3M1BA

Crystal structure of human fcrn with a dimeric peptide inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
263
structure length
263
Chain Sequence
LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG receptor FcRn large subunit p51
publication title X-ray crystal structures of monomeric and dimeric peptide inhibitors in complex with the human neonatal Fc receptor, FcRn.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/inhibitor
total genus 48
structure length 263
sequence length 263
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3m1bA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3m1bA01
4JE4B 4BK4A 1BFTA 3WDIA 5IKCB 4E41D 5GRUL 1ZVSA 4Z76A 5LQBH 4ELMB 1G9NC 2YK1L 4MX7A 3OPZL 1UH2A 1J0YA 4Y4KD 2V9RA 1NBQA 2JJVA 2Y25A 4DKAA 4R0LA 4JM2D 4OT1H 5ISZA 5GHWH 1A7OH 5D6DC 2WLYA 3U46B 2C4FT 4O4YH 5L2KA 1JYNA 3HMXA 3QDMB 4Z7QF 5BZDB 5DSCA 1CE6B 4F7PB 5L0QC 1BM3H 4X99B 4XPGL 1SQ2N 4MSWB 4U1NB 5T3XH 4AK1A 4NQTA 5D7JA 3CUPB 1J1OH 5JUEL 3QJFA 4JZNA 1R5VA 3AU1A 1NC2B 2P8PB 3QDJB 4W4NA 3WE6A 5DRNA 3GNMH 3VWKD 3LHPH 1RHHB 1JGVH 3RUGF 1MWAA 4QRRE 4JRYB 2VKXA 1MAJA 1FORL 5E70A 5JA9A 3QUZA 4Z7UF 4XP9L 5FUCE 1FVCB 1TZGH 5KSBE 1VCAA 4X8XA 5GS1B 2B39A 1ZLSL 4I77L 4AG4L 1MIEL 3TZVA 1J5OL 1MRDL 1ES0B 2GJ6D 3B2UD 5GS3A 5L88L 3JV6B 5C9KA 25C8L 3MLRH 2DM4A 4NZRH 4N1EA 1T7ZA 3BPOC 5F3HB 2HJLB 3ARQA 2ZCKL 3C60D 4N5ED 4LLVB 3BP4B 1OAXL 3IF1B 5EC1B 2E27H 1OPGH 5FCSH 4S2SA 4P2OA 2V5YA 2FJFA 5LXGL 3RY6C 1A4KB 1KJ3H 2D9QB 3CZJA 4Y5XB 1YEIL 5IMLA 3LKOA 1NLBH 3QNZA 2A6DB 3K8KA 1HIML 2ADGB 4YDJB 2WBKA 5C0NC 4WO4D 1OTUC 2NR6C 4JB9H 4KMTH 1W72L 3TV3H 4I3GA 4FABH 2J8HA 4YHKL 4RRPG 4R7DB 4FQ2L 1PGRB 1MIML 3WXVL 4X6EB 5JOEA 2BXYA 5F1SA 4NO5B 3BEWA 4HZAA 2DQJH 4N0FB 5CLTA 1U41A 4PJBB 1UADC 3V5KB 3UCRA 2QADD 1OTTD 3QQ9D 2X9XA 4OCMC 2XFXB 4LSTH 4Y2DD 4EN3B 4NSKA 4OV5B 1UC6A 2AJVH 1J0JA 3OKYA 1X5ZA 3PHOA 4NQXA 2DTML 4WV1A 4DEPB 5A2FA 1EUUA 3O3BB 3IAGC 3NABL 3MR9A 4LRIC 3KYOA 5C0EB 2CLRB 2APWA 5C0BE 4U6YA 2UY6A 3T2NH 3FT2A 1ROWA 3TBVB 4XCYA 5ESAB 1UT9A 4I5BB 5F7EH 1H8OA 1N4XL 1W8OA 2E9JA 3MRHA 4NQCA 1CLOH 4GW1A 3BDBA 4HFWA 4AH2B 1QLFB 4MA1C 3VG0L 4RRPA 1BVLA 1K4DA 3H3BC 3OBAA 4Z18A 1D5XB 1R6VA 2Y72A 3VRJA 3DJ9A 4ZFGH 4HXAL 5CZKA 1KV3A 4X9BA 2OS7A 3HS0A 4G3YL 2JB5H 1QFOA 1EEUA 4P57A 1JZ4A 3NGBB 3O2VL 3R06B 2BVPB 4L4TD 3U7AA 1JF6A 4ZS7L 2MMXA 1N7ML 4FMKA 4HIJA 2QV2A 4WIQA 1HDMB 4UU9A 1IM9D 1AGDA 5C0FB 4S10A 4ZYKA 4LPXA 4LSPL 4LHUB 5CZXD 4BA8A 4M3JA 1MSPA 4PTUB 3QXAB 4TRPL 5HHOD 2MQ0A 1MCNA 3MV8E 3O45B 4OFPA 3TCLB 4UILL 3HZVA 1YEEH 2QQKH 4GBXA 3SQOL 4JDTL 5D7LD 4U1IB 3KPOB 2ICCA 2MHAB 4PRPD 1H9VA 1WIUA 3OV6A 4MJIB 1IBGL 4KKCD 3S7GA 5TQ0L 5GIRA 3MA7B 1YDPB 1N2RA 3IAPA 2HMID 1RU9H 1ZSDA 1QLRB 2CKBL 4YDKL 1JPGB 2UWEF 1RZIB 1U8PB 3MJ9A 1LEKB 1HEZB 1LE5B 4U7MA 2P24B 5JQ6H 1U8JA 3WJJC 2KL6A 4LSQL 2F15A 2MSPA 3MRQA 4QHNA 1MFEL 4P2QB 4YK4B 3KPSD 2BHZA 1UH3A 4OM1L 3P9LA 4PJ8B 4PJIB 2DI7A 3WS6A 1A0QL 4PJHF 1J05A 2ICES 4OZIB 4DGVL 3ULUD 3O6FD 2VMFA 1XCTA 4NJ9L 2ZNWA 4JG0L 4DWHA 2Z91A 2I5YL 4DKFL 1RZKC 5DD3L 1DBBL 4Y4HD 1UH4A 2NY7H 2F54E 3QQ4A 3DIFA 5I1EH 1KTDB 4JHAL 4PR5B 5KZCD 2VR9A 5CWSA 2EH7L 4XVJH 3ARFA 1U58A 3ZKNC 1RK0A 3HI6H 1A6PA 3R8QA 5GZND 4Y89A 2IPTL 4U6HB 4LMQE 4FQPA 3GIVB 5I8EA 3KLSA 1RJYA 2YPKA 4U1KA 3IDGB 3DVIA 4PJXE 4UT6H 4Q0XH 3UMTA 3QEUB 1JVKA 2X09A 3QXDA 1FNEA 4LQFH 4OGXL 1U95A 4O58H 2EYSB 1WWAX 3D0LB 1VPOL 2OI9B 3AB0C 4HPYL 1LE9B 5CILH 2FGWL 3KHQA 2XN9D 3AC0A 5DD0L 5IW3A 3DYOA 1KEGH 5BVJA 2WBJC 2NMSA 1F4WH 4Y19E 3I6GA 3MLZH 3U1SL 4POUB 4U0RC 1FNGA 2K7PA 3IS0X 5CAYB 2EEDA 4CMMB 4S1SL 4JY5H 5D1XB 1ZT4B 3V95A 1F6LL 1RUAL 5AYUH 3K81A 4QRRB 5GGSB 5CD3B 4KI1A 2HKFH 3SGEI 4RNRB 1G6RA 1ONQB 3HPJB 1RMFL 2P5WA 3D69B 5E8DL 5KSBB 4EQ3A 1AH1A 3QB7C 5BRZD 4JGUA 3ZE2F 1UXWA 4EDWH 3VFNA 1WT5C 3JWDC 2O26U 4MCYB 1ZHNB 3WYRA 1YC7A 1S7XA 5E6IB 5JOFA 5C2BH 1MQ8A 1U92A 1M6OA 3BH9B 5JW3L 1F3JA 1N3NB 2YXFA 3UTZA 4ZFFB 2EC8A 4OI8A 3V4PH 5KOVC 1A8JH 3CCHB 4JFPA 5FYKH 3Q1SH 1N5YL 3KPTA 5KG9B 5HYSG 4QRPB 5CBAA 5A3ID 2Y7QA 1QSED 4XWOC 1BBDL 1D5MA 1KFAL 2QSVA 1T83C 4YUEH 3L3HB 2QLVB 1E4JA 3FT3A 4DTGH 4X83A 1CL7L 3ULVL 1WBZA 1OCWL 3BIKB 1MJJA 4M5YH 3BZ4A 2YD1A 3V6OC 2GSGB 3G5XB 3H9SD 4H0GA 3VJ6A 1I8LC 4WHCA 4ZS6D 1NGXA 2C3GA 4JO4L 2BRRH 4KTYA 4M48H 4OF3A 4KI5F 1U8HB 4G80A 1X4ZA 3ARBA 3VDAA 5F9WC 1RVFH 1JGDA 4PS4L 3L3KA 3MRCB 4OTXH 3P30H 1LQVA 2DWDA 4J23A 5T1KD 1PJ9A 1D3CA 1TJHL 2YSSB 1KN2H 5EWIL 2MQ3A 3GMRA 3RGVD 3BZEA 1FPTH 1PDKA 3NN8A 4I18C 4R7NA 2Z93A 3BKYL 1Y18B 2VRAA 4WW2C 1U3YA 5HVWA 2IADB 4M61A 2NW3A 4KK5D 1IEBA 3K3QA 5KJRL 1JZ2A 3BXNB 4IJ3C 1CFQB 3VA2C 4WDIB 2FECL 5T1MA 1NJ9A 3QJHA 4PV9A 1EFXD 3B2VL 4NZJA 2FIKB 2Y1VA 1U8KA 3EOBB 1AD0A 1CDGA 1B90A 3FB7B 4NQDD 3PHQA 3T0XA 5IMKB 2DM3A 4JZJB 1CBVL 1KB5H 4NQDA 4WENB 1ZKAA 2BVUA 1EVUA 2XI9A 1T0NA 4NN6C 2FBJH 3L9RB 4CU8A 2OTUB 4L8DB 3U6RB 3CU7A 1WICA 4S0UC 1BD2E 1OY3B 2M1KA 4Y5YC 2WIMA 3WKMH 4XCFL 2XKSA 5GS2H 4LLQA 1YMMD 4YDLB 5EBLA 1S9YA 1U3JA 2VAAB 2YD7A 2HFFA 1AJ7H 4MXVE 1D9KC 3QRGL 2W0FB 4PJCA 3VW3H 3IDIB 1HHHA 3ORJA 4K71C 4FQCH 3AAZA 1KB5B 4PP1D 3MV8B 3P4NB 1S5HB 4LCIH 4YQXH 3I2CL 4TSAH 1UM4L 1T04B 3MNVB 4JM2F 3DOSA 5D5MA 2BY1A 4HK0A 4X9IA 3INUL 3BSZL 4HDIB 5GRXG 3QDAA 4U1HB 3NA9H 1XCQA 3QFJD 4XBGB 1FO0H 2YOCA 3FO1A 4F7EA 2VXUH 3LS4H 3RJDA 4GXVH 2EKSA 3O8XA 1CQKA 5E8NB 3VI4E 3QFJA 3T0ED 2BDNL 1LD9A 3DRQB 3KLAB 1CZ8L 3G9AB 1ZWIA 5DVKA 1AGFB 4LQ1A 4OLUH 4GRLA 2P44B 3A67L 3C8KB 1BQUA 4P5TC 3L3IB 4MA8L 5HBBA 1GC1H 3IDXH 2ID5A 3KPMB 5DC9B 2FR4B 2M26A 3VFMB 1J8HA 3NCJH 3DYMA 4KROD 4F33B 1UGNA 4G7YL 1PLGL 3HFML 5HI3D 5CCKL 3SKUD 3L3JA 5IIEB 3QQ3A 4Y8AA 3TIEB 3FQXA 4BFIA 5I75B 3MCLL 1FO0B 3LQAL 3W39B 4Z7WB 5IHZA 3VXMD 2XQBH 2HJFB 2DQHH 4TOYH 1A7QL 2OCFD 1ETZA 2F54B 4OFDA 1CT8A 4ELKB 3KPPA 2VL5A 2A2QT 5GGVL 5FECA 2OXGA 1T0PB 4U1GC 2WINA 3OKMB 2OTWB 3LV3B 4LDOB 1EJ6A 5K33A 5IQ9B 2V7NA 3ALXA 2VXVL 4WHTB 2XG4A 2DDQL 5IB5B 3QIBD 1PZ5B 4HGWB 4QXTB 4YHZL 1U8IA 1IQWH 1IM3A 5FDWA 4Z8FH 5I74C 1BECA 2BMKA 2C9AA 4JFZH 4XAWH 3SDCB 3PL6D 4Z7QE 1RD6A 4I0CC 5BCAA 3ZT5A 4HH8A 1QQDA 1AKJB 1E27B 1J0KA 3QEQE 2PW1B 3OHXA 1UJ3B 2EDDA 4G8IA 1DVFC 1XIWD 4NQEB 4OUUB 4Y19B 2FWOA 1JI2A 5D7IA 4XAKD 2ZUQB 2IAMD 3E2HA 3KVQA 1GGYA 1WWBX 2QL1A 3D6GA 1S78D 4BKLB 5AD0B 5C0RL 2DD8L 4HBQA 4M93C 4MNQE 4KVCH 5FEBA 2X05A 2VXTL 4HIXL 1X9QA 5GRYA 3RUGE 1FYTA 5ETUB 1LVEA 2ZUVA 3BRGC 2O61A 2B0SL 1UACH 3HE7A 3VA6A 3TJHC 4GG6A 4L8BA 3IU4L 4Z7UE 1OGAB 5EOCL 2IFFH 4JPVH 1FIEA 1ACZA 2XA3A 1YNLL 4NZUH 3PDOB 1G7QB 1N5AB 3UJJL 2R2EB 3G9VA 3QAZB 5TE4H 3SDXB 3IFOB 3L3GA 4R97C 3CFJB 4MVBD 4YWGH 4KUCD 2FLBT 1FZMA 1GSMA 3EYOB 3U82B 1TIUA 2B4CL 1YQ2A 3D48R 4HS3B 4HF5H 4OIBA 1S3KL 1I8IB 4UDUA 4IS6A 3MRPA 2R4RL 5GSVA 1FRGH 4U1MA 4R8WH 1JPSH 1KIQB 4LASL 1TZIA 2YD8A 3VD3A 5AZ2L 5DHXB 3BT2H 1ORQB 3QEHA 4ZAKB 5IMMB 4XP6H 5EU3A 5JZ7C 3DX6A 2GT9A 3RWIA 3MZGB 2A83A 4M1DH 1R3JA 3C09B 4QRUA 5HDQH 4TUKL 4LVNB 4OLYH 1F90L 3FQWB 2W07A 2NY3C 3RIFK 1FGNL 2BNUB 3MLXH 2DYPD 4F15C 3T2PA 4Z0BL 3MLVH 5DMKB 4NWUH 3U36B 5I1KH 1NCTA 4AL8H 2GK0A 4JLRB 4WI5A 5IFAH 5D72L 4NIKB 3CC5B 4U7KA 2HVJA 4BZYA 3WL9A 2HTLC 2EDJA 5D7KD 4MNHA 3RWHB 4XNMB 4RWYL 1CIDA 1JZ3A 5TJWK 5DJ6B 5HXMA 4P3DA 1R3IH 1LDPL 4H26B 4FQJH 4HWZA 3DVFA 2YZ1A 5IB2A 5J3HD 4HKZB 5E95B 1ZEAL 7CGTA 1NKOA 5CSGA 4ODTL 1FFOB 4MQSB 43C9B 4N9GA 4JFFE 1EMTH 2Q76B 5DJZB 2B8OT 3GHBL 1JK8B 5F1NB 3GMOA 4GAYA 4PJGF 5C9JB 4DCQA 2Y5TA 3FO2B 1LO0H 5B38A 4M43H 5BXFA 1MFAH 2J2ZA 2IALA 4C56E 1F3DJ 3TH2T 2ADIA 5ACMA 1NUGA 4L3EE 4A6YH 2AVGA 3WFHB 4PJ5E 3F7VA 5KANI 3OR6B 5KVEH 1BD2B 3LKSB 1ED3A 4F3FB 3BN9D 3WJLA 3F12B 1CL7I 1NL0L 3BKJL 3OGCB 2DTSA 2YEZA 3BEVB 3CU1A 4YR6B 4PJDA 4H1LA 5J1AB 2FRGP 3ULVD 2X4RA 1IC4H 3MRMA 2HYMA 1NGYB 2JJUA 1JHLH 5E2TH 2QHRL 3RWFB 3C2AH 4TVPE 4A6YB 1DQML 4QHLA 2H2SD 2QTEA 4PGDB 5DJ8B 2AJYL 3CSPA 3MGOB 4U49A 1MFBH 4V1DA 3MLTA 3O9WB 5T5NF 2UWEE 4HUUB 1AD9B 4HK3J 1NMAH 3H42L 1R3LA 2HFEB 3PQYA 4PLJD 1UYWL 5HGAA 1VDGA 5HHME 5JIPA 4LSUL 4EXKA 3BD5A 2FO1A 3F58H 4U1LB 1FVEA 2FECI 3KWWB 3ROOA 1JF1B 1QRNA 2O5ZL 2YKLL 3P73A 3HG1A 1GPOL 4PJHE 2CRYA 4OZGA 2C1OA 1KPUA 3NA4A 1S9WB 4LPTA 3EFFA 1LEIB 5HHQA 4NCDA 2R2BB 5IOPA 2V2TA 5EO0B 2IH1A 2AJSH 5BS0A 1T3FA 3KGRA 3NFPA 1AGCA 1UWGL 4UV4L 2LQRA 1AHWB 1MHCB 1J0ZA 2J4WL 3FRPG 4NDMB 1GIGH 5L8JB 2GIYA 1XT5A 4OI9A 1DLFH 5DI8B 3DUSB 2MFNA 4K3EH 4Y1AA 1PX4A 4GQ9L 5D6DA 1UB6B 1JN6A 4YHYB 1NCCH 3W82A 3BH8B 3DXAA 3TM6A 1INEL 3GM8A 3RY5A 3T04D 2H32A 1LNUB 5DEGB 3QQNA 3WNNA 1JRHL 3X3FH 1X5LA 4LAQH 1KJ2A 3VG9C 3SCMB 2DWEA 5KAQG 3AS2A 3GMNA 4G43B 4L9DA 4NKMB 2B2XL 2EH8H 4NNYB 1F5WA 4GUPA 2H1PH 3W0WE 2DQUH 4ALAL 4G6MH 4U1JA 3M1BB 4XWGH 1BZ9B 1CFVL 3QEQB 3MJGX 2VABA 1BGXH 2L4OA 4HWUA 5CJQH 3RWDA 4OCWH 3MRBB 2V7HB 3VFPA 2VDRL 3GSQA 5I6XB 2BSED 1OSPL 5EZIL 1P1ZA 5K59F 5C0JB 4MNQB 3F62A 1IGCH 5DFVC 3RUGB 3W9DA 5AAWA 4PP8C 2JELH 1EGJH 5I30L 4NUGL 5EU6D 3LSOA 5F9JB 5E5UB 2BVTA 4Z7UB 3VFSB 4G59A 2FB4L 1A7RH 3ZE2E 4WJ5B 1KCVH 1ND0A 2P46B 1VFBB 3MA9L 3S34H 4IOFC 5EOTB 3DROB 3FFCD 4OFVA 1AQDB 3R0NA 1IFHH 3KPNB 3OB8A 1MAMH 1YNKL 1ZAGA 3K1KC 5KBNC 4HCRH 3MUGB 5KVMC 3RY6A 3ZMRA 1IAKA 2D7PA 3F7YB 5LG1A 5EIVA 4E0RB 2V2XA 4U6TA 3OL2A 3ARUA 2GCYA 3EKCA 2NNAB 5EUKA 2BSRA 4GAJL 2NY6C 1HXYB 4I3RL 5H94B 2AAVA 3UPRA 4XP1H 3BO8B 1IT9H 1DUZB 2IANE 2IJ0C 5F1IB 2E6PA 5E5RB 2VDNH 4FZEL 5KVDL 5DMGC 1QD0A 1P9MC 4HKJA 3DI3B 5TH2B 1WC7A 1HWGB 1PG7W 3D39D 2PUQT 3SGKC 4HT1H 4EZMA 4MHHI 4XMLH 4XNYL 3HRPA 4TULL 2MCPL 4YFLI 1M7IB 3EYUL 1EA9C 2B1AH 4P99A 1EJOH 2C3VA 1M7DB 3ZKMD 1QFUH 3GBLA 3E6FB 2OZ4L 1N6QL 4JRXE 3O3EB 1T0MB 4PJCF 2FD6L 5HPMA 1K4CA 2HLFC 4LRIA 4DGIL 4ZUUB 5EC2B 4LVOB 3TPUE 3MQIA 4ZDHA 4P0DA 1A4JA 3ARDB 1CFTB 1N64H 3DVGB 3FT4A 4QNPF 5D5MF 3SDAC 3SJVE 4LVEA 1D6VH 3QUYB 4AENB 3NFSH 4JGMA 4M4RA 1GGUA 1UJTA 3G6JB 2F8VA 3KPRD 5FB8A 3OF6A 4HV8A 4GKOA 3I75B 3HC0A 4C59B 2WK2A 4RAHA 1HXMA 2APFA 4X80H 3B9VA 3RKPA 5FO8A 1FL3A 3S96A 1I8KB 3KNBB 4UNTA 1ZGLM 1FL6A 4R6UA 3OKNA 1A22B 4JFFB 3PIQA 1SY6L 3SKOA 4BH8A 5HYJA 1SEQL 1RZJC 4LCCC 3QHZH 1FZKB 4G9DB 5CEXA 4X6CB 2ADFL 5C0AE 5L2JB 4Y4FD 4PD4J 4Y5VB 3B5HA 4XMPH 4JHWL 4F57L 3P4MA 3WUWG 1U3HB 2VYRE 5CJXC 2UVEA 4PJ5B 3AVEA 4NT6A 5F96H 3GIZL 1CG9B 4OGAD 5GS0C 4UTBH 4E41E 5CGYD 2PR4H 4JQIL 3U30C 1A6VH 3H3KA 4N0UA 3P2TA 2XWBB 4O2EA 5C08D 5EU7C 1T1ZA 5ISZE 4W68A 2FYYB 4HSQA 4O2FA 4PUBL 4FQXC 3GMLB 4YXLH 2R29L 4WTXA 5F70A 1WK0A 1KIRB 1MLCB 2ORBL 3U9PH 5E4IA 1S9VB 2D03L 3O11B 1AO7D 3MGTB 5KTEH 3EOTH 3WJJA 1BHGA 4MZ2A 3BRDA 3O4OC 3CDYA 3VXOB 2XNAB 4KQ3L 2NYYC 4ACPA 3NMEA 2OYPA 4PRDB 2UWEB 3FFDA 4ONFH 3HI1A 5IBTL 4HKXB 5IVNA 1QLEH 3O6KH 4YDIL 3FB6A 1TETL 4U7SA 1YYLH 1CDHA 4LLUB 4I1NB 1K6QL 1XR8A 2YC1B 3C87A 3RY4A 2XKNA 4MA7L 1NGZA 1TENA 2VLJA 1VACB 4KJWD 4P3CL 4GG6F 4JZOA 4PJHB 2C7UB 4MJ5A 5KSUA 1IAMA 2BC4B 4UDTB 5ALBH 3QG7H 4AY0A 1YEFL 5F88A 4YNYA 3OKLA 4JQXC 4X98B 4LSSH 1HHIA 4JFEB 5J12C 4XH2B 1MCQA 2VDOH 5FOBA 1D5IH 4X5WA 1X5FA 3MLUL 5DS8A 4V2CB 1H5BB 5DRWB 1HOCB 2WWKO 1GGCH 4KUCF 1UVQA 4OCXH 2WBJD 2IBGA 1C5BL 2Z4QB 5A43C 1XGTB 2XWTA 3QNXB 4GO6B 3DRTA 4TNWK 2WBJA 1JPFA 2AXGB 4HWBH 1OAZH 3D9AL 1Z0MA 3DUHA 4NN7C 3G04A 3W0WB 3CVIH 1X4YA 4BK5A 4NO2A 2A0LD 1A7OL 2D4DA 2R0LH 2BSTA 3LPWA 1KGCD 2NY2B 1S7VA 2X89D 4OM0L 1I1AC 3HAEH 5FIEA 4HUVB 3CNKA 4HXBH 2A6JB 4QRTA 4K8RC 3CLEH 1KIPB 3ZDZF 4ZG1A 3HNVL 1ITBB 3GMMA 3KYMA 1OWRM 3JWNC 2QQLH 1KTRL 3MRKA 2VO5A 1TITA 1R3KA 2BX5A 1FNSL 4KGJA 3FHQA 2DMKA 5K9OA 3QUMA 1DBJH 1UWEL 1WT5A 4OZHA 3SDDC 1SJXA 6CGTA 1I9RL 3PV6A 4P9ML 2CXGA 5C0CA 1AXTL 1MFDL 2VWEE 3GNML 4X8JA 3QA3A 1WCBB 5JOPE 2NY4C 4W6WB 3HAEB 3UJIL 3DBXA 4YPGB 4MCZA 2ZCLH 2W65B 4Y16D 5CUSH 4Q6IB 4XWOD 1TZGL 2ED8A 3KLDA 1C16A 1KACB 4Q97A 4FXGA 1IAOA 4XI5D 2VISB 4EOWH 1A9BA 1ITCA 1T83A 2NY1B 2CH8A 4NQCE 1CDYA 1DBKH 2DLEA 4Z78B 5E6YA 4LCUB 5FM4A 3HE6C 4OD3H 5C09D 3OGOE 2PW2A 3WNLA 2KQNA 4XPTH 2IANB 2RFXB 3V6OA 4NUJB 3PWJA 1YJDC 5ACZB 1KSRA 1JRHI 5HHXH 5AZEH 2YUWA 1I8LA 2YHGA 2VIRB 1GOHA 1HHJA 5HD8D 3RZCC 2Z92A 4JFDD 1CTNA 2FCBA 5IFHL 4XZUB 4OF6A 1NLDH 1OHQA 1Q9OB 4PG9B 1GZQA 2UZIH 3BE1H 1Q0YH 4RGMC 3O3UN 4NHCL 3LOWA 3PDGA 1D6EA 4PJDF 4I18A 5EOQH 4JRXB 4WW2A 4EI5D 4XHJC 2W0KA 5F6IC 5HHOE 3ZE0F 1MCFA 4KHTH 4OJFH 3ULVF 5J8OA 2R56H 1CS6A 4X9HA 4I3SH 2P8LA 3TPUB 4L4VD 3QI9D 3BYTA 3GK8L 2NXYC 5F7NC 5E9DD 3SJVB 2MJWA 2DQCL 2FHFA 3MRFA 4PRPE 4M7ZB 3SKJL 4AQ1B 4HH9B 3MRIA 5I15H 2PYEA 3QI9A 3LS5L 5M7QA 1MCBA 3VXSA 3WDJA 5TDOB 3ZKXC 3MGAA 2P5EA 4DZBA 4HIIB 4QXWA 5JLZB 4P3WA 2ZUWA 3TIDA 1MPAH 4JGJA 3FRUB 4PJGE 1BQHG 5ACLA 2PYFB 1U6AL 5IHLB 1CXKA 1YYML 4XNXH 1CF8H 2AXFB 1TJGH 4DVRH 2VE6B 4Y5YA 3ROLB 3KPSE 3E8UH 4OZGF 1OGTA 5D9SA 3LEYL 4NYLB 4WI9A 3PXHA 1NFIA 3FN3A 5C0AB 3ULUE 1OF2A 1KN4L 4UTAH 2YA2A 1D9KA 1R3HA 4F8TA 5I8KH 3K0WA 5ITBL 1OLLA 5CHNA 4HLJA 1S9KC 3BP6A 4E41B 1UCBL 3QCVH 4MX7B 4R96B 1RZ7H 1T4KB 1I75A 1VA9A 3V4UH 2Z31C 4JG1L 4R0LB 2DIAA 5HHPB 3BUTA 3ZYIA 4W6YB 2P45B 4Y4KB 5IROC 3I3EA 4JM2B 3DO7A 2O5YH 2EDYA 1A6UH 1MFNA 1AI1L 3H3PH 1I3GL 3RJQB 4ENED 1WBXB 3UP1A 3MLWL 1EAPA 2XN9E 1YEEL 2K1MA 4P5TA 2X4TB 1YY8A 3RWJB 3DUUA 4F2MB 4TPRL 5E99H 5E24E 5DD1L 4OQTL 5IBUB 1URLA 1CLYL 4TUOB 2DJUA 3QZWG 5ID0B 4OFYA 2LTQC 4OSUL 5DF0A 3EJYD 4DN4H 2X41A 4PY8I 1M71B 2EDEA 3CLFH 4IM8A 2OQJA 4WUUA 3BQUD 3VWKB 3AREC 4JDZB 3MOAL 3I02A 3LVEA 3ESVF 3WXWL 3RL2A 1LO5A 3RTQD 4R90H 4YHNA 2MOVA 1I7ZB 2NX5A 4FFEX 4HS6A 2P5WE 3KG5A 3I9GL 4NJAL 5D1ZD 3TZVB 3OXRB 4M5ZH 1XGPA 2HRPH 4P2RA 2EIZB 5IBLC 5BRZE 4PRIA 4RAUA 2FEDC 5DJXA 4FFZL 4BSJA 2A9NH 1FV1A 4ZO6A 1GHFH 2NXZD 5EB9A 4K3DH 3LQMA 4JHBA 4ZUVA 2ZKHH 5J56B 2OK0H 3L95A 1VADA 5AUMA 2NTSP 5BOPA 4QF1A 3C60B 2JIXA 2DKSA 1E4WH 4JJ5A 3OXSA 3MREA 1DVFD 2G5RA 4PJ9C 4YFDB 4Q7DA 4PJAF 1D7FA 3MACH 1DVFA 3CZFB 4ZPVA 3KPQB 5IMLB 3LKOB 1QSEE 3WEXA 4ZD3H 3S88L 1JMZA 4R4FH 3WS3A 4OLVL 1A6TB 5I16A 4YBQD 1INDH 3JWOH 3MLYL 4LQFL 2A9MH 4IIQC 1CGXA 4WO4B 3IDUA 3JXAA 5ILTL 3IDNA 1YEGL 1F4YH 5B21A 3RPIA 1KXVC 4ZMAT 2VXQH 4M6AA 4PJ7F 3TJHA 2ARWA 1OP3H 5K59E 3H9SE 4RGNE 4KZDL 2EZ0C 2HG5A 3BEWB 4I8DA 4TN9A 3ILPB 1TVHA 4WGWB 5BV7H 5D96C 4YFLF 4M1CC 3C9NB 5FV2A 4GOSA 1M05B 3R1GL 4EEEA 3QNYA 4JAMA 4NSKB 1F00I 2X4SA 3V7AE 2QADB 2G2RB 2YUXA 4N8VG 4Y2DB 3V7AG 3UZQA 4P2CG 1G0DA 4OLXL 1XF4A 1WVZA 1AGEA 3KYOB 4HJGB 5D7SL 5C0IB 4GFTB 3DV4B 1P84K 3DMMD 3SE3C 2FHBA 5INCB 2BNQD 4XPAH 3SKMA 3TVMC 3PP4H 1E0OB 1YN7B 1UA6L 1J11A 1PKQE 3C8HA 4IBLT 5SWZA 5BV7B 3H9HA 3QUXC 3D3VA 4M3KB 4LLYB 2RIKA 3TH4T 5IP4A 4GMTL 4HUWA 3PP3H 2I25N 3FL7A 4K3JH 4GW1B 3RWGA 3VXUD 3P4LA 4HFWB 1F13A 3LZFL 1BVLB 1JMXA 3P77B 2GQHA 1HK6A 4NQDE 1A9EA 3TT3L 1FIGH 2X9YA 4P46D 4M1GL 3MV11 1IGFH 3FQUA 1RPQA 2F5AL 5DHYA 4CVWA 1B9ZA 1G7PB 1MLBB 3IFLL 2D2OA 3Q3GA 1B0GA 3U7WH 1OP5H 4KZEH 5E6ZA 4MAYD 2VAJA 3NACL 1OB1B 2F74A 1G6VK 5IHBA 4PJCE 4XPFH 2ICWJ 4F9LC 3MXWH 3MODH 1CVSC 3IETA 3P0YH 1QPPA 4G9FD 1QYGH 4LPWA 2I26N 5HHOB 3HZVB 3N9GL 5EO9B 5I1JL 4GBXB 5D5ME 4IMLB 2OL3A 4QNPE 1OAUH 1U2HA 1E6OH 3LAFA 3VGFA 1U8QA 1HHKB 1MRCL 2FZ3B 1YNTB 1NBVH 2WIIA 4PRPB 3QULA 1IAIL 4OGYL 5HGHB 2J8UF 4FQLH 3BMVA 2ARJQ 3QFJE 2EDHA 3ULUH 1FPTL 2PCPB 4PB9H 1E28A 1TQBC 1I1FA 1JNNL 3CFEB 2R0ZH 2X5PA 3BIAX 4RA0C 3RA7L 1U8JB 5GJTH 3TBWA 1TVBB 2E7BA 4WU7A 4OAWA 4PJGB 2CLVB 3CXHK 3H8NA 5DRXA 5A2IH 1UM6H 4KRPD 1KPVB 2A6IA 2BJML 1YEJH 1UXSA 2VUOA 1IGTA 1MH5A 3QCUH 3KPSB 4C58B 1UEYA 3WFBL 1IGJB 3I6KB 1NQBA 5DMIL 4AM0B 5GGRY 1XCTB 3CXDL 3ARYA 4RX4D 3VFWB 3UYRH 3G08B 1NGPH 3VXME 1WZKA 3DIFB 3K46A 3FQTB 5B4MD 4L8CA 1LO2H 4Y4HB 2I07A 1U58B 3I3DA 4JM4H 1RK0B 3U7YL 2J6EL 4M00A 5KZCB 4QYOB 4LEOA 4UT7L 1X5KA 3CH8A 1VFAA 2ITCA 3P9MA 3WKML 2YPKB 3X17A 2HH0H 2YWYA 2YPLD 1H3UA 1HSAA 5CFHA 4JO1H 3TN0D 4EN3D 1U95B 1E6JL 3S37L 1DANU 1AJ7L 4HC1L 1EUTA 3MROA 2CPCA 3BX7C 1QO3A 4YO0A 1IGMH 5DZNA 5TDNA 5EORL 4X7FC 3UZVB 4HX1A 4JREB 5CP3A 1MCOH 1SEBA 5BVJB 1NH6A 4JN2B 4QY8A 2XN9B 3D25A 1YEKH 1AC0A 2JCCA 1NGQL 3OG6B 4K3GA 1FNGB 2VLRA 5D1QD 4TQEH 4UNUA 3MRGB 3WNOA 2BSSB 1U8OB 3NA9L 1NCAH 5DEFA 3QZWB 4KUZL 2R4SL 3SGEH 1KB9J 5GGTA 1YN6B 3QCTH 1Q0XH 4J3TA 4G8EA 1DLHB 4LARL 1F4AA 3EYSH 4H88H 1Q72L 1WAAA 4GG6E 3UTTD 4OZHF 1MCIA 4OLUL 4LRNL 3GJFH 2CRZA 2EXWD 4D9QD 1GOFA 3B4NA 1CGSH 3S3SA 3LKPA 1YY9C 4HZLB 1RV6X 2HKHH 5JPMA 5DQJB 4JKWA 5GRUH 5SWSA 2FX8L 5BRZB 3T8XB 2ZUTA 2DAVA 1I85C 2YK1H 3OPZH 1TFHA 4U2ZA 5LGJA 1BAFH 1U92B 3UEZA 1FCCA 4LHQB 1RJLA 1OWWA 4LHUD 1XR9B 3GJFB 2FDBP 1YPZA 2N4IA 5ICXA 4A2LA 1Y6MR 4YHML 1UB5A 1AXSA 3CX5J 1QNZL 5I2IA 3DX8A 4UAOB 2W38A 3QYCA 2ATKB 1QSEB 3JV4A 3PABA 2EE9A 3QIWD 4WWKC 4XPGH 5JPNA 2QHLA 3OJ2C 2WWKT 4MD0B 4FQIL 3LIZL 5JUEH 1IC1A 4U05A 3WIIL 3ZDZE 1JHKH 4WI3A 4LGRB 5I66A 4IRSD 3H9SB 4RGNB 1I3VA 1NFKA 1CDIA 4K23L 4N5UA 4X7DC 2H3NA 3ERYA 4LSRL 1G7MA 4WW2F 3ARGD 1JGDB 2VQ1B 5BVPL 4XP9H 5FO9A 3PGFL 1ZLSH 4I77H 4AG4H 4P4KD 1MIEH 4N8VB 1J5OH 1MRDH 3NN8B 5D7KE 4R7NB 5T1KB 5L88H 25C8H 2CUHA 3I6LD 4RMVA 4WEBL 4X9GA 3RGVB 2A6KB 4M61B 5FO7A 2NW3B 3QDGD 2HT4C 3FO0H 3H7BB 1G7JA 4KAQL 1HCFX 2ZCKH 1FBIH 2A73A 2G60L 1SVZA 1OAXH 3O6LL 4RMTA 3ETBF 3FN9A 5T1MB 1FLTX 1NJ9B 4C83A 3QJHB 2EYTA 4RISL 1PKQB 1DFBL 4OF5A 1P9MA 2JJSC 5LXGH 2BERA 1U8LA 3JZ7A 5CP7A 4YHPA 1EFXB 3V6FB 1RK1B 3L6FB 3DECA 3SGKA 1HIMH 4E42B 7FABL 1MEXL 1IGYA 4D0DB 4NQDB 4ODWA 1I8MA 4YGVA 1W72H 1IC5L 3DWTA 1T0NB 3U0PB 4R8WL 4YHKH 4Z77B 4FQ2H 2D7TL 3BWUC 1CI5A 3WXVH 1MIMH 2EC9U 4I2XE 2FX7L 3FTGA 5DQDL 4LLDA 2H6PA 5IW6A 2J7LA 1WITA 4CGTA 4LLQB 3H0TB 4M1DL 3MV7D 3SDAD 5EBLB 3RI5F 1S9YB 3V52L 4PJDE 2E7LC 5DJDA 5CJOL 2X4OB 5DJYB 3SDAA 3MV7A 3MV01 5KANG 1FNFA 1PY4A 4BQ6A 4CUCA 3ZE0E 3ES6A 4O2CB 5A16B 5T1DL 4PY7A 3ULVE 1BJ1H 5LBSL 3HZMA 5ICYB 4YHOH 1FZJA 3DO3A 1W72B 2BVQA 4AT6A 3C6LD 4P9HL 5D71L 2DTMH 4MXQC 4BQ8A 4R9HA 3UTSD 3KLHD 4HFUH 3NABH 5GGVY 2VLLA 2IQAA 1NMBL 1ZS8A 3RBGA 1CVRA 1K8IA 5C07D 4V1DE 4MD4B 1OW0C 1P7KB 5GS1C 3N06B 4WI8A 4PGEB 3BP5B 2EKSB 4XC3L 5F8QC 3OKEA 3X13A 3QFJB 1LHZA 5MI0B 3PQYE 3EYVA 4LCCA 4FP8L 1ZWIB 3T0EB 4GRLB 4F7MA 5MERA 1B0RB 4I0PD 4I48B 4J8RA 1P6FA 2NY5L 4G6AD 5DGQA 3OSKA 5JHLL 2ZJSL 1ZANL 1EEYB 4NKOA 3VG0H 1QRNE 3AS3A 1T7VA 4H8WC 1RIHL 5FF6B 1QVOA 4OZGE 1DSFL 4DW2L 4HXAH 5C71A 3CVHA 2R9HD 4PJEA 1LK2B 2N1KA 3G5VB 4G3YH 3FQXB 5ESQB 1DBAL 4WI7A 4ZNCD 5BS0E 4Y5XC 4CNIA 3C6SA 1NEZA 4WUKL 1S7WB 4ZS7H 1N7MH 3VXMB 2V2WB 1MFAL 4FQXD 4PLKC 4LHJB 4M02A 2VL5B 5AWNL 5C6TL 1NGWB 3LKQB 2JF1A 5BJTB 4FQXA 1J87A 1ZGLB 4Q58C 3DXAE 4TRPH 4D0CA 1EBPA 4RFOL 4UILH 2FNBA 5FUZL 1P7QD 3SQOH 4JDTH 3TJEH 3ZSSA 2AKRA 1PYWA 1U8IB 2ICEA 5GRVK 2BY0A 2X4NB 1JGLL 1V3LA 1Z9MA 5FDWB 3THML 1IGIL 4LL9A 5TQ0H 4E5XB 4M03A 4KK6C 1RZGB 3CFKA 5FHAL 4H5SA 4K7FA 3PL6B 1QKZL 3H6JA 3FB5B 4KKAC 4YDKH 1A7NL 1DP0A 3OZ9L 3DVNA 3RZWA 4LAJH 4G8IB 4DEPC 5C0BD 2Z9TA 4LSQH 4X5XA 4Z7OF 1X7QB 2EDFA 1XIWB 2J1KA 1IAII 4XCNB 5CJ8A 4RMRA 1LQSR 1F4XL 1CXFA 3F8UB 1MFEH 5DO2C 2X4PA 3VD7A 1XF3A 1Z3GH 2IAMB 1U93A 2ILLA 4OM1H 2GJZA 4Q2ZA 2AEWA 3SGJC 2YR3A 3CFCL 1A0QH 1NMAL 4G5ZL 3F7PC 5T5FL 1HILB 3T3PF 2OR8A 3B8YA 2X42A 3WKNA 3HE7B 4JQXA 5GRWA 4BZ1L 3GI8L 4NJ9H 4JG0H 3REVA 1JP5A 4MQXC 2I5YH 2BFVL 5EU6E 4DKFH 5DD3H 1DBBH 1NDMA 4RCAA 1IQDB 4YZFF 4JHAH 1UCTA 2EH7H 4OFIA 2AK4D 1IZJA 2N7AA 4I13B 4MAUL 3BISA 1EO5A 3NGBC 2B1HH 3FFCE 4LLMA 2IPTH 4KKLC 3FO9A 5FA4B 5B8CA 3SN6N 1UQSB 5EIIA 4UOJA 5I8OL 3SKNB 2WWMC 4IS6B 3IKCA 1XF5A 1GIGL 1KJVA 2X4QB 4N0CD 4OGXH 4PRNB 4U1MB 4ZXBD 4PJAE 5EBWA 1P2CB 1V7MH 2BOCA 4LCWA 2M8XA 1VPOH 4HPYH 3U9UB 1NCCL 2FGWH 3QEHB 1C1EL 4WNQA 1I1AA 1LO4L 5DD0H 4OZFA 3IXAA 2VDML 1MHEB 2A83B 2EECA 3PWPA 3U1SH 2G9HA 3RAJL 3D39E 4PREB 5L8LB 2CJUL 2H1PL 5CGTA 4PJ7E 3SDDA 1BBJA 4S1SH 1SJEA 4EQ2A 2ZNXA 2MPAH 4XNQB 4KJPC 3W11D 4RZCA 2AQ2A 3KPLA 1RUAH 2JTDA 1BGXL 3K4ZA 2X1OA 2DYPB 4FMFA 1YECL 2GK0B 3VI3F 3K4DA 4OCWL 4RDQG 3CX5K 3W5MA 1HYSD 1A6ZA 3WL9B 4YK4C 5E8DH 5CSZB 4MB5A 5T1LA 1BX2B 3OJMB 5GGRB 5J06A 5DJCA 2F58L 4PJ8C 4Z0XA 2ZG1A 3VGAB 5D2NB 2JELL 1EGJL 2D7OA 1MFCL 1J18A 1WZ1L 2CR6A 3W9EA 3KPRE 3TPKA 5JW3H 3HE6A 3OJDB 5GRZA 4EI6A 3WFZA 4FTVA 4I0KA 3WIHL 2YA1A 1N5YH 5IK3A 1Q1JL 5HYJE 3MUY1 5IB3B 1BBDH 3AS1A 3M07A 4H1LH 5D70L 4PTTB 4DCQB 2Y5TB 5L7XL 3RZCA 3G6AA 5BXFB 4X4YB 1TNMA 2Z35A 1MELA 2CDFB 5JW5B 1CL7H 3HC4L 4L3CB 5H2BA 3ULVH 1OCWH 2CDEB 3EFDL 4LKXB 1IT9L 3SDYL 3VD5A 2OI9C 1BVKA 5EZJA 4I2XB 2CKNA 3QRFM 4Y19D 3L3DB 1NANI 1RZFL 4JO4H 1A3QA 1NAML 3GSWB 1XGUB 2BNRA 5HGDB 3BKML 3BZFA 2C5DC 4N0UE 4H1LB 4PJDB 4PS4H 3VXNA 4Z5RB 2F53A 3S37X 1TJHH 3ZZ1A 2VZOA 5EWIH 1Y6NR 5D1XC 3Q48A 5J6HB 4YAQA 4X9FA 3BKYH 1FSKB 1PG7L 2NY0C 4CADA 1RUQL 3VMPA 3GJEA 3BGMB 3ZHDA 2DN7A 3L5IA 5KJRH 3ILQD 4M7LL 2J8UE 2LU3A 1AO7E 1JFMA 1SYSA 5FUCC 2FIRT 3U4EA 3HUJA 1A7BA 2R1YA 3O3DA 3B2VH 5IVZB 1D6VL 3V6ZB 1R3LB 2BVOB 2X1XR 3PQYB 1UZ6F 4QOKD 5E6IC 5I1CL 3HI5L 1FDLL 1FVEB 3NPZB 4YDVA 1QRNB 2VLJE 2ZSVB 4XP5L 1CBVH 1FGVL 3P73B 1PBYA 1WAAF 4OF7A 4TNVK 1FFPB 5FYLL 3PWLA 1D5ZB 3DTXA 4LIQL 3SY0A 4ZAKD 1OTSC 4QHMA 1OOAA 1G9EA 4QHKJ 1T1XA 1INQA 5GGQL 1KJ2H 4JKKA 3LB6C 5BS0B 5JR1L 3SQBA 4BYHA 3FOMA 2Z31A 3GSNA 4J3WA 3EJJX 4R4ND 4JPIB 1ZTXL 2R1XA 5HI4C 5IROA 3QRGH 5H35A 1JN6B 4TVPL 2VR5A 4HD9A 3UTQA 5F96L 4ISVB 2H32B 4KTEL 2AXHA 1H8SA 2CIKA 4PGZA 3NIFE 3I2CH 5IVXF 3EZ8A 4JFQA 1UM4H 3CDFA 3STBA 2HRLA 3MRLB 1KJ2B 4POZD 3INUH 3BSZH 5L0QB 1GVIA 1N59B 2VXSH 3LH2L 3SGDI 3HB3D 2HJKB 2J88L 2PO6C 1AGBA 1DN0A 5IEHA 4U1JB 1W0VA 2BDNH 2NPLX 3HLAA 4U3CA 3GBNL 1FE8L 1CZ8H 2P49B 4YXLL 4KJQC 3O2DA 5BQ7B 1S8DA 3A67H 3BVNA 2P7TA 3AREA 4K9EC 4MA8H 2DLTA 3VFPB 1FC1A 5INDB 1OL0A 4FFVC 5KS9A 1KCUL 3DSFL 4G7YH 1PLGH 3HFMH 4PBXA 5DMJB 4M9OA 5CCKH 4OZHE 3W9DB 4H20L 3MCLH 3LQAH 3UPCA 4U1SA 1IJ9A 4NKIL 5IF0A 4MDIA 1A7QH 5EU6B 1CFSA 1ND0B 3UBXA 3FONA 4X0KB 1NAKH 4HEME 5GGVH 3HCVB 5GSRA 1QFWL 1T7XA 2WZPD 3RU8L 4PJ9A 1N0LA 2VB5A 2X4UB 3FFCB 1RIVH 2VXVH 3KR3H 5JTWA 2DDQH 3RIAK 3X11A 5JNYB 4YDLC 4N0RA 1I7RA 3UPRB 3VCLA 1F58L 2E7HA 4PJAB 4JY6A 4IIQA 3Q2CA 5LWYL 1T5WA 1BMGA 1BVZA 1XF1A 2AV7A 4RQQB 4P48A 4K94L 4PYGA 4YJZL 4TVSa 3W5NA 3VE0B 1FFNA 2NQCA 3IGAB 3D39B 1ODAA 3VFTB 1B2WL 4JFDE 2FSEB 5C0RH 2DD8H 3WN5B 2C3XA 4J3SA 4GRWF 4J4PD 3R4DA 4PJ7B 2YRPA 4HIXH 2EDQA 4YIQB 2B0SH 3MLSL 2UZYB 3S3PA 4LK4A 5E2VL 5JXED 4R2GD 2HT3D 3IU4H 4HXBL 4KK9D 5EOCH 3DHMA 3LEXB 4U0QB 1G7HA 3ARVA 4M8QA 3WDHA 4ZDHB 3BDYH 1VB9A 1G9MC 1ADQL 3O4LA 4R3SB 3TVMA 3CPLB 4L4VE 5HHNA 4JKPH 4ZODA 2PYEE 5I75C 4WTZG 5E9DE 3QUXA 4M6NL 1MQKL 1WBYA 4M62H 4NFCA 3VXSE 5FB8B 2XKUA 1KLUB 4HV8B 3S4SG 3IFPB 2P5EE 1AE6L 2B4CH 2X1QA 3V79C 3KPRB 1S3KH 5GPRA 3QH3A 3VH8B 4AYFA 3PWUA 1A1MB 3EIFA 3REWA 2R4RH 4G8GA 1B3JA 4MLIA 1FL3B 2XRAL 3TBTA 3U2SA 4LASH 1FL6B 5AZ2H 12E8L 4KJYB 4M7JL 1GC1C 1KCLA 1X4XA 1HQRB 3DSNA 3SKOB 5TQ2L 4L1HA 4ZOAA 4FN0A 2Y9RT 4KVNL 4L8SB 1L9NA 1T1WA 5CEXB 4ZFOA 3SPVA 4QWWD 4QTIL 5F9AC 1Q9KA 5FXCH 4MYWB 1DBKL 4LLAA 1XEDA 1YUHB 4TUKH 3D85A 1F90H 3WLBA 4Y4FB 5DC0A 3SDCC 5E1AA 1JPST 3FZUC 1A3LL 4HULB 4BJLA 4F9LA 3S9DB 1FGNH 4FXKA 4PBWD 4MNGE 5B39G 1UJ3C 3HZKA 4Z0BH 5AZEL 1D5BA 2ED7A 2H8PA 3MBED 4D2NA 3NFNB 5E8PB 1I7TA 5ESVA 5ABDE 3VMOA 4XBPB 2ZUQC 4N0UB 4O2EB 4Z7VF 4JQVC 1NLDL 3NPSB 2NTFB 1ZHBA 2UZIL 3BE1L 1II4E 5C08B 4AEEA 3S4SA 4RWYH 2A74B 3OKDB 2EE2A 4HPOL 5KOMC 5J1SC 1IAIM 1CLZL 1FG9C 1LDPH 4YHIA 1DN2A 5F7YC 4HS8L 1QZ1A 2D31A 4S1QH 4HMDA 1ZEAH 2J8UB 4ODTH 1AO7B 3BAEL 5E5MB 2RBLA 3BPNC 3TNMA 1I7UA 1EDQA 4MS8C 4O9HH 3QAZC 5E00B 3MFFA 3HI1B 5C0DA 3CMGA 4AMKL 1WEJL 5D8JL 4WFHE 3GHBH 3WIFB 3OAYH 3TT1H 5AAMA 5CINH 4MD5B 3JTSB 4Q74A 4NWTL 1T7YA 5IMOB 3BD4A 2XZCL 2XKNB 4OKDA 5I73B 3HPLB 4NQSA 4WUUE 5ICZA 3T65A 1MY5A 1CICD 1T2JA 3T4YA 4JZOB 4M9PA 1SYVA 3R8BB 3OKOA 3MCKB 3X14B 2VKWA 4PGCB 2HT2D 4IRJD 4P2RE 1OSZA 5F88B 4PRIE 1NC4A 3E8UL 1JGEB 1LGVA 4KTDL 1NL0H 3BKJH 3C09C 3GRWA 4G8FA 2VDLL 4LVNC 1G1YA 5F7FA 5D4QA 3C5ZD 1ZMYA 1BREA 1RUKH 4TUJB 32C2B 4UTAL 1T89C 2HAZA 3LMJL 4FQQA 3HMXL 1UVQB 3RVWD 5FYJE 2QHRH 1H0DA 2XWTB 4ONGL 5CD5C 1DQMH 3PUCA 4JHZA 2WBJB 4LEXL 2EXYC 1A7PH 4HHAA 1KCSL 3K2UL 2AJYH 3F6IA 2E9BA 1EEZA 3TBYB 5ERWA 2AEIT 3V6BR 5FFLA 3P0VL 2H26A 5BMFL 3JBG7 1TDQA 2HFGL 2BSTB 4ZSOA 5C3LD 1MWAL 1UYWH 4LSUH 3G5ZA 4Z7OE 4MJ6A 4XVTL 3QFDB 2VZ3A 3W81A 2O5ZH 1S7QB 2AJXL 2YKLH 1Y0LA 3OR7A 1GPOH 2EYRA 3V5HA 2I9TB 4PRHA 1QUNA 4UINL 1R3KB 4L1DA 5MENA 4OZHB 3CSYA 2X7LA 4NKQB 3BHBA 3ABZA 4MXWL 1I85A 1UWGH 4UV4H 3HNSL 4YZFE 1AFVH 4OQ1A 4C56D 4JKMA 2G5BA 3QA3B 5TF0A 1A21A 2J4WH 3U79A 4L3ED 2UY7A 3PWNA 3F7RA 1AP2B 4MCZB 1QSFD 4GQ9H 1T20B 1ORSB 5FYLD 2OLDA 5TDPA 1QSFA 2OMBA 4Y16B 5E8EA 1UG9A 2BNQE 5SWZE 2COQA 1A2YA 1S7SB 2QJDA 1KT2A 1A9BB 4JDVA 1AR2A 1JRHH 4I4WB 1TPXB 5DUBB 2ARJA 4XRCB 1GHFL 1H15B 1QR4A 2V6HA 2WUCL 4WWKA 2B2XH 5ID1A 3VXUE 5C09B 4ALAH 2AXJA 1KPRA 4TVPD 1CD1A 4U31A 4CN4A 1CFVH 5F3BA 3AGVA 1KUMA 2F19L 2V5MA 4MDJA 3RVXD 3TBSB 1RUPL 3E3QC 3KS0H 4NQVB 4GKNA 5EU5B 5F9WB 4URTB 2DLFL 4U4BA 4D9LL 3IKKA 2SEBA 1OSPH 5EZIH 4JFDB 1GOGA 1IE5A 3O9WC 5HVFB 1N0XL 3D2UA 3RHWF 1JNHA 5HHMD 1P4BL 1V5JA 2Y23A 1CFNB 4UQ2B 3VI3E 5I30H 4NUGH 2HT4D 1HSBA 4BFGA 1PG7X 2D7NA 5FGCE 5EULV 3FCTA 1FN4A 3ZDYF 5EBGA 2FB4H 4EI5B 4G9FE 1JZ5A 3MA9H 3VXQB 4LLWA 1UM5L 3GSOB 2DBJA 4L4VB 3RKDC 3QIUD 2PYEB 3QI9B 2JJSA 1YNKH 3OX8B 5E9DB 2LU7A 3CMOL 4ELMA 4NRZB 3HUJF 1NBZB 4P4RB 1AHWC 2R23B 3EGSA 1QFWI 2YBRB 1IEAB 4GAJH 4I3RH 4ZQKB 3TIDB 3QPQD 1OT1A 4N90D 5I1AB 4Z7NF 5I76B 4JN1L 4UIMA 4FZEH 3LDBB 5KVDH 3JUYA 4Y5YB 5I18L 5IUSA 3QDMA 3B9KC 5BZDA 3QSKB 1CE6A 4F7PA 3D18A 3B9EA 4X4XA 3SCMC 4X99A 1QFHA 4XNYH 4TULH 2MCPH 5TGBB 3U48A 2E7LA 4MSWA 4KU1A 2BZDA 5J6GA 3CUPA 5B39B 4G6JL 1R3HB 2IG2L 4MXQD 2OZ4H 4MNGB 2P8PA 1N6QH 3QDJA 1ZA6B 3OAUL 3V4VL 1T21B 5CHNB 5EH1A 3E1F1 4MXQA 3BP6B 2FD6H 3F5WB 4JRYA 3O41B 4DGIH 5KN5A 4YBLB 1JFQL 3AXLB 5I6XC 4EUPG 5LCVL 1FVCA 1F3RB 1OW0A 2W60B 5GS1A 2YPLE 4P23D 3MJ9L 3KHOA 3JV6A 5EBMA 3P0YL 2LAGB 5F3HA 1CD0A 2HJLA 1HKLL 3GSXA 3FHAA 5JO5A 1OAUL 1YY8B 4LLVA 3BP4A 3IF1A 1UZ6E 2EICA 3DURA 4FFWC 1NBVL 2GTWB 1SY6H 2P8MB 4I9WE 1AR1D 2NY1D 1SEQH 3PGCB 4X6DF 5KS9F 4Y5XA 3MXVH 1T80A 1WAAE 2Z0BA 2A6DA 4UNVA 1EX0A 1MHHB 2ADGA 2PXYD 4YDJA 4WEMB 3I02B 3UTTE 2D9CA 5JIKA 3RL2B 2IAND 1LO5B 1PEWA 4JHWH 4F57H 2ATPB 2PXYA 2ZCHL 3BQUB 4HS6B 4D9QE 5I8CB 3C8DA 4R7DA 4RAVB 1YC8A 3RTQB 3BKCL 1XGPB 3GIZH 1P6AB 1RFDL 2Q3ZA 5SWSE 3H9ZA 4HKBB 4PRIB 3T3MF 4RAUB 5DJXB 2GEEA 1LP9F 4JQIH 4NO5A 1DJSA 3UYPA 4NBYB 1QSZA 4GMSL 3IJSA 4N0FA 5HI5D 1NGPL 5DK0B 2DLGA 5I1DB 2DJ4A 5AUMB 2WNGA 3V5KA 4QF1B 4KI5D 5TPWL 4QRSA 4DFHA 1NMCB 4JRXD 5IVXE 4NHUA 3DETD 4OV5A 3MREB 3MJ8B 5HTSA 2ORBH 4LHUG 1DVFB 1T5XB 2D03H 4WTWA 3O3BA 5D2LB 5C0EA 2CLRA 4APQD 3CX2A 1ZE3C 4OLWL 2HH0L 2I9LB 4LVOC 3SJVD 1V05A 4KQ3H 3ARDC 1DANT 2MWCA 4NFBA 4M93B 1C8PA 4OF8A 4IMKC 5IBTH 3RDTD 3SGJA 3TO4D 5ESAA 3RX7A 5FM8A 4I5BA 4YDIH 4NM8L 3MBXL 4UB0L 1TETH 2XY2A 4Y7MA 2VDQL 4KKBC 1K6QH 1K2DB 4MA7H 1J1PL 1G6RL 1SMAA 5IQ7L 2VTFA 2R8SL 2CIIA 4HJ0C 4P3CH 1TVHB 3CH1A 1D5XA 4PGJA 4ZUSB 2W9DL 4FQ1L 3FOLB 4KDWA 3QO0B 4JAMB 4WY7L 1ZVHA 1YEFH 3R06A 4MGXA 5LAXB 5C0AD 2CRMA 5DJ2B 2YD4A 3LN5B 3I6LE 4QRQA 2XOTA 1XF4B 1AGEB 5F7KC 3MLUH 3QDGE 2ICWI 5JHDA 1CGSL 1BOGB 1U3HC 1MCEA 3NIGF 4CJ0A 3LCYA 4P2YA 1JBJA 4PTUA 3DMMB 3QXAA 5EO1B 1C5BH 2BNQB 4S1RL 3O45A 1WFNA 3TCLA 5DR5L 4PP2B 4M6OH 2ICWA 2F8XC 4JANA 4ZUWB 3RWGB 3KPOA 3BP7A 3D9AH 1BAFL 4UBDC 4CVUA 5ITFB 5ISZD 1RZ8B 2E6QA 2EKJA 5FAAA 4MJIA 3VXUB 1CXLA 4NGHL 3NCFB 3MA7A 5L2KD 4P46B 4KWUA 3MLPA 1QLRA 1BLNB 4OM0H 4TTGA 1JPGA 5DHYB 1RZIA 3S3JA 1LEKA 3Q3GB 1HEZA 2P24A 4OB5L 3HNVH 1HZHH 3A6CL 5D7JD 4P2QA 1F2XK 1FNSH 3MV7E 2F74B 2QQQA 4MAYB 1B6UA 1UWEH 4PJ8A 4PJIA 1I9RH 4OZIA 4P9MH 1JHKL 5FGCB 3RP1A 2PETA 1AXTH 1ERNA 1MFDH 1A02N 2QKIA 3QUZD 1U8MB 5K9JL 4G9FB 3UJIH 2XXCB 4N1HB 3UTSE 1KTDA 4PR5A 1U8QB 3TZVD 1I3RB 2AQ3A 2R15A 2UYLB 2AABH 3MV9A 5C07E 4XC1L 1Q94B 1KYOK 2FJHA 2NLJB 4QKXB 2VJXA 3UO1L 4IRZL 1NFDF 3HMWL 2VLMD 1QP1A 2BXZA 5E08L 3IDGA 3QEUA 1K5NB 3FO0L 5BO1L 1WLHA 3TBWB 2VH5L 1FBIL 1H5BC 1VGKA 3G5YA 4PB0L 4LOUC 4LBEB 5GISH 1P5UA 1DQQB 3D0LA 3QXVA 2A6IB 3FQNB 4P2OD 2OI9A 3IFNL 4EUPH 1U36A 1UXSB 1IGTB 1MH5B 5F9OL 4KRPB 3ARSA 5IFHH 2Q6WB 2OJZL 5HYQA 2XQYK 4HMCA 4GXUN 1F6AB 5I71B 2NY0D 2IPKB 1JYWA 2I07B 2EC9T 4NHCH 4H0IA 5D1XA 1ZLUH 1ZT4A 2NY2C 4JFHD 4LEOB 9CGTA 4CVXB 2ITCB 4XTRD 4Z7VE 5GGSA 5DT1L 4EUPB 5CD3A 2VLKA 4OLZL 5CZVL 3RGHA 4RNRA 1HSAB 4UUJB 1ONQA 3HPJA 5KSBA 3ARZA 3GK8H 4LF3B 1MCSA 2YPLB 2CQVA 2DQCH 1S7TB 3SKJH 3TN0B 1L0YA 1QO3B 1ZHNA 5SV4A 3LS5H 2X70A 5E6IA 3GBML 1L8JA 4YHOL 5JOPD 3N1FC 1BQSA 3BH9A 4HFUL 4M4PA 2BRQA 3GO1H 1KENL 4K55A 4G7VL 3E6HB 3M17B 4Q6IC 1U6AH 3MOQA 2R0KL 1YYMH 5DEFB 5D1QB 1UKTA 5KG9A 1BF8A 4QRPA 4JO3L 1Q9WB 5I0DA 1T1YB 43CAB 5EG6C 2B5IB 2VN7A 3BYYA 4NQCD 1EIBA 4G8EB 1I9JL 3LEYH 3L3HA 5FDYA 4CDHA 2BVYA 2NZIA 2C3WA 4JJHA 1HH6B 1KN4H 3UTTB 1NUNB 2YZ8A 1GCFA 2X1WL 3BIKA 3UC0L 3LKPB 5DA4A 2K3TA 5JPMB 4TTDD 5AG8A 5D6CB 5ITBH 3UJTL 3T4AB 3NCYS 4NNXB 3TNNA 5SWSB 5IR1A 3VMNA 2AK4E 1UCBH 1X5HA 4D0BB 3CDGB 2FEEL 1SBBA 4JG1H 2PO6A 1EBAA 1O7VA 1C7TA 5IJVB 4B53A 4RSVA 2YSSA 4XP4L 1MUJB 5IVXB 2JK5B 3V2AR 1Y18A 4JO2H 5FKAB 1GZPA 4WU5B 1AI1H 1I3GH 3ZYJA 4GBXD 2IADA 4DZ8B 5IB1A 3MLWH 3PWPE 3TJEL 3PABB 1CFQA 4ETYA 5SX4I 4WDIA 3EHBC 1U2CA 4TPRH 3TA3C 5DD1H 2AP2A 4OQTH 4M7ZC 1AIFB 3QIWB 1CLYH 3O0RL 4JRWA 1K3ZA 2FIKA 2OXHA 4PBVC 3MPCA 3VGHA 4OSUH 3FB7A 4GXUM 4KK8D 5IMKA 3BMWA 1XFPA 1K9TA 4FNLL 1G7MB 3MOAH 4IRSB 3WXWH 5M94B 4F37K 15C8L 1KELL 3L9RA 3I9GH 2OTUA 3ARGB 4NJAH 3V7MA 1Z3GL 3ZYZA 3MJ7B 1QFWM 3VRIB 2RHEA 4P4KB 4XGZB 4FFZH 2DF3A 4Y88A 2FJGA 5F21B 4M6MH 4OBSA 4M7KL 3QDGB 3ARFD 4F58L 3WCYA 2W0FA 4FTVE 3IDIA 1HHGB 3OG4B 1BQLL 1KB5A 3QISA 3T1FA 3E0GA 1Z2KA 3MV8A 3P4NA 2IGFL 3GSUB 4HGKC 5CP7B 4YHPB 2B1HL 4J3XA 5JXAL 3MNVA 2HLAB 2GI7A 3SOBL 4CU6A 3Q6GL 3S88H 2D7MA 4OLVH 1OP3K 4U1HA 2DL2A 1IGYB 1S7UA 4XBGA 5JIHA 3MLYH 4Y4KC 1HINL 1V7ML 2GJJA 4JM2C 5E8NA 5ILTH 4YH6A 1YEGH 1G0XA 2BCKB 1WTLA 3S5LB 3CFDA 1AGFA 5IW6B 1UZ8A 2V5TA 4KZDH 3C8KA 5DK2B 3L3IA 3MC0A 3T77B 4D3CL 1BFSA 5DJDB 4QGYA 2FR4A 3VFMA 3SDAB 2F53E 3EO1B 3MV7B 3R1GH 3X3GL 4F33A 2Q7YB 2ZUXA 4ODBD 3ZDYE 5IIEA 4W6XB 5F44A 2RGSA 1FO0A 1NUDA 1TCMA 4Z7WA 3W39A 2MPAL 3OTTA 4AT6B 5F9DC 2HJFA 1P53A 1R5WB 4OLXH 2EIBA 3VWKC 3C6LB 5D7SH 2F54A 1NCWH 4ELKA 1H3GA 2P5WD 3UTSB 3PP3K 1K8IB 3ARPA 3OKMA 1BJ1J 2OTWA 3HUJE 1C12B 1UA6H 3EJZD 5C07B 3LV3A 4GS7C 3H7LA 5KSAD 3EYVB 1S9XB 4PRBB 4WHTA 2LFGA 4GMTH 5KSAA 2PNDA 3B2UC 4Z7NE 4QOKE 1PZ5A 3FQRB 4HGWA 4QXTA 3QWRA 5DFWH 4NKOB 3U0TB 3LZFH 3AUVA 4I0PB 1QVOB 3TT3H 2HTKD 1OP5K 3SDCA 2W0LA 4DJMA 4M1GH 3C60C 4N5EC 1AKJA 1E27A 2PW1A 2F5AH 4CVZB 2Q87A 1UJ3A 1DBMH 2DQFB 4ZOBA 3IFLH 4IOSD 2EO9A 4M8VA 4CNIB 4NQEA 4OUUA 4RFNB 5EZLB 2E9WA 4U6XB 5CIPH 3NACH 4JQVA 4BKLA 4W70A 5AD0A 2XG5A 3LKRB 2QQNL 2Q8AH 3IRPX 4BZ2H 2AEQL 5DJ0A 4WO4C 4FQXB 2ZZUT 4D0CB 4NPYB 1KTLB 3IS1X 3K7UA 4RGND 4Z6AT 4WFFE 4Z7VB 3ARBD 4HJJL 3N9GH 1OGAA 3Q6FB 1VFUA 4XX1E 5I1JH 5JW4R 4OCSL 1YEDA 3CDCA 2ICEB 1P7QB 2EDTA 4ZPTA 2V17L 1MRCH 3PDOA 1G7QA 1N5AA 2ERJC 4GLRI 2R2EA 4MS8A 3SDXA 1JTPA 4OCLC 1IAIH 4OGYH 5CIPB 1DZBA 3CFKB 1JV5B 3JWOC 4BSVA 1OQOA 2QADC 1OTTC 3QQ9C 1CE1L 3CFJA 4Y2DC 2L7JA 3S35L 2GFBB 3RX8A 3EYOA 2VWEC 1JNNH 5C8JB 4HS3A 3RA7H 1MREH 5DD6B 4X5XB 5C0BB 1OAYH 3IDJB 5HYSA 5AYQA 1KIQA 1QA9B 4X6DE 5KS9E 1JZ7A 1KJMA 2BJMH 1U93B 1G9NL 4Q2ZB 5IMMA 5BV7C 1N8ZB 4QT5B 5DJAA 3WFBH 5DMIH 3CXDH 4OD2A 4YHLL 2EIEA 4LP5A 1NDMB 2CK2A 1WIOA 4B7LA 3T3ME 1T89A 1LP9E 5CD5D 3U7YH 2BNUA 2J6EH 3QWOB 4PJFA 1XAUA 4UT7H 3CK0L 4OZ4B 1KJ2L 1MI5D 2AK4B 4LLMB 3U36A 2OJEA 5HGGS 1MI5A 5B8CB 2H2PD 4JLRA 5JDJA 3QBTB 2VNCA 5EIIB 3HR6A 5HPOA 3FKUS 1DTUA 3MMEB 3IKCB 3CC5A 2AS5M 4POYA 1KJVB 3AY4C 3GKWL 1E6JH 3RX5A 4HC1H 3S37H 2BY2A 1JNLL 1GH7A 5DRZB 4F9PC 3RNQB 3DYPA 4XNMA 3L7FB 4C4KO 4ZXBB 5ENWA 2ADJB 5DJ6A 2QR0B 4GKSB 5EORH 1IRAY 5CZXC 1AY1L 1V7NL 3MRJA 4H26A 2N56A 5HVHB 5IGXL 1NCNA 1NGQH 4HKZA 5DTFA 5L9DL 2VXSL 4WI4A 1FFOA 3B6SA 3GJFK 3O8XD 43C9A 5I19H 1JIBA 2V9TA 4KUZH 2R4SH 3NOIA 2Q76A 1LK3L 1YMHB 4GG8B 4ODVL 3D0VB 1JK8A 4KKCC 2EEBA 3HRZA 5F1NA 4GRLD 3ZYOA 4J3VA 3KPLB 4LARH 5C9JA 3ZLQC 1Q72H 5KW9L 2HMIC 3KJ6L 4LRNH 8FABB 3GB7B 4LVHB 3STZA 1J8HD 2KH2B 3BJ91 4PG2C 1BIIA 3WFHA 3IJHA 4NQUA 3RQ3A 3TWCL 3OR6A 1BD2A 3LKSA 4F3FA 4Z0XB 2FX8H 2WY3A 2E5EA 4J1UA 3OGCA 1IILE 1GGTA 2CGRL 4P59H 3UAJD 3ULUC 3NIGE 3BEVA 4YR6A 3O6FC 2I24N 5F7UA 4IHOB 1T22A 2OBGA 3BWAB 4LPCA 5E0QA 1PY9A 2DBLL 1NAKL 4Y4HC 1NGYA 4BSWA 5DUML 3MTRA 4YHMH 3RWFA 5CJ5A 1QHOA 1QNZH 4A6YA 2FEEI 3CD4A 1RIVL 3E3QA 5JQHC 1EXUB 2VDKL 1QOKA 3KR3L 5GZNC 2GITA 5DJ8A 3MGOA 3BJLA 1NANH 2Z35B 3MO1B 2PF6A 4PJXB 5LVEA 1PSKL 2W9EL 4U6VL 3O9WA 2GTZA 4FQIH 3LIZH 1BEYH 1MVUA 1I9IL 1OT2A 4HUUA 4CAGA 1AD9A 4WEUD 3WIIH 4G42A 2HFEA 4N8PA 2BOBA 2VQUA 4U1LA 1F4HA 3KWWA 4K23H 1JF1A 4LSRH 2YA0A 4YX2L 2J5LB 1HCVA 5BVPH 5E2UL 4JR9L 3IU3B 4K7PL 4XMKH 1FYTD 3PGFH 1LEIA 4WHDA 4FG6D 2R2BA 2A77L 3HE7D 5EO0A 3MUZ1 4KMLB 2YN5A 4WEBH 4DQOL 1SJHB 3LN4A 1AHWA 4KAQH 1JWMB 2G60H 5DI8A 3DUSA 3O6LH 1SYSB 5HVGB 4X6BB 3B43A 1IL1B 3AM8C 3BDYL 3B9DA 1NFDE 4V3DB 1K8DB 3TYFB 2HWZL 5IJKC 4RISH 2XA8H 1RUML 4CW1A 4JKPL 1DFBH 2DB8A 1XMWA 3QHFL 2VZUA 3B9KA 3GSNH 2AV1A 2E6JA 4M62L 2EDBA 2L7UA 4QOKB 3QUKB 3WLWC 4AIZA 1PKOA 4JFYA 3GSRB 2IPUG 4NKMA 7FABH 1MEXH 4NNYA 2WSKA 2F5BH 1IC5H 3PWLB 2D7TH 4QHMB 5JW4N 1BZ9A 3LKNB 3QEQA 2FX7H 1MHPL 4NO3B 3RL1B 5DQDH 4YXKL 3RWCA 3WFEL 5A3IC 2WW8A 3OKKB 3MRBA 2V7HA 5KVFL 2VZ1A 2FBOJ 3MNZB 3GSNB 3V52H 3QR2A 4JPWL 5CJOH 5I1GL 3TFKD 2EO1A 5H35B 1HQ4B 2Z8RA 3SGDH 5C0GB 2X2YA 5T1DH 3TFKA 5LBSH 1GAFL 4L9LB 1AQKL 1BZ7B 4FRWA 5F9JA 4P9HH 5D71H 1KIUA 4Z7UA 3VFSA 3HC3L 2DQEL 2XTJC 4ZS6C 4WJ5A 1NMBH 3IDYB 1VFBA 4QHUB 1CGVA 3DV6B 5HY9B 1DEDA 2DQIH 1VHPA 5LJYH 5EOTA 3DROA 4XT1C 3WO4B 4XC3H 1W0VB 4X7SL 5IG7B 4OCRL 3MUGA 2P47B 4Y2OA 1Z9OA 1RZKL 3F7YA 4FP8H 3RGVC 3WFCL 3RVUD 1J86A 2NY5H 2NNAA 4ZTOL 5JHLH 2ZJSH 1ZANH 4KY1L 1HXYA 2VN4A 4S1QL 5F7HA 3GHEH 4KK5C 1RIHH 4DUVA 1DUZA 1I1YA 1KF9B 4PRHE 1DSFH 4PRAB 4DW2H 4X6DB 5GZOD 5F1IA 1ZHLB 4O9HL 4XVUD 2IWGA 1DBAH 3DLQR 4YLQT 1QR1A 2KQMA 5TH2A 3TT1L 4QXUL 1SVCP 1IKFL 3NAAL 5CINL 4GW5A 5IF0B 1XZ0B 4WUKH 5E03A 4HCRA 4AIOA 5ALCH 3DX7B 3MRNB 3EBAA 1M7IA 5AWNH 5C6TH 2IQ9L 1LP9B 5CBEA 4H25A 4PLOB 3E6FA 3S97C 4WW1B 1QSFE 3O3EA 2R2CA 3EYQD 3RVVD 5FYLE 1TQCB 1T0MA 4LIQE 4Q9QL 4RFOH 4DGYL 5FUZH 5J11C 4XNUL 2BP3A 4ZUUA 3ARDA 1OLZA 3THMH 1JGLH 3DVGA 1IGIH 4JY6B 4IIQB 4IMKA 1RUKL 2Q20A 5TFSL 5FHAH 3B8SA 2Y07L 4PGBA 2DLIA 3G6JA 1QKZH 1A7NH 3OZ9H 4TNVF 3K74B 4PP1C 3RNKB 3I75A 1C5CL 2Q86B 3VD4A 1X5IA 4BH7B 1A7PL 4V1DD 5HYEA 1FFNB 5JW4M 3NZHL 5FK9A 3QUML 2XWJA 1F4XH 3JWDL 1I8KA 3KNBA 3QPXL 4JFFA 3PQYD 3CFCH 4G5ZH 5MI0C 5T5FH 3PNWA 5FA3B 3KYNB 5EPMA 4BZ1H 3T0EC 3GI8H 4X6CA 1QRND 1DQJB 2BK8A 4HW6A 1KLGA 1A47A 2BFVH 5L2JA 3HG1D 4M8QB 4Z7WF 1GJIA 2VDPL 4R2GB 2APBA 3ZE1F 1ZA3B 1U3HA 3GMPB 5DFTA 1VESA 4YE4H 5HHNB 5BS0D 3L3OB 4MAUH 4KROC 3QUXB 5HI3C 1WBYB 4WCYL 5I0ZA 4ODXB 5C3TA 3SBWC 1AFVL 3EYFB 5I8OH 3QH3B 2XWBA 4Y1AD 4O51A 1HH9B 1HWHB 2FYYA 1WIPA 3DXAD 3FAWA 1FQ9C 1B88A 3GMLA 4ODSL 1C1EH 4N90E 3V0VB 1LO4H 1MLCA 1NBYA 5F6HJ 3QDME 1S9VA 3O11A 2VDMH 3KXFA 2KDGA 5HHVL 3NTCL 3VXOA 1YEHL 2XNAA 3QIBC 3RAJH 4XB8A 1WWWX 2CJUH 4ZO9A 2CSPA 2DM2A 4N8CL 2VC2L 5GRJL 1VENA 4HKXA 4FXKB 1ACYL 3PL6C 5I17B 1G7IB 1KOAA 2H8PB 3GSVA 2WM0A 2NW2B 3J8F7 2YC1A 1I7TB 4J6RL 5HYFA 1YECH 3MBEB 1XF2B 1VACA 3ECBB 3CSBA 1XIWC 2C7UA 3RIAF 2IAMC 2BC4A 4KKNA 1S78C 5ECJE 2F58H 5F7MC 1FG2B 4ERSL 4YPJA 5T3XE 2Q8BL 4KMQA 1FJ1A 2XZQL 4X98A 3SDXF 3FRPA 1MFCH 1RJZB 1TQBB 4JFEA 4LNRA 4XH2A 1WZ1H 1WV7T 2DICA 2XZAL 4KXZI 5MHSD 3BUYB 1H5BA 5HDOA 5DRWA 2GSIB 1HOCA 4ZFZB 3WIHH 4EVNB 3HAEG 1I7UB 4K07A 1NFDB 4JCMA 2I60L 4LKCB 3WMSA 4D8PB 1Q1JH 1XGTA 4EXPX 1JWSB 3QNXA 3LEVL 5D70H 5FHBL 5L7XH 5C0ND 1OTUD 2NR6D 5CSBA 4MVBC 3T4YB 5DHVH 3HC4H 5FKPB 1MJ8L 3EFDH 4RIRA 1SYVB 3SDYH 1CICB 2D0HA 3LRSA 1XH3A 4HUVA 1BFVL 3DGGB 3NCYP 3K8MA 4GKZB 3O6ML 1RZFH 1I4FB 3EOAB 1KIPA 1NAMH 4IRJB 2YMXL 4PJFF 2L0DA 4ONHB 3BKMH 5T33L 5AG9A 1QG3A 5DWUH 3A0OA 3B5TA 4HWBA 5ADPL 2IH3A 4NHUE 4FQQB 5DHVB 1OARL 2IBBA 3C5ZB 4KI5E 1PG7H 4ZTPL 3VWJC 1RUQH 3C5SB 5IHUL 3HR5B 3TO2B 1QEWA 1WCBA 3HAEA 2D4FA 4M7LH 2YUZA 4YPGA 2W65A 4Q6IA 1NAMB 4ODUB 3EO0A 3CAFA 2H26B 1HNGA 4AEHL 3OF6D 3VGAC 2VISA 5D2NC 4X7TB 5I1CH 3HI5H 5ADOL 1JTOA 1FDLH 4Z78A 4LCUA 5JDSB 4XP5H 2YD6A 3LD8C 2D0GA 1FGVH 3T09A 1E4XL 5CEYA 1RIUL 2YS4A 5FYLH 5J3HC 4LIQH 2RFXA 4JY4B 4NUJA 5HYJD 2XQYG 1WSST 2HP4A 1VGEL 3B83A 5GGQH 3GI9L 3B3IA 3BHBB 4HUXB 2VIRA 1EO7A 4NCC1 5IESL 5JR1H 3SE8L 2EDLA 3MXVL 4WFED 3T0WA 1U42A 3AMKA 4EBQL 5I1IL 5KSVA 2G5BB 3QDHA 3HKFA 4R26L 5C70A 5MEOB 3GMQB 4XZUA 4C56B 4G6FD 1ZTXH 2GUOB 3PWNB 4PG9A 5JHDE 5FYJL 5DYOB 4L3EB 4TVPH 2CK0L 5HDBF 1XGRA 1QSFB 5E8EB 3MYJB 4KTEH 2J8OA 4KDTC 1T2XA 4P5MB 4JDVB 5HSFA 3BN9C 4B7IA 2APXA 4X4MA 1X5GA 3LH2H 3TPUA 1P4LB 2O5XL 3PJSB 5FGBC 4UV7L 4XPBL 2J88H 3TA3A 4BFEA 4J3UA 4ETQB 3ULVC 1N6UA 5F3BB 1FSKC 3GBNH 1FE8H 4WHYG 4MDJB 5L2KE 1UFUA 1T66C 5DD5L 4HIIA 1A1OA 5IW1B 5JLZA 2H2SC 2KZ1B 5IEKA 3FRUA 1CIUA 1R5IB 3VXRD 3ZO0A 1WFUA 1NKRA 1JNJA 2PYFA 5EU4B 4K7PX 2GAZB 3D2UB 1KCUH 3DSFH 4C4KT 1V3MA 5CS7A 3VXRA 1JNHB 2BHYA 4H20H 2VE6A 5D7IF 3ZT7A 3QG6B 2RJMA 4AEIL 2RQ8A 5IBUG 3KS0J 5HHMB 4NKIH 1OAQL 2VLJD 4PLJC 1EHLH 35C8L 2CUIA 3WUWA 4GQPH 3SE4C 3ZKND 1QFWH 4QCIA 3MJ6A 3RU8H 4HWEL 3W2DL 3N85L 3MV9E 3VFOA 2LABA 4E41A 3QIUB 2E7MA 4R96A 5BZWB 2ZOLB 4ZUTB 1T4KA 3EGSB 5IT2L 1L0QA 2VLME 5HHPA 1F58H 4Y4KA 1DE4B 5LWYH 5DQ9B 1XGQA 5J1TC 1W2KT 4JM2A 3LRHA 4UIMB 3FB8B 4ODHL 1LEGA 3HZYB 3P11L 4K94H 2R0WL 5J13B 4MQ7A 1WBXA 1WTGT 3D18B 3QO1B 4M6OL 4X4XB 2X4TA 3RWJA 2FL5B 1B2WH 4F2MA 1GXEA 3LQZB 1F8TL 4DKEL 4NC1C 5J6GB 5F89B 1V8HA 1L9MA 3S36L 3JV0A 2AJZB 4TUOA 1NSNL 4AJ0A 5ID0A 3JTCA 3MLSH 2OL3L 1MJUL 4DN3L 3EDJA 2WUBL 4H8WH 5E2VH 1P84J 4XB7A 1M71A 4JFHE 1MJ7L 2VLKE 3VWKA 4JDZA 5KN5B 4C55A 3DX9B 3U4AA 2DI8A 5SV3A 2AK1L 1HZHL 1I7ZA 3VFRB 1ADQH 1Z9LA 6FABH 5HGBA 3OXRA 1FLRL 1KBGL 4MWFA 2EIZA 4P23B 3I50L 5C0CD 4M6NH 1ZT7B 3PWVB 3UTPD 1MQKH 4F7TA 3EDDA 1JWUB 2GJ6A 5EBMB 4XBEL 2Q7NA 1AE6H 2OP4L 3WV0A 3GSXB 5JO5B 2ITDB 4FS0A 5JORA 5DK3A 1NCDL 5IM7B 2XRAH 1DQLL 3C60A 3DURB 2W92A 4N5EA 12E8H 4QRPE 4M7JH 3WD5L 2AABL 1FVDB 5TQ2H 1JYXA 3JTTB 1DL7L 2IF7A 4KVNH 3CZFA 3WHXB 1WF5A 3KPQA 4QTIH 1MF2L 3NIDF 1PZUB 1CK0L 3LQAC 4PY8J 3BGFC 1A6TA 1RULL 2ZPKH 4YEEA 2PXYB 3CFIC 1OD9A 4WO4A 1A3LH 1W0WB 3U83A 8CGTA 5GISL 5KVGL 3KYKH 4FFYL 3L5XL 5FYKE 4NZTL 4F7CA 3IJSB 1JUFB 3ILPA 3P4OB 1M4KA 3C9NA 3WN5C 1M05A 4XCEB 1VSCA 4LGSB 4QRSB 3H2WA 4NHUB 3L7EB 1GL4B 2G2RA 1MVFA 4HPOH 3ZKMC 4Y2DA 1ZLWH 1CLZH 4L29A 2P43B 4HS8H 3KDMB 3CXHJ 3OAYK 1F11B 4HJGA 5C0IA 3G6JF 5CMAB 3DV4A 1S7RB 3BAEH 1A1NB 5GGTL 5INCA 2PTUA 4APQB 2PYED 1TTUA 4J2XA 4ZOEA 1YN7A 5E2JA 4AMKH 1WEJH 5H8DA 3VXSD 4O00A 5D8JH 1NUFA 4QXGL 1SM3L 2P5ED 3RDTB 3ALWA 4LLYA 3TO4B 4NWTH 2O93L 2XZCH 4K3HA 2EDXA 3MNWB 3V5DA 3P77A 5DVNA 4RGOL 2CIIB 4ZOCA 3GO1L 1Z5LB 1FZOB 4X6CF 3CH1B 3D1MC 1A3RL 4A2MA 2ZWLT 2OSLA 4EDXB 1G7PA 1MLBA 1DUYA 4L8SC 2HN7A 4KTDH 4LFHD 3BPCB 3STLB 4QRQB 2EIDA 4L4TA 2VDLH 1J0IA 3ARXA 1D9KD 5J9PA 4WHYH 3B5GA 4NNPL 3RWEB 3AY4A 1OB1A 4JFOA 4Y4FC 2B4CC 5JHDB 2R39A 1IM9A 1U8NA 1NPUA 3LMJH 4F9PA 4FHBD 3HMXH 1OD7A 3DGCR 3Q5YA 1VEOA 4ONGH 1ZVSB 4Z76B 2IMMA 5HHOA 1TCRA 1OAKL 3UXFA 4LEXH 5EO9A 1MCRA 2XIDA 4IMLA 2ICWB 2CRIA 4JANB 1KCSH 1ZT1A 3K2UH 4OGAC 3BP7B 2RB8A 5FCUL 5CGYC 1CR9L 1EO8H 1Q8MA 1HHKA 5D7LA 4JVUA 5ISZB 3NPSC 2FZ3A 1YNTA 3P0VH 4PRPA 5EFIA 5BMFH 2HFGH 5HGHA 1F45A 4Q9RL 2ZSWA 1MWAH 2VR4A 5C1MB 4JO2L 2PCPA 4OIIL 5SWQA 5L2KB 2XXMB 4P5TD 4XVTH 3CFEA 5DSCB 3FJTA 5H37G 3JV5A 1BQHA 2AJXH 1PQZA 1TVBA 4RBPH 1T03L 4PJGA 5T5NG 2CLVA 2UZXB 4PG2A 4UINH 2AEPL 2E8ZA 2YD3A 5FM5M 1KPVA 4WFHD 1J7VR 5D7JB 3QJFB 3KPSA 4JZNB 1RQ5A 4OFYD 1R5VB 3AU1B 4WRLA 4Z7WE 1IGJA 1ZOXA 4MXWH 3WE6B 3I6KA 4AM0A 4WUUD 3EUUA 5DRNB 3HNSH 1SMOA 3ZE1E 2D7QA 3VFWA 5I73C 1E4XI 2QSTA 3G08A 4WI6A 2QKIB 1MWAB 3O6FA 3MRDA 3S8WA 2NX5D 3TYGL 3FQTA 3QUZB 3MUJA 4Y4HA 4KJWC 4P2RD 3MV9B 4PRID 4QYOA 2FJHB 2W59A 2WUCH 5KAQF 4M6ML 2JIXD 4HLZG 1VGKB 3G5YB 4WFGD 2Z8SA 4DVBA 5FYJD 3EZJB 3SO3B 2XZZA 2ZG3A 3IVKA 4S2SB 4P2OB 2F19H 2FJFB 3OAZH 3MFGB 4JN2A 1RUPH 4NRXA 1L7TL 2XN9A 4NQEE 4F8QA 3T0AA 3WFDL 2CUMA 3QNZB 2DLFH 4D9LH 2I27N 5HYQB 2A1WH 3MRGA 2BSSA 3I3BA 1BFOA 1U8OA 1N0XH 3QZWA 4KHXL 1P4BH 1YN6A 3TJHD 2A0LC 1DDHA 2NY0B 4YGAB 4MJ2A 2EDRA 1DLHA 1TNNA 5A2JH 1OGAE 4LPUA 4L5FL 2VLKB 1B4JL 3PXJA 4MA3A 1UM5H 3AM8A 4HZLA 5DQJA 1RZJL 3SDXE 5IJKA 2MQCA 4HBCL 3RI5K 3BI9X 5BRZA 2X70B 3T8XA 3WLWD 3CMOH 2AJUH 4NRYA 3PHOB 4NQXB 1MOEA 3N1QC 4O02L 4WV1B 4PLNC 1KNOA 2UUDH 3MR9B 3CVHL 1NCWL 4UMGA 3O3AA 4U6YB 1XR9A 3GJFA 3M45A 2OR7A 4CMHC 5SWZD 4JN1H 5GS0L 3ZDXF 3UZEA 3FT2B 4Y16C 5JZ7D 3VGBA 3T0BA 3D3VD 4YFEA 4HIEA 5I18H 4XCYB 3K4AA 3JVGC 2WANA 4XI5C 1TPXC 2ATKA 1QSEA 3T2QA 3MRHB 4NQCB 1TZHA 4NP4L 5EZOL 2NY3D 4FXLA 1EAJA 2APVA 1K4DB 4MD0A 4G6JH 4KQ4L 3VRJB 2IG2H 1JTTA 4PJFE 3OAUH