3M19A

Crystal structure of variable lymphocyte receptor vlra.r5.1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
244
structure length
237
Chain Sequence
b'CETVTGCTCNEGKKEVDCQGKSLDSVPSGIPADTEKLDLQSTGLATLSDATFRGLTKLTWLNLDYNQLQTLSAGVFDDLTELGTLGLANNQLASLPLGVFDHLTQLDKLYLGGNQLKSLPSGVFDRLTKLKELRLNTNQLQSIPAGAFDKLTNLQTLSLSTNQLQSVPHGAFDRLGKLQTITLFGNQFDCSRCEILYLSQWIRENSNKVKDESPDGVTCSDGKVVRTVTNETLKYEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor A diversity region
publication title A structural basis for antigen recognition by the T cell-like lymphocytes of sea lamprey.
pubmed doi rcsb
source organism Petromyzon marinus
molecule tags Immune system
total genus 75
structure length 237
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3m19A00
5B0TA 2P1MB 3RFEA 4Z64C 3CIYA 4MN8B 1JL5A 1M9SA 4L3FA 4FHOA 2Z65A 3W3GA 5B0NA 2ASTB 1OGQA 1DFJI 1SQ0B 3A79B 4KNGA 4FCGA 3W3LA 1FT8A 3M18A 1D0BA 2RR6A 5HDHA 4J4LA 5GS2B 1M9LA 3UL9A 1OTOA 4M7EA 5IJBA 1WWLA 3REZA 2WQXA 4L3AA 5GQRK 2WFHA 4FDWA 3ZYOA 3WPHA 4PKIG 2P1PB 4U09A 3ULUA 4EZGA 4U08A 2XWTC 3ZYNA 4R6FA 2OMUA 1FS2A 2BNHA 3ULVA 1XCDA 3UL7A 3RW6A 2WQVA 4ECNA 3WN4A 4CC4A 3VQ2A 5CMNA 4V2EA 3WPFA 4CILA 1FQVA 2V9TB 3O53A 5GMHA 1W8AA 4C2BB 4YEBB 3P72A 2Z64A 3G3BA 3E4GA 1A9NA 2JE0A 1M10B 2O6QA 1PGVA 1OOKG 4R6GA 4R5DA 5AWCA 4Z94G 3RJ0A 5IJDA 4Q62A 3W3MA 4Z61C 3RGZA 2RA8A 4XGOA 4PSJA 1LTXA 1G9UA 4CNMA 5D3IA 2Q4GW 3SB4A 2ASSB 4V2CA 3C6NB 1Z7XW 4QC0A 2R9UA 5FTTB 4GT6A 3W3NA 4Q3GA 4WP6A 4Z8GA 4RCAB 3CVRA 5LFNA 3OGLB 4V2DA 1XKUA 3UN9A 5GMFA 4FS7A 4AW4A 3CIGA 2P1QB 3BZ5A 1QYYA 4IM6A 3W3JA 2FT3A 3WPEA 1K5GC 3RIZA 4LSXC 3M19A 2JQDA 1XECA 3OGMB 4LSAA 2Z7XB 1FO1A 3WPCA 2P1NB 4WYKA 3DZEA 5B4PA 3RFJA 3WPGA 4KXFB 1A4YA 4R0AA 4B8CD 3RFSA 4Q3IA 2A0ZA 1U0ND 2O6RA 5AWAA 2OMVA 4R6JA 1XEUA 4FD0A 2V9SA 2Z62A 4LXSA 1K5DC 4U7LA 1OZNA 4OQTA 4KT1A 1YRGA 2OMTA 3C6PB 4ARNA 3PMHG 3OJAA 3ZYJA 3ULAA 4TZHA 2Z66A 4M7EC 4ECOA 1OTMA 5AZ5A 2P1OB 5IYXC 3UL8A 3VQ1A 3KJ4A 4LSCA 3GOZA 2WQUA 4GLPA 4R6AA 2CA6A 1OTNA 4Y61B 5GMGA 4QXEA 4BSUA 1M0ZA 4PEQB 5AWBA 2JE1A 4NKHA 2V70A 4BSRA 2XOTA 4CC4C 1O6TA 4BV4R 3WPBA 2OMZA 2OMYA 1O6SA 5GS0A 1XWDC 3W3KA 3E3ZA 4P91A 3RW7A 4R5CA 4XSQA 1DS9A 4FMZA 5AWDA 4H09A 2UZXA 1DCEA 4G8AA 4R09A 3C6OB 4CNCA 2OMXA 1H6TA 2OMWA 4J0MA 3OJAB 4PQ8A 2Z63A 1KOOA 2Z82A 3JB9j 2Y5QA 1P9AG 4Z79A 2O6SA 4LXRA 1GWBA 4RCWA 3TSRE 1P8VA 3E6JA 4R08A 3FXIA 3ZYIA 3G3AA 2UZYA 1O6VA 2IFGA 5HZLB 4UFRA 4LI2A 4I6JB 1IO0A 4MQWX 3RGXA 4CP6A 4HQ1A 4XOSA 4AY9X 3WPDA 4P8SA 1KOHA 4NKGA 4C2AB 5A5CA 4K17A 2Z81A 2Z7XA 4LI1A 4R58A 1H6UA 4LSXA 4QBZA 2ID5A 1P8TA 4PERA 3G39A 5CMPA 4RWTC 4ARRA 4BSSA 1ZIWA 5IJCA 3WPIA 2BEXA 3OGKB 4U06A 3E2JA 3G04C 2ELLA 3O6NA 4R07A 3G06A 2WQWA
chains in the Genus database with same CATH superfamily
5B0TA 2P1MB 3RFEA 4Z64C 3CIYA 4MN8B 1JL5A 1M9SA 4L3FA 4FHOA 2Z65A 3W3GA 5B0NA 2ASTB 1OGQA 1DFJI 1SQ0B 3A79B 4KNGA 4FCGA 3W3LA 1FT8A 3M18A 1D0BA 2RR6A 5HDHA 4J4LA 5GS2B 1M9LA 3UL9A 1OTOA 4M7EA 5IJBA 1WWLA 3REZA 2WQXA 4L3AA 5GQRK 2WFHA 4FDWA 3ZYOA 3WPHA 4PKIG 2P1PB 4U09A 3ULUA 4EZGA 4NZTM 4U08A 2XWTC 3ZYNA 4R6FA 2OMUA 1FS2A 2BNHA 3ULVA 1XCDA 3UL7A 3RW6A 2WQVA 4ECNA 3WN4A 4CC4A 3VQ2A 5CMNA 4V2EA 3WPFA 4CILA 1FQVA 2V9TB 3O53A 5GMHA 1W8AA 4C2BB 4YEBB 3P72A 2Z64A 3G3BA 3E4GA 1A9NA 2JE0A 1M10B 2O6QA 1PGVA 1OOKG 4R6GA 4R5DA 5AWCA 4Z94G 3RJ0A 5IJDA 4Q62A 3W3MA 4Z61C 3RGZA 2RA8A 4XGOA 4PSJA 1LTXA 1G9UA 4CNMA 5D3IA 2Q4GW 3SB4A 2ASSB 4V2CA 3C6NB 1Z7XW 4QC0A 2R9UA 5FTTB 4GT6A 3W3NA 4Q3GA 4WP6A 4Z8GA 4RCAB 3CVRA 5LFNA 3OGLB 4V2DA 1XKUA 3UN9A 5GMFA 4FS7A 4AW4A 3CIGA 2P1QB 3BZ5A 1QYYA 4IM6A 3W3JA 2FT3A 3WPEA 1K5GC 3RIZA 4LSXC 3M19A 2JQDA 1XECA 3OGMB 4LSAA 2Z7XB 1FO1A 3WPCA 2P1NB 4WYKA 3DZEA 5B4PA 3RFJA 4NZRM 3WPGA 4KXFB 1A4YA 4R0AA 4B8CD 3RFSA 4Q3IA 2A0ZA 1U0ND 2O6RA 5AWAA 2OMVA 4R6JA 1XEUA 4FD0A 2V9SA 2Z62A 4LXSA 1K5DC 4U7LA 1OZNA 4OQTA 4KT1A 1YRGA 2OMTA 3C6PB 4ARNA 3PMHG 3OJAA 3ZYJA 3ULAA 4TZHA 2Z66A 4M7EC 4ECOA 1OTMA 5AZ5A 2P1OB 5IYXC 3UL8A 3VQ1A 3KJ4A 4LSCA 3GOZA 2WQUA 4GLPA 4R6AA 2CA6A 1OTNA 4Y61B 5GMGA 4QXEA 4BSUA 1M0ZA 4PEQB 5AWBA 2JE1A 4NKHA 2V70A 4BSRA 2XOTA 4CC4C 1O6TA 4BV4R 3WPBA 2OMZA 2OMYA 1O6SA 5GS0A 1XWDC 3W3KA 3E3ZA 4P91A 3RW7A 4R5CA 4XSQA 1DS9A 4FMZA 5AWDA 4H09A 2UZXA 1DCEA 4G8AA 4R09A 3C6OB 4CNCA 2OMXA 1H6TA 2OMWA 4J0MA 3OJAB 4PQ8A 2Z63A 1KOOA 2Z82A 3JB9j 2Y5QA 1P9AG 4Z79A 2O6SA 4LXRA 1GWBA 4RCWA 3TSRE 1P8VA 3E6JA 4R08A 3FXIA 3ZYIA 3G3AA 2UZYA 1O6VA 2IFGA 5HZLB 4UFRA 4LI2A 4I6JB 1IO0A 4MQWX 3RGXA 4CP6A 4HQ1A 4XOSA 4AY9X 3WPDA 4P8SA 1KOHA 4NKGA 4C2AB 5A5CA 4K17A 2Z81A 2Z7XA 4LI1A 4R58A 1H6UA 4LSXA 4QBZA 2ID5A 1P8TA 4PERA 3G39A 5CMPA 4RWTC 4ARRA 4BSSA 1ZIWA 5IJCA 3WPIA 2BEXA 3OGKB 4U06A 3E2JA 3G04C 2ELLA 3O6NA 4R07A 3G06A 2WQWA
chains in the Genus database with same CATH topology
5B0TA 2P1MB 3RFEA 4Z64C 3CIYA 4MN8B 1JL5A 1M9SA 4L3FA 4FHOA 2Z65A 3W3GA 5B0NA 2ASTB 1OGQA 1DFJI 1SQ0B 3A79B 4KNGA 4FCGA 3W3LA 1FT8A 3M18A 1D0BA 2RR6A 5HDHA 4J4LA 5GS2B 1M9LA 3UL9A 1OTOA 4M7EA 5IJBA 1WWLA 3REZA 2WQXA 4L3AA 5GQRK 2WFHA 4FDWA 3ZYOA 3WPHA 4PKIG 2P1PB 4U09A 3ULUA 4EZGA 4U08A 2XWTC 3ZYNA 4R6FA 2OMUA 1FS2A 2BNHA 3ULVA 1XCDA 3UL7A 3RW6A 2WQVA 4ECNA 3WN4A 4CC4A 3VQ2A 5CMNA 4V2EA 3WPFA 4CILA 1FQVA 2V9TB 3O53A 5GMHA 1W8AA 4C2BB 4YEBB 3P72A 2Z64A 3G3BA 3E4GA 1A9NA 2JE0A 1M10B 2O6QA 1PGVA 1OOKG 4R6GA 4R5DA 5AWCA 4Z94G 3RJ0A 5IJDA 4Q62A 3W3MA 4Z61C 3RGZA 2RA8A 4XGOA 4PSJA 1LTXA 1G9UA 4CNMA 5D3IA 2Q4GW 3SB4A 2ASSB 4V2CA 3C6NB 1Z7XW 4QC0A 2R9UA 5FTTB 4GT6A 3W3NA 4Q3GA 4WP6A 4Z8GA 4RCAB 3CVRA 5LFNA 3OGLB 4V2DA 1XKUA 3UN9A 5GMFA 4FS7A 4AW4A 3CIGA 2P1QB 3BZ5A 1QYYA 4IM6A 3W3JA 2FT3A 3WPEA 1K5GC 3RIZA 4LSXC 3M19A 2JQDA 1XECA 3OGMB 4LSAA 2Z7XB 1FO1A 3WPCA 2P1NB 4WYKA 3DZEA 5B4PA 3RFJA 3WPGA 4KXFB 1A4YA 4R0AA 4B8CD 3RFSA 4Q3IA 2A0ZA 1U0ND 2O6RA 5AWAA 2OMVA 4R6JA 1XEUA 4FD0A 2V9SA 2Z62A 4LXSA 1K5DC 4U7LA 1OZNA 4OQTA 4KT1A 1YRGA 2OMTA 3C6PB 4ARNA 3PMHG 3OJAA 3ZYJA 3ULAA 4TZHA 2Z66A 4M7EC 4ECOA 1OTMA 5AZ5A 2P1OB 5IYXC 3UL8A 3VQ1A 3KJ4A 4LSCA 3GOZA 2WQUA 4GLPA 4R6AA 2CA6A 1OTNA 4Y61B 5GMGA 4QXEA 4BSUA 1M0ZA 4PEQB 5AWBA 2JE1A 4NKHA 2V70A 4BSRA 2XOTA 4CC4C 1O6TA 4BV4R 3WPBA 2OMZA 2OMYA 1O6SA 5GS0A 1XWDC 3W3KA 3E3ZA 4P91A 3RW7A 4R5CA 4XSQA 1DS9A 4FMZA 5AWDA 4H09A 2UZXA 1DCEA 4G8AA 4R09A 3C6OB 4CNCA 2OMXA 1H6TA 2OMWA 4J0MA 3OJAB 4PQ8A 2Z63A 1KOOA 2Z82A 3JB9j 2Y5QA 1P9AG 4Z79A 2O6SA 4LXRA 1GWBA 4RCWA 3TSRE 1P8VA 3E6JA 4R08A 3FXIA 3ZYIA 3G3AA 2UZYA 1O6VA 2IFGA 5HZLB 4UFRA 4LI2A 4I6JB 1IO0A 4MQWX 3RGXA 4CP6A 4HQ1A 4XOSA 4AY9X 3WPDA 4P8SA 1KOHA 4NKGA 4C2AB 5A5CA 4K17A 2Z81A 2Z7XA 4LI1A 4R58A 1H6UA 4LSXA 4QBZA 2ID5A 1P8TA 4PERA 3G39A 5CMPA 4RWTC 4ARRA 4BSSA 1ZIWA 5IJCA 3WPIA 2BEXA 3OGKB 4U06A 3E2JA 3G04C 2ELLA 3O6NA 4R07A 3G06A 2WQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0T A;  2P1M B;  3RFE A;  4Z64 C;  3CIY A;  4MN8 B;  1JL5 A;  1M9S A;  4L3F A;  4FHO A;  2Z65 A;  3W3G A;  5B0N A;  2AST B;  1OGQ A;  1DFJ I;  1SQ0 B;  3A79 B;  4KNG A;  4FCG A;  3W3L A;  1FT8 A;  3M18 A;  1D0B A;  2RR6 A;  5HDH A;  4J4L A;  5GS2 B;  1M9L A;  3UL9 A;  1OTO A;  4M7E A;  5IJB A;  1WWL A;  3REZ A;  2WQX A;  4L3A A;  5GQR K;  2WFH A;  4FDW A;  3ZYO A;  3WPH A;  4PKI G;  2P1P B;  4U09 A;  3ULU A;  4EZG A;  4U08 A;  2XWT C;  3ZYN A;  4R6F A;  2OMU A;  1FS2 A;  2BNH A;  3ULV A;  1XCD A;  3UL7 A;  3RW6 A;  2WQV A;  4ECN A;  3WN4 A;  4CC4 A;  3VQ2 A;  5CMN A;  4V2E A;  3WPF A;  4CIL A;  1FQV A;  2V9T B;  3O53 A;  5GMH A;  1W8A A;  4C2B B;  4YEB B;  3P72 A;  2Z64 A;  3G3B A;  3E4G A;  1A9N A;  2JE0 A;  1M10 B;  2O6Q A;  1PGV A;  1OOK G;  4R6G A;  4R5D A;  5AWC A;  4Z94 G;  3RJ0 A;  5IJD A;  4Q62 A;  3W3M A;  4Z61 C;  3RGZ A;  2RA8 A;  4XGO A;  4PSJ A;  1LTX A;  1G9U A;  4CNM A;  5D3I A;  2Q4G W;  3SB4 A;  2ASS B;  4V2C A;  3C6N B;  1Z7X W;  4QC0 A;  2R9U A;  5FTT B;  4GT6 A;  3W3N A;  4Q3G A;  4WP6 A;  4Z8G A;  4RCA B;  3CVR A;  5LFN A;  3OGL B;  4V2D A;  1XKU A;  3UN9 A;  5GMF A;  4FS7 A;  4AW4 A;  3CIG A;  2P1Q B;  3BZ5 A;  1QYY A;  4IM6 A;  3W3J A;  2FT3 A;  3WPE A;  1K5G C;  3RIZ A;  4LSX C;  3M19 A;  2JQD A;  1XEC A;  3OGM B;  4LSA A;  2Z7X B;  1FO1 A;  3WPC A;  2P1N B;  4WYK A;  3DZE A;  5B4P A;  3RFJ A;  3WPG A;  4KXF B;  1A4Y A;  4R0A A;  4B8C D;  3RFS A;  4Q3I A;  2A0Z A;  1U0N D;  2O6R A;  5AWA A;  2OMV A;  4R6J A;  1XEU A;  4FD0 A;  2V9S A;  2Z62 A;  4LXS A;  1K5D C;  4U7L A;  1OZN A;  4OQT A;  4KT1 A;  1YRG A;  2OMT A;  3C6P B;  4ARN A;  3PMH G;  3OJA A;  3ZYJ A;  3ULA A;  4TZH A;  2Z66 A;  4M7E C;  4ECO A;  1OTM A;  5AZ5 A;  2P1O B;  5IYX C;  3UL8 A;  3VQ1 A;  3KJ4 A;  4LSC A;  3GOZ A;  2WQU A;  4GLP A;  4R6A A;  2CA6 A;  1OTN A;  4Y61 B;  5GMG A;  4QXE A;  4BSU A;  1M0Z A;  4PEQ B;  5AWB A;  2JE1 A;  4NKH A;  2V70 A;  4BSR A;  2XOT A;  4CC4 C;  1O6T A;  4BV4 R;  3WPB A;  2OMZ A;  2OMY A;  1O6S A;  5GS0 A;  1XWD C;  3W3K A;  3E3Z A;  4P91 A;  3RW7 A;  4R5C A;  4XSQ A;  1DS9 A;  4FMZ A;  5AWD A;  4H09 A;  2UZX A;  1DCE A;  4G8A A;  4R09 A;  3C6O B;  4CNC A;  2OMX A;  1H6T A;  2OMW A;  4J0M A;  3OJA B;  4PQ8 A;  2Z63 A;  1KOO A;  2Z82 A;  3JB9 j;  2Y5Q A;  1P9A G;  4Z79 A;  2O6S A;  4LXR A;  1GWB A;  4RCW A;  3TSR E;  1P8V A;  3E6J A;  4R08 A;  3FXI A;  3ZYI A;  3G3A A;  2UZY A;  1O6V A;  2IFG A;  5HZL B;  4UFR A;  4LI2 A;  4I6J B;  1IO0 A;  4MQW X;  3RGX A;  4CP6 A;  4HQ1 A;  4XOS A;  4AY9 X;  3WPD A;  4P8S A;  1KOH A;  4NKG A;  4C2A B;  5A5C A;  4K17 A;  2Z81 A;  2Z7X A;  4LI1 A;  4R58 A;  1H6U A;  4LSX A;  4QBZ A;  2ID5 A;  1P8T A;  4PER A;  3G39 A;  5CMP A;  4RWT C;  4ARR A;  4BSS A;  1ZIW A;  5IJC A;  3WPI A;  2BEX A;  3OGK B;  4U06 A;  3E2J A;  3G04 C;  2ELL A;  3O6N A;  4R07 A;  3G06 A;  2WQW A; 
#chains in the Genus database with same CATH topology
 5B0T A;  2P1M B;  3RFE A;  4Z64 C;  3CIY A;  4MN8 B;  1JL5 A;  1M9S A;  4L3F A;  4FHO A;  2Z65 A;  3W3G A;  5B0N A;  2AST B;  1OGQ A;  1DFJ I;  1SQ0 B;  3A79 B;  4KNG A;  4FCG A;  3W3L A;  1FT8 A;  3M18 A;  1D0B A;  2RR6 A;  5HDH A;  4J4L A;  5GS2 B;  1M9L A;  3UL9 A;  1OTO A;  4M7E A;  5IJB A;  1WWL A;  3REZ A;  2WQX A;  4L3A A;  5GQR K;  2WFH A;  4FDW A;  3ZYO A;  3WPH A;  4PKI G;  2P1P B;  4U09 A;  3ULU A;  4EZG A;  4NZT M;  4U08 A;  2XWT C;  3ZYN A;  4R6F A;  2OMU A;  1FS2 A;  2BNH A;  3ULV A;  1XCD A;  3UL7 A;  3RW6 A;  2WQV A;  4ECN A;  3WN4 A;  4CC4 A;  3VQ2 A;  5CMN A;  4V2E A;  3WPF A;  4CIL A;  1FQV A;  2V9T B;  3O53 A;  5GMH A;  1W8A A;  4C2B B;  4YEB B;  3P72 A;  2Z64 A;  3G3B A;  3E4G A;  1A9N A;  2JE0 A;  1M10 B;  2O6Q A;  1PGV A;  1OOK G;  4R6G A;  4R5D A;  5AWC A;  4Z94 G;  3RJ0 A;  5IJD A;  4Q62 A;  3W3M A;  4Z61 C;  3RGZ A;  2RA8 A;  4XGO A;  4PSJ A;  1LTX A;  1G9U A;  4CNM A;  5D3I A;  2Q4G W;  3SB4 A;  2ASS B;  4V2C A;  3C6N B;  1Z7X W;  4QC0 A;  2R9U A;  5FTT B;  4GT6 A;  3W3N A;  4Q3G A;  4WP6 A;  4Z8G A;  4RCA B;  3CVR A;  5LFN A;  3OGL B;  4V2D A;  1XKU A;  3UN9 A;  5GMF A;  4FS7 A;  4AW4 A;  3CIG A;  2P1Q B;  3BZ5 A;  1QYY A;  4IM6 A;  3W3J A;  2FT3 A;  3WPE A;  1K5G C;  3RIZ A;  4LSX C;  3M19 A;  2JQD A;  1XEC A;  3OGM B;  4LSA A;  2Z7X B;  1FO1 A;  3WPC A;  2P1N B;  4WYK A;  3DZE A;  5B4P A;  3RFJ A;  4NZR M;  3WPG A;  4KXF B;  1A4Y A;  4R0A A;  4B8C D;  3RFS A;  4Q3I A;  2A0Z A;  1U0N D;  2O6R A;  5AWA A;  2OMV A;  4R6J A;  1XEU A;  4FD0 A;  2V9S A;  2Z62 A;  4LXS A;  1K5D C;  4U7L A;  1OZN A;  4OQT A;  4KT1 A;  1YRG A;  2OMT A;  3C6P B;  4ARN A;  3PMH G;  3OJA A;  3ZYJ A;  3ULA A;  4TZH A;  2Z66 A;  4M7E C;  4ECO A;  1OTM A;  5AZ5 A;  2P1O B;  5IYX C;  3UL8 A;  3VQ1 A;  3KJ4 A;  4LSC A;  3GOZ A;  2WQU A;  4GLP A;  4R6A A;  2CA6 A;  1OTN A;  4Y61 B;  5GMG A;  4QXE A;  4BSU A;  1M0Z A;  4PEQ B;  5AWB A;  2JE1 A;  4NKH A;  2V70 A;  4BSR A;  2XOT A;  4CC4 C;  1O6T A;  4BV4 R;  3WPB A;  2OMZ A;  2OMY A;  1O6S A;  5GS0 A;  1XWD C;  3W3K A;  3E3Z A;  4P91 A;  3RW7 A;  4R5C A;  4XSQ A;  1DS9 A;  4FMZ A;  5AWD A;  4H09 A;  2UZX A;  1DCE A;  4G8A A;  4R09 A;  3C6O B;  4CNC A;  2OMX A;  1H6T A;  2OMW A;  4J0M A;  3OJA B;  4PQ8 A;  2Z63 A;  1KOO A;  2Z82 A;  3JB9 j;  2Y5Q A;  1P9A G;  4Z79 A;  2O6S A;  4LXR A;  1GWB A;  4RCW A;  3TSR E;  1P8V A;  3E6J A;  4R08 A;  3FXI A;  3ZYI A;  3G3A A;  2UZY A;  1O6V A;  2IFG A;  5HZL B;  4UFR A;  4LI2 A;  4I6J B;  1IO0 A;  4MQW X;  3RGX A;  4CP6 A;  4HQ1 A;  4XOS A;  4AY9 X;  3WPD A;  4P8S A;  1KOH A;  4NKG A;  4C2A B;  5A5C A;  4K17 A;  2Z81 A;  2Z7X A;  4LI1 A;  4R58 A;  1H6U A;  4LSX A;  4QBZ A;  2ID5 A;  1P8T A;  4PER A;  3G39 A;  5CMP A;  4RWT C;  4ARR A;  4BSS A;  1ZIW A;  5IJC A;  3WPI A;  2BEX A;  3OGK B;  4U06 A;  3E2J A;  3G04 C;  2ELL A;  3O6N A;  4R07 A;  3G06 A;  2WQW A; 
#chains in the Genus database with same CATH homology
 5B0T A;  2P1M B;  3RFE A;  4Z64 C;  3CIY A;  4MN8 B;  1JL5 A;  1M9S A;  4L3F A;  4FHO A;  2Z65 A;  3W3G A;  5B0N A;  2AST B;  1OGQ A;  1DFJ I;  1SQ0 B;  3A79 B;  4KNG A;  4FCG A;  3W3L A;  1FT8 A;  3M18 A;  1D0B A;  2RR6 A;  5HDH A;  4J4L A;  5GS2 B;  1M9L A;  3UL9 A;  1OTO A;  4M7E A;  5IJB A;  1WWL A;  3REZ A;  2WQX A;  4L3A A;  5GQR K;  2WFH A;  4FDW A;  3ZYO A;  3WPH A;  4PKI G;  2P1P B;  4U09 A;  3ULU A;  4EZG A;  4U08 A;  2XWT C;  3ZYN A;  4R6F A;  2OMU A;  1FS2 A;  2BNH A;  3ULV A;  1XCD A;  3UL7 A;  3RW6 A;  2WQV A;  4ECN A;  3WN4 A;  4CC4 A;  3VQ2 A;  5CMN A;  4V2E A;  3WPF A;  4CIL A;  1FQV A;  2V9T B;  3O53 A;  5GMH A;  1W8A A;  4C2B B;  4YEB B;  3P72 A;  2Z64 A;  3G3B A;  3E4G A;  1A9N A;  2JE0 A;  1M10 B;  2O6Q A;  1PGV A;  1OOK G;  4R6G A;  4R5D A;  5AWC A;  4Z94 G;  3RJ0 A;  5IJD A;  4Q62 A;  3W3M A;  4Z61 C;  3RGZ A;  2RA8 A;  4XGO A;  4PSJ A;  1LTX A;  1G9U A;  4CNM A;  5D3I A;  2Q4G W;  3SB4 A;  2ASS B;  4V2C A;  3C6N B;  1Z7X W;  4QC0 A;  2R9U A;  5FTT B;  4GT6 A;  3W3N A;  4Q3G A;  4WP6 A;  4Z8G A;  4RCA B;  3CVR A;  5LFN A;  3OGL B;  4V2D A;  1XKU A;  3UN9 A;  5GMF A;  4FS7 A;  4AW4 A;  3CIG A;  2P1Q B;  3BZ5 A;  1QYY A;  4IM6 A;  3W3J A;  2FT3 A;  3WPE A;  1K5G C;  3RIZ A;  4LSX C;  3M19 A;  2JQD A;  1XEC A;  3OGM B;  4LSA A;  2Z7X B;  1FO1 A;  3WPC A;  2P1N B;  4WYK A;  3DZE A;  5B4P A;  3RFJ A;  3WPG A;  4KXF B;  1A4Y A;  4R0A A;  4B8C D;  3RFS A;  4Q3I A;  2A0Z A;  1U0N D;  2O6R A;  5AWA A;  2OMV A;  4R6J A;  1XEU A;  4FD0 A;  2V9S A;  2Z62 A;  4LXS A;  1K5D C;  4U7L A;  1OZN A;  4OQT A;  4KT1 A;  1YRG A;  2OMT A;  3C6P B;  4ARN A;  3PMH G;  3OJA A;  3ZYJ A;  3ULA A;  4TZH A;  2Z66 A;  4M7E C;  4ECO A;  1OTM A;  5AZ5 A;  2P1O B;  5IYX C;  3UL8 A;  3VQ1 A;  3KJ4 A;  4LSC A;  3GOZ A;  2WQU A;  4GLP A;  4R6A A;  2CA6 A;  1OTN A;  4Y61 B;  5GMG A;  4QXE A;  4BSU A;  1M0Z A;  4PEQ B;  5AWB A;  2JE1 A;  4NKH A;  2V70 A;  4BSR A;  2XOT A;  4CC4 C;  1O6T A;  4BV4 R;  3WPB A;  2OMZ A;  2OMY A;  1O6S A;  5GS0 A;  1XWD C;  3W3K A;  3E3Z A;  4P91 A;  3RW7 A;  4R5C A;  4XSQ A;  1DS9 A;  4FMZ A;  5AWD A;  4H09 A;  2UZX A;  1DCE A;  4G8A A;  4R09 A;  3C6O B;  4CNC A;  2OMX A;  1H6T A;  2OMW A;  4J0M A;  3OJA B;  4PQ8 A;  2Z63 A;  1KOO A;  2Z82 A;  3JB9 j;  2Y5Q A;  1P9A G;  4Z79 A;  2O6S A;  4LXR A;  1GWB A;  4RCW A;  3TSR E;  1P8V A;  3E6J A;  4R08 A;  3FXI A;  3ZYI A;  3G3A A;  2UZY A;  1O6V A;  2IFG A;  5HZL B;  4UFR A;  4LI2 A;  4I6J B;  1IO0 A;  4MQW X;  3RGX A;  4CP6 A;  4HQ1 A;  4XOS A;  4AY9 X;  3WPD A;  4P8S A;  1KOH A;  4NKG A;  4C2A B;  5A5C A;  4K17 A;  2Z81 A;  2Z7X A;  4LI1 A;  4R58 A;  1H6U A;  4LSX A;  4QBZ A;  2ID5 A;  1P8T A;  4PER A;  3G39 A;  5CMP A;  4RWT C;  4ARR A;  4BSS A;  1ZIW A;  5IJC A;  3WPI A;  2BEX A;  3OGK B;  4U06 A;  3E2J A;  3G04 C;  2ELL A;  3O6N A;  4R07 A;  3G06 A;  2WQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...