBB 4J9EA 4RTYA 1SPKA 2DMOA 2CT3A 1B07A 1IO6A 2PNIA 1I1JA 2OI3A 3M0PA 2JW4A 3M0TA 4DEXA 3NHNA 5FWCA 4Z8AA 1K1ZA 1QKXA 3EG3A 5ECAA 1X2QA 1HJDA 1K9AA 1E6HA 2BZXA 2LMJA 1X6BA 3NMZC 1JQQA 2RQWA 3SEMA 1U06A 2F2XA 1VYUA 4J9DA 1UFFA 2A36A 2YT6A 3TSZA 5IXFA 3M0SA 1AZGB 2K3BA 2CUDA 1YN8A 4M4ZA 1JU5C 2DX1A 4RTXA 1PNJA 2RMOA 2LQWA 2SRCA 4HVUA 2J6OA 1FYNA 4RTVA 3CQTA 4CC3A 2EKHA 5GJWB 1NG2A 1X27A 2AZVA 2J6FA 3I9QA 4AFQC 1X43A 2ENMA 1W70A 2KYMA 2LZ6B 2L3QA 1X2KA 1AWJA 2H8HA 2ED0A 4JJCA 2EGAA 1AWOA 1BU1A 2DJQA 3U23A 1PRLC 1GFDA 5EC7A 1QLYA 1WDXA 1M3CA 4F16A 5IHIA 3R6NA 3EG2A 2KXDA 2J7IA 3I5RA 3M0QA 1GL5A 1K0XA 2LCSA 2C0OA 2V1QA 2BZ8A 2CDTA 2ROLA 1ZBJA 3RNJA 5IXBA 2GQIA 2L3PA 2D8JA 2EVRA 3ULRB 1Y57A 2CSQA 4X1VA 3H0FA 3KFVA 4J9IA 1WXBA 1U3OA 2RNAA 4LUEA 1GCQC 1JEGA 1MV3A 2EGEA 1JXMA 3VS4A 2KEAA 2RQUA 2MIOA 2KRNA 1XOVA 1AD5A 2KE9A 1WFWA 5I11A 5IHNA 2JM9A 4IIMA 2DVJA 2KROA 2C0TA 4JZ4A 5FW9A 2GNCA 1JO8A 1CKBA 1UUEA 1NM7A 1X69A 1LCKA 1E6GA 1T3SA 1B3QA 3VRYA 2DA9A 4AG1C 3H0HA 2KNBB 2YUOA 2EPDA 1AOJA 1AWXA 3QWXX 1BBZA 3VS6A 4EIKA 5GJVB 1RI9A 1JXOA 2X3WD 4DEYA 2J6KA 5I22A 1SHFA 1M30A 1UJYA 1YCSB 1SRMA 2KXCA 1PHTA 2YUNA 3VS7A 4F14A 5FWBA 2HEQA 2D8HA 1WLPB 1G83A 2VVKA 4ORZA 1H92A 3TVTA 2LNHB 2YSQA 1OEBA 1A0NB 1TUDA 2AK5A 3PVQA 2LX7A 1GBRA 1ABQA 2YUQA 2E5KA 2ED1A 2FEIA 4RTUA 2DF6A 1GRIA 4HVVA 1NEBA 1J3TA 1CSKA 2DL3A 3FJ5A 2CH4W 2FPEA 2X3XD 1AWWA 1SRLA 2DBMA 2FO0A 1PKSA 4ZNXA 2LJ3A 2GGRA 4D8KA 2K79A 3VS1A 3C0CA 2HBWA 4LN2A 4RTTA 5IH2A 2VWFA 3TSWA 3O5ZA 1K0SA 2JMCA 2CUBA 2K2MA 1SEMA 1GCQA 1GCPA 1W6XA 2O88A 2O9SA 2RF0A 4OMPA 1YP5A 2MCNA 1AZEA 3M0RA 2HSPA 1NYGA 2L2PA 4OMQA 1K76A 3UA7A 2KYBA 1U5SA 2LJ1A 2LP5A 1HSQA 2PZ1A 2RQTA 3VS2A 1RLQC 2BZYA 2KBTA 4J9CA 2RQRA 4CC4B 1E7OA 2NUZA 2DBKA 4HXJA 5HCKA 2HCKA 1M27C 3I5SA 2C0IA 4OMMA 2L3SA 1QWEA 2DL7A 2VKNA 1I0CA 3NPFA 3PE0A 2FRYA 2JT4A 5L23A 2CREA 4J9HA 1CKAA 4RTZA 4K11A 2O2OA 4LNPA 1OPLA 3VS0A 2JM8A 2W0ZA 2YUPA 2EYWA 4OMOA 1VA7A 1QCFA 2DILA 1UECA 2V1RA 4E6RA 1UE9A 2FG0A 1Y0MA 4WCIA 1KIKA 3SHWA 2GTJA 4JPBW 1YWOA 1UTIA 2DL8A 2J06A 1AEYA 2CH4A 2BTTA 2F2WA 1MV0B 3RBBB 1WI7A 1UJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z88 A;  1PWT A;  1NLO C;  2ABL A;  1SHG A;  2G6F X;  4RUG A;  2XMF A;  3VRZ A;  3JV3 A;  2RQV A;  1WA7 A;  1RLP C;  2EYZ A;  1TUC A;  4AFS C;  3NGP A;  4IIO A;  2B86 A;  3UAT A;  1NEG A;  1QWF A;  2EW3 A;  2JS0 A;  3EG0 A;  2KT1 A;  2LQN A;  1Z9Z A;  1WYX A;  2J05 A;  1YWP A;  1HD3 A;  2DYB A;  4Z89 A;  2YDL A;  2KRS A;  3VS3 A;  2K7A A;  1WXT A;  2DRK A;  1ARK A;  2M0Y A;  1M3A A;  1ZUU A;  2GBQ A;  2FPF A;  2KR3 A;  2M51 A;  4JJD A;  1TG0 A;  1KSW A;  1WXU A;  2PTK A;  2FRW A;  4OML A;  2DNU A;  1T0H A;  4F17 A;  1OV3 A;  1I07 A;  4JZ3 A;  2ESW A;  1W1F A;  3A98 A;  2DLP A;  4J9B A;  4LUD A;  4HCK A;  2O9V A;  2EBP A;  1ZUY A;  1ZSG A;  2JS2 A;  2NWM A;  1H8K A;  1ZLM A;  2CT4 A;  3EHQ A;  1BK2 A;  2K9G A;  1FMK A;  4CC2 A;  1T3L A;  2F2V A;  1UHC A;  3EGU A;  3LH5 A;  4AG2 C;  1GFC A;  2LJ0 A;  2D0N A;  2GTO A;  1RUW A;  1PKT A;  2SEM A;  1VYT A;  2A08 A;  1QKW A;  4JJB A;  2EQI A;  4GLM A;  2OJ2 A;  3GBQ A;  4RTW A;  2FPD A;  1YNZ A;  3I35 A;  1KJW A;  3QWY A;  4R0K A;  4AFZ C;  3EHR A;  4OMN A;  1BB9 A;  1SSH A;  4QT7 A;  2A28 A;  1X6G A;  2ECZ A;  1OPK A;  1G2B A;  4HVW A;  1WIE A;  2DE0 X;  2MOX A;  3H41 A;  2AKK A;  3PVL A;  4CC7 A;  1UHF A;  1H3H A;  4GBQ A;  4J9F A;  2DM1 A;  2EYX A;  2JXB A;  2K6D A;  1UGV A;  1VYV A;  4ESR A;  1M3B A;  2KRM A;  4A63 B;  2DL5 A;  3UA6 A;  1GBQ A;  3IQL A;  3EG1 A;  1ZUK A;  1EFN A;  1Z9Q A;  3M0U A;  1ABO A;  1V1C A;  3REA B;  4D8D A;  1PRM C;  2CSI A;  1K4U S;  1WX6 A;  1UDL A;  1T0J A;  4Y92 A;  3VS5 A;  1N5Z A;  2I0N A;  2IIM A;  2D1X A;  2HDA A;  2O31 A;  3UF4 A;  2DRM A;  2RPN A;  1KFZ A;  2EYY A;  3H0I A;  1AVZ C;  2KT8 A;  4LE9 A;  1ZX6 A;  2W10 A;  4AFU C;  2JTE A;  2A37 A;  2RN8 A;  3THK A;  1S1N A;  4J9G A;  1NLP C;  2QDL A;  1UG1 A;  4FSS A;  2ROT A;  5IHK A;  2OAW A;  3ZL7 C;  2AZS A;  4KRT A;  2DL4 A;  1M8M A;  2P4R A;  2EGC A;  2L0A A;  2KGT A;  1NYF A;  1MUZ A;  2JMA A;  1OOT A;  2AKL A;  3REB B;  4J9E A;  4RTY A;  1SPK A;  2DMO A;  2CT3 A;  1B07 A;  1IO6 A;  2PNI A;  1I1J A;  2OI3 A;  3M0P A;  2JW4 A;  3M0T A;  4DEX A;  3NHN A;  5FWC A;  4Z8A A;  1K1Z A;  1QKX A;  3EG3 A;  5ECA A;  1X2Q A;  1HJD A;  1K9A A;  1E6H A;  2BZX A;  2LMJ A;  1X6B A;  3NMZ C;  1JQQ A;  2RQW A;  3SEM A;  1U06 A;  2F2X A;  1VYU A;  4J9D A;  1UFF A;  2A36 A;  2YT6 A;  3TSZ A;  5IXF A;  3M0S A;  1AZG B;  2K3B A;  2CUD A;  1YN8 A;  4M4Z A;  1JU5 C;  2DX1 A;  4RTX A;  1PNJ A;  2RMO A;  2LQW A;  2SRC A;  4HVU A;  2J6O A;  1FYN A;  4RTV A;  3CQT A;  4CC3 A;  2EKH A;  5GJW B;  1NG2 A;  1X27 A;  2AZV A;  2J6F A;  3I9Q A;  4AFQ C;  1X43 A;  2ENM A;  1W70 A;  2KYM A;  2LZ6 B;  2L3Q A;  1X2K A;  1AWJ A;  2H8H A;  2ED0 A;  4JJC A;  2EGA A;  1AWO A;  1BU1 A;  2DJQ A;  3U23 A;  1PRL C;  1GFD A;  5EC7 A;  1QLY A;  1WDX A;  1M3C A;  4F16 A;  5IHI A;  3R6N A;  3EG2 A;  2KXD A;  2J7I A;  3I5R A;  3M0Q A;  1GL5 A;  1K0X A;  2LCS A;  2C0O A;  2V1Q A;  2BZ8 A;  2CDT A;  2ROL A;  1ZBJ A;  3RNJ A;  5IXB A;  2GQI A;  2L3P A;  2D8J A;  2EVR A;  3ULR B;  1Y57 A;  2CSQ A;  4X1V A;  3H0F A;  3KFV A;  4J9I A;  1WXB A;  1U3O A;  2RNA A;  4LUE A;  1GCQ C;  1JEG A;  1MV3 A;  2EGE A;  1JXM A;  3VS4 A;  2KEA A;  2RQU A;  2MIO A;  2KRN A;  1XOV A;  1AD5 A;  2KE9 A;  1WFW A;  5I11 A;  5IHN A;  2JM9 A;  4IIM A;  2DVJ A;  2KRO A;  2C0T A;  4JZ4 A;  5FW9 A;  2GNC A;  1JO8 A;  1CKB A;  1UUE A;  1NM7 A;  1X69 A;  1LCK A;  1E6G A;  1T3S A;  1B3Q A;  3VRY A;  2DA9 A;  4AG1 C;  3H0H A;  2KNB B;  2YUO A;  2EPD A;  1AOJ A;  1AWX A;  3QWX X;  1BBZ A;  3VS6 A;  4EIK A;  5GJV B;  1RI9 A;  1JXO A;  2X3W D;  4DEY A;  2J6K A;  5I22 A;  1SHF A;  1M30 A;  1UJY A;  1YCS B;  1SRM A;  2KXC A;  1PHT A;  2YUN A;  3VS7 A;  4F14 A;  5FWB A;  2HEQ A;  2D8H A;  1WLP B;  1G83 A;  2VVK A;  4ORZ A;  1H92 A;  3TVT A;  2LNH B;  2YSQ A;  1OEB A;  1A0N B;  1TUD A;  2AK5 A;  3PVQ A;  2LX7 A;  1GBR A;  1ABQ A;  2YUQ A;  2E5K A;  2ED1 A;  2FEI A;  4RTU A;  2DF6 A;  1GRI A;  4HVV A;  1NEB A;  1J3T A;  1CSK A;  2DL3 A;  3FJ5 A;  2CH4 W;  2FPE A;  2X3X D;  1AWW A;  1SRL A;  2DBM A;  2FO0 A;  1PKS A;  4ZNX A;  2LJ3 A;  2GGR A;  4D8K A;  2K79 A;  3VS1 A;  3C0C A;  2HBW A;  4LN2 A;  4RTT A;  5IH2 A;  2VWF A;  3TSW A;  3O5Z A;  1K0S A;  2JMC A;  2CUB A;  2K2M A;  1SEM A;  1GCQ A;  1GCP A;  1W6X A;  2O88 A;  2O9S A;  2RF0 A;  4OMP A;  1YP5 A;  2MCN A;  1AZE A;  3M0R A;  2HSP A;  1NYG A;  2L2P A;  4OMQ A;  1K76 A;  3UA7 A;  2KYB A;  1U5S A;  2LJ1 A;  2LP5 A;  1HSQ A;  2PZ1 A;  2RQT A;  3VS2 A;  1RLQ C;  2BZY A;  2KBT A;  4J9C A;  2RQR A;  4CC4 B;  1E7O A;  2NUZ A;  2DBK A;  4HXJ A;  5HCK A;  2HCK A;  1M27 C;  3I5S A;  2C0I A;  4OMM A;  2L3S A;  1QWE A;  2DL7 A;  2VKN A;  1I0C A;  3NPF A;  3PE0 A;  2FRY A;  2JT4 A;  5L23 A;  2CRE A;  4J9H A;  1CKA A;  4RTZ A;  4K11 A;  2O2O A;  4LNP A;  1OPL A;  3VS0 A;  2JM8 A;  2W0Z A;  2YUP A;  2EYW A;  4OMO A;  1VA7 A;  1QCF A;  2DIL A;  1UEC A;  2V1R A;  4E6R A;  1UE9 A;  2FG0 A;  1Y0M A;  4WCI A;  1KIK A;  3SHW A;  2GTJ A;  4JPB W;  1YWO A;  1UTI A;  2DL8 A;  2J06 A;  1AEY A;  2CH4 A;  2BTT A;  2F2W A;  1MV0 B;  3RBB B;  1WI7 A;  1UJ0 A; 
#chains in the Genus database with same CATH topology
 3PMT A;  2LDM A;  2R58 A;  1B7T A;  1SHG A;  4RUG A;  2XMF A;  2X51 A;  4RMO A;  4J6Y A;  3JV3 A;  2D9T A;  2RQV A;  1AHJ B;  2HD0 A;  3QJ6 A;  2DEQ A;  2PQW A;  3JCM J;  2B86 A;  5CKF A;  2R5A A;  1PG5 B;  1Z9Z A;  1WYX A;  2J05 A;  5KYN A;  3DB4 A;  3QBY A;  2YDL A;  3L2R A;  4JS4 A;  1C6V X;  2FPF A;  2KR3 A;  2M51 A;  2VGN A;  4JJD A;  4NL3 A;  4BE2 A;  3CXC P;  1TG0 A;  2PTK A;  4F17 A;  3M4Y A;  1W1F A;  3A98 A;  3VYH B;  4QQG A;  2NWM A;  1G3S A;  4OB2 B;  2CT4 A;  4ME7 A;  3VJP A;  1Q7Y U;  1T3L A;  2F2V A;  3QII A;  4FYX B;  3OW2 P;  4TVR A;  3JB9 I;  2NUT B;  2RB6 A;  4J6W A;  4N4G A;  4R55 A;  1ZSZ C;  2A08 A;  4FSX A;  4GLM A;  3GBQ A;  1ZSZ B;  3M5A A;  3I56 Q;  1RAC B;  3QWY A;  5J3B A;  4QT7 A;  1X6G A;  1YJW Q;  5GAO p;  1OPK A;  1QVF P;  1WIE A;  3JCM f;  2D0Q B;  3QDR B;  3H41 A;  2DD4 A;  4CC7 A;  3L2W A;  1H3H A;  1D0Y A;  2L5Q A;  4J9F A;  8AT1 B;  3CCU A;  1R0C B;  1UGQ B;  5GAM e;  5GAO r;  1Y07 A;  1JJ2 P;  4ESR A;  4Y91 A;  1WHH A;  2IG0 A;  3OYD A;  1WQ7 A;  1VQ4 T;  5GAM j;  3OS2 A;  2CKK A;  3G4S Q;  1MND A;  1ZUK A;  2PVO B;  5LJ5 h;  1ABO A;  3REA B;  2LRQ A;  1PRM C;  1LVK A;  4HCZ A;  2EIF A;  1K4U S;  4M7A G;  4ELY C;  4Y92 A;  3V8J A;  5HKC A;  3OYK A;  4FCY A;  2D1X A;  1BI3 A;  2HL5 C;  3A8O B;  2DRM A;  1LJO A;  2HSE B;  2CP3 A;  1KD1 C;  2QAZ A;  2NUT A;  1V76 A;  1AVZ C;  2KT8 A;  2HL3 A;  2W10 A;  3OYJ A;  4LD6 A;  3CME T;  1ZSZ A;  2RN8 A;  1S1N A;  4J9G A;  1NLP C;  4PJL A;  2GFU A;  2EYQ A;  4PFO A;  4JS5 A;  2RHU A;  2XIC A;  1KG1 A;  4HCB A;  1YI2 A;  3CCQ Q;  1OOT A;  3REB B;  5GAO l;  4M75 G;  5KH6 A;  1VQM Q;  5GAN 8;  1I1J A;  1VQ6 A;  2XI9 A;  3EFS A;  2ZPF B;  2XD0 A;  1LOJ A;  2JNG A;  4M7D F;  3JB9 H;  1QKX A;  1MMN A;  1X2Q A;  1K9A A;  3MJX A;  4F7U F;  2EQJ A;  3JCM b;  3HP9 A;  2YXY A;  1TSF A;  5CKH A;  2F2X A;  3LX7 A;  2A36 A;  4J9D A;  3TSZ A;  4EMK B;  3M0S A;  2K3B A;  1M9S A;  2CUD A;  5LJ5 d;  1VQL T;  2DX1 A;  2ATC B;  4KGV B;  3A8H B;  2LQW A;  4MML A;  4FIB A;  4BE0 A;  3I9Q A;  1X43 A;  5CKE A;  4UC4 A;  2KYM A;  1Y71 A;  2BKD N;  2ED0 A;  4JJC A;  5CO7 A;  5GAN h;  2EGA A;  1BU1 A;  3CD6 Q;  1PRL C;  3QJY A;  4PFP A;  1WDX A;  4O6J A;  3JCM W;  5A0D A;  3OYL A;  4X9D A;  1LNX A;  2C0O A;  3OYM A;  4KH0 B;  3RNJ A;  3CCM A;  4NS5 A;  4XTX A;  3LYI A;  1YJ9 T;  5GMK j;  1Y96 B;  1FMW A;  3ULR B;  3L2Q A;  4X1V A;  3H0F A;  2MI6 A;  3N5B B;  2RNA A;  2V8K A;  4KUL A;  5KCH A;  3LWH A;  1JEG A;  1WPY A;  1KC8 U;  2DTI A;  1QVG P;  2JUF A;  2KRO A;  3UDC A;  4M7A E;  3OYE A;  4EMK A;  2GNC A;  1CKB A;  3D7S B;  3BY7 A;  1VQ7 A;  1B3Q A;  3VRY A;  4IUQ A;  4R56 A;  3H0H A;  1D3B A;  1AWX A;  1BBZ A;  2KI7 A;  2X35 A;  3VS6 A;  5GMK m;  4C5E A;  4C0Z A;  3L2V A;  1JXO A;  4M7D C;  1FX7 A;  4JDS A;  4M7D B;  1M30 A;  1NE8 A;  3CCR Q;  2OTJ A;  4F7U B;  2YUN A;  4KUI A;  2BIV A;  2VVK A;  4ORZ A;  1H92 A;  3TVT A;  2XID A;  5LJ3 e;  4IUR A;  4M75 E;  3CBP A;  1OEB A;  4BY6 C;  1TUD A;  2AK5 A;  4PJO D;  4RCC A;  2DJZ A;  1K9M U;  4BY6 B;  2QEX Q;  3J81 E;  2ED1 A;  3JCM h;  1GRI A;  1CSK A;  1S72 T;  2CYZ B;  2CGH A;  2X3X D;  1Y96 A;  3L2U A;  2XG8 D;  3CCS T;  1PKS A;  4ZNX A;  3QSU A;  2LJ3 A;  3MP8 A;  5AYF A;  1NZ9 A;  2K79 A;  3VS1 A;  2HBW A;  5IH2 A;  3EGD B;  3O5Z A;  2QI2 A;  1K0S A;  2CUB A;  1Q95 G;  1SEM A;  1GCP A;  1W6X A;  1IGQ A;  2O9S A;  1FXX A;  2QG9 B;  4FT4 A;  4XK8 E;  1YP5 A;  1TU0 B;  3JB9 D;  2M9U A;  1YIT A;  4AT1 B;  2L2P A;  2GF7 A;  1U1S A;  4B9X A;  2DER A;  3V7R A;  3OMG A;  2LP5 A;  4DOV A;  1VQK A;  3KUF A;  2E10 A;  2PZ1 A;  1BYM A;  2P84 A;  3I55 Q;  2JTM A;  4KGX B;  3CCJ A;  2BZY A;  3EGX B;  4IUP A;  4M7D A;  1MHN A;  1G3W A;  2QXF A;  1E7O A;  1NJI C;  4F7U A;  1W2B S;  5HCK A;  2RJD A;  3CC7 Q;  4C8Q B;  5A0L A;  1U8R A;  3FJP A;  2COW A;  3HSB A;  2RD1 A;  4OMM A;  1UB4 A;  2YLC A;  2VKN A;  2CZ7 B;  5GAO n;  2OTL A;  5L23 A;  1VQO Q;  2CRE A;  3MP1 A;  4J6X A;  4IKF A;  3V8K A;  1OPL A;  2YUP A;  4JRQ A;  2PVG B;  4ZGD B;  3CME Q;  3VYG A;  1O75 A;  4A54 A;  3URG A;  4QQD A;  2V1R A;  2RI2 A;  3EGD A;  1D1B A;  4E7J A;  4WCI A;  1KIK A;  3SHW A;  4JJN K;  2GTJ A;  2VB6 A;  4JPB W;  1KQS A;  3M57 A;  1ZA2 B;  1UTI A;  2DL8 A;  2J06 A;  3MEW A;  4XTV A;  1YJN A;  1SG5 A;  2BTT A;  2F2W A;  1M5Q 1;  1WI7 A;  3RBB B;  3QYG B;  1MMA A;  3F70 A;  1PWT A;  3CCE A;  2DTO A;  2ABL A;  1RLP C;  2FZK B;  2M0O A;  2ZAE A;  2EYZ A;  1TUC A;  4M78 E;  4AFS C;  3M4G A;  4DBR A;  2YLB A;  3UAT A;  4WTO B;  2FL7 A;  1NEG A;  1QWF A;  2EW3 A;  3EGX A;  4RG2 A;  1YWP A;  3CCU T;  4C8Q D;  3P8D A;  1KK7 A;  2O01 E;  5IAY A;  3A1P A;  2NLU A;  1IRX A;  3VS3 A;  4C8Q A;  5GAN 7;  3LH0 A;  1I8F A;  4E7H A;  1M3A A;  2P0K A;  1N6A A;  1KSW A;  4OML A;  2FYK A;  1OV3 A;  1I07 A;  4JZ3 A;  2FVU A;  4PLL A;  2HBP A;  2DLP A;  3X20 B;  4HCK A;  2EBP A;  1ZSG A;  4J7I A;  3UT1 A;  3MET A;  9ATC B;  3WXM B;  3LH5 A;  2LJ0 A;  1PKT A;  1UGS B;  1VYT A;  3CCL Q;  5D6W A;  1YHQ A;  2MAM A;  1QKW A;  4PKC C;  1VQ5 A;  1MNE A;  1KJW A;  1RL2 A;  3CMA Q;  4OMN A;  1BB9 A;  3OYB A;  1JB0 E;  2RK2 A;  2E1H A;  2H3J A;  1BKB A;  2E65 A;  1KHI A;  4B6M A;  3OYF A;  1VQ6 T;  3PVL A;  5CQX A;  1N8R C;  2DYI A;  3EH1 A;  3OA6 A;  2K6D A;  1UGV A;  1VYV A;  1BIA A;  3NTK A;  5CVI A;  2KRM A;  3HTR A;  2LT4 A;  2DXT A;  2EFI A;  1C1A A;  2E64 A;  3G6E Q;  3C4S A;  4NL2 A;  3OS5 A;  2V26 A;  4IUT A;  2DKG A;  1QCO A;  1UDL A;  1KQS S;  2EKO A;  3C94 A;  1I5O B;  3X25 B;  3E2U A;  2EJG A;  2V8J A;  1KFZ A;  1M2V B;  3H0I A;  2RA2 A;  3CPW A;  4PJN A;  1S72 Q;  2L8D A;  4LE9 A;  1WHL A;  1I4K 1;  2ZCF B;  1HK9 A;  3PNW C;  3THK A;  2QDL A;  1UG1 A;  2KMT A;  2EGC A;  3CCM T;  1OZ2 A;  2KGT A;  2PUO B;  3CPF A;  1JJ2 A;  4N4H A;  3SDZ A;  2DMO A;  3JB9 J;  1PD0 A;  2CT3 A;  1IO6 A;  3M0P A;  2JW4 A;  3NHN A;  5FWC A;  2M1H A;  2YRV A;  2HQE A;  3LW5 E;  2LC4 A;  5ECA A;  1KQ2 A;  3OBY A;  3NMZ C;  2RQW A;  1VQP T;  1QP3 A;  3SEM A;  1OZ3 A;  1UFF A;  5FU6 C;  1VQ7 T;  4ZN3 A;  2CS7 A;  5FU6 B;  2EJF A;  2RHZ A;  5KYU B;  1GXI E;  5LL6 S;  3I56 A;  3KXT A;  1D1C A;  2H3E B;  2VXF A;  2YRC A;  3E9G A;  1FYN A;  3DLM A;  1YJW A;  1TOV A;  3ZFJ A;  1NG2 A;  1TS9 A;  2J6F A;  2ENM A;  3CCV Q;  2LZ6 B;  3T9N A;  5GMK l;  2OTJ T;  1WHJ A;  3S6W A;  3U23 A;  1M2V A;  2EJ9 A;  3QYH B;  4A53 A;  2E6N A;  5LJ3 h;  3I5R A;  4KBM B;  1OI1 A;  1ZBX A;  3G4S A;  1KQ1 A;  4XTZ A;  1JBM A;  4FM4 B;  1VQN A;  2F5T X;  5IXB A;  3L1A A;  2GQI A;  1NPR A;  2DTH A;  1RAF B;  2RHI A;  2D8J A;  2EVR A;  1Y57 A;  2CSQ A;  2JZ2 A;  3J7A F;  1QVP A;  1IXD A;  3OSS C;  1H64 1;  2EGE A;  1R8O B;  2KEA A;  1X01 A;  1D0X A;  1V29 B;  2L3R A;  3OW2 S;  1WFW A;  4PJO F;  2RHY A;  2DVJ A;  3CBO A;  4EMG A;  2O4X B;  1KD1 R;  1YIT T;  4KGZ B;  3CCU Q;  2HKN A;  1UUE A;  5KYU A;  3BE3 A;  3EFR A;  3FLG A;  3X28 B;  3M53 A;  3CBM A;  4BI3 A;  5DLO A;  1K8A R;  1VQK T;  4M7D G;  2X9H A;  4AG1 C;  3FB9 A;  3V8L A;  2YUO A;  2VAS A;  4F7U G;  3CCQ A;  5GJV B;  3CPW S;  3CCJ T;  2X3W D;  1K8A C;  1QVF S;  3PIP A;  1SHF A;  1UJY A;  3JB9 F;  5KE3 A;  4ELZ C;  2DZ9 A;  1PHT A;  4J7F A;  2E3I A;  5FWB A;  2HEQ A;  5C0M A;  1WLP B;  3OYY A;  3E19 A;  1JJ2 S;  2LNH B;  5CIU A;  2OTL T;  3MCA B;  1WJR A;  3BFM A;  4LDU A;  4JUV A;  2FB7 A;  1XNI A;  3TQ7 P;  4RTU A;  1SF9 A;  1NEB A;  4HVV A;  3G71 Q;  4EMK C;  2DK3 A;  2QQ9 A;  5A2Q E;  2FPE A;  1AWW A;  1TTH B;  2DBM A;  2GGR A;  3SFM A;  3C0C A;  4RTT A;  3TSW A;  3MHX A;  1YI2 Q;  2JMC A;  4BAC A;  4HT8 A;  5KYY B;  1MMD A;  1RAB B;  5LJ5 g;  5J39 A;  1YJN T;  2O88 A;  4OMP A;  2K5L A;  3CD6 A;  4VUB A;  3CC4 A;  2MCN A;  2O4X A;  2F69 A;  1VQ6 Q;  2HSP A;  2MYS A;  3M58 A;  3CCE T;  4OF1 A;  5IT9 E;  1K76 A;  3BDU A;  3QO3 A;  5GAM f;  3DKM A;  3BDL A;  5J26 A;  2JOY A;  1YBY A;  4C8Q G;  4C0G A;  4FL6 A;  2E70 A;  3RMS A;  5GMK e;  5CKD A;  3C12 A;  1VQ9 Q;  1W2B A;  4CC4 B;  3VUB A;  4ZGE B;  4PJO C;  3JCM V;  3CC2 Q;  4C5G A;  1KHC A;  2LQ8 A;  2HCK A;  4PJO B;  4JLI A;  3RKW A;  2RJF A;  4BB7 A;  2XDD A;  2Z0W A;  5FLX E;  1VOM A;  1DJ7 B;  4XU1 A;  2DEU A;  3OYH A;  2L3S A;  1QWE A;  4MZT A;  2C06 A;  4A4F A;  2QA4 A;  4Y28 E;  3PE0 A;  4AMC A;  3X24 B;  2FRY A;  1RAD B;  4J9H A;  2ZPG B;  2HNI A;  2O2O A;  2EQM A;  4LNP A;  1WHK A;  4C8Q F;  1VQP A;  2IVW A;  4RCB A;  1VQ8 T;  3FEO A;  4XU0 A;  2COZ A;  3G7Z A;  4C92 C;  4LDW A;  4C92 B;  4QW2 A;  3CCM Q;  1VIE A;  1WJQ A;  5KYY A;  3CCR A;  1IB8 A;  1YHQ T;  4M7D E;  1AEY A;  1VQ5 T;  3VKI A;  1MV0 B;  4F7U E;  4J8O A;  4Z88 A;  4JLG A;  4BDZ A;  3VRZ A;  2ZPE B;  5GAN d;  1WA7 A;  4OGC A;  3MPU B;  2DVE A;  4PNO A;  4OB1 B;  2KVQ G;  2HZY A;  2QQR A;  2QEX A;  2XDB A;  1I81 A;  5GAN g;  6AT1 B;  2X4Y A;  2DYB A;  1BCO A;  2P4T A;  5HY6 A;  3EAE A;  3HRS A;  2GFA A;  3UWN A;  2K7A A;  4PJO A;  2DRK A;  2M0Y A;  2D6F A;  2EQU A;  1ZUU A;  2CZ6 B;  2GBQ A;  5DY9 A;  1M90 R;  2QGG A;  1QVG S;  4P5N A;  2FRW A;  3PGG A;  1YIJ A;  2DNU A;  1BI2 A;  3S3O A;  3TEE A;  2ESW A;  5DM7 R;  1M90 C;  4J9B A;  4DOW A;  1HXD A;  2O9V A;  3MEV A;  1TXQ A;  1H8K A;  4C92 D;  1ZLM A;  3I55 A;  1BK2 A;  4QVD A;  1FMK A;  5LJ5 e;  1UHC A;  3EGU A;  1TWB A;  1WJS A;  4M77 C;  4C92 A;  2HAX A;  2VC8 A;  2RHX A;  4M77 B;  2D0N A;  2GTO A;  2XDP A;  1RUW A;  3P8H A;  1M1F A;  1NJI R;  5LJ5 j;  1VQ4 Q;  3CC7 A;  1OU9 A;  4JJB A;  2OJ2 A;  4RTW A;  2FPD A;  4M7A D;  4C5H A;  3S3M A;  3EHR A;  4C8Q C;  1PD1 A;  2A28 A;  1VQO A;  1G3T A;  2AKK A;  2K2V A;  1UHF A;  2DM1 A;  2JXB A;  2K57 A;  2QQS A;  1IHW A;  3JCM d;  4A63 B;  4DBF A;  2DXC A;  1YFN A;  4LDV A;  1KC8 C;  4L6V 5;  4MMK A;  1GBQ A;  2P0P A;  4GY5 A;  5EG2 A;  3IQL A;  2V8I A;  3JCM g;  4M75 D;  3I56 T;  1EFN A;  1Z9Q A;  1V1C A;  2DIG A;  3OS1 A;  3DB3 A;  3OYN A;  3V7C A;  4LD9 K;  1YJW T;  3GNG A;  1WX6 A;  5AT1 B;  4DBH A;  5M9O A;  1UGP B;  1XQH A;  1N5Z A;  3MP6 A;  4M77 D;  5LJ3 f;  1G5V A;  2HDA A;  2X4W A;  2O31 A;  3UF4 A;  3J80 E;  2RPN A;  3KBG A;  2DD5 A;  2A0F B;  3INZ A;  4M77 A;  1W4S A;  3GOX A;  1M1K R;  3QUI A;  1LPL A;  4BDY A;  2L89 A;  2RH2 A;  2VYT A;  1ZX6 A;  2A37 A;  1M1K C;  1VQL Q;  3G4S T;  4FSS A;  5IHK A;  3QG1 A;  2WAC A;  2OAW A;  4DQ2 A;  2AZS A;  3A8G B;  5GAM h;  2DL4 A;  1VQN T;  2P4R A;  4XQ3 A;  2LCL A;  1NYF A;  1MUZ A;  3MO8 A;  3GPL A;  4QQ6 A;  4DBQ A;  1YJN Q;  2LQK A;  4J9E A;  2GQV A;  4E7S A;  2E4H A;  1B07 A;  2ZZD A;  4C5I A;  2PNI A;  2OI3 A;  5GAN j;  3M0T A;  4M78 B;  4DEX A;  1O9S A;  4PL6 A;  1K1Z A;  3EG3 A;  2R5M A;  3ZBD A;  4N4I A;  2LMJ A;  1X6B A;  1JQQ A;  5KYX B;  1U06 A;  1UGR B;  1VYU A;  1VQ8 A;  4RG8 A;  3CCL A;  4GLK A;  4J5Y A;  1YN8 A;  3HFN A;  5C6S A;  1PNJ A;  2XU8 A;  1K73 R;  3OS0 A;  4XTW A;  3OYC A;  3CMA A;  1Q81 R;  4HVU A;  3CQT A;  3LLR A;  1YJ9 Q;  5GJW B;  3CCQ T;  2X4X A;  1X27 A;  4L5G A;  3PIO A;  1K73 C;  2AZV A;  5A0G A;  1Q81 C;  2VXE A;  1AWJ A;  4MDX A;  5GAN 5;  1N8R R;  1AWO A;  1D0Z A;  3E9F A;  1OU8 A;  2KSS A;  5EC7 A;  3RKY A;  1C0M A;  1M3C A;  1OUL A;  4F16 A;  2VV5 A;  5IHI A;  2KXD A;  1BI1 A;  1FMV A;  3M0Q A;  4BE1 A;  3CXC A;  3M56 A;  3QKJ A;  1H3Z A;  2LCS A;  1ZQ1 A;  5GAM d;  2V1Q A;  1Q82 R;  3G6E A;  2BZ8 A;  2CDT A;  1M4Z A;  1ZBJ A;  1YHQ Q;  3SWN C;  4EMH A;  2L3P A;  2CP0 A;  3E1S A;  2CP2 A;  3OQ5 A;  4M78 D;  5FRM A;  1VQ5 Q;  1Q82 C;  2BE7 D;  3SWN B;  3QDF A;  3P8B B;  4ZN1 A;  1Q86 R;  8ATC B;  4M78 A;  4J9I A;  2NYS A;  4KH1 B;  4DA4 A;  4LUE A;  4OMF B;  1GCQ C;  1MV3 A;  3VS4 A;  1JXM A;  3OW2 A;  2RQU A;  2MIO A;  2KRN A;  4BUG A;  3DLL A;  2KY9 A;  1AD5 A;  1P92 A;  2KE9 A;  1Q86 C;  4D6W A;  5KYX A;  4JRI A;  5I11 A;  3CD6 T;  3NTH A;  2JM9 A;  3CC4 T;  4IUU A;  2C0T A;  4XU3 A;  4JZ4 A;  4FYY B;  5FW9 A;  1BCM A;  1LCK A;  1JRI A;  2XHC A;  2A7Y A;  2EPD A;  2DXU A;  1AOJ A;  4FW2 A;  3QWX X;  1XTD A;  3OB9 A;  4EIK A;  1QVF A;  1WQW A;  3CCS Q;  4NOY A;  1UEB A;  4A4E A;  1KD1 U;  1M1G A;  5GMK h;  2F5K A;  5I22 A;  1NPP A;  3PTA A;  2KXC A;  2XK0 A;  2JTF A;  4X9C A;  1OX9 A;  3OYG A;  1K8A U;  2D8H A;  1R0B G;  2VUB A;  2BUD A;  4OGE A;  3QZ9 B;  2YSQ A;  3GLX A;  2QA4 T;  2R57 A;  2E6Z A;  2LX7 A;  1GBR A;  1ABQ A;  2E5K A;  4FYW B;  2FEI A;  2KDS A;  2DF6 A;  3TRE A;  3LWI A;  2WSC E;  3FJ5 A;  4E47 A;  2CH4 W;  3SWN A;  3ZEH A;  1XJW B;  3MEU A;  3OBW A;  5FRN A;  3TCJ A;  3CCV A;  1N9R A;  1RAG B;  2K2M A;  2PUK B;  2JN0 A;  3CCR T;  1GCQ A;  5I21 A;  2AT1 B;  3M0R A;  4PFZ A;  2AIR B;  1NYG A;  5KYW B;  2DXB A;  2FHD A;  5GAN 3;  3PT9 A;  3UA7 A;  3TU4 K;  1IZ6 A;  2QGF B;  2KYB A;  3HRT A;  2RM4 A;  1WGS A;  4RKU E;  2QEX T;  2KAF A;  2MMP A;  4MZM A;  2RQT A;  3HRU A;  4PJO G;  4WF2 A;  1IRE B;  1EZZ B;  4J9C A;  3FDR A;  2NUZ A;  2DBK A;  3CXC S;  4HXJ A;  4A4K A;  1M27 C;  2MWO A;  3CPW P;  1N9S A;  4FW1 A;  2QDY B;  3GNF B;  3I5S A;  3JSC A;  5D7U A;  3RIR A;  2DL7 A;  4IUV A;  1YIJ T;  4FU6 A;  1TH7 A;  3QHS A;  3QPH A;  4ZTJ A;  4RTZ A;  3JB9 G;  5GAO q;  4F04 B;  3MKD A;  3VS0 A;  1G8X A;  4C92 G;  2JM8 A;  2W0Z A;  4OMO A;  1VA7 A;  2DIL A;  3I55 T;  3BW1 A;  3G1J A;  4E6R A;  1MGQ A;  1VQN Q;  3RMQ A;  2I2L A;  2DAQ A;  4L59 A;  1QQJ A;  3CC7 T;  1YWO A;  2CH4 A;  5GAN 6;  2YRD A;  3O8V A;  5HK0 A;  1VQM A;  1UJ0 A;  3X26 B;  5KYW A;  1OX8 A;  1NLO C;  1ACM B;  2G6F X;  3OYA A;  4C92 F;  1VQO T;  3FIF A;  1R77 A;  1QW1 A;  1FWZ A;  3NGP A;  4IIO A;  4PK4 A;  3G71 A;  2JS0 A;  5LJ3 d;  3EG0 A;  1F1B B;  2KT1 A;  2LQN A;  4II1 A;  1HD3 A;  4Z89 A;  2KRS A;  1HYO A;  5LJ3 g;  4M7A F;  1WXT A;  2M02 A;  2CP6 A;  1ARK A;  4Z02 A;  2Y90 A;  1ZHI A;  4LXC A;  1QVG A;  1Q7Y R;  4XU2 A;  2K5I A;  3H6Z A;  3PMI A;  1WXU A;  1T0H A;  1PM3 A;  2GCX A;  2DZC A;  1Q7Y C;  1I5L A;  3UPU A;  3H9N A;  1VUB A;  4MDW A;  1PSF A;  4LUD A;  1D1A A;  1NBE B;  2LNV A;  2ZPB B;  4M77 G;  1ZUY A;  3FC3 A;  2JS2 A;  5DLQ E;  1WHG A;  3EHQ A;  1WZO A;  2HKQ B;  2K9G A;  4CC2 A;  7AT1 B;  2RJE A;  1M90 U;  3L42 A;  4E7Z A;  1IHV A;  4QVZ A;  4AG2 C;  1VQ9 A;  1GFC A;  2DIQ A;  1WHM A;  1MMG A;  3WVD B;  4M75 F;  2QK0 A;  3WVE B;  3CC2 A;  2SEM A;  1D3B B;  5GMK i;  1D09 B;  2EQI A;  4HA8 A;  4CI0 C;  1YNZ A;  3I35 A;  3PFS A;  4PJO E;  2EQK A;  2YHT A;  4R0K A;  4AFZ C;  1SSH A;  2DET A;  4KT0 E;  1QCN A;  3AHU A;  2ECZ A;  4M77 F;  2LT1 A;  5GAN 2;  3CC4 Q;  1G2B A;  3RES A;  4HVW A;  2DE0 X;  3M9Q A;  3A8M B;  2MOX A;  1NJI U;  3LGL A;  3M59 A;  4GBQ A;  4E7L A;  5CK9 A;  4XTY A;  2EYX A;  5KCO A;  4V2S A;  2Y4Y A;  1M3B A;  1RAH B;  1X6O A;  2E5Q A;  3HHT B;  2DL5 A;  4C92 E;  3CCL T;  3UA6 A;  2E3H A;  4FYV B;  2A3L A;  3M55 A;  5KE2 A;  3S3N A;  3EG1 A;  3M0U A;  3H8Z A;  2E12 A;  3CMA T;  4N0A C;  5FU7 C;  4D8D A;  2CSI A;  5FU7 B;  3RR6 A;  1T0J A;  4YTL A;  4EDU A;  3VS5 A;  1RI0 A;  4QVC A;  2QA4 Q;  2I0N A;  2G3R A;  2IIM A;  5D6X A;  4M7A C;  3OY9 A;  3OYI A;  4M7A B;  3RDV A;  4FT2 A;  1VQP Q;  2EYY A;  2OAU A;  2LVM A;  4AFU C;  2JTE A;  1M2O A;  1VQ7 Q;  4E2F B;  2ROT A;  2MK5 A;  3ZL7 C;  3G6E T;  4KRT A;  3MEA A;  1M8M A;  2PU9 B;  2L0A A;  4M78 G;  1AT1 B;  2JMA A;  2AHJ B;  2AKL A;  1M1K U;  4RTY A;  1SPK A;  5CKB A;  4EPC A;  1SSF A;  4JRP A;  1W2B P;  5GAN 4;  2OTJ Q;  4M75 C;  1BIB A;  4Z8A A;  2BE9 B;  1HJD A;  4M75 B;  1E6H A;  2BZX A;  2OX7 A;  1WNL A;  4XAX B;  5LJ3 j;  3M54 A;  2M16 A;  4XTU A;  2YT6 A;  1VQ4 A;  3ME9 A;  5IXF A;  4M77 E;  1Y7X A;  1AZG B;  4M4Z A;  1JU5 C;  4RTX A;  4M78 F;  4C0D C;  2LTO A;  5D6Y A;  2HMA A;  1BI0 A;  1PC0 A;  2QAS A;  2RMO A;  2SRC A;  4C0D B;  4E7I A;  2J6O A;  4N0A A;  4RTV A;  4CC3 A;  2EKH A;  2DFU A;  4BD3 A;  1PSE A;  3JCM Q;  2K3Y A;  2FZG B;  4AFQ C;  2B8A A;  3HFO A;  4C8Q E;  1W70 A;  2JVV A;  3EH2 A;  1YIJ Q;  2NUP B;  2L3Q A;  1X2K A;  1RAA B;  2QYZ A;  2H8H A;  4M7A A;  5HK3 A;  4CRI A;  1K73 U;  2DJQ A;  2KK4 A;  2YWW A;  1GFD A;  1Q81 U;  1QLY A;  4OB0 B;  2RJC A;  5I2M A;  1G3Y A;  4A4H A;  4M7D D;  1YIT Q;  3R6N A;  1U1T A;  3ER0 A;  5CAI A;  3EG2 A;  3CME A;  2J7I A;  1GL5 A;  1K0X A;  2RO0 A;  5GAO m;  4BI4 A;  1KC8 R;  1VQK Q;  2JJ9 A;  2ROL A;  4C0F A;  1N8R U;  2QTV A;  3HL8 A;  5CR2 A;  1ZA1 B;  3CCJ Q;  3Q1J A;  2P0Q A;  4HT9 A;  1N27 A;  2K3X A;  3KFV A;  3CCV T;  1WXB A;  1U3O A;  1QP2 A;  2EAY A;  4M75 A;  1Q82 U;  1XOV A;  3SB2 A;  3NTI A;  5CQY A;  2DPP B;  3HKS A;  5IHN A;  4IIM A;  5I2S A;  4HCC A;  3EFO B;  3JCM P;  2EWN A;  2OTL Q;  1JO8 A;  1Q86 U;  1NM7 A;  1X69 A;  4MZP A;  2KQW A;  3C95 A;  1E6G A;  1T3S A;  1VQL A;  2Y4X A;  1OQK A;  2DA9 A;  1PCX A;  3LGF A;  2KNB B;  2K4Y A;  1RI9 A;  4DEY A;  2J6K A;  1VIF A;  3OMC A;  2DO3 A;  4ANJ A;  2NUP A;  2F1L A;  2HQX A;  2QQA A;  1K9M R;  1YCS B;  4JRK A;  1SRM A;  4LDY A;  1OYX A;  3GP8 A;  5GAN e;  4ZTF A;  4OVA A;  3VS7 A;  3GF5 A;  4F14 A;  2K5F A;  1G83 A;  2XKO C;  1K9M C;  3RER A;  3CCE Q;  4M78 C;  5FRO A;  3EG9 B;  3NFC A;  4ZGJ B;  1A0N B;  3QXE B;  1TUG B;  2MWP A;  3PVQ A;  2LX9 A;  5LJ5 f;  4OB3 B;  2WSF E;  2YUQ A;  3AT1 B;  1X75 C;  1J3T A;  2DL3 A;  3OSV A;  4PLI A;  1YJ9 A;  1SRL A;  5L8R E;  4Q5W A;  2FO0 A;  1IGU A;  4D8K A;  3VU3 C;  2FZC B;  4LN2 A;  2VWF A;  4OP0 A;  2RK1 A;  2MPX C;  4KUD K;  4E7K A;  3JCM X;  3CEY A;  2CP5 A;  2RF0 A;  1VQM T;  2CP7 A;  3EFO A;  1AZE A;  3L2Z A;  1B34 B;  2RI5 A;  2E41 A;  2ZGW A;  3VV0 A;  4OMQ A;  5CCA A;  2VGM A;  2X4J A;  1U5S A;  3HPW A;  1KQS P;  2LJ1 A;  2RI3 A;  2CZ0 B;  1VQ8 Q;  2COY A;  3A8L B;  4PJJ A;  3ASK A;  1HSQ A;  3G71 T;  3VS2 A;  2QQB A;  1SKU B;  3JRZ A;  1EX4 A;  2IPO B;  1RLQ C;  2KBT A;  2RQR A;  1EIF A;  1YI2 T;  2CZ1 B;  4PJM A;  3RKX A;  2WSE E;  5GAM g;  2MF2 A;  2C0I A;  2QTX A;  3GIB A;  2ZPH B;  3JAM E;  2PVD B;  1RAE B;  3JCM c;  3FRN A;  4B9W A;  3EG9 A;  1I0C A;  1RAI B;  3NPF A;  2JT4 A;  4ATO A;  1CKA A;  4K11 A;  3VUZ A;  4BI8 B;  2ZPI B;  3JCM e;  3RUX A;  2EYW A;  4J83 A;  1QCF A;  1S72 A;  1UEC A;  3A5Z B;  3QZ5 B;  3CCS A;  1UE9 A;  4HKE A;  2FG0 A;  1Y0M A;  1VQ9 T;  1QMC A;  1YCY A;  2LCC A;  3CC2 T;  5IN1 A;  3R6O A;  1M8V A;  4O5V A;  5GAN f;  4QKU A;  3V7S A;  4A4G A;  2HQH A;  3SD4 A;  4LDX A;  4X34 A;  1B34 A; 
#chains in the Genus database with same CATH homology
 4Z88 A;  1PWT A;  1NLO C;  2ABL A;  1SHG A;  2G6F X;  4RUG A;  2XMF A;  3VRZ A;  3JV3 A;  2RQV A;  1WA7 A;  1RLP C;  2EYZ A;  1TUC A;  4AFS C;  3NGP A;  4IIO A;  2B86 A;  3UAT A;  1NEG A;  1QWF A;  2EW3 A;  2JS0 A;  3EG0 A;  2KT1 A;  2LQN A;  1Z9Z A;  1WYX A;  2J05 A;  1YWP A;  1HD3 A;  2DYB A;  4Z89 A;  2YDL A;  2KRS A;  3VS3 A;  2K7A A;  1WXT A;  2DRK A;  1ARK A;  2M0Y A;  1M3A A;  1ZUU A;  2GBQ A;  2FPF A;  2KR3 A;  2M51 A;  4JJD A;  1TG0 A;  1KSW A;  1WXU A;  2PTK A;  2FRW A;  4OML A;  2DNU A;  1T0H A;  4F17 A;  1OV3 A;  1I07 A;  4JZ3 A;  2ESW A;  1W1F A;  3A98 A;  2DLP A;  4J9B A;  4LUD A;  4HCK A;  2O9V A;  2EBP A;  1ZUY A;  1ZSG A;  2JS2 A;  2NWM A;  1H8K A;  1ZLM A;  2CT4 A;  3EHQ A;  1BK2 A;  2K9G A;  1FMK A;  4CC2 A;  1T3L A;  2F2V A;  1UHC A;  3EGU A;  3LH5 A;  4AG2 C;  1GFC A;  2LJ0 A;  2D0N A;  2GTO A;  1RUW A;  1PKT A;  2SEM A;  1VYT A;  2A08 A;  1QKW A;  4JJB A;  2EQI A;  4GLM A;  2OJ2 A;  3GBQ A;  4RTW A;  2FPD A;  1YNZ A;  3I35 A;  1KJW A;  3QWY A;  4R0K A;  4AFZ C;  3EHR A;  4OMN A;  1BB9 A;  1SSH A;  4QT7 A;  2A28 A;  1X6G A;  2ECZ A;  1OPK A;  1G2B A;  4HVW A;  1WIE A;  2DE0 X;  2MOX A;  3H41 A;  2AKK A;  3PVL A;  4CC7 A;  1UHF A;  1H3H A;  4GBQ A;  4J9F A;  2DM1 A;  2EYX A;  2JXB A;  2K6D A;  1UGV A;  1VYV A;  4ESR A;  1M3B A;  2KRM A;  4A63 B;  2DL5 A;  3UA6 A;  1GBQ A;  3IQL A;  3EG1 A;  1ZUK A;  1EFN A;  1Z9Q A;  3M0U A;  1ABO A;  1V1C A;  3REA B;  4D8D A;  1PRM C;  2CSI A;  1K4U S;  1WX6 A;  1UDL A;  1T0J A;  4Y92 A;  3VS5 A;  1N5Z A;  2I0N A;  2IIM A;  2D1X A;  2HDA A;  2O31 A;  3UF4 A;  2DRM A;  2RPN A;  1KFZ A;  2EYY A;  3H0I A;  1AVZ C;  2KT8 A;  4LE9 A;  1ZX6 A;  2W10 A;  4AFU C;  2JTE A;  2A37 A;  2RN8 A;  3THK A;  1S1N A;  4J9G A;  1NLP C;  2QDL A;  1UG1 A;  4FSS A;  2ROT A;  5IHK A;  2OAW A;  3ZL7 C;  2AZS A;  4KRT A;  2DL4 A;  1M8M A;  2P4R A;  2EGC A;  2L0A A;  2KGT A;  1NYF A;  1MUZ A;  2JMA A;  1OOT A;  2AKL A;  3REB B;  4J9E A;  4RTY A;  1SPK A;  2DMO A;  2CT3 A;  1B07 A;  1IO6 A;  2PNI A;  1I1J A;  2OI3 A;  3M0P A;  2JW4 A;  3M0T A;  4DEX A;  3NHN A;  5FWC A;  4Z8A A;  1K1Z A;  1QKX A;  3EG3 A;  5ECA A;  1X2Q A;  1HJD A;  1K9A A;  1E6H A;  2BZX A;  2LMJ A;  1X6B A;  3NMZ C;  1JQQ A;  2RQW A;  3SEM A;  1U06 A;  2F2X A;  1VYU A;  4J9D A;  1UFF A;  2A36 A;  2YT6 A;  3TSZ A;  5IXF A;  3M0S A;  1AZG B;  2K3B A;  2CUD A;  1YN8 A;  4M4Z A;  1JU5 C;  2DX1 A;  4RTX A;  1PNJ A;  2RMO A;  2LQW A;  2SRC A;  4HVU A;  2J6O A;  1FYN A;  4RTV A;  3CQT A;  4CC3 A;  2EKH A;  5GJW B;  1NG2 A;  1X27 A;  2AZV A;  2J6F A;  3I9Q A;  4AFQ C;  1X43 A;  2ENM A;  1W70 A;  2KYM A;  2LZ6 B;  2L3Q A;  1X2K A;  1AWJ A;  2H8H A;  2ED0 A;  4JJC A;  2EGA A;  1AWO A;  1BU1 A;  2DJQ A;  3U23 A;  1PRL C;  1GFD A;  5EC7 A;  1QLY A;  1WDX A;  1M3C A;  4F16 A;  5IHI A;  3R6N A;  3EG2 A;  2KXD A;  2J7I A;  3I5R A;  3M0Q A;  1GL5 A;  1K0X A;  2LCS A;  2C0O A;  2V1Q A;  2BZ8 A;  2CDT A;  2ROL A;  1ZBJ A;  3RNJ A;  5IXB A;  2GQI A;  2L3P A;  2D8J A;  2EVR A;  3ULR B;  1Y57 A;  2CSQ A;  4X1V A;  3H0F A;  3KFV A;  4J9I A;  1WXB A;  1U3O A;  2RNA A;  4LUE A;  1GCQ C;  1JEG A;  1MV3 A;  2EGE A;  1JXM A;  3VS4 A;  2KEA A;  2RQU A;  2MIO A;  2KRN A;  1XOV A;  1AD5 A;  2KE9 A;  1WFW A;  5I11 A;  5IHN A;  2JM9 A;  4IIM A;  2DVJ A;  2KRO A;  2C0T A;  4JZ4 A;  5FW9 A;  2GNC A;  1JO8 A;  1CKB A;  1UUE A;  1NM7 A;  1X69 A;  1LCK A;  1E6G A;  1T3S A;  1B3Q A;  3VRY A;  2DA9 A;  4AG1 C;  3H0H A;  2KNB B;  2YUO A;  2EPD A;  1AOJ A;  1AWX A;  3QWX X;  1BBZ A;  3VS6 A;  4EIK A;  5GJV B;  1RI9 A;  1JXO A;  2X3W D;  4DEY A;  2J6K A;  5I22 A;  1SHF A;  1M30 A;  1UJY A;  1YCS B;  1SRM A;  2KXC A;  1PHT A;  2YUN A;  3VS7 A;  4F14 A;  5FWB A;  2HEQ A;  2D8H A;  1WLP B;  1G83 A;  2VVK A;  4ORZ A;  1H92 A;  3TVT A;  2LNH B;  2YSQ A;  1OEB A;  1A0N B;  1TUD A;  2AK5 A;  3PVQ A;  2LX7 A;  1GBR A;  1ABQ A;  2YUQ A;  2E5K A;  2ED1 A;  2FEI A;  4RTU A;  2DF6 A;  1GRI A;  4HVV A;  1NEB A;  1J3T A;  1CSK A;  2DL3 A;  3FJ5 A;  2CH4 W;  2FPE A;  2X3X D;  1AWW A;  1SRL A;  2DBM A;  2FO0 A;  1PKS A;  4ZNX A;  2LJ3 A;  2GGR A;  4D8K A;  2K79 A;  3VS1 A;  3C0C A;  2HBW A;  4LN2 A;  4RTT A;  5IH2 A;  2VWF A;  3TSW A;  3O5Z A;  1K0S A;  2JMC A;  2CUB A;  2K2M A;  1SEM A;  1GCQ A;  1GCP A;  1W6X A;  2O88 A;  2O9S A;  2RF0 A;  4OMP A;  1YP5 A;  2MCN A;  1AZE A;  3M0R A;  2HSP A;  1NYG A;  2L2P A;  4OMQ A;  1K76 A;  3UA7 A;  2KYB A;  1U5S A;  2LJ1 A;  2LP5 A;  1HSQ A;  2PZ1 A;  2RQT A;  3VS2 A;  1RLQ C;  2BZY A;  2KBT A;  4J9C A;  2RQR A;  4CC4 B;  1E7O A;  2NUZ A;  2DBK A;  4HXJ A;  5HCK A;  2HCK A;  1M27 C;  3I5S A;  2C0I A;  4OMM A;  2L3S A;  1QWE A;  2DL7 A;  2VKN A;  1I0C A;  3NPF A;  3PE0 A;  2FRY A;  2JT4 A;  5L23 A;  2CRE A;  4J9H A;  1CKA A;  4RTZ A;  4K11 A;  2O2O A;  4LNP A;  1OPL A;  3VS0 A;  2JM8 A;  2W0Z A;  2YUP A;  2EYW A;  4OMO A;  1VA7 A;  1QCF A;  2DIL A;  1UEC A;  2V1R A;  4E6R A;  1UE9 A;  2FG0 A;  1Y0M A;  4WCI A;  1KIK A;  3SHW A;  2GTJ A;  4JPB W;  1YWO A;  1UTI A;  2DL8 A;  2J06 A;  1AEY A;  2CH4 A;  2BTT A;  2F2W A;  1MV0 B;  3RBB B;  1WI7 A;  1UJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...