3M19A

Crystal structure of variable lymphocyte receptor vlra.r5.1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
244
structure length
237
Chain Sequence
CETVTGCTCNEGKKEVDCQGKSLDSVPSGIPADTEKLDLQSTGLATLSDATFRGLTKLTWLNLDYNQLQTLSAGVFDDLTELGTLGLANNQLASLPLGVFDHLTQLDKLYLGGNQLKSLPSGVFDRLTKLKELRLNTNQLQSIPAGAFDKLTNLQTLSLSTNQLQSVPHGAFDRLGKLQTITLFGNQFDCSRCEILYLSQWIRENSNKVKDESPDGVTCSDGKVVRTVTNETLKYEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor A diversity region
publication title A structural basis for antigen recognition by the T cell-like lymphocytes of sea lamprey.
pubmed doi rcsb
source organism Petromyzon marinus
molecule tags Immune system
total genus 75
structure length 237
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3m19A00
3WPDA 5GMHA 4Q3IA 5HZLB 3REZA 2P1QB 3RJ0A 1WWLA 4K17A 2UZYA 4KNGA 4RWTC 1OGQA 1KOOA 3RW7A 2ELLA 2P1PB 1P8TA 4LI1A 3KJ4A 4P91A 2A0ZA 4PEQB 1P8VA 1P9AG 3W3JA 2OMYA 2ASSB 4LSCA 4C2AB 3O6NA 4Y61B 4RCWA 3ZYNA 4LSXA 4AW4A 2WQWA 3RIZA 4LXRA 3FXIA 4PSJA 1LTXA 5AWAA 4CC4C 4R6AA 3GOZA 1K5DC 5CMNA 4TZHA 2Z65A 5IJBA 2WFHA 5D3IA 5A5CA 4FDWA 3RGZA 4Q62A 4V2DA 4MN8B 4ECOA 3W3MA 1DS9A 4R6GA 2P1NB 1D0BA 3WPFA 4B8CD 2WQVA 3RFSA 3UL9A 4BSUA 3PMHG 4Z61C 3W3GA 4U7LA 3W3NA 2JE0A 3UL7A 5AWBA 1U0ND 4NKGA 3WPIA 1OOKG 4LXSA 4OQTA 1KOHA 3G39A 4R09A 4HQ1A 5B0NA 4XOSA 3WN4A 1OTMA 4ECNA 2RA8A 3A79B 3RFJA 4R6JA 4L3AA 4V2CA 4PKIG 4U06A 1M9SA 4H09A 1M10B 2R9UA 4R0AA 1XCDA 2P1OB 2O6QA 4R58A 1A4YA 3ULUA 3M19A 4CNMA 1SQ0B 4R5DA 3CIYA 3TSRE 4CNCA 4KXFB 1IO0A 4G8AA 2UZXA 3G06A 5B0TA 3OGLB 1ZIWA 2Z7XA 2BEXA 4FD0A 5AWDA 4CC4A 2Q4GW 4XSQA 2Z62A 4CP6A 1DCEA 4QBZA 4QXEA 4Z8GA 2O6RA 3WPEA 1K5GC 1XEUA 4I6JB 3JB9j 3SB4A 3E3ZA 2OMVA 3M18A 5CMPA 4Q3GA 4QC0A 5GS0A 3OGMB 2WQXA 1M0ZA 2IFGA 1A9NA 2BNHA 4GLPA 1W8AA 4RCAB 2OMWA 3RGXA 2OMTA 3WPCA 3RFEA 1YRGA 5GS2B 4J0MA 5IJCA 2O6SA 5AZ5A 3E4GA 4UFRA 4M7EC 4FS7A 4LI2A 1XKUA 3E6JA 4NKHA 4EZGA 3WPGA 3G3AA 2Z63A 3CVRA 2Z64A 3G3BA 2P1MB 4R5CA 4IM6A 1OTOA 4P8SA 3WPHA 3O53A 4FHOA 3P72A 1XECA 3UL8A 4U08A 3E2JA 5IYXC 5HDHA 2XWTC 5GQRK 3ZYOA 5B4PA 4PERA 2Z81A 3CIGA 2Z7XB 2XOTA 3OGKB 3ULVA 4R08A 3UN9A 4Z64C 2ID5A 1G9UA 3ZYJA 1OTNA 4Z79A 4BSSA 4R6FA 1FS2A 4MQWX 4AY9X 3RW6A 2V9SA 1FQVA 5GMGA 1FT8A 1FO1A 4BSRA 3C6NB 3VQ1A 2Z82A 2V9TB 3VQ2A 4ARNA 3ZYIA 2CA6A 2WQUA 3OJAB 3BZ5A 4LSXC 1H6TA 4KT1A 5IJDA 1H6UA 2RR6A 2JE1A 4WP6A 3DZEA 2FT3A 3OJAA 3ULAA 4J4LA 1QYYA 1M9LA 2V70A 2Z66A 4M7EA 2OMUA 3C6OB 2JQDA 2ASTB 5AWCA 1O6TA 5GMFA 1OZNA 4GT6A 4V2EA 2Y5QA 4FMZA 4U09A 4ARRA 4R07A 4BV4R 4FCGA 4PQ8A 1PGVA 5FTTB 1O6SA 1GWBA 3W3LA 1JL5A 3W3KA 1O6VA 5LFNA 3WPBA 2OMZA 4C2BB 3C6PB 4WYKA 3G04C 1Z7XW 4YEBB 4LSAA 4L3FA 2OMXA 4CILA 4Z94G 1DFJI 1XWDC 4XGOA
chains in the Genus database with same CATH superfamily
3WPDA 5GMHA 4Q3IA 5HZLB 3REZA 2P1QB 3RJ0A 1WWLA 4K17A 2UZYA 4KNGA 4RWTC 1OGQA 1KOOA 3RW7A 2ELLA 2P1PB 1P8TA 4LI1A 3KJ4A 4P91A 2A0ZA 4PEQB 1P8VA 1P9AG 3W3JA 2OMYA 2ASSB 4LSCA 4C2AB 3O6NA 4Y61B 4RCWA 3ZYNA 4LSXA 4AW4A 2WQWA 3RIZA 4LXRA 3FXIA 4PSJA 1LTXA 5AWAA 4CC4C 4R6AA 3GOZA 1K5DC 5CMNA 4TZHA 2Z65A 5IJBA 2WFHA 5D3IA 5A5CA 4FDWA 3RGZA 4Q62A 4V2DA 4MN8B 4ECOA 3W3MA 1DS9A 4R6GA 2P1NB 1D0BA 3WPFA 4B8CD 2WQVA 3RFSA 3UL9A 4BSUA 3PMHG 4Z61C 4NZTM 3W3GA 4U7LA 3W3NA 2JE0A 3UL7A 5AWBA 1U0ND 4NKGA 3WPIA 1OOKG 4LXSA 4OQTA 1KOHA 3G39A 4R09A 4HQ1A 5B0NA 4XOSA 3WN4A 1OTMA 4ECNA 2RA8A 3A79B 3RFJA 4R6JA 4L3AA 4V2CA 4PKIG 4U06A 1M9SA 4H09A 1M10B 2R9UA 4R0AA 1XCDA 2P1OB 2O6QA 4R58A 1A4YA 3ULUA 3M19A 4CNMA 1SQ0B 4R5DA 3CIYA 3TSRE 4CNCA 4KXFB 1IO0A 4G8AA 2UZXA 3G06A 5B0TA 3OGLB 1ZIWA 2Z7XA 2BEXA 4FD0A 5AWDA 4CC4A 2Q4GW 4XSQA 2Z62A 4CP6A 1DCEA 4QBZA 4QXEA 4Z8GA 2O6RA 3WPEA 1K5GC 1XEUA 4I6JB 3JB9j 3SB4A 3E3ZA 2OMVA 3M18A 5CMPA 4Q3GA 4QC0A 5GS0A 3OGMB 2WQXA 1M0ZA 2IFGA 1A9NA 2BNHA 4GLPA 1W8AA 4RCAB 2OMWA 3RGXA 2OMTA 3WPCA 3RFEA 1YRGA 5GS2B 4J0MA 5IJCA 2O6SA 5AZ5A 3E4GA 4UFRA 4M7EC 4FS7A 4LI2A 1XKUA 3E6JA 4NKHA 4EZGA 3WPGA 3G3AA 2Z63A 3CVRA 2Z64A 3G3BA 2P1MB 4R5CA 4IM6A 1OTOA 4P8SA 3WPHA 3O53A 4FHOA 3P72A 1XECA 3UL8A 4U08A 3E2JA 5IYXC 5HDHA 2XWTC 5GQRK 3ZYOA 5B4PA 4PERA 2Z81A 3CIGA 2Z7XB 2XOTA 3OGKB 3ULVA 4R08A 3UN9A 4Z64C 2ID5A 1G9UA 3ZYJA 1OTNA 4Z79A 4BSSA 4R6FA 1FS2A 4MQWX 4AY9X 3RW6A 2V9SA 1FQVA 5GMGA 1FT8A 1FO1A 4BSRA 3C6NB 3VQ1A 2Z82A 4NZRM 2V9TB 3VQ2A 4ARNA 3ZYIA 2CA6A 2WQUA 3OJAB 3BZ5A 4LSXC 1H6TA 4KT1A 5IJDA 1H6UA 2RR6A 2JE1A 4WP6A 3DZEA 2FT3A 3OJAA 3ULAA 4J4LA 1QYYA 1M9LA 2V70A 2Z66A 4M7EA 2OMUA 3C6OB 2JQDA 2ASTB 5AWCA 1O6TA 5GMFA 1OZNA 4GT6A 4V2EA 2Y5QA 4FMZA 4U09A 4ARRA 4R07A 4BV4R 4FCGA 4PQ8A 1PGVA 5FTTB 1O6SA 1GWBA 3W3LA 1JL5A 3W3KA 1O6VA 5LFNA 3WPBA 2OMZA 4C2BB 3C6PB 4WYKA 3G04C 1Z7XW 4YEBB 4LSAA 4L3FA 2OMXA 4CILA 4Z94G 1DFJI 1XWDC 4XGOA
chains in the Genus database with same CATH topology
3WPDA 5GMHA 4Q3IA 5HZLB 3REZA 2P1QB 3RJ0A 1WWLA 4K17A 2UZYA 4KNGA 4RWTC 1OGQA 1KOOA 3RW7A 2ELLA 2P1PB 1P8TA 4LI1A 3KJ4A 4P91A 2A0ZA 4PEQB 1P8VA 1P9AG 3W3JA 2OMYA 2ASSB 4LSCA 4C2AB 3O6NA 4Y61B 4RCWA 3ZYNA 4LSXA 4AW4A 2WQWA 3RIZA 4LXRA 3FXIA 4PSJA 1LTXA 5AWAA 4CC4C 4R6AA 3GOZA 1K5DC 5CMNA 4TZHA 2Z65A 5IJBA 2WFHA 5D3IA 5A5CA 4FDWA 3RGZA 4Q62A 4V2DA 4MN8B 4ECOA 3W3MA 1DS9A 4R6GA 2P1NB 1D0BA 3WPFA 4B8CD 2WQVA 3RFSA 3UL9A 4BSUA 3PMHG 4Z61C 3W3GA 4U7LA 3W3NA 2JE0A 3UL7A 5AWBA 1U0ND 4NKGA 3WPIA 1OOKG 4LXSA 4OQTA 1KOHA 3G39A 4R09A 4HQ1A 5B0NA 4XOSA 3WN4A 1OTMA 4ECNA 2RA8A 3A79B 3RFJA 4R6JA 4L3AA 4V2CA 4PKIG 4U06A 1M9SA 4H09A 1M10B 2R9UA 4R0AA 1XCDA 2P1OB 2O6QA 4R58A 1A4YA 3ULUA 3M19A 4CNMA 1SQ0B 4R5DA 3CIYA 3TSRE 4CNCA 4KXFB 1IO0A 4G8AA 2UZXA 3G06A 5B0TA 3OGLB 1ZIWA 2Z7XA 2BEXA 4FD0A 5AWDA 4CC4A 2Q4GW 4XSQA 2Z62A 4CP6A 1DCEA 4QBZA 4QXEA 4Z8GA 2O6RA 3WPEA 1K5GC 1XEUA 4I6JB 3JB9j 3SB4A 3E3ZA 2OMVA 3M18A 5CMPA 4Q3GA 4QC0A 5GS0A 3OGMB 2WQXA 1M0ZA 2IFGA 1A9NA 2BNHA 4GLPA 1W8AA 4RCAB 2OMWA 3RGXA 2OMTA 3WPCA 3RFEA 1YRGA 5GS2B 4J0MA 5IJCA 2O6SA 5AZ5A 3E4GA 4UFRA 4M7EC 4FS7A 4LI2A 1XKUA 3E6JA 4NKHA 4EZGA 3WPGA 3G3AA 2Z63A 3CVRA 2Z64A 3G3BA 2P1MB 4R5CA 4IM6A 1OTOA 4P8SA 3WPHA 3O53A 4FHOA 3P72A 1XECA 3UL8A 4U08A 3E2JA 5IYXC 5HDHA 2XWTC 5GQRK 3ZYOA 5B4PA 4PERA 2Z81A 3CIGA 2Z7XB 2XOTA 3OGKB 3ULVA 4R08A 3UN9A 4Z64C 2ID5A 1G9UA 3ZYJA 1OTNA 4Z79A 4BSSA 4R6FA 1FS2A 4MQWX 4AY9X 3RW6A 2V9SA 1FQVA 5GMGA 1FT8A 1FO1A 4BSRA 3C6NB 3VQ1A 2Z82A 2V9TB 3VQ2A 4ARNA 3ZYIA 2CA6A 2WQUA 3OJAB 3BZ5A 4LSXC 1H6TA 4KT1A 5IJDA 1H6UA 2RR6A 2JE1A 4WP6A 3DZEA 2FT3A 3OJAA 3ULAA 4J4LA 1QYYA 1M9LA 2V70A 2Z66A 4M7EA 2OMUA 3C6OB 2JQDA 2ASTB 5AWCA 1O6TA 5GMFA 1OZNA 4GT6A 4V2EA 2Y5QA 4FMZA 4U09A 4ARRA 4R07A 4BV4R 4FCGA 4PQ8A 1PGVA 5FTTB 1O6SA 1GWBA 3W3LA 1JL5A 3W3KA 1O6VA 5LFNA 3WPBA 2OMZA 4C2BB 3C6PB 4WYKA 3G04C 1Z7XW 4YEBB 4LSAA 4L3FA 2OMXA 4CILA 4Z94G 1DFJI 1XWDC 4XGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPD A;  5GMH A;  4Q3I A;  5HZL B;  3REZ A;  2P1Q B;  3RJ0 A;  1WWL A;  4K17 A;  2UZY A;  4KNG A;  4RWT C;  1OGQ A;  1KOO A;  3RW7 A;  2ELL A;  2P1P B;  1P8T A;  4LI1 A;  3KJ4 A;  4P91 A;  2A0Z A;  4PEQ B;  1P8V A;  1P9A G;  3W3J A;  2OMY A;  2ASS B;  4LSC A;  4C2A B;  3O6N A;  4Y61 B;  4RCW A;  3ZYN A;  4LSX A;  4AW4 A;  2WQW A;  3RIZ A;  4LXR A;  3FXI A;  4PSJ A;  1LTX A;  5AWA A;  4CC4 C;  4R6A A;  3GOZ A;  1K5D C;  5CMN A;  4TZH A;  2Z65 A;  5IJB A;  2WFH A;  5D3I A;  5A5C A;  4FDW A;  3RGZ A;  4Q62 A;  4V2D A;  4MN8 B;  4ECO A;  3W3M A;  1DS9 A;  4R6G A;  2P1N B;  1D0B A;  3WPF A;  4B8C D;  2WQV A;  3RFS A;  3UL9 A;  4BSU A;  3PMH G;  4Z61 C;  3W3G A;  4U7L A;  3W3N A;  2JE0 A;  3UL7 A;  5AWB A;  1U0N D;  4NKG A;  3WPI A;  1OOK G;  4LXS A;  4OQT A;  1KOH A;  3G39 A;  4R09 A;  4HQ1 A;  5B0N A;  4XOS A;  3WN4 A;  1OTM A;  4ECN A;  2RA8 A;  3A79 B;  3RFJ A;  4R6J A;  4L3A A;  4V2C A;  4PKI G;  4U06 A;  1M9S A;  4H09 A;  1M10 B;  2R9U A;  4R0A A;  1XCD A;  2P1O B;  2O6Q A;  4R58 A;  1A4Y A;  3ULU A;  3M19 A;  4CNM A;  1SQ0 B;  4R5D A;  3CIY A;  3TSR E;  4CNC A;  4KXF B;  1IO0 A;  4G8A A;  2UZX A;  3G06 A;  5B0T A;  3OGL B;  1ZIW A;  2Z7X A;  2BEX A;  4FD0 A;  5AWD A;  4CC4 A;  2Q4G W;  4XSQ A;  2Z62 A;  4CP6 A;  1DCE A;  4QBZ A;  4QXE A;  4Z8G A;  2O6R A;  3WPE A;  1K5G C;  1XEU A;  4I6J B;  3JB9 j;  3SB4 A;  3E3Z A;  2OMV A;  3M18 A;  5CMP A;  4Q3G A;  4QC0 A;  5GS0 A;  3OGM B;  2WQX A;  1M0Z A;  2IFG A;  1A9N A;  2BNH A;  4GLP A;  1W8A A;  4RCA B;  2OMW A;  3RGX A;  2OMT A;  3WPC A;  3RFE A;  1YRG A;  5GS2 B;  4J0M A;  5IJC A;  2O6S A;  5AZ5 A;  3E4G A;  4UFR A;  4M7E C;  4FS7 A;  4LI2 A;  1XKU A;  3E6J A;  4NKH A;  4EZG A;  3WPG A;  3G3A A;  2Z63 A;  3CVR A;  2Z64 A;  3G3B A;  2P1M B;  4R5C A;  4IM6 A;  1OTO A;  4P8S A;  3WPH A;  3O53 A;  4FHO A;  3P72 A;  1XEC A;  3UL8 A;  4U08 A;  3E2J A;  5IYX C;  5HDH A;  2XWT C;  5GQR K;  3ZYO A;  5B4P A;  4PER A;  2Z81 A;  3CIG A;  2Z7X B;  2XOT A;  3OGK B;  3ULV A;  4R08 A;  3UN9 A;  4Z64 C;  2ID5 A;  1G9U A;  3ZYJ A;  1OTN A;  4Z79 A;  4BSS A;  4R6F A;  1FS2 A;  4MQW X;  4AY9 X;  3RW6 A;  2V9S A;  1FQV A;  5GMG A;  1FT8 A;  1FO1 A;  4BSR A;  3C6N B;  3VQ1 A;  2Z82 A;  2V9T B;  3VQ2 A;  4ARN A;  3ZYI A;  2CA6 A;  2WQU A;  3OJA B;  3BZ5 A;  4LSX C;  1H6T A;  4KT1 A;  5IJD A;  1H6U A;  2RR6 A;  2JE1 A;  4WP6 A;  3DZE A;  2FT3 A;  3OJA A;  3ULA A;  4J4L A;  1QYY A;  1M9L A;  2V70 A;  2Z66 A;  4M7E A;  2OMU A;  3C6O B;  2JQD A;  2AST B;  5AWC A;  1O6T A;  5GMF A;  1OZN A;  4GT6 A;  4V2E A;  2Y5Q A;  4FMZ A;  4U09 A;  4ARR A;  4R07 A;  4BV4 R;  4FCG A;  4PQ8 A;  1PGV A;  5FTT B;  1O6S A;  1GWB A;  3W3L A;  1JL5 A;  3W3K A;  1O6V A;  5LFN A;  3WPB A;  2OMZ A;  4C2B B;  3C6P B;  4WYK A;  3G04 C;  1Z7X W;  4YEB B;  4LSA A;  4L3F A;  2OMX A;  4CIL A;  4Z94 G;  1DFJ I;  1XWD C;  4XGO A; 
#chains in the Genus database with same CATH topology
 3WPD A;  5GMH A;  4Q3I A;  5HZL B;  3REZ A;  2P1Q B;  3RJ0 A;  1WWL A;  4K17 A;  2UZY A;  4KNG A;  4RWT C;  1OGQ A;  1KOO A;  3RW7 A;  2ELL A;  2P1P B;  1P8T A;  4LI1 A;  3KJ4 A;  4P91 A;  2A0Z A;  4PEQ B;  1P8V A;  1P9A G;  3W3J A;  2OMY A;  2ASS B;  4LSC A;  4C2A B;  3O6N A;  4Y61 B;  4RCW A;  3ZYN A;  4LSX A;  4AW4 A;  2WQW A;  3RIZ A;  4LXR A;  3FXI A;  4PSJ A;  1LTX A;  5AWA A;  4CC4 C;  4R6A A;  3GOZ A;  1K5D C;  5CMN A;  4TZH A;  2Z65 A;  5IJB A;  2WFH A;  5D3I A;  5A5C A;  4FDW A;  3RGZ A;  4Q62 A;  4V2D A;  4MN8 B;  4ECO A;  3W3M A;  1DS9 A;  4R6G A;  2P1N B;  1D0B A;  3WPF A;  4B8C D;  2WQV A;  3RFS A;  3UL9 A;  4BSU A;  3PMH G;  4Z61 C;  4NZT M;  3W3G A;  4U7L A;  3W3N A;  2JE0 A;  3UL7 A;  5AWB A;  1U0N D;  4NKG A;  3WPI A;  1OOK G;  4LXS A;  4OQT A;  1KOH A;  3G39 A;  4R09 A;  4HQ1 A;  5B0N A;  4XOS A;  3WN4 A;  1OTM A;  4ECN A;  2RA8 A;  3A79 B;  3RFJ A;  4R6J A;  4L3A A;  4V2C A;  4PKI G;  4U06 A;  1M9S A;  4H09 A;  1M10 B;  2R9U A;  4R0A A;  1XCD A;  2P1O B;  2O6Q A;  4R58 A;  1A4Y A;  3ULU A;  3M19 A;  4CNM A;  1SQ0 B;  4R5D A;  3CIY A;  3TSR E;  4CNC A;  4KXF B;  1IO0 A;  4G8A A;  2UZX A;  3G06 A;  5B0T A;  3OGL B;  1ZIW A;  2Z7X A;  2BEX A;  4FD0 A;  5AWD A;  4CC4 A;  2Q4G W;  4XSQ A;  2Z62 A;  4CP6 A;  1DCE A;  4QBZ A;  4QXE A;  4Z8G A;  2O6R A;  3WPE A;  1K5G C;  1XEU A;  4I6J B;  3JB9 j;  3SB4 A;  3E3Z A;  2OMV A;  3M18 A;  5CMP A;  4Q3G A;  4QC0 A;  5GS0 A;  3OGM B;  2WQX A;  1M0Z A;  2IFG A;  1A9N A;  2BNH A;  4GLP A;  1W8A A;  4RCA B;  2OMW A;  3RGX A;  2OMT A;  3WPC A;  3RFE A;  1YRG A;  5GS2 B;  4J0M A;  5IJC A;  2O6S A;  5AZ5 A;  3E4G A;  4UFR A;  4M7E C;  4FS7 A;  4LI2 A;  1XKU A;  3E6J A;  4NKH A;  4EZG A;  3WPG A;  3G3A A;  2Z63 A;  3CVR A;  2Z64 A;  3G3B A;  2P1M B;  4R5C A;  4IM6 A;  1OTO A;  4P8S A;  3WPH A;  3O53 A;  4FHO A;  3P72 A;  1XEC A;  3UL8 A;  4U08 A;  3E2J A;  5IYX C;  5HDH A;  2XWT C;  5GQR K;  3ZYO A;  5B4P A;  4PER A;  2Z81 A;  3CIG A;  2Z7X B;  2XOT A;  3OGK B;  3ULV A;  4R08 A;  3UN9 A;  4Z64 C;  2ID5 A;  1G9U A;  3ZYJ A;  1OTN A;  4Z79 A;  4BSS A;  4R6F A;  1FS2 A;  4MQW X;  4AY9 X;  3RW6 A;  2V9S A;  1FQV A;  5GMG A;  1FT8 A;  1FO1 A;  4BSR A;  3C6N B;  3VQ1 A;  2Z82 A;  4NZR M;  2V9T B;  3VQ2 A;  4ARN A;  3ZYI A;  2CA6 A;  2WQU A;  3OJA B;  3BZ5 A;  4LSX C;  1H6T A;  4KT1 A;  5IJD A;  1H6U A;  2RR6 A;  2JE1 A;  4WP6 A;  3DZE A;  2FT3 A;  3OJA A;  3ULA A;  4J4L A;  1QYY A;  1M9L A;  2V70 A;  2Z66 A;  4M7E A;  2OMU A;  3C6O B;  2JQD A;  2AST B;  5AWC A;  1O6T A;  5GMF A;  1OZN A;  4GT6 A;  4V2E A;  2Y5Q A;  4FMZ A;  4U09 A;  4ARR A;  4R07 A;  4BV4 R;  4FCG A;  4PQ8 A;  1PGV A;  5FTT B;  1O6S A;  1GWB A;  3W3L A;  1JL5 A;  3W3K A;  1O6V A;  5LFN A;  3WPB A;  2OMZ A;  4C2B B;  3C6P B;  4WYK A;  3G04 C;  1Z7X W;  4YEB B;  4LSA A;  4L3F A;  2OMX A;  4CIL A;  4Z94 G;  1DFJ I;  1XWD C;  4XGO A; 
#chains in the Genus database with same CATH homology
 3WPD A;  5GMH A;  4Q3I A;  5HZL B;  3REZ A;  2P1Q B;  3RJ0 A;  1WWL A;  4K17 A;  2UZY A;  4KNG A;  4RWT C;  1OGQ A;  1KOO A;  3RW7 A;  2ELL A;  2P1P B;  1P8T A;  4LI1 A;  3KJ4 A;  4P91 A;  2A0Z A;  4PEQ B;  1P8V A;  1P9A G;  3W3J A;  2OMY A;  2ASS B;  4LSC A;  4C2A B;  3O6N A;  4Y61 B;  4RCW A;  3ZYN A;  4LSX A;  4AW4 A;  2WQW A;  3RIZ A;  4LXR A;  3FXI A;  4PSJ A;  1LTX A;  5AWA A;  4CC4 C;  4R6A A;  3GOZ A;  1K5D C;  5CMN A;  4TZH A;  2Z65 A;  5IJB A;  2WFH A;  5D3I A;  5A5C A;  4FDW A;  3RGZ A;  4Q62 A;  4V2D A;  4MN8 B;  4ECO A;  3W3M A;  1DS9 A;  4R6G A;  2P1N B;  1D0B A;  3WPF A;  4B8C D;  2WQV A;  3RFS A;  3UL9 A;  4BSU A;  3PMH G;  4Z61 C;  3W3G A;  4U7L A;  3W3N A;  2JE0 A;  3UL7 A;  5AWB A;  1U0N D;  4NKG A;  3WPI A;  1OOK G;  4LXS A;  4OQT A;  1KOH A;  3G39 A;  4R09 A;  4HQ1 A;  5B0N A;  4XOS A;  3WN4 A;  1OTM A;  4ECN A;  2RA8 A;  3A79 B;  3RFJ A;  4R6J A;  4L3A A;  4V2C A;  4PKI G;  4U06 A;  1M9S A;  4H09 A;  1M10 B;  2R9U A;  4R0A A;  1XCD A;  2P1O B;  2O6Q A;  4R58 A;  1A4Y A;  3ULU A;  3M19 A;  4CNM A;  1SQ0 B;  4R5D A;  3CIY A;  3TSR E;  4CNC A;  4KXF B;  1IO0 A;  4G8A A;  2UZX A;  3G06 A;  5B0T A;  3OGL B;  1ZIW A;  2Z7X A;  2BEX A;  4FD0 A;  5AWD A;  4CC4 A;  2Q4G W;  4XSQ A;  2Z62 A;  4CP6 A;  1DCE A;  4QBZ A;  4QXE A;  4Z8G A;  2O6R A;  3WPE A;  1K5G C;  1XEU A;  4I6J B;  3JB9 j;  3SB4 A;  3E3Z A;  2OMV A;  3M18 A;  5CMP A;  4Q3G A;  4QC0 A;  5GS0 A;  3OGM B;  2WQX A;  1M0Z A;  2IFG A;  1A9N A;  2BNH A;  4GLP A;  1W8A A;  4RCA B;  2OMW A;  3RGX A;  2OMT A;  3WPC A;  3RFE A;  1YRG A;  5GS2 B;  4J0M A;  5IJC A;  2O6S A;  5AZ5 A;  3E4G A;  4UFR A;  4M7E C;  4FS7 A;  4LI2 A;  1XKU A;  3E6J A;  4NKH A;  4EZG A;  3WPG A;  3G3A A;  2Z63 A;  3CVR A;  2Z64 A;  3G3B A;  2P1M B;  4R5C A;  4IM6 A;  1OTO A;  4P8S A;  3WPH A;  3O53 A;  4FHO A;  3P72 A;  1XEC A;  3UL8 A;  4U08 A;  3E2J A;  5IYX C;  5HDH A;  2XWT C;  5GQR K;  3ZYO A;  5B4P A;  4PER A;  2Z81 A;  3CIG A;  2Z7X B;  2XOT A;  3OGK B;  3ULV A;  4R08 A;  3UN9 A;  4Z64 C;  2ID5 A;  1G9U A;  3ZYJ A;  1OTN A;  4Z79 A;  4BSS A;  4R6F A;  1FS2 A;  4MQW X;  4AY9 X;  3RW6 A;  2V9S A;  1FQV A;  5GMG A;  1FT8 A;  1FO1 A;  4BSR A;  3C6N B;  3VQ1 A;  2Z82 A;  2V9T B;  3VQ2 A;  4ARN A;  3ZYI A;  2CA6 A;  2WQU A;  3OJA B;  3BZ5 A;  4LSX C;  1H6T A;  4KT1 A;  5IJD A;  1H6U A;  2RR6 A;  2JE1 A;  4WP6 A;  3DZE A;  2FT3 A;  3OJA A;  3ULA A;  4J4L A;  1QYY A;  1M9L A;  2V70 A;  2Z66 A;  4M7E A;  2OMU A;  3C6O B;  2JQD A;  2AST B;  5AWC A;  1O6T A;  5GMF A;  1OZN A;  4GT6 A;  4V2E A;  2Y5Q A;  4FMZ A;  4U09 A;  4ARR A;  4R07 A;  4BV4 R;  4FCG A;  4PQ8 A;  1PGV A;  5FTT B;  1O6S A;  1GWB A;  3W3L A;  1JL5 A;  3W3K A;  1O6V A;  5LFN A;  3WPB A;  2OMZ A;  4C2B B;  3C6P B;  4WYK A;  3G04 C;  1Z7X W;  4YEB B;  4LSA A;  4L3F A;  2OMX A;  4CIL A;  4Z94 G;  1DFJ I;  1XWD C;  4XGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...