3M1BA

Crystal structure of human fcrn with a dimeric peptide inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
263
structure length
263
Chain Sequence
LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of monomeric and dimeric peptide inhibitors in complex with the human neonatal Fc receptor, FcRn.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/inhibitor
molecule keywords IgG receptor FcRn large subunit p51
total genus 48
structure length 263
sequence length 263
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3m1bA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3m1bA01
4L9DA 3ZDXF 4K8RC 3GI8L 3DVNB 4NCC2 1I1AB 2ARJA 3ZDYF 3MUJA 5CAYB 4LCCC 4OCYL 1KJ2A 2OJEA 1T4KA 3KHQA 5E5MB 3SO5A 3CSYB 1R5IB 1G7IA 5TE4L 4TVPE 1U42A 5EORL 2QKIB 4Y1AB 1T0MB 4GO6B 3RWDA 2ZUQB 5DRWA 2X1WL 3OB0H 4LLMB 3MBXH 4Q9BA 1UVQA 3G6JA 1LEKA 1MRCL 3FT4A 3TT1L 3QAZB 1JNJA 4TUOA 4JQVC 4OV6F 3LHPH 4HGWA 3T2QA 1JNNL 1TJHL 4XP9L 4KMTH 1FDLL 5TF0A 5ANMA 3E2HB 3JBG7 3W5MA 4UAOB 4QXTB 3WFCL 3EJZD 2FBOJ 3BE1L 2A74A 4YH6A 2OMBA 3NPSB 3VD5A 3W11C 3ZT6A 3KPMB 1JRHL 4H5SA 5DD5L 1MWAL 1H15B 5F1NA 1DN0B 4A6YL 4Z7WE 3SDAD 1JPSL 3MOBL 3SGJC 2IH1B 1KJ2B 2C7UA 5HGGS 4HFWA 4LSRH 4UT7L 4OCWH 4CMMB 2DQUH 3BZFA 3WN5C 1D5ZA 1G9ML 3N0PB 2DMKA 5J1AB 4YZFF 8FABB 3WFBL 2ICCA 2PUQT 4JZJA 4DQOH 1HSBB 5C0RL 3I9GH 2UZXB 4NC1E 2IF7A 1FGNL 1QVOB 2GFBB 4QRUB 1XR9B 4I0CC 1MFEL 1A3RL 3MLVL 5EDXA 3NCBB 5I1AB 1NCUA 2LU4A 4G8IA 4W6WB 2P7TA 3QQ3B 1OQXA 4GJTB 4N5ED 4JM2B 4Q6YA 1RJZB 1NFKA 2DQDH 3LB6D 4F9PA 5GRVL 5I1LA 5IM7A 4EEEA 3ZKQD 1WWCA 5K9OB 1PG7L 4U7SA 1CFTB 3RL2B 3P4LA 2DN7A 1KJ3L 3RTQC 2WWMC 3C87A 3TH3T 5FOBA 1WIUA 3QEGL 1H3PL 2BVYA 4IMKA 5L6YL 4PIRF 2Z8RA 3A6BH 1GGIL 2ZCLH 5HVHB 1PLGH 5DSCB 1MFBL 1UACL 3FB8A 4MS8D 2GJ6D 4GKOA 3U2SB 1OSPL 5FGBA 3KPQB 4PY7A 3MMEA 2AKRB 2VDOH 1RJYB 1DEEB 5JQ6L 4C59B 1J12A 4R90H 4MDIB 2HJLA 3B5GA 3QUZB 1JF1B 3RWEA 1DP0A 1I9JH 4JN1H 5FUCC 2M26A 4LLAA 5J6HA 5GGSY 4WJ5B 3TV3H 4JQXA 4OCNC 4LLUB 3GK8H 4Z7WF 4Y5XC 2NTFB 5BZDA 3O3EB 4M5ZH 5D93B 3AXLA 4PYHA 5I1GH 2ED7A 3VMPA 4Q6IC 5I1KL 4EI6A 3RI5K 4XH2B 1WC7B 1MFAL 5CSZA 3ECBA 3BZ4B 5JW4R 2A73B 1XCQB 5KSBA 2QSVA 5T33L 1MCRA 1XIWC 5DEGA 3HZKA 3MXVL 3NIGE 1KPUA 4ODSH 3HHRB 1NLBL 3SJVA 1A1OA 1EFXA 3DUSB 12E8L 4EUPG 5GS0C 2BERA 3BP4A 4N9OB 3QXDA 4Y4KB 5EC2A 5I74C 4G5ZH 2E8ZA 2CRMA 3VFNB 3AB0C 1LILA 3ILQD 5ACLA 1MLCB 4QRSB 4FHBD 1BGXL 5IFAH 2VO5A 1E4KC 2X7LA 3BN9D 3V7MA 2VLRB 4LLQA 3QO0A 1L6ZA 3B8SA 3L5WA 1ZS8A 1DJSA 3O3EA 2C1OB 3V6OC 1QLFA 1A6WL 2DBLL 5EBWB 4CU6A 3QI9D 3K2MC 5BZWA 4P5MB 2A83A 2HKFH 1XH3B 2OLDA 5GISL 4R4ND 1IAIL 1D9KB 2VL5A 3U4BL 3A0OA 2J6EL 1YY8A 1CXKA 3P9MB 3SDDC 1HOCA 4M61A 4P0DA 4F57H 2YMXH 3AU1B 2MMXA 5IVZB 1S9WA 4HJGA 1CE6A 1G0DA 1KN4H 5D7IE 4G6AC 1Q38A 3O4LE 2P49B 3P11H 1A9BB 3O6KH 5SX5K 2FEEI 1WBXB 3D25A 3QIBD 3RWJA 1A7QL 4X4MA 4HH9A 2FLRT 3E6HA 1BPVA 2MTPA 5C0IA 3QIUB 4PY8J 1OVZA 3ARBB 5EA0L 1H5BB 3M17A 4KRMB 4OFKA 5CILH 4PJEF 1P7HL 5JPNA 4C4KT 3VXRB 3RJQB 3RY6C 1N6QH 1XGUA 3EFFA 2X41A 3B3IA 3MACL 4JFZL 5JXEA 2OS7A 2X4TA 1E6OH 3VXUD 2FCBA 4AIZB 4KKBC 3O6MH 1Y6NR 1SBSH 2H2SD 3HE6D 1BZQK 3UCRA 4P2RA 1QR1B 1HKLL 4PD4J 4NZTL 4XTRC 1I9IH 2F58L 4J6RH 1JPGB 1YEIH 1HDMB 4WV1A 5H94A 5C0CD 5L88H 3VWKA 4MJ5B 3OAUH 4XGZB 1SM3L 4Y8DC 4AL8H 4MNQA 1RHHA 5FYLE 2F53A 4MNHA 4XMKH 4IRZH 1OTSD 3DHJA 4IRSB 1OSZB 3LV3A 5E7FA 3OF6A 2JB5L 4OF0A 2HN7B 3HN3A 2NY2C 2MFNA 3IDIB 2Q7YA 5FYKE 3F12B 1OGAD 3UC0H 1KCLA 1S7WA 4HJ0D 5IFHL 1DUYA 3VA2C 1UFUA 1CR9H 1A3QA 4NUGL 2XN9A 3HI5H 1TZGL 2W0KA 4B41A 4F8QA 1FV1A 1CXHA 1ZA6A 4J4PC 1AH1A 2P47B 4AY0A 3QDMA 3UBXI 4LLVB 1OP3H 3PQYD 4J3TA 1T2QL 1BJ1H 1K4DA 5K9JH 1UZ6F 1OARL 3I02A 4X98B 5E2TL 2VLLB 3MJ6A 4KMQA 4WUUD 5BW7C 4CVWA 2AJ3B 4Y4FA 2CLRB 4GKNA 2NR6C 2ICWA 1AXSB 2D0FA 3PJSA 1MREL 2ADIA 3ARUA 3H7BB 2NXYD 3RNQA 5F1OB 5TDNB 4PREB 3V0VB 1MRDH 4XHJD 1FN4A 1HQ4A 5ESVB 2XACC 4A2MA 4BUHA 4S1DC 1MWAA 1MFAH 2GJ6B 4DJMA 3WJLC 4YXLL 2DTML 3BGFB 2GY7B 2VR9A 1DL7L 3JZ7A 4FXGB 4PJ9B 1F4HA 4X80L 4QF1B 3QH3A 2X4PB 1QBLL 3X13B 3UPRA 3MJ7B 4LSPH 2V2XB 3OKMB 3K1KC 1KYOK 4CVUA 1JPGA 4WV1B 2NY2B 2P43B 1UH3A 4M8VA 5CBAB 4JAMB 3V5KB 3MR9A 4DKDC 1UWEL 1EGJL 3K4DA 5SV4A 2Q87A 1HK6A 2YXMA 5DZNA 5E1AA 4R4BB 4TULH 2AJSL 2XN9E 4XXDB 3K81A 4LF3A 4Z6AT 1RIVL 1TETH 4ODWA 2BVOA 3VFTB 4AMKH 1ED3B 2XKUA 3QDME 3GMMB 8CGTA 1DLHB 3FQXB 2ATPB 5CJXA 1L9NA 3MV8B 1F42A 3VD3A 2J8OA 2QLVB 4S2SB 3U30C 1A6UL 2MKLC 3Q5TA 1LGVA 1BQHA 3GI9L 3E8UH 1JN6A 1KB5H 3T2PA 3ZSSA 5DQ9B 5GRUL 4ZYKB 3L1OL 3C5ZB 3CFJB 5DRNA 1AHWA 1RZJL 3JV5A 4FQ2H 1RUML 3BWAA 3JWOC 4PJ7E 1OGTB 1QSEB 3QNXB 5EA0H 4ZTOH 4IS6B 5EO0A 4P3DB 4NFCA 2MHAA 4PRHD 4DK6A 1MHPH 1HIML 5E2VL 1JFQL 1JPST 1A6AA 5T1MA 4DFHA 3BKCH 3BGAA 1ES0A 4G6FB 1F3JA 5LAXB 5MHSD 3IU3B 4QOKD 4W81A 4JCMA 4EUPA 3U0PA 3BUTA 4GOSA 4MQXD 3BPCA 3BT2L 1FNGA 3FO2B 5DO2C 1A0QH 3A67H 1BQLH 3S96B 2GFBA 4OCWL 3F5WA 4PGBA 3TBYB 5IT2L 2KZ1B 3DRQA 4W68A 5HD8C 4HXBH 5T3ZE 4JDVB 1V7MH 4FQJL 3WJJC 1JRHH 1F90H 4XBGA 2DICA 2BSRB 4NN5B 4XPTH 5DUPH 5GJTH 4KMLB 4UQ2A 1JWMA 3O3AB 4LU5L 1FNFA 4OCYH 5DHXB 3QG7H 3ZKMC 3O6ML 5DJ8B 3R1GL 5F97E 2DKSA 3SKOB 4YHML 3KPTA 3C8DA 1GIGH 4V2BA 5I1DA 2BSED 4WCYH 1XAUA 3BH8B 4HKJB 1MIML 3RPIA 4QRPD 1P4IL 3RWGB 1I7RA 5CJQL 4ZOBA 3NA4A 1UKTA 4U0RC 3IFLH 1AQKH 2E9IA 5IESH 2UY7A 2YOCA 4E5XB 3SKNB 4RGMB 2UZIH 4NYLB 2F53E 3BHBB 1AR1C 1MJ7L 3V6ZB 4LSQL 3ZTNL 1OOAA 1BFVH 5DQJA 1P6AB 3WLBB 3QHZH 3UROR 4LLYA 4MD0B 3BJ91 1ZMYA 1KCUL 3BEVA 4QRRE 4LCUB 4UU9B 1GXEA 3WEXA 4KVNL 1IC5H 1PX3A 5D96C 4Z7OF 3PV6B 4PJBE 4NHUA 3P4NB 3DGCR 4TRPL 4F9PC 2NQCA 5BV7C 3JXAA 3HC3H 4Q97A 4LQFH 3ILPA 3EOYG 4GSDL 3CUPB 5DJAA 3VI3F 3W5NA 3GIVB 4ZQKA 1CGXA 1R5VA 5FOJA 3TNNB 4PB0L 5JW3L 3NGBC 4FQCH 1BZ7A 4WFFD 1YNKL 2R69H 3GEWB 4YO0A 4BZ2L 5INCB 3MJGX 3NMEA 2ZNXA 3NPSC 4HIIA 1T5XA 4R3SB 3IDYB 3ULUL 5JIHA 2AJZB 1HXMA 4GUPB 5E6ID 3SDDA 4ISVA 5DXWA 2R23A 5BS0A 3GGWB 2ZG3A 2CKBA 2Q3ZA 2Q76B 4NIKB 3CK0L 5I73B 2E7BA 1I1AA 5I1GL 2EYTB 3I50L 2XTJB 3AREA 4BH8A 2NW2A 4Z76A 1J10A 3TPUB 5CIPB 1MJJB 2FJFB 4XRCA 1FP5A 4NKDB 3MCKB 3MROA 4KVCL 4ONHB 4MXWH 2WV3A 2ZCLL 4WVRA 4ZXBD 4IRJB 3TP4A 1GGUA 2X4QB 3MJ9L 4OM1L 4OD3H 3FT3A 5A2IH 2LVCA 5EBLA 4BELD 5DK3A 5B3JE 4HWZB 1TJGL 5I1EH 2OL3L 5E2WL 5LQBH 3CVHA 1T1YB 1G0YR 5A16A 4EIGB 4M5YL 1FSKB 1W8OA 3DUUA 5FXCH 1EIBA 4KJWC 4JQIL 4OT1L 1C12A 3CMGA 1PEZA 3LSOA 4XVJL 4ZUWB 5MEPA 2RHEA 4KQ4L 1KPRA 4P5TA 1Q9KA 2J2ZA 2WQ8A 4PRHB 3C8KA 5INDB 3B43A 2CJUL 2E8YA 1KIQB 2ZZUT 1CLCA 1MCIA 4WW1A 4NN6B 2E7LC 1ZLSL 4NQXB 4WTZG 3PL6B 4PGDB 1EMTH 1ND0A 3KNBA 2HLAB 3QUKA 3B2VH 4LASH 4MD4B 3TIEA 1OLZA 4XNXL 3MNVA 2YUWA 4PJHB 3MROB 4ONHA 1A9EB 4UV7H 4YBLC 1T1XA 3MO1B 4PJXB 3GIVA 2HJKB 2ZCKH 3ALWA 5IB4B 1D5ZB 4ZNEA 4I18C 5C07E 3BIAX 1KUMA 4OZ4B 4ETQA 4I2XB 1U3HA 3MV7B 1ITCA 5GS0H 4O2FB 2XV6B 2BY3A 2NYYC 3ARPA 4GMTL 5CEXB 3WDHA 4FFWC 5KANI 1F00I 3MOAH 4X5WB 4R3SA 2UZIL 1RY7B 2E7HA 4NJ9H 4HSQA 4UINH 3LKPA 1VFUA 3DYPA 5JUEL 4ALAH 4OCXH 1F90L 3SDAA 1AGDB 3MBEB 5DI8A 3OKKA 1KLGA 2GJZA 2YC1B 4G9FD 2VXSL 2YKLL 2IALB 1OAKL 2JIXD 1T0NA 1LP9E 4K9EL 4K9EC 4XNYH 2CDGA 3QIBC 2FYYA 3U4AA 5LGJA 4PJDB 1XCQA 1RZIA 4Z0BH 2QKIA 1NUDA 4Y1AA 3RX8A 3HC3L 2C5DC 2ZKHL 1I3GH 2VXVH 3G6JB 3GJFH 1OP3K 5CS7A 2GITB 4Y4KC 1BQHG 5I74B 5BRZD 3AROA 1EFXB 3P4MB 4RFOH 3V52L 1G6RL 2UVEA 5IFHH 1K4DB 1VEPA 2DS4A 4JZOB 1TVBA 2R0WH 5EZOL 4R7DB 3RHWF 4DAGL 1NCBH 5FYKL 1ORSB 3MJ8A 5F9AC 2XA8H 4FABH 4JY6B 1JE6A 2EO1A 2WWMD 4FQXC 2PO6A 1HILA 2Z93B 5EO9B 3WIFB 2F19L 3PP4H 2YPLB 1OARH 3NIFF 3P77B 4JFEE 4Q6IB 1JWUB 2BVEA 4D0DA 4NHUE 2ZSVA 5F9WC 2Y7QB 2UV3A 4I3SL 3FOMA 4P9MH 2WBJD 1K6QH 4C56E 5F88A 3V4PH 1A9EA 3FQUA 1EGJA 3O6FD 5C08B 1KB9J 2QSCH 2BNQD 3FCTA 1Q0XH 4HGKC 3ZTNH 3O9WB 1KOAA 2WLYA 4NHCL 1MCJA 4GRLB 2H32H 1MCNA 2NX5B 3QRGH 2YD6A 4TSBH 2D0GA 4QRRD 4D0BA 3CDCA 3FQNB 1YEJL 2C3WA 3NFNA 4RQQB 2IANA 4H8WC 4TQEH 2VABA 3TJHC 5D6DA 5F1IA 3CD4A 1YMMA 5ACZB 5AAMA 5L2KE 3V5DA 2IQAA 3C08L 5I75B 3VFGL 1N5YH 2XQBH 2HVJB 4OFPA 1XF1A 4ZPTB 4ONGL 5K9OA 4WI2A 1KXVC 1LEGA 1XGYH 4JG1L 2DJUA 5DVOA 3LIZH 4GS7C 5C0AE 5I1HL 1RK1A 2DQCL 1INDL 2VZUA 5F88B 3T0EA 3VXME 2YHGA 4DKAA 4PRDA 3FRUB 1AHWC 3PDGA 4AIXA 2VL4A 3B3IB 4OJFH 5T5FH 4ZOCA 4ORZC 5ICZB 3QEHB 3LKNB 3STLA 4WO4A 1F4YL 4EN3C 2D7TH 5T3XE 1NAKH 4M7JH 4XC1H 4MJ4A 4G43B 4YHNB 1A9BA 4EI5C 1B3JA 2HJFB 4NQEA 3QDGB 4JVWA 3GSQA 3MGTB 1J1OL 1CTOA 3BEWB 3L7FB 4XZUA 2ZOKA 4XPHH 3MREA 4MB3A 1EZVX 3DLQR 4C56A 3EDKA 5CP7B 5HYJD 4ODUB 3R0NA 3U36A 2EC8A 4HLZG 5JORA 2PCPA 3DO7A 4KJQC 1C16A 1J7VR 2I26N 3GI9H 4HEPG 3LN4A 1L7TH 2YR3A 2GSGB 4D0DB 5F70A 1UKQA 4WWKD 3SCMB 3TESA 3KVQA 4PJEA 5HDOA 1EXUA 3SDCD 5C0GA 4ZPVB 5DRXB 4KUZH 3ARTA 3BZEA 2EDYA 2UWEE 3C9NA 1AJ7H 4U4BA 2WBWB 3TGXA 2V5SA 3VFPB 4KKAC 1GH7A 3MLWH 4QRPA 5T1LA 3LKNA 4WEUD 3KS0H 3ARWA 3MXWL 3V52H 4OLXL 3L7EA 4KAQH 2J5LB 1A14L 1ZTXH 3KPRB 3W9DA 2X4NA 3O2WL 2R1XB 5D5ME 5BW7A 3SGEH 3MODL 4GLRI 3RP1A 4OLUL 5HI4C 1ETZA 5FK9B 1QBMH 4NKOB 3HI6H 2D0HA 1A5FH 3SY0A 4DTGL 2XIDA 1I1YB 1KJ2H 3L5WB 1BQLL 1HHGB 3ISWA 4MYWB 1FQ9C 2DQFB 3O3BA 2YKLH 2WQRA 2ATKB 1A47A 4J3XA 5D1QA 4OCSH 4UIKL 4GRLC 3EGSA 4R96A 3OJVC 1MF2H 1S8DA 2DQUL 2VQ1A 3UTPD 3GRWH 1FO0A 1SJHB 3STZA 4OFVA 3BSZL 3OXRA 1QLEH 3ULVD 3MYJB 2Y36H 2YZ8A 3VWKD 1WFOA 1U0QA 2B20A 1UCBL 3MNWA 4N0CD 3RGVD 3OBAA 1FZMB 3LS5H 1AGFB 4UIMB 5FYJU 3EDFA 4UT7H 5ITFB 3QQ4B 5E9DE 1RZ7L 1JGLH 1AKJB 1H5BA 3RBSA 1LO0L 2GJ6E 1BIHA 2YD5A 4QXGH 4G80B 5ITBH 1FC2D 1QEWA 1FGNH 1HYRC 3OHXA 3D9AL 5C1MB 3KYOA 1LEIA 4YDKL 1SEQL 1UB6B 2JJTA 2PNDA 3EYVB 4KXZH 3ROOA 4TRPH 1AKJD 1I8LA 1WTLA 3OAYH 1OT2A 1NKOA 3UO1H 5SV3A 2FD6H 3WIIL 4BQ8A 1T2JA 4M00A 1X5HA 1IAIM 4Z0XA 4WFFE 5IB3B 4NZUL 1CE1H 5DRNB 1I9RL 5L6YH 3F65A 2X42A 3DGGB 1JK8A 1FAIH 4R4BA 4EDXB 1S7UB 5CKAA 4UTBL 1YJDL 1MHEB 5DK2B 4XCCH 3PQYA 5TFSH 3KXFD 1Q0YL 2NR6D 3PGCB 5HGHB 2ORBH 4YNYB 3BFOA 3UPCA 1JBJA 3RVWC 5IMOA 5JDSB 4FZ8H 2YD9A 1U8LB 1XGTB 3DRTA 1U8OB 2CKNA 1OP5K 2MPAH 4EOWL 4ODSL 4YWGH 4Y4HD 2D3VA 3HCVA 1KN4L 2CH8A 3K1DA 3QXAB 1MLBB 3CGTA 3IETA 5SWSA 3IDNA 1MJ7H 2BNUB 4PJXE 1YYLH 4L1HA 3GNML 3K74B 3G5YA 1YPZE 4HIEB 1NGWB 3LN5B 4JDVA 4X6BA 1BEYH 2CDFB 4APQA 1DDHB 4YXHL 1KIQA 4JKPL 2RFXB 3RZCC 3FOLB 3JTCA 1NAML 3X3FL 1F4WH 4KVNH 1IEBB 4N9GA 1CLYL 5HGHA 4HBCL 3EHBC 3Q1SH 1F11A 2A73A 1OGAA 3KPSA 3U30B 2WWKO 2XTLA 3HZKB 4HF5H 3PDOA 4Y1AD 1RZKL 2D7PA 3IFOB 3LKOA 1JWSB 4Z7OE 5FA4B 1MI5D 4HJJL 4ACPA 2ZWLT 1EEQA 2WINA 4G6FD 1S7QA 3LS4H 5T3XH 3F6IA 4X5WA 3F5WB 1ZHBA 4X7SH 5JOPE 4WW2C 1MRCH 5I1KH 2OI9C 3BXNB 3SOBL 4P49A 4DVBA 1N6VA 4N5EC 2DIJA 4RFEA 1BD2A 4OLYL 5E2JA 1X5XA 1M7DB 4KK8C 5C8JB 1VFBA 3GJEA 3MV8E 5JW4M 3GFUA 3IFNH 3PQYB 4U6YA 5C0EB 1G7PA 5J0BA 2G60H 4U6HA 1ADQA 5J1SC 1VADB 3QUYB 3E6FB 4Z7WA 2LU7A 4G9FB 3UJIL 1X44A 2WBJA 4Y5XB 5HTSA 2XRAL 1IL1A 4NO5B 3IDJB 5GGVY 4XNQA 4YPGB 3QAZC 1RUQL 2ARWA 4P46B 3I3EA 5K59E 1G9NH 4WDIA 3HZVA 3D85A 4CW1A 2XPGB 3RTQA 4YK4C 1IKNA 1NEZG 4XT1C 5JIKA 3ARDD 1JF6A 4UV4H 1R3KA 4DUXA 4L4TB 1GZPA 3D25B 5GHWH 3VMOA 3QEUB 4LIQH 5F7EL 4HC1A 1TQCC 3NFSH 3IFPB 4NQTA 2NZIA 1IGFL 5KVFH 3VE0A 3UTPE 5EO9A 2XZAH 4TVPL 1ZT1A 4BFIA 4M48L 5C3LD 3BSZH 5L2JB 3DXAA 4NKDA 2I9TA 4QXGL 1QLEL 5EUKB 3QA3B 4Z7WB 5GS1A 3UEZA 4DN3H 1YEEL 2I5YL 2IH3B 3ETBF 4P2OC 3CCHB 3QUML 3IDJA 1RUAH 2HP4A 5F9WB 3TNNA 1IILE 5H35B 4U1NA 3CFBB 3BN3B 1KT2A 3NABL 5EN2A 4U6VH 1H3PH 5C0AD 2RR3A 1I8LC 3SQBA 1UYWL 3TWCL 1D9KC 1NMBH 1RURH 4P2CG 3VU2A 1I9EA 1QKZL 5FAAA 5E1HB 3BXNA 2ZG2A 1UM4L 4ELKB 1CFNA 2H41A 3TBSB 2FWOA 2DJ4A 5CWSA 3UTSB 1Z0MA 4JGJA 2J8UE 3DSFL 4FNLL 2VZ3A 3IFPA 1FBIH 3C2AH 4RMRA 2YD4A 1MVUB 2XWBB 3MLYL 2C4FT 1MCWM 3MRDB 2VZVA 5D1XD 3L3IA 5CP3A 3AREB 4BH8B 5AYQA 3HI5L 4YDVB 2G5RA 1OW0C 1NFDE 2V7HA 4NNYA 4IOFC 3RL1B 5DRZA 4LHQB 3P9WB 1PVHA 4G3YH 2W1NA 4PJIA 5EBMA 4WIQA 3O4LA 4U1IB 1T2QH 4M93B 3GUTA 3BZ4A 4IRJC 4TSAL 3FAWA 5HYEA 2QQNL 3VFVA 2HTKD 1F97A 1G9MH 4HC1L 2DLFH 2E5EA 1CQKA 3JTTA 1JUFA 1I7RB 3IAGC 5FYLL 1QRKA 4XMKL 4KDVA 1LO5A 3MLTA 3MLZH 4U7KA 3BD4A 5CEXA 5KW9H 3F58H 5CKGA 3I6GB 1ZANL 15C8L 4WW2F 3FZUD 4HUNB 4QRTB 1CFNB 3ARGD 1N4XH 4JDTL 2ITCA 4OFYA 1KG0A 4WTXA 4M7JL 3IKCB 4XC1L 4LKXB 1DSFH 4UB0H 3QUYC 3KPPB 4PGDA 4UTAL 3ZE2E 2P44B 2DWDA 3QZWA 1B6DA 1CQYA 1F4WL 5BQ7A 3KPRE 2L7UA 4FXKA 3KLAB 4YBLB 4PJGF 4YDIH 5D7LA 1JMXA 1FG2A 1OHQA 5TE6L 4YZFE 5FA3A 5D1ZC 4BFGA 3FQTA 4ZOAA 5EG6C 4Y5YB 3GO1H 3K2UL 1UZ8B 3JTTB 3MRLA 1T3FA 4NZRL 2YWZA 4NSKA 5FCSH 3FTGA 4HDIA 4MDJB 3B5HA 1WWBX 4CVXA 1X7QA 4WW2A 3BAEH 5C0ND 4KRPD 4YHOL 1HEZA 3HC4L 4Q2ZA 3WLWD 3MX0A 2MSPA 1A1MB 3OJMB 4Q0XL 4LLWA 4PJ8A 3W81A 5ETUA 4U1SA 3HNVL 2I27N 3DOSA 4POUB 3PNWA 4JFQA 2CIIB 4EDWH 1EHAA 1I4FA 1U93B 2BOCB 2Z91A 4MD5B 3HE6C 4WHTA 1TJIL 1RJLB 4PJGA 1KELL 1B0RA 5GXBB 3ARZA 3BQUA 3CIQA 4F3FB 5IJKA 3S4SG 3B9KB 5HVGB 4IRJA 1DQLH 3FB8B 3TYGL 1HWHB 3PQYE 2R9HD 1REIA 2LTQB 1NQBA 2XT1B 1QTYT 3NTCH 2ARJQ 5ENWA 5EH1A 4HHAA 5TE7L 3UDWC 4CN4A 4OD1H 3V0WL 4ZMAT 3ZKXC 1H3XA 3BD3A 2KZWA 4JY6A 1B6UA 1NBVH 2DJSA 4P4KA 2H3NA 5D7IF 1HI6A 4KK5C 5ACZA 2MQ3A 5GS1C 1N5AB 4LGSB 5DVLA 5DC0A 2VDPH 4Q6IA 4WGWB 2LAAA 5IK3B 4P3DA 3ZT7A 5CJ5A 5JZ7D 1FFOB 4LCWB 5ISZD 4JG0L 3TBTA 4WHYH 3I2CH 5FCUL 1FVCB 3B9KC 1RZGB 4Y4KD 1A6UH 5D7LB 1W72B 5HHQA 1CD1B 2EYSA 3C60B 1I8IA 1T21B 3L95B 4ZXBA 2WIIB 4F57L 4LPUA 5AWNL 5IB1A 5FV1L 3OGCA 1G7MB 3RU8L 4OLXH 4KDTA 3HZMA 3O6KL 1T20B 2P8PB 4LIQE 2G9HA 3CFEA 3S4SB 4GBXD 3SE8H 3K8KA 3IXAA 4S1DD 1NCAL 4XC3L 2BY1A 2X1OA 2PXYB 2GTZB 5KS9E 1E27B 1BZ9B 3JV0A 3FKUS 3CMOL 5KS9A 3X14A 5I66A 4LLQB 3MRGB 4G6JL 1NC2D 5KN5A 2NY1D 1MHEA 4NRZB 4JPIB 3IDXL 3O3AA 4HS8L 4PLJD 5D5MA 1JYVA 3HG1E 3BPOC 2BOBA 1G7IB 1OAZH 3TM6A 3ALXA 2CDGB 1T2XA 2VN4A 4YDIL 1S78C 3S9DB 1SYSA 2EDKA 3I75A 5DRWB 1NDMA 4HT1L 3W9EA 1K8DB 5DUBB 4WEMB 4I18A 4PJ7A 2CK0L 3MLYH 2OL3H 4H1LH 1KJMB 2IAND 2GT9A 4KRLB 4QHUB 4F2MA 4Z78A 5KZCD 5T5NF 2R29H 3BEWA 3L7FA 1CFQB 1FL6A 4G3YL 3QNYA 4PRPD 1YEDA 1NSNL 2IPTL 3LRGA 1DVFC 3RQ3A 1WFUA 5KS9F 1RHFA 4G7YH 3ZO0A 2F5BH 3MRIB 5DQDL 1XIWD 5D5MF 5DR5H 1MCQA 4YBQD 5F44A 1UXWA 2EDJA 1A3LL 5D7LE 5HHXL 4YGVA 5F7MC 3T0WA 1PYWB 5I18H 1C1EL 2EO9A 4HKXB 5IWLC 2FDBP 3TH4T 5I9QB 5I1CH 1ZGLB 3QPXL 4HWNA 1I85A 5IFJB 3MFFA 3EFFB 1Q72L 5KSAA 3BUYA 4E41B 5AYUH 3EYFB 1UH4A 2MKWA 3QXUA 3NACL 4PR5B 1QFWI 4UMGA 4GAYA 1FYTA 4HMCA 1TJGH 2W07A 4LSSH 4K3HA 3V95A 3UJJL 2BMKA 3S98A 5I1AA 4WI9A 4X4ZA 1RMFH 4L8CB 1ZGLM 1C08A 4TUKL 1CICB 1EHNA 3VCLB 4KQ4H 3U83A 4LOUC 3BWAB 4JJ5A 1T1WA 2FHCA 1BBDL 4NJAH 4B5EA 4POYA 1MWAH 1HHGA 4GRWB 1CXIA 4BQCA 4Y16C 2QQQA 1TQBB 4P59L 4OLYH 2H2PC 1HHJB 3L3KB 3C8HA 5IHBA 2NY4C 3FRUA 4Y5XA 1FGVL 3ULUH 5BS0D 1WBYA 2VE6B 3EW3B 1G7LB 3TT1H 5IHUH 2DM2A 3ARVA 3JTSB 6CGTA 3GSNH 1A1OB 2HYMA 4NNPH 1KJMA 4QKXB 3UJIH 5HYSG 3DX6B 4DKEH 3BVNB 4NNXB 3CZFB 4OZFB 1OTUD 1TZHB 5FGCE 2V17L 3P4OA 4OI8A 2C26A 1CGTA 4RAUA 1X6LA 3GNMH 1OL0A 3DBXB 4NQSB 4NQCA 1BEYL 4KUCF 1BJMA 4J3UA 3DTXB 2VWEC 4NBZB 2ZPKL 3HRZA 4ZSOA 2GSGA 4ZSOE 3QFJD 3CXHK 2X4UB 2H8PA 2YPKA 4HXBL 3ARFA 1XH3A 2EDHA 1IGJB 4FQJH 4MNGE 4XP6L 3ZTJH 4OGXL 5IBLD 1PFCA 3LRSB 3VI4E 4NFDA 2IAMA 1X5IA 4LP5A 3CDFA 1NBVL 2XY1A 4ZUSA 1TITA 5L0QC 2EH8L 4HGWB 2E7CA 4Q9CA 1J9CT 2H26A 4OQTH 5DURD 1CL7H 4JRXD 2FJGA 1I9JL 4JN1L 2NY3C 4JG0H 5D9SB 4J3SA 4XPFH 3OKNB 4EJ1C 2I07B 4X7CC 3LQZB 2VLMD 2P8LA 5C2UB 2AI0L 1SEBB 4ZFZB 1I1AD 3FONA 1TJHH 3ZL4H 4P2YA 4PJDE 3VRJB 4PRHE 3SDCA 3HMWH 2VRAA 3MRNB 3MRBA 4JFEA 1M05B 4NN7C 2R1WA 4TN9A 2APBA 5MHSE 4L3CB 4PRNA 3MRFA 1R3IH 3A67L 4WI8A 4NM4L 5C7XL 3CZFA 4OZFA 5FF6A 3BDXA 5KANG 5TH2A 5HGAB 3LKQB 4G5ZL 3HPLA 2A6IB 2PTTB 2R1YB 1BVZA 1T1ZA 5CBEB 2EDWA 1HXMB 3WE6B 4Y88A 3A6BL 4RZCB 3V5HB 3FO9B 5FUCE 4KI5D 3D3VB 4B53A 3GSVB 4XNMA 1CFTA 2AXGB 3H0TB 1T04B 3QEQE 2FEDC 5I17B 1IBGH 4LEXH 4U6HB 2Q7YB 5C08D 4I0KA 2N1KA 4JZNA 3FONB 3BPNB 3E6FA 4G80A 2QQNH 3WNKA 3RGVB 5JLZA 1VDGA 4KJQD 2IPTH 3V0AC 4OCRL 4KZDL 4HIXL 2JCCA 3RI5F 5F3BB 1XGQB 4HDIB 5E8NA 1ONQA 5ALCL 5IQ9A 3O6FC 3GRWA 2Z92A 5DR5L 4WW2B 1FIGL 1OAXH 1R3KB 4S0SD 3HAEA 3LD8B 4HUKB 4J4PD 2YSSA 4M9OA 1A6VL 2F74A 2UZYB 3LSOB 4JO1H 4ZUWA 5C0FA 5DVKA 4QOKB 1NCDH 3QPXH 4U1SB 4F15C 1WZ1L 4IOIA 1HN1A 2VDRH 5DJXA 5E8OA 1T5WB 4ODXA 5KG9A 1L7IL 5C0AB 3T4AB 2BVPA 4MXWL 3OAZH 3R0MA 4YHKH 4XI5C 4JFHE 1D5BB 3OR7A 1OAUH 5JTWA 2O26U 1M6OA 1M05A 1MF2L 1YEKL 1AJ7L 3O4OC 1QACA 1RMFL 3S8WA 3LN9A 4GW5A 2DKMA 2JJTC 3GRWL 2BNQB 3KAAA 4XNXH 4Z7UA 4GG6F 1KB5A 3TZVC 2OL3A 4HXAH 5FYJL 4KAQL 4CADB 1QHOA 1HZHL 3MRKB 3VGAB 3BRGC 3O11A 3TN0C 2RQ8A 2H2SC 2VDML 3MRQA 2VLRD 4AEIL 3DECA 4MZ2A 4GBXA 4X6CE 1LQSR 2QJDA 2YSSB 1A5FL 4BSVA 3GSXA 5GS2D 2GK0B 3DX8B 1IGTA 3LN4B 2AI0H 1ADQH 1X4YA 2P42B 2QSTA 3CX5K 3HNTL 4WTZA 3RL1A 1MI5B 5FHBH 4L4VA 3F8UB 3C6SB 5C0CE 5J7CC 4ZPVA 1P1ZB 4FQXA 1CR9L 3MOQA 2Y1VA 4HJ0C 4ODHL 3TNMB 3LKSB 4M7ZB 4U1GB 2BNQA 1LO5B 3H9SE 4PRAA 1WLHA 4F7TA 2EDQA 4IIQC 5KSBF 5K9JL 2Z92B 4NQCE 1EBPA 5AEAA 5EUOE 4R2GD 3W9DB 4JPKL 3TJEH 4IJ3B 1KIPB 1RIUL 2EZ0C 5AWNH 4LQ1A 3T0EE 1QNZL 1XF3A 3MRCB 2XFXB 1CGWA 3GHEL 2IFGA 1R5WB 3MRGA 1OTTC 3O9WC 4MNGA 4NN6C 2AABL 1Q0YH 2YPLD 2P5EA 3I6LE 1AO7A 4PP2B 1NCCL 4ZODA 5ISZB 2F54E 2ORBL 4GG8A 4MHHI 3TZVB 1MCOH 4K7PH 4KI5E 4L4TD 3PABB 1IAII 3P9LB 5KVMC 5M7QA 1NJ9B 2Y72A 3T1FB 5ISZE 2XZQH 1UWXK 1LE5A 1HXYB 3MV9E 5DGQA 4YDKH 3TVMA 4NM8L 3QCUL 3OAUL 4MGXA 1Q9OA 4LSVH 5FDYA 2IGFH 1CFVH 2KQNA 1L4IA 5GGRB 4MCZA 5E94B 1A64A 5BRZB 5AD0B 1CIDA 4HV8B 1U2CA 2AV7A 4LAQH 4WO4D 4R97C 4Z78B 4J3WA 2Q8AH 3TN0A 3NFNB 3AM8C 3WN5A 3D0VB 4V1DB 1Z9MA 1DANT 3CXDH 5H2BB 4KHXL 3WO3B 3UBXA 1HHIA 3ZL4L 4Y8AA 4UNVA 4Z7VA 3C8KB 4LFHG 4UZGA 4BJLA 4OBRA 5A3IC 3ARBD 4P9HL 5DJCA 4MA3B 3QUXB 2EEDA 5EZLB 4MD5A 3TYFB 5IEKB 1H3UA 5EIIA 4RGNE 3RRQA 1FJ1A 1IC7H 2EXYC 3DROB 3IAPA 3BUYB 2VLKE 3GMQB 3HLAA 3LKRB 3TT3L 3KJ6L 2KPNA 2VERN 4LRNL 1TPXC 4JFOA 4UI2A 3T77B 1X7QB 4AM0B 4F33B 4EVNA 5F9OL 3AMKA 3SOBH 1RU9H 2AJ3A 1WFTA 4WY7L 4N0UA 4NKMA 5IKCA 1CT8A 3RHWK 4G6ML 3H7BA 2J1KA 1T83A 4O4YL 2WZPD 1S5IH 1HH6B 3ZDZF 5F96H 5HVFB 1JWMB 2ARJB 3UX9B 3BJLA 2YC1A 4DEPC 4NZJA 4KQ3L 1RVFH 3QIWD 3S3SA 4N1CA 5DJZA 3VXQB 2FH8A 4I48B 1U8OA 1KCSL 1IKFL 3MLUH 1CK0L 2OCFD 4ZDHA 2BDNL 4MJIB 3PWPE 2PR4H 3FO0H 2H6PB 3HR5B 3UJJH 3QNZB 5IROC 3OWEA 5DO2D 1P84K 1RZJC 3H9SD 3MQIA 4LGRB 1J0YA 3L5JA 5E4IA 1K2DA 3I6LD 4JFXB 1VCAA 3DSNA 1FFPB 2APVA 3EYQC 2GUOA 3O45B 3HRZB 4ZSOB 3KR3H 2VSCA 2BK8A 3EO9H 2V7NB 3RDTC 3VFWB 4G9DB 2M8XA 1M4KA 35C8L 3QI9B 5FOBB 4L3EA 1DQJB 1TPXB 1FJ1B 4Y5VB 1I8IB 3WJJA 3O4LD 4JO3H 3RWCB 1AGCB 4K8RH 1XGUB 1EA9C 2CLVA 2DQJL 3NIGF 3FMGL 4LRIA 4FQPA 4U0QB 2DLGA 1YUHB 2ZSWB 4AEIH 5C9JB 2HAZA 5C0DB 1AY1H 4ZAKD 2EXWD 5EBLB 2FHBA 3H7LA 4WU7A 5DDHB 4ELMF 3WSQL 3MV9D 4MAYD 1N7ML 3VG0L 3ARYA 5HGBA 5FO8A 2I9LA 2R2EB 5E2VH 3L3GA 4JANB 3HI6L 4HEME 4HWBL 4BKLA 3ARGA 5SX4I 2B4CH 3QSKB 4AEHH 2WWKT 2AXFB 4HUVA 4LGPB 1V3LA 4Y19A 3PNWB 3B9EA 5BXFB 1KIRB 1PYWA 1SJEA 3LS5L 1RK1B 5ALBL 2NTSP 1KB5L 3CFKB 1ZGLA 4JFYB 4M7KL 3GMPB 4RDQG 4K7FA 2DLTA 2R0ZL 4LIQL 4IHOA 1X5LA 3ARDB 3A6CL 1FL3B 5DD0H 2B1HH 1T22A 5TJWK 2VDQL 1LK2A 1ZHLA 1ZTXL 3PGDA 1PAMA 5EBGA 1MELA 3EYOB 3GHBL 3HPLB 2NXZC 43CAB 4F8TA 1FLRH 2OR7A 1MLCA 3L3GB 4MS8A 1U8HB 3KJ4B 3D39D 3RVUC 1MHCB 1KC5H 3UAJC 3RNKB 1QA9B 7CGTA 2B5IB 2R2CA 1TQBC 2AGJH 5F96L 1Z9LA 2HG5B 4PJ5B 1SVZA 1G6VK 1PQZB 5E5MA 2B4CC 4LP4A 2OTUB 1NEZB 2NCMA 5EOCL 1Q1JH 5DEGB 4HW6A 3HMWL 3ARRA 4GRWF 5GHWL 1KPUB 5E56A 5GJSL 3FT4B 5T1KB 3GM8A 4FTVE 4QRQB 5EU4A 4ZFOB 1XF2B 1OT1A 3RUGE 1AFVL 3QDJB 3WUWB 3RWFA 1FL5A 1KCUH 2C1PA 3AVEA 2X4NB 2LABA 4OI9A 1TVBB 4X4ME 2F54B 2W9LA 2AK1H 1FRGL 5CZVH 3QFDB 3MJ8B 4XPFL 5ACMA 3PHSA 4JJHA 3KPMA 4QTHA 3RBGA 2X7LB 1W72L 4Y4FD 1P84J 4X6BB 4P4KD 4RMQA 1H9VA 3EUUA 1J8HB 1UT9A 2RFXA 2BC4B 4PGEB 3O2DL 4NQVB 3UJTH 3C6LC 2BY2A 2PYEB 4KQ3H 5GZNC 3LOWA 4DZBA 2FSEA 5FKPB 1B4JH 1U3JA 2P48B 1YY8B 4OD2B 3I75B 3PWPA 5MENE 1OTSC 5JOFA 4YWGL 4CN1A 3KLHC 2HVKA 4XP4H 1LK2B 1ZHLB 3BVNA 4NNXA 2EH7H 2NY3B 1JI2A 1KFAL 4LHUB 3RWIA 3UBXG 1QSVA 4XXCA 4JGMA 2PYEE 2P7TB 3QQ3A 1I9RH 4QHMB 2J6EA 3L6FA 4FMFA 2F53B 3EOAB 3BP5B 4M62H 4MNHB 1INEL 2AJYL 3GI8H 1CF8H 4X6DB 4E41D 1SY6A 1FYTD 5EO0B 3UTSE 4G7VL 1JV5B 2AQ2A 3RZCB 3QJFB 5E8DL 4E0RB 2IPUK 3BZDA 4NO3B 3FT2B 1ZLUK 3KXFB 1FC1A 5GS2H 3O41A 4HZLB 1J0ZA 3QUYD 4AK1A 5IEHB 3OJDA 4ZD3L 1KNOB 3SE9L 4HUMB 4PJ9D 3OJ2C 4JDTH 2A6JB 2EIBA 1AI1L 3MV9B 5GS0L 4WO4B 3J8F7 3D3VD 3E8UL 5L9DL 1JP5A 1EJOL 4HK3J 4TPRH 5SWZD 2VLKB 4PLNC 1J0IA 2UYLA 35C8H 3IXTB 4FQ2L 1UKSA 3IJSA 2DQDL 3DYOA 1IC1A 3MRHB 5HPMB 5JXED 1T1WB 4NC1C 1XF5A 4QOKE 2O5YL 1XIWA 4UAOC 1SYVA 1RAMA 1VGEH 4NO3A 1TCRA 1H3GA 2D31B 5CHNA 2J3SA 2NXZD 1OD9A 1Y0LA 4LPCA 3EYUH 1EVTC 4RGNC 1ZVYA 3T1FA 2W0FB 3JV4A 3MFGB 5FB8A 3ULVH 3VJ6A 1I7TB 4U6XB 1D6EB 3QFJE 3VFPA 3T1WA 4QCIA 5TPWH 2L7JA 5HHMB 3QFJA 3H42H 2Z4QA 3MRFB 3ZDZE 2WUCL 5I16A 1QSEE 1FFNB 3WBDA 1E4KA 4HV8A 4X7SL 4PBWD 4G8EA 5DFVC 4LCYA 1VHPA 5GQBA 4GAJH 1FO0H 1BJ1J 1S7SA 1LP9B 3ULSB 1VENA 4LPXA 3TV3L 4KKCC 3EDJA 5DT1H 1C16B 4S11A 3V0VA 3L9RB 3HNTH 2DLHA 5ESVA 3V4VH 3O3BB 2C3VB 2XI9A 4XP9H 4N5UA 4OZGA 5ID1A 4TNVF 2FZ3B 5J6GB 2KBGA 1EDQA 5AAWA 3GUTB 1MFEH 5B8CC 4RIRA 3VI4F 3QO1A 1Z5LA 2WANA 4ZAKC 4FQIH 1YMHB 5FM5O 4YFDB 3P4MA 3MJ7A 1ZVSB 5KOMC 4R90L 1G9MC 1IEAB 4D9LH 5C09B 4H8WH 3WFDL 1A1NA 3OKEA 1P7KB 3SO3B 2PW1B 3C2AL 1LDPL 2W60B 4PG2C 4F15B 4MLSA 1CDHA 4K07A 4MNQD 1RUPH 3LPGA 1F6LL 1AD9A 3ZZ1A 2CMRL 1IARB 5F9OH 4UBDC 1JL8A 1MCHA 3RGVC 1AP2B 4KROD 5CMAA 5D6CB 1GIGL 5ELIA 5CLTA 4OLWH 2DQCH 4DGYL 2I5YH 3ARFD 1F3DH 4Y16D 3VFUB 4HPYH 4GSDH 1BX2B 4O4YH 5E6YA 4ZAKB 1LNUA 4YHYB 1CYGA 1KLUA 4LDLB 1MJUH 1OW0A 1FPTL 4AQ1B 1AC0A 4GKSB 3E6HB 2HRPL 3QFJB 1CD9B 1JTOA 1QO3A 3ARBC 2ICWJ 1N5YL 4EIZC 1MCCA 4PY8I 5GGVH 1EJOH 4X8JA 1HDMA 5H94B 2A6DA 2X4OB 5L8KB 1U91B 4PRPE 1BFVL 1IGYA 3GSRB 2VAAA 2Z8VC 4X99A 2BNRB 3WO4B 2O5XH 5ITFA 3IJYB 1FFPA 4WW1B 2AAVA 1PDKA 1PZ5B 3ARED 4M02A 2R9HC 4U7MA 1N59A 1F4YH 4NHCH 1YDPA 3T09A 5ISZA 3AS1A 2LU3A 3LPWA 5EUKA 4TSBL 1HE7A 5HI4D 4L8DB 4Z95L 5BCAA 4PJFA 4JHBA 3G9VA 4Y2DD 3MFFB 4OFIA 1X5KA 1NBYA 3FB5A 5ID0A 5BOPA 3STLB 5MP6H 1EEYB 4JPWL 3SGJA 1G6RB 1QYGH 4ONGH 1ONQB 1RIHL 15C8H 4Y89A 1WQVT 3CFDA 5JXEC 1QQDB 1EHXA 4I3GA 1CGSL 2XWTA 3VDBA 5MEOB 5J11C 3VRLF 5GGUB 1IGYB 1G0XA 2W0LA 4I2XE 4P5TC 4CJ1A 2J6EH 4LMQE 2C1OA 3OSKA 2QEJA 5DVNA 3CH1B 2BCKB 1KLGB 1BJ8A 2H9GB 3VGFA 2NY7H 4HFUH 5CD5D 2C7UB 1URLA 2CUIA 4HWBA 4KK8D 4U1GC 4DKEL 1VPOH 4K7PX 2Q6WA 4CUCA 3P9MA 5SWSE 3K2UH 1PZUB 2P24B 4DZ8A 5I71C 2ADIB 3INUH 3P73B 3UPRB 2ZCHH 5DK0A 3MOAL 1JZ7A 3QJHB 3D18B 5AG9A 4EUPH 3O11B 1MH5B 5BO1L 1V8HA 4FZEH 4R4FL 5E00A 4QGTA 1MJ8H 5E99H 4FTVD 4YQXL 4L4JA 1J05B 2YPLA 3O6LH 4U49A 4W4NA 1ZK9A 2G5BA 1OTUC 4BH7A 5D5MB 4G8FA 5B38G 1U58A 4F7MA 1KSRA 1SY6L 3MNZB 1A7RL 2Y4SA 4XPAL 1N2RB 2HFEB 2BP3A 2D7NA 2X89D 4MA1B 3S88H 3TVMD 3B8YA 2JJWA 3QQ9C 1DVFA 3C5JA 3BRDA 2R4RH 2NLJB 1DBKH 3RIAK 1TZGH 3UYPA 3SE4A 4ZXBC 3KHOA 2FO4A 1K4CA 1BVLB 1J86A 3TA3A 1S7XA 4FQIL 4DKFH 4JRWA 5B22A 1E4XI 4KDTC 2Q86B 4LL9A 1Q9LB 5ESQB 3VXPB 1A7PL 2DWEB 1F3DJ 2V9TA 5IF0A 2JJUA 1YEGH 1UC6A 4S10A 2APFA 3QEUA 1J87A 5CLWA 4HWBH 1UWEH 3VDAA 3PWUA 3NIDF 4NC0B 3OG4B 1Q94A 4EN3A 2ADGB 4NQDB 5KOVC 4L4TE 4OZIF 2O5ZL 4RNRB 4PJIE 3NCYP 3D2UA 1BQHB 1NDGA 2WBJB 1UB6A 3C5ZA 2X4QA 4P2RD 4N0FB 3CSGA 4YDJB 4O2EB 4U1HB 1HHHB 3W0WB 1FNGB 1NGQH 2P45B 4E9LA 4UT6H 1WZLA 3ZSTA 3VD9A 1P7QB 1MRDL 5GGSB 1JGLL 5MERB 3QUZA 3HTLX 4LHUA 3G6DL 2P1YA 5HGAA 1AD0B 1G7JB 2F53D 2KDGA 1CBVH 5AYUL 1S3KL 2DTSA 4L8SA 4JR9H 3EOTL 3PWUB 3EJZC 1GGBL 1KIUA 4BKLB 1A6PA 1XGPB 1P6FA 4LCCB 5CD3A 3TLRA 2G5BB 2AJSH 2RGSA 1S7VA 2E9WA 4Z7QF 4R2GB 2X9YA 5BVJB 4J3VA 3SE3A 3LEXB 1PD6A 4BUGA 4RNRA 4M62L 2MNUA 3FB7B 1AGCA 4ZO6A 2E7MA 1LHZA 3HUJB 4HT1H 2UUDH 4U0RB 4FFVC 5C0DA 5E8DH 3NFPB 4RGMC 4S1QH 5JIPA 3SBWA 2R0LL 2MJWA 3ROLB 5EWIH 1Q9LA 5GRXG 3IF1B 3QXDB 4OLVL 4XX1G 1T20A 2P8PA 4M43L 5IBLC 1JYXA 4C57C 1U3YA 2A9MH 3NIFE 2HH0L 1YN6A 4YHZL 1X5FA 2X44D 1O7SA 2JF1A 4OGAC 4AEFA 5EU6A 3VXUA 4CGTA 4XCEA 5DMKB 2DAVA 2NXYB 3MBEA 5DI8B 5FEBA 4M7LL 5BZWB 3UAJD 5I8OH 2JE8A 3DURB 2OJZL 3FRPG 4AT6A 5KVEH 1CZ8L 2Y5TB 3QG7L 2EXWC 2WNGA 2BJML 4U33A 3GZKA 4HMDA 3TO2B 5IV2A 3ES6A 1OLLA 1NH6A 3EGSB 1JNHA 4QXTA 1YYMH 5F93C 4DGIL 3QXTA 3B5TA 1NAKL 1AQKL 2IGFL 1YA5A 1K8IA 3INUL 4Z7VE 5SWQA 2FR4A 1I3RB 4F7CB 3ROLA 4M1DL 3CLFH 2ID5A 5ICXB 1FVDA 1NAMH 1I1AC 4TUKH 1XGRA 5D1ZA 1F6AA 4XNZC 5DURB 1N8ZB 2G75A 4MNQB 3T3PF 3ZLQC 4OIIL 3UTOA 2JCCF 2IG2L 4BSVB 3NCMA 4LNVA 4KY1L 2XTJE 3R8BB 4P48A 1YPZF 1IAKA 1FFRA 4X6DE 3GIZH 2DQGL 1U93A 1HNGA 2BOCA 3F12A 2OTUA 5TDOB 5E08H 5CP3H 1Z0NA 4FQ1H 3G04A 4CU7A 1S9YB 1WAAF 5LAXA 5C08A 4XHJC 4N0YL 5KSAB 5IT2H 1JPFA 2AKRA 5CEZL 3NABH 4W70A 1ZKAA 4QGYA 3U7AA 2JK5B 1S9VB 3NA9H 4UQ3A 1QFUL 3GBNH 1JF1A 3ZKND 2DBJA 4EI5D 4UNTA 5IR1B 4I8DA 1F8TL 3CFCH 1CLOL 1Y6KR 1KPRB 5DVMA 1HWGB 3V5DB 3EOAA 1CG9A 4JJ5B 2OP4L 1RZ7H 5CILL 3U2SA 2OTWB 2XQYK 4MD4A 1RJYA 4M7LT 3KDMA 1RV6X 1CFSB 4KTEH 3DXAB 4KVCH 1B0RB 2X4SB 1N6QL 3HC0B 3S3JA 5IQ7H 5DLMH 2EDBA 3L3DB 1OAQH 3UTQA 3UTZA 5JOFB 1WFNA 4PJCE 3N50A 1GJIA 1A4JA 2A6JA 1TZIA 1KENH 1GZQB 3V6FB 2AEPL 3UTTB 5L0QB 2ZUUA 5BRZA 2C4FU 2GSIA 3HPJA 4HHAB 1AO7D 1JI1A 4Q9QH 1MJUL 2GAZA 2YD2A 4I3RL 5IVXB 3FB6B 4OZHA 32C2B 3WFEL 5IR1A 1XZ0B 3BW9A 2PXYA 4CVZA 4MQTB 1DE4A 1J88A 3MRJB 5D8JL 4S1SH 1DQDH 4ZS6D 1F58L 1R3JB 1OQOA 3VA6A 2VUOA 4HZAA 5MI0B 4DGYH 2FATH 4P99A 3ELAT 4HPYL 4K3DL 3ZYZA 1NEZA 2NZ9C 3HE7C 1YNTB 5IVNA 4YHLH 4M8QB 3MA7B 4U3CA 4GW5B 3STZB 4PTUA 2IMMA 1KCKA 4IOFD 2HKHL 2K7PA 4LVEA 4ZTPL 3FO0L 3SDAB 1UM6L 2D9QB 2AJUH 5KVGH 2PYFA 3UPAA 3VFSA 4K94C 1A6ZA 1RZKC 3MJ9A 4R7DA 1T66C 2F54A 3WHE0 2EE9A 2FGZA 1T0NB 1MREH 2ICWI 3OB8A 3QHFL 2BSTA 4OZIB 3ET9F 5E1AB 4JKPH 1HH6A 5DMJB 5IUSA 3KR3L 2VDMH 1U8IB 3SGKA 4JEGB 4PJCA 1NANH 1LE9A 3TBVB 1UEMA 4KKAD 3S3PA 4GKZA 4N1HB 3N9GH 4HD9A 1TCMA 4E42B 5A2LH 1JZ3A 2X89A 1IQWL 5HYFA 4XBPA 3U0PB 3ESUF 3ESVF 5DD6A 1E6JH 3DARA 2B2XL 4P2RB 3P73A 4HG4J 5I16B 3NTCL 3HNVH 4LARL 3VGEA 3K3QA 4HCRL 3OR6B 3D18A 4LCYB 5DQ9A 2MCG1 1TLKA 2Z31D 2E7LE 3DVIA 1CD0A 2XNAA 4QY8A 1KCRL 3MZTA 1TJIH 1S7RB 5JOPD 1NCDL 3MRJA 1Q9KB 3QNXA 2G2RA 1YC7A 4GG6B 3VXSE 4CDGC 5EOCJ 3D3VA 3TZVD 2VKXA 4Y4HB 4D9QD 2CRYA 3H3KA 1VKXA 5GGTH 5C08E 3JSSA 4WUKH 2PO6C 1RJLA 3V4PL 1QR1A 1VPOL 3PABA 4OM0H 2P5EE 3RWEB 3KYOB 1ZWIA 3TVMB 5ADOH 3WFBH 5ICZA 4F7PB 2VNCA 1FHGA 2VLRE 2YPVL 1IM9B 4BSJA 5HYQA 2IQAB 4K7PL 4NRYB 4JO2L 1MY5A 1IEAA 3QIUC 4UV4L 2R4RL 5GRUH 1NMAH 5EFIA 3TN0B 4LSTH 1F8TH 3CFCL 2XNAB 3KLSA 2IQ9L 4MJIE 3RAJH 3C08H 1VACB 2ITDB 1PY9A 1IE5A 1Q94B 3O6LL 2ZP0T 3LMJL 5MENA 1U8IA 1MAMH 1NAMA 1PZ5A 1LQVA 5B8CB 3QG6B 3CXDL 1NCCH 1UEYA 3MLXL 4YHPB 1N59B 2DQHL 2NY6C 4BM7A 1MCOL 4ZFFA 1DQMH 4PJDA 1NDGB 1LNUB 4HKJA 3QWRD 3HB3D 3BMWA 1M7IA 1IQDB 4NPYB 4I9WE 5F1KC 1J0KA 4ZQKB 4U1LA 5DHYB 4ODBD 5FYJE 1CFVL 5JA8B 4K23L 4J1UB 3T0EC 4PJGE 3L7EB 3OR6A 4X8JB 3QRFM 1FFNA 1LDSA 2VZTA 3MLRL 3MRKA 4YIQA 5IVOA 3I6GA 3H6JA 1ZHBB 3P30L 5IBTL 2A83B 1QSFA 4EQ2A 4LBEB 4NO2B 4IJ3C 3IAQA 2A2QT 4QYOB 2R23B 5BVPL 1NGZA 2PO6B 4F7EB 1JYNA 5ILTH 1W72H 1T6WA 3OKNA 4Z0BL 5IKCB 4XPTL 5BOZG 5F72S 4HX1B 4MD0A 2GK0A 3DX8A 1SEBA 5E2UL 5GJSH 4JPIA 3PGFH 4PDCE 1JF5A 3LQAC 2DKUA 4U1MB 2KH2B 4RFOL 3A6CH 3ALPA 4DOHB 2Y07L 1WITA 4YHPA 4W6YB 2W9EH 5EO1A 1E0OB 4JRXB 4KJPC 3SQOL 5TDPB 1B4JL 3E3QA 3Q6FB 4JRYA 4PJBA 3CUPA 2IAMB 1NLBH 1B90A 1H5BC 1HNFA 5AZEL 4N0RA 1KC5L 3GJFK 5E8PA 4NKIL 4BYHA 4V1DE 2H26B 3FQRA 3PWJB 1OF2B 4HMEA 1CBVL 3WXWL 1QSFB 4HLJA 1FBIL 4FQLL 5FGRA 1ZHKB 1OCWL 3Q48A 2R0LH 2V2WB 4P5TB 1UACH 3LV3B 3FHQA 4R0LB 1H3WM 4O51A 1JIBA 4FQHB 4N0UE 2BCKA 4YC2B 4MQ7B 5D72L 5F89B 4K2UH 3U6RB 2HKHH 4PJAE 3DVGB 4PGCB 1P4BL 2I9TB 4ZUTA 4NWTH 4PJAA 3T0EB 2K1MA 1NJ9A 5F3HB 4NPYA 4PGZA 4EUPB 4ZD3H 4D3CH 5JLZB 4NT6A 4D2NA 3HI1A 1AHWB 2YRZA 4FP8H 1EFQA 1NGQL 5TPWL 1SBBA 2FB4H 4G43A 1TENA 2VLKD 4JO2H 4Z5RB 1L7TL 1NC4D 2HJLB 4MJID 3VRLE 1KTLB 3QUXD 5IROA 3HAEB 1XCTA 3HKFA 4BFEA 5FUZL 2VN7A 1KPVA 2VZSA 1EK3A 1N6UA 5F6HJ 3U0WH 1HHIB 2R39A 3D6GA 3VE0B 4CMHC 4LPYA 3CNKA 3H9HB 2A9NH 1ZVHA 2Y23A 3D69A 1BQSA 3PGCA 2WBJC 4JRXE 3GB7A 3B6SA 4PJAF 4XAKE 3X11A 4FG6D 2R4SH 2P8MB 4P4RA 4PJ8C 4PJBB 1DQLL 3CDGA 4MS8C 3G04B 1JTPA 1J1PL 2R8SL 1W0VA 4OM1H 1KN2H 4TUOB 2K7QA 4Y1AE 2PF6A 1SBSL 4RA0C 3HI1B 1IGIH 1L8JA 1HHHA 3W0WA 1CE6B 2HMID 4HUXA 1QRNA 4DTGH 1QLRA 4XVSH 3PHOA 5IJVB 2IPKB 4M4RA 5FHAL 2MQ0A 4Y16B 4HIHB 4JY4A 5DC9B 2O61B 1WISA 4C56D 4JAMA 3V5KA 1ZHNB 4X0KB 1SM3H 1RFDH 5HI5D 1EAPB 2E6PA 4ZS7L 3ULUD 4WHYG 3MRMB 1MCBA 3QO0B 4LKXA 3NA9L 4HKZB 4J3OC 4KY1H 3X14B 3OXSA 1I1YA 4FXGA 4PJ9A 3OMZA 3GBNL 3EO9L 3QH3B 4X9FA 4HLZH 3C6LD 3S97C 1GOFA 3KS0J 1MCDA 4PJAB 1VESA 4XAWL 3CVHL 2FYYB 5LGJB 5SWZA 4K8RL 3SQOH 5CZXC 4RWYH 2NZ9D 3HE7D 4NUJA 2ATPA 3SCMC 4I48A 3DPBA 1K8DA 3L3OB 1Q9WB 4FTVB 4X6CA 4NSKB 4ZUSB 5JZ7C 5FA4A 1ROWA 5JHDD 4N90E 1XF2A 1K85A 1BAFH 1SMOA 5D7KD 3OX8A 3OGOE 3WEXB 4M1CC 1VGEL 1FE8H 3P3YA 4OUUA 5KSAC 5GZND 1WZKA 4GQPH 1ZSDB 5E4EB 1EAPA 4O02L 3LEYH 2JKXA 5DGRA 3NBNA 1DE4B 1V05A 2OP4H 3VXOB 4TSCL 2VSDA 4UTBH 2VDLH 3EZJB 3ULVC 1S7VB 1JPSH 5F6IC 3CC5B 3FQWB 3IFOA 5DD1L 1WF5A 2Y5TA 2C3VA 4W6XB 1YQ2A 2CXGA 3GMLA 3OKLA 3WNMA 1DUYB 3TIDA 3C5ZD 3UO1L 1YEIL 5EUOA 4NUJB 1YNTA 1AE6H 4N8VG 2MPAL 1H3VA 1QSED 4HIJB 3UJTL 5J13B 5J1TC 1Q9WA 3QEHA 1JZ8A 5EOQH 5TGBB 3CAFA 2AK4E 4IS6A 5C6TH 3U1SL 1MPAL 4OKDA 2IANB 2A38A 5GRVK 5DA4A 1B2WL 2NY5H 2DQEH 5D7LD 3CSPA 2R0KL 3D5OF 2RBLA 4NQEE 3V4UL 1Y18A 2J8UB 1UJ3C 1JPTH 1C5CH 4K71C 3OZ9L 4ENEC 3BH9B 3FFCA 4JFQB 4XI5D 3N1FC 5HHXH 2HLAA 1PG7X 3G6JF 4WDIB 3REVB 2AJVH 1H0DB 5LXGL 2EDOA 3GMPA 4OCLC 3MA9L 4WHCA 4ETYA 3MV7E 2SEBB 4NN5C 1CE1L 1HHKB 3QRGL 3RY5A 1FORH 5IMKA 5E94A 4RISH 3T08A 2HJFA 2FL5B 4GRLD 1P7QA 4PJ5D 3T65B 4UILL 4OF3A 1RIVH 1TETL 2X2YA 3G08A 1WCQA 4KKCD 1I8MB 1Z6JT 4JLRA 1L0QA 4R8WH 4IIQA 3SGDH 4NJAL 4LARH 2C3XA 1CI5A 5B38A 1NFDB 4JREC 4LCCA 4QEGA 4GG6A 1LEKB 2HT3D 1C5DB 4I4WA 3HMXH 4U31A 4LCUA 4UU9A 3BWUC 2EDEA 2UWEF 4KTDH 4XB7A 4XPAH 3TCLA 4KRPB 2CKBH 3KYAA 4WWID 4ORGB 4S0UC 1IQWH 1YZZA 3MV8A 1WGOA 5DJ0B 5EIQA 5K33A 1J11A 4OZFH 4QRSA 5BS0E 3NCFB 2XTJD 1TTGA 1QVOA 4XB8A 3W39B 4HIIB 5CFHA 3TVMC 1A6TA 1CFQA 1FL6B 4LCWE 3I3DA 4WU5B 1YEGL 4YHYC 2YXFA 2IALA 1QPPA 5K93A 4HKBA 4Y0GA 1IJ9A 3IU4H 2GI7A 1KLFA 1ORQB 4JFFE 4MVBD 4G8GE 3LEYL 5EU6B 1JHKL 4NWUH 5FUOL 1JGUL 4TVPH 3KPPA 4B7LA 1HCFX 4EXPX 5IOPB 4MX7A 4ODHH 5BQ7B 3FOMB 1S9WB 4HJGB 3N9GL 5SX5H 2L4OA 3B4NA 4MLIA 4PV9B 3NCEB 5E70A 1LD9A 1CXEA 3TO2A 1HZHH 3STBA 3UTQB 2ZUXA 4JPKH 1DBKL 1KTKE 3DX9A 1JNHB 1IQDA 3LZFH 2DLFL 1IC4H 3HAEG 1Z5LB 3IGAB 3V4VL 4HWEH 3OKOA 3K8LA 4PTUB 3BIKA 4NCDA 3VWJA 4L5FL 4CNIA 1I3RA 1ZLUH 3CZJA 1U41A 3GSNA 2LAGB 3ZT5A 1R0AH 4RRPG 1UM4H 5TQ0L 1WBZA 4LRIC 3VWKB 4YHMH 2C3HA 5FDWB 4I5BA 5BZDB 1U3HC 4URTB 3CK0H 3ZE0E 1YY9C 3MV11 4P57B 4MQSB 3O3UN 3LMJH 2W38A 1D7FA 4XWGH 3IT8D 3Q5YA 2ESVD 4OTXL 3MV01 3IFLL 3O8XC 5SWSD 2EZ0D 4PJHA 5I73C 1N3NB 1S7TB 3IVKA 1A7PH 3IU3A 2VABB 3TFKC 4XGZA 5CSBA 4KHXH 4OF8A 3I85A 5EOQL 5EU6E 2WUCH 4JFFA 1XGQA 5E8EA 4P4KC 5IVXE 4JKWA 5FO8B 3HA0A 2ICES 4P46C 3K0WA 2DQEL 1B0GB 1XR8B 3KPSD 2E9BA 4PJGB 3G6AB 3O6FB 4D8PA 1BWWA 2H3NB 2Q20A 4WY7H 3V4UH 5HI5C 4LAJH 4WFEE 2CPCA 2EYRA 3DI2B 5BV7H 4PJXA 1S7UA 1T6VN 4MMXC 2BSSA 4FQHA 4OGYL 2ADGA 2QQLL 3ULUF 3QIWC 3OV6A 1P2CA 3JV6A 3BP7A 2YMXL 3MPCA 4TYUA 4N8VA 4M1CD 4LRNH 4LKCA 5F7YC 3JWOL 3QISA 1MFCH 5IBUG 5C6TL 4JDZA 3D9AH 5F7HA 3WV0A 5L7XH 4F58L 3HFML 3GO1L 2NY5L 5B39A 4OF5A 1LVEA 4QRPB 3T3PE 3LB6C 4HIXH 4LNRB 4HG4K 4RWHA 1ZS8B 4NKIH 3RVXD 3T3MF 3W0WD 4Q9RH 3D2UD 2FJGB 2XZZA 4UINL 3WFCH 4H26A 5DC4B 1J1XL 4GUPA 3SDDB 2GJ6A 5C0IB 4AG4L 3WO4C 4NO0B 4V1DD 1MFDH 1BZ9A 3IKCA 4EQ3A 2DYPA 5TE6H 4IDJH 3HS0A 3QWOB 3RWHA 3IDGB 3O9WD 4U6YB 3UMTA 3UTTE 5HHMD 4GRWH 1I1FB 2BC4A 4PGEA 5KSUA 1SQ2N 3VGHA 5T1LB 3W2DH 2ATKA 4V3DB 2YRPA 2BJMH 1JZ5A 2QBWA 1U8KA 5IMMA 1U3ZA 4FQXB 4GXVL 3W9EB 4FFWD 2IBZX 2P5WE 3QO1B 2A6KB 4GW1A 2P24A 1MAKA 4DGIH 3ZKMD 1BREA 3MUY1 3OXRB 1CDCA 5E9DD 1A7OL 3T8XA 3GMRB 1MHHB 2CJUH 3QIBA 1F3RB 5M95B 1S5IL 2WINB 4BQ6A 3PHOB 5INCA 1ZVSA 3RWFB 5I8OL 4NRZA 3PE9A 2R8SH 3BISA 2O61A 4X7TB 5DS8A 4G8GA 5JMRA 4OIAA 4WUUB 4FS0A 5E5UB 4L29B 2AK4B 2KQMA 4XVSL 3MCG1 1WVZA 4MAUL 2HN7A 3T04D 1ADQL 4IMLA 2AGJL 3QG6A 2OSLA 3QPQD 4NZRH 5GSRA 4CN6A 4YE4H 1UB5A 2EE3A 2DLEA 3TN0D 3T0DA 3VFRA 3BKYL 4ZFFB 4XNYL 2BFVL 4OLVH 3KPOB 4G42B 5GS1B 5MEQA 4OV5B 3ZHDA 1BQUA 3B2UD 5E2TH 1CICD 5GZOD 4BSWA 4NJ9L 5IIEB 4MJ6A 4JQIH 4OZHE 1VFAA 4MJ5A 3FFCE 4JHWL 1FG9C 1EEZB 4HCRA 1P53A 4HS3B 4O5LH 5I6XC 5T3ZD 1IGIL 3AAZB 5DMYA 3QDAA 2B1HL 1QSEA 2B4CL 3FN0H 1OSZA 4AEEA 3RZCD 3QCTH 3CVHH 4KKLC 1QYGL 5D71L 3B2UC 2HVJA 4ZPTA 4Y5YC 1RULH 2XKNB 1A3RH 1CVRA 4OSUH 5H8DA 1FVEA 2AERT 3RX7A 4ELKA 5FUZH 4YUEH 4L8CA 1A6AB 1H3TA 5GIRA 5ALBH 1F3JB 4ODUA 3U36B 3MRHA 2VMFA 1IGCH 3RKDC 3FMGH 3RUGB 1YECH 2A9NL 1PG7H 3ULUC 4DOHE 4RMSA 4Z18A 4E0RA 4HWEL 4L8BB 1BIIA 1AQDB 5I18L 5DD0L 1DTUA 2P5ED 1ZEAL 4XAWH 5B4MD 4HZLA 4X5XA 4QWWD 3QDGA 2EE2A 1KN2L 4P3CH 4V2CB 1C08B 5ESAB 4DKFL 1BHGA 4RRPA 3VXUE 5IVZA 2GJJA 5I71B 4QWWC 5IQ9B 3TBWA 3QIWA 3WUWG 5BO1H 3ZE1F 2QR0B 2VXQL 4D9QE 5HBBA 2B1AL 2V5YA 2VB5A 3Q2CA 1VERA 3W0WE 4EI5B 3BP6A 2Z93A 3KLHD 2J8UA 2V5MA 1DR9A 1MUJB 5DMIL 3LDBC 4M48H 1NLDH 4RAHA 3QR2A 4G7VH 4R26L 3U46B 3MZGB 4KJWD 1R3HA 5C0RH 3RU8H 4KHTH 4WFGD 4WV1C 4LMQI 4N9GB 1JVKA 4ZUTB 4HUUB 1MIEH 1UJ3B 3QI9C 4WFHD 1DLHA 3FQXA 2Q6WB 2YD1A 4GXVH 3FQTB 5CBAA 2Z8SA 4JZJB 4YAQB 2VR4A 3MRLB 3HUJF 3WKNA 5CINL 1BZ7B 4PLKC 1I7UB 1UA6H 3FFDB 1MCEA 1UM6H 4JZOA 1A14H 3QJHA 2HMIC 1NGYB 3VFMB 4G8EB 1LO2L 4D9RD 2BZDA 1J1OH 4Y2DB 3W11D 2XN9D 5DJ2B 1F4AA 4KK5D 1OAZL 3V79C 2J8UF 1I3UA 2NMSA 1T7YA 3BYYA 4K3DH 4RISL 3QULA 3H3BC 4MAUH 1U8NB 2YD3A 2HA1A 1NCWH 1G1YA 3UDWA 4AT6B 4LCWD 3F7RA 1S9XA 2CD0A 1AFVH 1MOEA 1ZOXA 1TMCA 5HYSA 1UJ3A 4ODTH 5LXGH 4HBQA 4KI5C 3OKDB 1MQ8A 3HZYB 5TDPA 2V2TB 4RIRB 1ERNA 1NKRA 1IVLA 1YC8A 3WFEH 5JW5B 3KJ6H 3L5IA 2F9BT 3GBML 2PR4L 4IRSA 5ABDE 4YR6B 3KYMB 4Y2DC 4NQDE 1K5NB 2BMKB 2IBZY 2N7BA 3NCJH 4HIHA 4JY4B 4MXQC 2V17H 5DEZA 4H1LG 4LSTL 4XZUB 3M07A 3L3JA 3P0YH 1HI6B 3BP6B 5CP7A 2H45A 4R8WL 4PRHA 4XBEH 4NP4H 4LVOC 4L3AA 3D39B 4GAGH 4X6FB 3PL6A 3MMEB 1P4IH 4EI6B 5DJCB 2BRRH 4X6DF 5CSZB 3TYFA 5IEKA 1RJCA 4F3FA 4KKBD 3CU7A 3MGOB 1A7NL 4JFYA 1EAJA 3N85H 3DUUB 4OGAD 5J6HB 4JRYD 1T03L 4K3GA 5ADOL 5IB1B 3SJVE 2DQGH 2CLRA 3ULUE 1NC2A 1UM5L 4OIBA 3S6CA 4NBYB 2CGRH 3V5HA 1FL3A 1FNAA 2Q1EA 3BGMA 5GGRA 4UDTA 2W9DL 1CLZL 3BAEL 3VXMA 5DK2A 1BF8A 1ZT1B 4RFNC 4BFIB 1ND0B 2F5AH 5HJ3B 1OPGH 3LDBB 1FZKA 3MNVB 1TFHA 1NUGA 3T0XA 2EIZB 5F9JB 4X99B 3ARGC 2I24N 4ONOA 4P2RE 1FAIL 1FZOA 1H15A 3IKKA 5F1NB 3DIFB 3H9HA 4XCCL 3WFHB 1BM3H 3GSNL 3GIZL 5CJXC 5I8KH 1KT2B 5EN2B 5T3ZL 4FQQB 3WDJA 3X13A 4WWKB 3PWNB 1V3JA 2Q8BL 2N7AA 5GRJL 4KK6C 1S7TA 2VJXA 4R9HA 3ILPB 5L8LB 3C2SA 3V8OA 3PDOB 3LH2L 3MR9B 3RIFK 4RAVA 1GC1L 4H5SB 3VWJC 4HULB 4M1DH 4HK0A 5C07B 1K5NA 3MUHL 4HQQL 3SEPA 4OZGF 2R1XA 4K3JL 1FL5B 1WBXA 2C1PB 4H8WL 3SPVB 4LVHB 3RX5A 1BF2A 1TVDA 4AIOA 2Z31B 3UP1A 5ITBL 4ZFOL 4PP8C 3D39A 2P8LB 4TOYH 3FFCB 4A6YH 3D39E 4M61B 4CBPA 2VXSH 4ZFZA 4XWGL 1JUFB 3BO8B 1RZ8A 2EECA 3QDGE 2AQ3A 4K9EH 2J88L 3RVVC 1CGVA 3MTRA 2IADA 1Q1JL 1S7QB 1S8DB 1UCBH 4M5YH 1X4XA 1VA9A 2OTPA 2X40A 4QRTA 3P0GB 3BRFA 1K4CB 5E6IC 1LDPH 4XP1H 1WIOA 3O8XB 3K4ZA 5EC1A 3NVQA 3ZDYE 1X9QA 4F2MB 4U1JA 3SPVA 3GSOB 1BVKA 4WU5A 5T1MB 3M8OH 1AIFB 5BV7B 1N64L 2Z31A 4PRPB 3R06B 4G6JH 1DL7H 3DIFA 5L2KD 4F9LA 3CX5J 4MCYB 4NQXA 3IDIA 3BD5A 1FNSH 4MX7B 3SKOA 2CUMA 1SJEB 1UXSA 3D1MC 1BECA 5JDSA 1ZAGA 3MO1A 3OHXB 3Q6GH 4XPBH 4JCLA 3FL7A 2XRAH 1V7NH 4IM8A 3CCHA 5E9DB 4PGBB 3E0GA 2GTWB 1T03H 3JTSA 2YZ1A 4AYFA 4YDJA 2NTFA 5F3BA 3U48A 1CCZA 3VWKC 4O58H 4GT7A 4UUJB 2PTVA 1PKOA 4FG6C 1TZHA 1JJUA 2NX5D 1G7JA 1OPGL 2NY3D 1U6AH 2QQKL 4PJFF 1AO7B 1OY3B 2DD8L 1S7RA 2AXHA 2VAAB 3CX2A 3IJSB 5FV2A 1DQDL 4QHKJ 3RDTA 4NO0D 4K94L 2YA0A 1HSAA 2Q7NA 1ZA6B 4E41E 4H20H 4PJ5A 2WMPA 2YEZA 3JWDC 1OTTD 2D31A 2Q8BH 1YEEH 4I77H 1D5XA 4YEFA 4JM2D 3TFKA 4L4VE 4LOUD 4BSWB 3UXFA 1D5MB 1NCBL 4P4KB 2XWJA 4RBPK 1OCWH 2APWA 4XP4L 1JWSA 1NFDF 3U7WH 3LY6A 4Y19D 4QHKI 4WI6A 5DTFB 3RIFF 2VC2H 3B83A 3GSNB 4O9HL 4K2UL 1FVEB 4P23C 1ORSA 2UUDK 4FZEL 4R4FH 5FK9A 3U7YH 1RQ5A 3QQNA 1I1CA 1JGVL 3E3QE 1QUNA 3AC0A 1CF8L 5EZIL 3F62A 3VFVB 3SBWC 2DBLH 1BBJA 1F2XK 1RPQA 1RZKH 3WLWC 1MCSA 1S5HA 1ED3A 2YEZB 1A7RH 2BFVH 1OGAB 5DUMH 2W65B 3Q3GB 5T3XL 1BLNA 1RIHH 2O93L 1KGCE 4FFYH 5FA3B 1T5XB 2XZQL 3TJEL 2VQ1B 5K9KB 2VISA 5D2NE 3ZMRA 5C07D 5DHYA 4KPHH 3FN0L 3FTGB 5IW3A 1K8IB 3DWTA 3QPQC 3VFGH 5C92A 2DDQH 5SWZE 3MLSL 2ZUYA 1A6ZB 3OF6D 1ZANH 5D7SL 4C83A 3RWIB 1NC4B 4M3KB 5D1ZB 4LLUA 3ILQC 1T66D 2AV1B 4DUVA 1GVIA 5I6XB 5GSVA 4XCEB 2RCSL 4OLEA 2N56A 2OXHA 5EPMB 5CJQH 3GSUB 4PJ7B 4HUWA 3WMSA 1JNLH 3RPKA 4X4XB 5L2JA 5KTEL 1CWVA 3RJDA 4OM0L 5ANME 4M4PA 3QDMD 4OD2A 5DMIH 3LQAH 1VGKB 1F2QA 5I2IA 3AS3A 3DSFH 3PXHA 4FNLH 4WFED 2EH8H 1T7WA 3DETC 4X6CB 3MLZL 4O02H 2VWEE 3FFDA 1U8PA 3ZHLA 2NY6D 1PEWA 1NGYA 3VFMA 1WWAX 3KNBB 3QUKB 1I7ZB 2HH0H 3U0TA 2VLKA 4A6YA 1NC4A 4G8GB 1FLTX 4JR9L 2MWCA 4Y5VC 4C56B 1UA6L 3BPOB 4QOKA 4Z7VB 3B9KA 4U2YA 3QWOA 1RUPL 2XN9B 4PRBA 3VXSD 5IW6A 2BNRD 3GSVA 4XNMB 3T0ED 1GOHA 4LSVL 5DJ8A 4KJYB 5BXFA 4O2FA 4PG2A 4NUGH 3IVKB 4I77L 3SHSA 3DROA 5IEHA 1G7LA 2YPLE 3BYTA 2EIDA 4NT6B 3EOBA 4U6XA 1T0PB 1ZV5A 4IHOB 3VCLA 5LCVH 2JCCB 5E2WH 3U7WL 2AXFA 4HUVB 1MAJA 3K46A 2Y25A 3BQUC 3IDMA 4PJEE 5E8EB 2NY1C 3EJYC 2A9ML 4D3CL 3BE1H 5HD8D 4HH9B 3IXTA 1X5AA 4X6CF 5GIRB 1EHLL 4D8PB 4DUWA 3ARBA 2M2DA 4YC2C 3BZFB 4RDQF 5JO5B 1IKFH 3MLUL 5D72H 2JLLA 4QRRA 2GITA 3T2NL 3T4YB 4QTIH 3S36X 1T7XA 4UT6L 4G42A 5C09D 4YBHA 2WM0A 3L5XL 2PXYC 1NDMB 4LLDB 3L3HB 1BOGB 2X4TB 1FPTH 1HQRA 1IC4L 7FABL 3O9WA 2GIYA 4GH7B 3C60C 3PWPD 3B9AA 3MYJA 4IRSC 1U8PB 4G6KH 4LF3B 5D7SH 3MRRA 5F1IB 4LPWA 2PW1A 3UC0L 2F15A 4RMVA 1XF3B 3JWDH 1IGJA 4QTHB 3UTSD 4AEHL 2CKBL 4TUJB 5J3HD 4JM2F 5HHNB 3L9RA 5C2BH 1G7PB 1FYHB 1CK0H 2OMNA 3DURA 4JO4H 5FCUH 5AZ2H 3TBVA 1WCBB 3AS0A 4ZFOA 4LSRL 5JNYB 5KTEH 3KXFE 5SWZB 4JRXA 3WKML 5IQ7L 1DVFB 1AO7E 3C5JB 2CLVB 5HDQL 5HYJA 4O2CB 5DJ0A 3GBMH 2CXKA 1G84A 3ZE2F 5CEZH 4RFEB 2E6QA 2IJ0C 4LLVA 4L5FH 2BHUA 1NBZA 3KJ4C 1BMGA 2VDNH 2WUBH 5E8PB 5GGQH 5FUOH 4N0CA 1FNLA 2PYFB 3NN8B 3VFSB 1NL0L 4JKLA 4JN2A 2B5IC 1A2YA 3MGTA 5FM4A 1XGRB 2IBBA 1NCAH 3I2CL 1CLOH 4XC3H 1EPFA 4HGMA 5EORH 2CR6A 4ERSL 3JWNC 3MV8D 3MBXL 4FZ8L 43C9A 4UQ2B 1MHPL 4L3ED 4JG1H 3THML 1QFWL 1FE8L 4HFUL 1R24A 2OR9H 1QFHA 4JE4B 4KTEL 1EXUB 3CVHB 4JKKA 5GRJH 2R2HA 2ERJC 4Z7UE 3CFKA 1QD0A 3CLFL 3TPUE 1XGTA 3DRTB 3W82A 5IW1B 3HFMH 3SE4C 9CGTA 2FX9H 1ACYH 3OAYK 4U1NB 4F37F 4ZS6C 3MV9A 1G7MA 2YUXA 4P46D 4XBGB 5T1LD 3DVNA 5IB5A 4D94A 4HQQH 5HDBF 3SE3C 2AV7B 1SJXA 4OB5H 1GOGA 3EYOA 1TQCB 5CD5C 3WYRA 3WN5B 4QXUH 1TTFA 3N1GC 5C86A 1LO3L 4NDMA 1U8HA 1YEFL 1CGUA 1QFOA 4AG4H 1XGPA 2X70A 5EU7C 3GMNA 3RUGA 4N0YH 1G7HA 4LU5H 2OZ4A 1QHPA 1XGYL 4C58B 1KNOA 1B2WH 5DD1H 3RDTD 1CL7I 3WJLA 4RGNB 1B4RA 1U8JB 1A7BA 1R24B 2XICA 4PD4K 3VXNA 3ZYJA 4M6OL 3VRIA 2P8MA 5C0CB 3D87B 4OKVA 3H9SA 4ZFGH 1YPZA 1P5UA 5LGHH 5IW1A 5HHOE 2D7TL 2YA1A 2IWGA 2ZUQC 5T1KD 3ZE0F 4YEEA 2FBJH 1QBBA 4ZUVB 1EERB 1AR2A 4GRMA 4RMWA 4B0MM 5J56B 1IAOB 4GBXB 4UOJA 1INDH 4QHLB 1I3VA 2VL5B 3BDYL 2NX5E 3JVGC 4MMZC 2J7LA 2W92A 3KPSB 2I60H 4CMMA 4JM2C 3DV6B 3OPZH 1Q0XL 3ULVF 3LPFA 2IFFL 2DWDB 1L6XA 2PTUA 5DJDA 3LAFA 2AQ1A 2O5ZH 2W0PA 5GISH 4S2SA 1VADA 5EU3A 3U4BH 3VRJA 1CU4H 5EO1B 3Q6GL 2V9QA 3WKMH 1YEJH 3C60D 4OF7A 4K94H 1AGEB 2FEDD 4IRSD 4OLZH 5GS3A 1FZMA 1HILB 1GHFH 1BFOA 2UWEB 1KF9B 3GSXB 3GJEB 4QHUA 3QHTC 2CDEB 4GBXC 1KIPA 2JJSA 1N4XL 1S3KH 3KPNA 5DWUH 5FECA 3DRQB 5JXAL 1IAOA 3R1GH 2RIKA 4XWOC 3AGVA 5D7JC 2P4AB 4KV5F 2FEEL 3O0RH 5DT1L 2D2OA 5FM5M 3G5XA 4XNZB 5CIPH 4UTAH 2K3TA 1E28A 4OF6A 3RVTC 5J06A 4PRID 5EB9A 2FHFA 3MBEC 1I1FA 4PFEA 1T4KB 5A3ID 2OR9L 1KTDA 4U6VL 2W65A 2W91A 3Q3GA 3TWCH 5E6IB 4TPRL 1EUTA 3VGAC 5K9KA 1JFMA 4P3CL 4Z0XB 5H35A 3U9UB 1YMMB 4RFNB 3ARDA 4GW4B 3JWDL 3HCVB 3T8XB 5TDNA 5TQ2L 4YHNA 2J8HA 3DMMB 1G7QA 1VB9A 1EEUA 1A8JH 3WDIA 1NL0H 1IFHL 1CXLA 3DI3B 5B4MC 4ZO9A 3W2DL 1XCTB 3CSYA 4AL8L 4WNQA 5BMFH 2ZJSH 5J57B 3JUZA 3S35X 3CU1A 1VFMA 3O2VL 4M1GL 4TSAH 1CG9B 2ESVB 3DV6A 4IOIB 4APQD 2ICEB 5FIEA 1FFOA 4R26H 3EFDL 1K3IA 4WTWA 3MXWH 3QDMB 4FQCL 4UV7L 2VIRB 1YDPB 2JJVA 3NCYS 4HAFA 4ONFL 1U95A 2VZ1A 4K3EL 4TTDD 5EOTA 3EO1A 3WS3A 1A7QH 2J4WL 4ODVH 5H2BA 1W8NA 5HYIA 3C5SA 2GTWA 4XCYA 4GMTH 4EN3D 3LCYA 4YLQT 1IM3A 5LBSH 2R2BB 4HS6A 2VKWA 3UTTA 4Z5RA 1YECL 3U4EA 3JUYA 4TVSa 1FVCA 4JFPA 2CLZB 4P5KA 3D0LA 4BZYA 4XP5L 4OIIH 2Y06L 4NHUB 4P2QA 1YEFH 5IGXL 4JLRB 5HHME 3P77A 1HOCB 1U8QB 4NQUA 2VUYA 1FZOB 3TPUA 3KWWB 4ESKA 3WS6A 4KFZC 4PTTA 4V3EB 2Y07H 1WSST 3QCTL 3UZVB 2VIRA 4FQ1L 4HBCH 4NM4H 1PKQA 5C7XH 1OAQL 3CDGB 2GCYA 5L88L 5FO9B 1QP1A 1ETZB 1BD2B 2CKBB 3PXJA 4KGLA 4HJJH 1C5BL