3M1CB

Crystal structure of the conserved herpesvirus fusion regulator complex gh-gl
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
180
structure length
146
Chain Sequence
TEYVLRSVIAKEVGDILRVPCMRTPADDVSWRYEAPSVIDYARIDGIFLRYHCPGLDTFLWDRHAQRAYLVNPFLFAAGFLEDLSHSVDTQETTTRRALYKEIRDALGSRKQAVSHAPVRAGCVNFDYSRTRRCVGRRDPVLALSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the conserved herpesvirus fusion regulator complex gH-gL.
pubmed doi rcsb
source organism Human herpesvirus 2
molecule tags Viral protein
molecule keywords Envelope glycoprotein H
total genus 35
structure length 146
sequence length 180
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05259 Herpes_UL1 Herpesvirus glycoprotein L
B PF12524 GlyL_C dsDNA virus glycoprotein L C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3m1cB01
3M1CB
chains in the Genus database with same CATH superfamily
1RXQA 1Z3IX 4C7OB 3K66A 1ST6A 3UNGC 4DVZA 4CJGA 3LJBA 2OKUA 3ZTMA 1PD1A 4UDVA 1OCRC 2P6VA 3GEIA 1SF8A 2IM8A 3POVA 4QDLA 3IQCA 2H7BA 4I1MA 1YAUO 1BR1A 1I4ZA 4YWQA 1D1AA 4NC3A 2EPNA 3AGTA 2Z15A 3F47A 2IXNA 4IARA 3ZDLA 1F1MA 1ORSC 5KYNA 1VYIA 2M4EA 1VTMP 2EIMC 4XPWA 5GPGB 2FGYA 5CIVA 2CW0F 2J9BA 3S29A 2P61A 1YYJA 4I3MA 3JYYA 2PX3A 4HEAJ 2OEXA 2KYHA 2VH3A 4KI2A 1EKYA 3A9CA 3RYLA 1T6UA 1OKKD 1M2VB 2KSFA 4PACA 1FNTc 3AOUA 3LEOA 3VYWA 3IQ5A 2Q00A 3FOOA 4G7ZF 1TWHA 4BJ5C 3ZIBA 1QVXA 4C3EA 2R7QA 4N6CA 2TMVP 3TJ5A 2KQ9A 3EHMA 4PR9A 2L6GA 3H2VA 3Q6MA 1OW6A 4MVSA 4XLNF 3CZ6A 1M6TA 3RQGA 4GYTA 2WZFA 5DS6A 2DYSC 3LESA 3R2PA 2YLDA 2YL0A 5KYYA 1HY5A 1S7ZA 3G4ZA 1HW1A 2WZGA 4PJJA 3C8ZA 5COMA 4ZLDA 2J7PA 1Q0KA 2XL8A 3DI5A 1J8YF 1ZVZA 3SXMA 4AE4A 3EFOB 3M15A 2LCHA 1M2OA 2F22A 3X1OA 5A69A 2WB7A 4JZAA 3IQTA 3SXYA 4PK4A 2J8WA 1BR4A 4CDVA 2XXAA 4W8KA 3ATPA 3QVZA 3DWWA 1NFNA 3U2MA 5E33A 2NSFA 4CIPA 1ORJA 3EGXA 4F4BA 5L3QA 2H7VC 2XM4A 2YL1A 3LS0A 2R7XA 3DE8A 2BL2A 3NG1A 4AL1A 3MFNA 5A6JA 1HMDA 5DQZA 1VOMA 4MVUA 3GWNA 3SNHA 3S90A 4EBJA 1Y4CA 2Q3TA 2IXPA 4LLCA 4P9TA 3T4RA 1OW7A 2QY9A 3GWLA 5HSWA 2UUHA 3ZG1A 4BJ5A 2HKVA 4E0IA 2V3CC 3SXZA 1UFBA 1D0YA 1Q0GA 2XLOA 1QQ3A 1WTYA 2FFHA 3I5QA 4MW3A 4Z9JA 1WATA 2X0CA 4ULWA 4DRHB 1AUEA 1TFKB 4EBKA 2HV7A 4BJTA 1MNEA 3DM5A 4IJJA 3QTHA 3KMIA 3L34A 2PBEA 1TWCA 2NUPB 5B3IA 4E18A 1Z63A 1TR2A 2R05A 3O10A 3U8PA 2WVOA 3ABMC 1YA9A 2L6HA 3DAGA 4JC7A 1RMVA 2ZXPA 2EINC 3UMIA 3V5XA 1IW7F 1LI7A 1MMNA 2Q9CA 3L0IA 3DJUB 3MBGA 3L1MA 1NU9C 1OXBA 3EH1A 2WVNA 1VLTA 2GA0A 4U5HA 3N24A 3EHNA 2AU5A 4CS9C 1S05A 1RJ9B 1TKNA 2NG1A 1FFHA 3HLZA 3KYJA 1R5ID 3EG9A 4Z9HA 1VK5A 3S0XA 4OIOF 2IBFA 2MYSA 3LUTB 3Q7LA 2KC3A 4W8PA 2NUTB 4MVRA 2PFDA 4U5CE 5COFA 1WASA 4I1OB 1LS1A 2OOCA 4H4KC 4JEAA 4DJ9A 3TULA 1YARO 3HKKA 4YL0A 1JOGA 5HV9A 1U6HA 4BG0A 2AWYA 3W2WA 2CDQA 4IRUA 3FOPA 1TWAA 2ZXRA 5F5FA 2YL7A 4RBNA 1W2WA 3GM2A 1KNYA 3ASNC 3U3BA 3U9JA 3SYNA 4AX2A 1LKXA 1FTSA 1LIHA 4CDAA 1RCPA 3DD7A 3K1IC 5DQTA 4RDAA 3NKDA 3U8VA 1E2XA 2OJED 3FAPB 2L7AA 2HSQA 3GORA 3CQZA 4JTAB 4C3BA 3W8HA 4DBQA 4O6MA 2IXOA 5TJ5E 5KYWA 2LK4A 2KGOA 4KC9A 1C02A 3TK0A 2ZD9A 1JPJA 3TOMA 1MMDA 3R7CA 1KU2A 1NZEA 2YHSA 3AG1C 2I15A 5B1AC 4MTGA 3J06A 1EQ1A 3B9QA 1HMOA 2VASA 3G4XA 1YVIA 3C7JA 3HNJA 3OWTA 4MS2A 4D4XA 2A69F 2WVQA 5KYYB 4J7YA 1OCCC 4C7OA 2BC5A 2L9JA 2QNLA 3K6BA 4H54A 2LP4A 3HNIA 3JZ0A 2HFIA 4U9EA 4XEFA 4U5FE 3UGOA 2LFDA 1MQVA 2ZXOA 1EI7A 3H65A 1CPQA 5L0DA 1ZHTA 4N06A 4Q4ZF 1ZHZA 3C8GD 4BJ6C 3W8IA 3NKEA 4WJ0A 2ICWG 2YQYA 1CGME 5L0JA 2W9YA 1YDIA 1LI5A 3EGDB 1OXKA 3FVYA 3IQ6A 3FHDA 3UMHA 2HUJA 1RKEA 4ONSA 4ULVA 1J8MF 1RKCA 2IOQA 3ZQYA 3H2UA 5DS4A 3S28A 4KNVA 1G5ZA 1FFTC 3M4CA 3C62A 2Q9BA 1A7EA 1ORYA 1WGWA 3JSEO 2Q7RA 3N2ZB 3LAYA 1QPUA 4NTFA 4EKWA 2R7WA 4NQFA 2HS5A 1C03A 1QLEC 3W2VA 4AL0A 2Y69C 3K33A 1ZHXA 2YRFA 1T6QA 1ZU5A 3QMKA 1Z23A 3K7DA 2HJMA 3EG9B 4JVSA 1LE2A 1LM3B 2PP4A 4IWBA 4LDKA 3V5YA 4CSAA 4YT8A 3N0TA 4LDQA 1GQAA 3NDBB 1E85A 1H6GA 2YL3A 5EHHA 3IHUA 3EPVA 3O6XA 2PX0A 2CYDA 2J0XA 1EA8A 2EILC 3EH2A 3ABLC 3DM9B 4HFFB 4CS8C 1XWJA 2VC9A 5AC4A 5KYWB 2W45A 3JYHA 4CX9A 3GM3A 3GM1A 2EPOA 4OIPF 1U89A 3JSZA 2MHRA 1H9GA 3S9OA 2HSBA 2CNWD 3NMJA 3I4UA 4J7TA 5A6BA 3RVYA 1T6IA 4FX5A 4MTFA 4A4AA 3AG3C 5KYUA 1G4US 3ABKC 4BEJA 4E7SA 3AJMA 4ANJA 1M2VA 1K05A 256BA 3NYLA 1MMAA 3O55A 4YL1A 3V5ZA 3PHF2 3TOLA 2Y3DA 4QI2A 5KYUB 1QZXA 2R25A 2C03A 2XLVA 5AGFA 1O87A 2BE5F 4X0RA 2NUPA 2Y3HA 3SP1A 1LVKA 5L3VA 4DBRA 2G3VA 2KW3C 1GGQA 3HNKA 3KYIA 3EGXB 2R7RA 3UMKA 3JT1A 4YK5A 3F46A 2A6EF 2DGJA 3B29A 4JRZA 2Y3BA 4A2NB 2XS1A 1AEPA 1TWGA 2DI3A 4ZLCA 4FWVA 3LLIA 5AC5A 5D92A 2W4MA 3FMSA 4O6NA 3C18A 3GEHA 4J30B 3CAXA 2P1AA 3KPHA 4R32A 3L8JA 4CBEA 5IY5C 2H8AA 4JCHA 2DYRC 1WOLA 4JIOA 4DRIB 2QLAA 4P9FA 2XS8A 1MNDA 4XWJA 3ZQVA 3T9OA 4EIYA 4Z9IA 5L0HA 2XL4A 4XTKA 4BJ1A 4LERA 2XXAB 5JP7A 1UG7A 1V74B 1VMAA 4J32B 5D91A 1NU7D 3U5SA 3ZWIA 4AK9A 4BPMA 3EZIA 3GANA 3UGPA 2OQMA 3VAYA 2XLWA 2XLEA 2D4UA 2ZXWC 2PNOA 2YLGA 4U5GA 3WG7C 3NYJA 5L0IA 1V54C 3EQLF 3JTLO 5JT4A 3NYMA 3I5PA 4B6IA 2QUPA 1JMWA 3FDQA 3LNMB 1D1BA 1Y6DA 2ASRA 4OD4A 4XLPF 3WHNA 5COGA 3U3FA 1FR0A 2B0JA 4WGYA 1AVOB 4Q5SF 1KTMA 4JJGA 2C04A 2V26A 4G78A 5BQGA 5JS5A 2R7TA 1D1CA 4DRJB 1T01A 1YZAA 3T6BA 1BZ4A 2OU6A 2VCCA 5DLJA 1RJ9A 5BQIA 5A6BD 3E70C 3M1CB 1DOWA 2IXMA 3HNLA 4K0DA 1SR2A 3NRHA 1Z7Qc 3C8GB 2PF4E 4CDYA 5B1BC 2VCBA 4LLEA 4YT4A 1Q0DA 5A6KA 5JSLA 1WWPA 2L6FA 4OD5A 1PD0A 2KK1A 5FCLA 3MYIA 2H7OA 4QI0A 3DJNB 4IAOA 2YLIA 4FESA 3RIPA 3ASOC 1K04A 2ZPAA 2FAPB 3JRTA 4AE4B 4MNDA 3ITFA 4JKVA 4D4NA 1QKRA 1VYKA 1ZYRF 3A11A 3FXHA 3G50A 2I8BA 3RF3A 1ZU4A 3DZAA 3QVYA 5F28E 3DKAA 4ER9A 3ZC4A 5KYXB 1QSPA 3OEOA 5E3AA 2XLHA 3U0CA 2NPUA 3Q6NA 5F5HA 3VM6A 2AVKA 3M79A 2HZ8A 4N6HA 2X51A 4YJWA 3LNRA 4I44A 4IB4A 4RD9A 4PJNA 2XSEA 4CJOA 1O3UA 2LIGA 1OW8A 3DE9A 2J9WA 2YWAA 3Q7GA 1TQGA 4MTOA 4XQ1A 1Q0FA 3EGDA 2QTVA 4MQ9F 4G7HF 2KJGA 3EFOA 1R4TA 1XZPA 1ZHYA 2Y3GA 4EUKB 1A7VA 3PCVA 4JW1A 2CCYA 4C3DA 5EGYA 2R7SA 1B68A 4FAPB 1L7CA 2DB4A 1ZW2A 1ZW3A 3B0PA 4BEMJ 4GQHA 3OA1A 4HE8D 4MVOA 4YT2A 2WL8A 4BJ6A 2J7PD 3CEXA 3JCUQ 2R03A 2O9XA 2ETSA 4DOZA 3M4BA 3K1HA 4DVYP 1TFOB 2MWQA 3LLKA 2D5RB 3NMKA 2YVKA 4NCQA 4E7ZA 5A6AA 1JR8A 3KKBA 2EIKC 3LS1A 4N4WA 1C17M 2AWCA 3RQEA 3S27A 4O79A 3QZCA 1APCA 4JCZA 3SEOA 1NFOA 4PJMA 2GAQA 1M56C 4IGGA 2J45A 4XPXA 3PMRA 5CI9A 3KL4A 4OIRF 1T9KA 1N1CA 3CSKA 4XEKA 4U5DE 1OQCA 1A7DA 2A68F 4CS9A 1E84A 4EWCA 5T3WA 2L81A 3AG4C 1A0BA 1CGOA 1XZQA 2LQGA 3QW1A 1RKEB 3C63A 1YYXA 2JPUA 4LACB 2Q4FA 4WABA 4CIHA 2EPLX 1OR3A 2VB6A 3IEEA 2OG2A 4G0HA 2LSEA 5DVWA 4XEVA 5L0CA 2QE9A 4L6RA 3T6JA 4JEBA 3RVZA 2CGEA 4YN0B 2EIJC 4JTCB 4LDRA 5EK0A 2A0UA 2R7UA 3DAFA 2R7VA 2R02A 1LPEA 4NY3A 2A6HF 1Z5ZA 2GWWA 2JD3A 1G8XA 2NUTA 3RH3A 3US6A 4EBBA 4U5BE 4E17A 2B0HA 1BBHA 5FZTA 3DMDA 1PCXA 4HFKB 4Q7CA 1HW2A 3ZSUA 4NTBA 2J46A 4OIQF 4K1OA 5KYXA 1NBBA 2HMQA 1HE9A 1YA7O 1M57C 1BR2A 4NTAA 4U5EE 4XPYA 3C8GA 3VRCA 3HTKC 4O7GA 3RKOF 3X2QC 1NLXA 3W4YA 4MVMA 5JRAA 3MLGA 3GEEA 3ZTZA 5JUAA 4E0HA 1HE1A 1LS4A 3BRJA 3RFYA 3WODF 3UR3C 3IPMO 2R7OA 4KNWA 3VF0A 4EHPA 5K0IA 5B3SC 2KNHA 1YZCA 3LEVA 5E2QA 3SZRA 1U0BB 4YL3A 1V55C 1MMGA 2NSGA 2GDCA 2HMZA 1NG1A 1FMWA 3O39A 2LFFA 4O6YA 3T6GB 4CSAC 1OR2A 5JVEA 1V4AA 2J9UA 4JURI 1JAFA 2OEVA 4JE9A 3GODA 2A0BA 3AG2C 1SZIA 4MVZA 4U9DA 1T5OA 1H7IA 4GEHA 2Y39A 5T1DB 5DS5A 4PFOA 2W4BA 3MX3A 3U9MA 3BEHA 3U2LA 2EPKX 1L3PA 2HV6A 1CPRA 4MW8A 3PDMP 4KBLA 4M63A 2LD6A 1NSGB 2AP3A 4P6IC 2VCAA 3ZVRA 2XM0A 4PFPA 1WN0A 1SYQA 1OKKA 1JPNA 2G3KA 2OCCC 2P0NA 3AQCA 3MYFA 2GFHA 4JTDB 2M64A 1FMVA 5E3CA 3K1IA 3NMIA 5L0FA 4IAQA 1YLMA 1ZZPA 3TD7A 3KH2A 1A41A 1D0XA 2P7VA 2UUIA 1O5HA 1Z6AA 1G4WR 1VLSA 1SMYF 5T3TA 2XLMA 3B71A 3AGUA 1LE4A 1YJGA 3TJ6A 4MVQA 2R9RB 5L0GA 3RW0A 2YZSA 3ECSA 2RSEB 3EJNA 2YKZA 1IZMA 3S84A 2WZLA 2XRHA 4YT5A 1CGNA 5BUOA 1OCOC 2G62A 3RQFA 1E83A 3JRMO 3V7OA 3SXKA 4CS8A 1OCZC 1JRAA 1H9TA 1FAPB 2CNWA 5BQHA 2RD9A 4OINF 2Q9AA 1GS9A 2JX0A 2A1DD 2HJ3A 3FAJA 2J0WA 5JLIA 1I5NA 3HJCA 1E86A 3AQBA 3TQOA 3QW0A 2E87A 4PJLA 5CI8A 1PV3A 4WGZA 2YEVA 2XLDA 1D0ZA 3EZHA 1K40A 2EPMX 3DXJF 1VB5A 1Q0MA 4G7OF 1GM5A 4K7BA 3E9VA 2XL6A 1ZHWA 3WAQA 1BDJB 3L8IA 1I4YA 2J9VA 4JJFA 4DXWA 4CS7A 3B0VC 3B0UX 2IYLD 1DOVA 2OJQA
chains in the Genus database with same CATH topology
1Z3IX 4C7OB 3K66A 1ST6A 3UNGC 4DVZA 3LJBA 1PD1A 1OCRC 2P6VA 3POVA 1SF8A 4QDLA 2H7BA 4I1MA 4YWQA 1BR1A 1D1AA 2Z15A 3F47A 2IXNA 5KYNA 1VYIA 2M4EA 2EIMC 2FGYA 2CW0F 3S29A 4I3MA 2PX3A 4HEAJ 2VH3A 4KI2A 3RYLA 1OKKD 1M2VB 3VYWA 4G7ZF 1TWHA 4BJ5C 3ZIBA 4C3EA 2R7QA 2KQ9A 3EHMA 3Q6MA 4XLNF 3CZ6A 4GYTA 2WZFA 5DS6A 2DYSC 3LESA 5KYYA 1S7ZA 2WZGA 4PJJA 4ZLDA 2J7PA 1J8YF 4AE4A 3EFOB 1M2OA 3X1OA 2WB7A 4JZAA 4PK4A 1BR4A 2XXAA 4W8KA 5E33A 3EGXA 4F4BA 5L3QA 2H7VC 3LS0A 2R7XA 3NG1A 5DQZA 1VOMA 3SNHA 2Q3TA 2IXPA 4LLCA 3T4RA 2QY9A 5HSWA 3ZG1A 4BJ5A 2V3CC 1D0YA 3I5QA 2FFHA 4ULWA 2HV7A 4BJTA 1MNEA 3DM5A 4IJJA 3KMIA 3L34A 1TWCA 2NUPB 1Z63A 1TR2A 2WVOA 3ABMC 3DAGA 2ZXPA 2EINC 3UMIA 3L0IA 1IW7F 1MMNA 2Q9CA 3DJUB 1NU9C 3EH1A 2WVNA 4U5HA 3N24A 3EHNA 4CS9C 1RJ9B 1TKNA 2NG1A 1FFHA 3HLZA 3S0XA 3EG9A 4OIOF 1VK5A 2MYSA 3Q7LA 2NUTB 2PFDA 4U5CE 4I1OB 1LS1A 4H4KC 4BG0A 2CDQA 4IRUA 1TWAA 2ZXRA 5F5FA 4RBNA 1W2WA 3ASNC 3SYNA 4AX2A 1LKXA 1FTSA 3DD7A 3K1IC 5DQTA 4RDAA 3NKDA 3CQZA 4C3BA 4DBQA 3W8HA 4O6MA 2IXOA 5KYWA 2KGOA 4KC9A 1JPJA 1MMDA 1KU2A 1NZEA 2YHSA 3AG1C 5B1AC 3B9QA 2VASA 3OWTA 2A69F 2WVQA 5KYYB 1OCCC 4C7OA 2L9JA 3K6BA 4U5FE 3UGOA 2ZXOA 3H65A 1ZHTA 4N06A 4Q4ZF 1ZHZA 4BJ6C 3W8IA 3NKEA 4WJ0A 2W9YA 3EGDB 3FVYA 3FHDA 3UMHA 1J8MF 2IOQA 5DS4A 3S28A 4KNVA 1FFTC 2Q9BA 1WGWA 2R7WA 3N2ZB 3LAYA 3W2VA 1QLEC 2Y69C 3K33A 1ZHXA 1ZU5A 3QMKA 1Z23A 3K7DA 3EG9B 4JVSA 2PP4A 4IWBA 4CSAA 4YT8A 3N0TA 3NDBB 5EHHA 3EPVA 3O6XA 2PX0A 2J0XA 3EH2A 2EILC 3ABLC 3DM9B 4HFFB 4CS8C 5KYWB 2W45A 3JYHA 4OIPF 3JSZA 2CNWD 3I4UA 4FX5A 3AG3C 5KYUA 3ABKC 4BEJA 4E7SA 4ANJA 1M2VA 3NYLA 1MMAA 3PHF2 4QI2A 2Y3DA 5KYUB 1QZXA 2C03A 1O87A 2BE5F 4X0RA 2NUPA 2Y3HA 3SP1A 1LVKA 5L3VA 4DBRA 2G3VA 2KW3C 3EGXB 2R7RA 3UMKA 3JT1A 3F46A 2A6EF 2DGJA 4A2NB 2Y3BA 1TWGA 4ZLCA 4FWVA 3LLIA 5D92A 2W4MA 4O6NA 4J30B 4CBEA 5IY5C 4JCHA 2DYRC 1MNDA 4XWJA 2XL4A 4XTKA 4BJ1A 4LERA 2XXAB 1VMAA 4J32B 5D91A 4AK9A 1NU7D 3UGPA 3EZIA 3GANA 3VAYA 2ZXWC 4U5GA 3WG7C 3NYJA 1V54C 3EQLF 3NYMA 3I5PA 4B6IA 3FDQA 1D1BA 4OD4A 4XLPF 2B0JA 4Q5SF 4JJGA 2C04A 2V26A 2R7TA 1D1CA 3T6BA 5DLJA 1RJ9A 3E70C 3M1CB 2IXMA 4K0DA 3NRHA 2PF4E 5B1BC 4LLEA 4YT4A 4OD5A 5FCLA 1PD0A 2H7OA 4QI0A 3DJNB 4IAOA 2R7SA 4FESA 3RIPA 3ASOC 2ZPAA 3JRTA 4AE4B 4MNDA 3ITFA 1VYKA 1ZYRF 2I8BA 1ZU4A 3DZAA 3ZC4A 5KYXB 3OEOA 5E3AA 3Q6NA 5F5HA 2X51A 4YJWA 3LNRA 4I44A 4RD9A 4PJNA 2XSEA 2J9WA 3Q7GA 3EGDA 2QTVA 4MQ9F 4G7HF 2KJGA 3EFOA 1ZHYA 2Y3GA 4C3DA 4JW1A 5EGYA 3B0PA 3OA1A 4HE8D 4YT2A 2WL8A 4BJ6A 2J7PD 3JCUQ 2O9XA 4DOZA 3K1HA 4DVYP 2MWQA 3LLKA 2D5RB 4E7ZA 3KKBA 2EIKC 3LS1A 3S27A 4O79A 3QZCA 3SEOA 4PJMA 1M56C 2J45A 3PMRA 5CI9A 3KL4A 4OIRF 1N1CA 3CSKA 4U5DE 2A68F 4CS9A 4EWCA 5T3WA 2L81A 3AG4C 4LACB 4CIHA 2VB6A 3IEEA 2OG2A 4G0HA 2LSEA 5DVWA 3T6JA 2R7UA 2CGEA 4YN0B 2EIJC 2R7VA 3DAFA 4NY3A 2NUTA 2A6HF 1Z5ZA 2JD3A 1G8XA 3RH3A 4EBBA 4U5BE 3DMDA 1PCXA 4HFKB 4Q7CA 3ZSUA 2J46A 4OIQF 5KYXA 3W2WA 1M57C 1BR2A 4U5EE 3HTKC 4O7GA 3RKOF 3X2QC 3MLGA 3RFYA 3WODF 3UR3C 4KNWA 2R7OA 5B3SC 2KNHA 3LEVA 5E2QA 3SZRA 1V55C 1MMGA 1NG1A 1FMWA 3O39A 4CSAC 4O6YA 2J9UA 4JURI 3GODA 3AG2C 1SZIA 5T1DB 5DS5A 4GEHA 2Y39A 4PFOA 2W4BA 3MX3A 2HV6A 4KBLA 4M63A 4P6IC 3ZVRA 4PFPA 1OKKA 1JPNA 2G3KA 2OCCC 3AQCA 2GFHA 5E3CA 1FMVA 3TD7A 3KH2A 1D0XA 2P7VA 1O5HA 1Z6AA 5T3TA 1SMYF 2YZSA 3ECSA 3EJNA 1IZMA 2WZLA 2XRHA 4YT5A 5BUOA 1OCOC 2G62A 3V7OA 4CS8A 1OCZC 2CNWA 4OINF 2Q9AA 3FAJA 2A1DD 2J0WA 3HJCA 3AQBA 2E87A 4PJLA 5CI8A 2YEVA 1D0ZA 3EZHA 3DXJF 4G7OF 4K7BA 3E9VA 1ZHWA 4JJFA 2J9VA 4CS7A 3B0VC 3B0UX 2IYLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1C B; 
#chains in the Genus database with same CATH topology
 1RXQ A;  1Z3I X;  4C7O B;  3K66 A;  1ST6 A;  3UNG C;  4DVZ A;  4CJG A;  3LJB A;  2OKU A;  3ZTM A;  1PD1 A;  4UDV A;  1OCR C;  2P6V A;  3GEI A;  1SF8 A;  2IM8 A;  3POV A;  4QDL A;  3IQC A;  2H7B A;  4I1M A;  1YAU O;  1BR1 A;  1I4Z A;  4YWQ A;  1D1A A;  4NC3 A;  2EPN A;  3AGT A;  2Z15 A;  3F47 A;  2IXN A;  4IAR A;  3ZDL A;  1F1M A;  1ORS C;  5KYN A;  1VYI A;  2M4E A;  1VTM P;  2EIM C;  4XPW A;  5GPG B;  2FGY A;  5CIV A;  2CW0 F;  2J9B A;  3S29 A;  2P61 A;  1YYJ A;  4I3M A;  3JYY A;  2PX3 A;  4HEA J;  2OEX A;  2KYH A;  2VH3 A;  4KI2 A;  1EKY A;  3A9C A;  3RYL A;  1T6U A;  1OKK D;  1M2V B;  2KSF A;  4PAC A;  1FNT c;  3AOU A;  3LEO A;  3VYW A;  3IQ5 A;  2Q00 A;  3FOO A;  4G7Z F;  1TWH A;  4BJ5 C;  3ZIB A;  1QVX A;  4C3E A;  2R7Q A;  4N6C A;  2TMV P;  3TJ5 A;  2KQ9 A;  3EHM A;  4PR9 A;  2L6G A;  3H2V A;  3Q6M A;  1OW6 A;  4MVS A;  4XLN F;  3CZ6 A;  1M6T A;  3RQG A;  4GYT A;  2WZF A;  5DS6 A;  2DYS C;  3LES A;  3R2P A;  2YLD A;  2YL0 A;  5KYY A;  1HY5 A;  1S7Z A;  3G4Z A;  1HW1 A;  2WZG A;  4PJJ A;  3C8Z A;  5COM A;  4ZLD A;  2J7P A;  1Q0K A;  2XL8 A;  3DI5 A;  1J8Y F;  1ZVZ A;  3SXM A;  4AE4 A;  3EFO B;  3M15 A;  2LCH A;  1M2O A;  2F22 A;  3X1O A;  5A69 A;  2WB7 A;  4JZA A;  3IQT A;  3SXY A;  4PK4 A;  2J8W A;  1BR4 A;  4CDV A;  2XXA A;  4W8K A;  3ATP A;  3QVZ A;  3DWW A;  1NFN A;  3U2M A;  5E33 A;  2NSF A;  4CIP A;  1ORJ A;  3EGX A;  4F4B A;  5L3Q A;  2H7V C;  2XM4 A;  2YL1 A;  3LS0 A;  2R7X A;  3DE8 A;  2BL2 A;  3NG1 A;  4AL1 A;  3MFN A;  5A6J A;  1HMD A;  5DQZ A;  1VOM A;  4MVU A;  3GWN A;  3SNH A;  3S90 A;  4EBJ A;  1Y4C A;  2Q3T A;  2IXP A;  4LLC A;  4P9T A;  3T4R A;  1OW7 A;  2QY9 A;  3GWL A;  5HSW A;  2UUH A;  3ZG1 A;  4BJ5 A;  2HKV A;  4E0I A;  2V3C C;  3SXZ A;  1UFB A;  1D0Y A;  1Q0G A;  2XLO A;  1QQ3 A;  1WTY A;  2FFH A;  3I5Q A;  4MW3 A;  4Z9J A;  1WAT A;  2X0C A;  4ULW A;  4DRH B;  1AUE A;  1TFK B;  4EBK A;  2HV7 A;  4BJT A;  1MNE A;  3DM5 A;  4IJJ A;  3QTH A;  3KMI A;  3L34 A;  2PBE A;  1TWC A;  2NUP B;  5B3I A;  4E18 A;  1Z63 A;  1TR2 A;  2R05 A;  3O10 A;  3U8P A;  2WVO A;  3ABM C;  1YA9 A;  2L6H A;  3DAG A;  4JC7 A;  1RMV A;  2ZXP A;  2EIN C;  3UMI A;  3V5X A;  1IW7 F;  1LI7 A;  1MMN A;  2Q9C A;  3L0I A;  3DJU B;  3MBG A;  3L1M A;  1NU9 C;  1OXB A;  3EH1 A;  2WVN A;  1VLT A;  2GA0 A;  4U5H A;  3N24 A;  3EHN A;  2AU5 A;  4CS9 C;  1S05 A;  1RJ9 B;  1TKN A;  2NG1 A;  1FFH A;  3HLZ A;  3KYJ A;  1R5I D;  3EG9 A;  4Z9H A;  1VK5 A;  3S0X A;  4OIO F;  2IBF A;  2MYS A;  3LUT B;  3Q7L A;  2KC3 A;  4W8P A;  2NUT B;  4MVR A;  2PFD A;  4U5C E;  5COF A;  1WAS A;  4I1O B;  1LS1 A;  2OOC A;  4H4K C;  4JEA A;  4DJ9 A;  3TUL A;  1YAR O;  3HKK A;  4YL0 A;  1JOG A;  5HV9 A;  1U6H A;  4BG0 A;  2AWY A;  3W2W A;  2CDQ A;  4IRU A;  3FOP A;  1TWA A;  2ZXR A;  5F5F A;  2YL7 A;  4RBN A;  1W2W A;  3GM2 A;  1KNY A;  3ASN C;  3U3B A;  3U9J A;  3SYN A;  4AX2 A;  1LKX A;  1FTS A;  1LIH A;  4CDA A;  1RCP A;  3DD7 A;  3K1I C;  5DQT A;  4RDA A;  3NKD A;  3U8V A;  1E2X A;  2OJE D;  3FAP B;  2L7A A;  2HSQ A;  3GOR A;  3CQZ A;  4JTA B;  4C3B A;  3W8H A;  4DBQ A;  4O6M A;  2IXO A;  5TJ5 E;  5KYW A;  2LK4 A;  2KGO A;  4KC9 A;  1C02 A;  3TK0 A;  2ZD9 A;  1JPJ A;  3TOM A;  1MMD A;  3R7C A;  1KU2 A;  1NZE A;  2YHS A;  3AG1 C;  2I15 A;  5B1A C;  4MTG A;  3J06 A;  1EQ1 A;  3B9Q A;  1HMO A;  2VAS A;  3G4X A;  1YVI A;  3C7J A;  3HNJ A;  3OWT A;  4MS2 A;  4D4X A;  2A69 F;  2WVQ A;  5KYY B;  4J7Y A;  1OCC C;  4C7O A;  2BC5 A;  2L9J A;  2QNL A;  3K6B A;  4H54 A;  2LP4 A;  3HNI A;  3JZ0 A;  2HFI A;  4U9E A;  4XEF A;  4U5F E;  3UGO A;  2LFD A;  1MQV A;  2ZXO A;  1EI7 A;  3H65 A;  1CPQ A;  5L0D A;  1ZHT A;  4N06 A;  4Q4Z F;  1ZHZ A;  3C8G D;  4BJ6 C;  3W8I A;  3NKE A;  4WJ0 A;  2ICW G;  2YQY A;  1CGM E;  5L0J A;  2W9Y A;  1YDI A;  1LI5 A;  3EGD B;  1OXK A;  3FVY A;  3IQ6 A;  3FHD A;  3UMH A;  2HUJ A;  1RKE A;  4ONS A;  4ULV A;  1J8M F;  1RKC A;  2IOQ A;  3ZQY A;  3H2U A;  5DS4 A;  3S28 A;  4KNV A;  1G5Z A;  1FFT C;  3M4C A;  3C62 A;  2Q9B A;  1A7E A;  1ORY A;  1WGW A;  3JSE O;  2Q7R A;  3N2Z B;  3LAY A;  1QPU A;  4NTF A;  4EKW A;  2R7W A;  4NQF A;  2HS5 A;  1C03 A;  1QLE C;  3W2V A;  4AL0 A;  2Y69 C;  3K33 A;  1ZHX A;  2YRF A;  1T6Q A;  1ZU5 A;  3QMK A;  1Z23 A;  3K7D A;  2HJM A;  3EG9 B;  4JVS A;  1LE2 A;  1LM3 B;  2PP4 A;  4IWB A;  4LDK A;  3V5Y A;  4CSA A;  4YT8 A;  3N0T A;  4LDQ A;  1GQA A;  3NDB B;  1E85 A;  1H6G A;  2YL3 A;  5EHH A;  3IHU A;  3EPV A;  3O6X A;  2PX0 A;  2CYD A;  2J0X A;  1EA8 A;  2EIL C;  3EH2 A;  3ABL C;  3DM9 B;  4HFF B;  4CS8 C;  1XWJ A;  2VC9 A;  5AC4 A;  5KYW B;  2W45 A;  3JYH A;  4CX9 A;  3GM3 A;  3GM1 A;  2EPO A;  4OIP F;  1U89 A;  3JSZ A;  2MHR A;  1H9G A;  3S9O A;  2HSB A;  2CNW D;  3NMJ A;  3I4U A;  4J7T A;  5A6B A;  3RVY A;  1T6I A;  4FX5 A;  4MTF A;  4A4A A;  3AG3 C;  5KYU A;  1G4U S;  3ABK C;  4BEJ A;  4E7S A;  3AJM A;  4ANJ A;  1M2V A;  1K05 A;  256B A;  3NYL A;  1MMA A;  3O55 A;  4YL1 A;  3V5Z A;  3PHF 2;  3TOL A;  2Y3D A;  4QI2 A;  5KYU B;  1QZX A;  2R25 A;  2C03 A;  2XLV A;  5AGF A;  1O87 A;  2BE5 F;  4X0R A;  2NUP A;  2Y3H A;  3SP1 A;  1LVK A;  5L3V A;  4DBR A;  2G3V A;  2KW3 C;  1GGQ A;  3HNK A;  3KYI A;  3EGX B;  2R7R A;  3UMK A;  3JT1 A;  4YK5 A;  3F46 A;  2A6E F;  2DGJ A;  3B29 A;  4JRZ A;  2Y3B A;  4A2N B;  2XS1 A;  1AEP A;  1TWG A;  2DI3 A;  4ZLC A;  4FWV A;  3LLI A;  5AC5 A;  5D92 A;  2W4M A;  3FMS A;  4O6N A;  3C18 A;  3GEH A;  4J30 B;  3CAX A;  2P1A A;  3KPH A;  4R32 A;  3L8J A;  4CBE A;  5IY5 C;  2H8A A;  4JCH A;  2DYR C;  1WOL A;  4JIO A;  4DRI B;  2QLA A;  4P9F A;  2XS8 A;  1MND A;  4XWJ A;  3ZQV A;  3T9O A;  4EIY A;  4Z9I A;  5L0H A;  2XL4 A;  4XTK A;  4BJ1 A;  4LER A;  2XXA B;  5JP7 A;  1UG7 A;  1V74 B;  1VMA A;  4J32 B;  5D91 A;  1NU7 D;  3U5S A;  3ZWI A;  4AK9 A;  4BPM A;  3EZI A;  3GAN A;  3UGP A;  2OQM A;  3VAY A;  2XLW A;  2XLE A;  2D4U A;  2ZXW C;  2PNO A;  2YLG A;  4U5G A;  3WG7 C;  3NYJ A;  5L0I A;  1V54 C;  3EQL F;  3JTL O;  5JT4 A;  3NYM A;  3I5P A;  4B6I A;  2QUP A;  1JMW A;  3FDQ A;  3LNM B;  1D1B A;  1Y6D A;  2ASR A;  4OD4 A;  4XLP F;  3WHN A;  5COG A;  3U3F A;  1FR0 A;  2B0J A;  4WGY A;  1AVO B;  4Q5S F;  1KTM A;  4JJG A;  2C04 A;  2V26 A;  4G78 A;  5BQG A;  5JS5 A;  2R7T A;  1D1C A;  4DRJ B;  1T01 A;  1YZA A;  3T6B A;  1BZ4 A;  2OU6 A;  2VCC A;  5DLJ A;  1RJ9 A;  5BQI A;  5A6B D;  3E70 C;  3M1C B;  1DOW A;  2IXM A;  3HNL A;  4K0D A;  1SR2 A;  3NRH A;  1Z7Q c;  3C8G B;  2PF4 E;  4CDY A;  5B1B C;  2VCB A;  4LLE A;  4YT4 A;  1Q0D A;  5A6K A;  5JSL A;  1WWP A;  2L6F A;  4OD5 A;  1PD0 A;  2KK1 A;  5FCL A;  3MYI A;  2H7O A;  4QI0 A;  3DJN B;  4IAO A;  2YLI A;  4FES A;  3RIP A;  3ASO C;  1K04 A;  2ZPA A;  2FAP B;  3JRT A;  4AE4 B;  4MND A;  3ITF A;  4JKV A;  4D4N A;  1QKR A;  1VYK A;  1ZYR F;  3A11 A;  3FXH A;  3G50 A;  2I8B A;  3RF3 A;  1ZU4 A;  3DZA A;  3QVY A;  5F28 E;  3DKA A;  4ER9 A;  3ZC4 A;  5KYX B;  1QSP A;  3OEO A;  5E3A A;  2XLH A;  3U0C A;  2NPU A;  3Q6N A;  5F5H A;  3VM6 A;  2AVK A;  3M79 A;  2HZ8 A;  4N6H A;  2X51 A;  4YJW A;  3LNR A;  4I44 A;  4IB4 A;  4RD9 A;  4PJN A;  2XSE A;  4CJO A;  1O3U A;  2LIG A;  1OW8 A;  3DE9 A;  2J9W A;  2YWA A;  3Q7G A;  1TQG A;  4MTO A;  4XQ1 A;  1Q0F A;  3EGD A;  2QTV A;  4MQ9 F;  4G7H F;  2KJG A;  3EFO A;  1R4T A;  1XZP A;  1ZHY A;  2Y3G A;  4EUK B;  1A7V A;  3PCV A;  4JW1 A;  2CCY A;  4C3D A;  5EGY A;  2R7S A;  1B68 A;  4FAP B;  1L7C A;  2DB4 A;  1ZW2 A;  1ZW3 A;  3B0P A;  4BEM J;  4GQH A;  3OA1 A;  4HE8 D;  4MVO A;  4YT2 A;  2WL8 A;  4BJ6 A;  2J7P D;  3CEX A;  3JCU Q;  2R03 A;  2O9X A;  2ETS A;  4DOZ A;  3M4B A;  3K1H A;  4DVY P;  1TFO B;  2MWQ A;  3LLK A;  2D5R B;  3NMK A;  2YVK A;  4NCQ A;  4E7Z A;  5A6A A;  1JR8 A;  3KKB A;  2EIK C;  3LS1 A;  4N4W A;  1C17 M;  2AWC A;  3RQE A;  3S27 A;  4O79 A;  3QZC A;  1APC A;  4JCZ A;  3SEO A;  1NFO A;  4PJM A;  2GAQ A;  1M56 C;  4IGG A;  2J45 A;  4XPX A;  3PMR A;  5CI9 A;  3KL4 A;  4OIR F;  1T9K A;  1N1C A;  3CSK A;  4XEK A;  4U5D E;  1OQC A;  1A7D A;  2A68 F;  4CS9 A;  1E84 A;  4EWC A;  5T3W A;  2L81 A;  3AG4 C;  1A0B A;  1CGO A;  1XZQ A;  2LQG A;  3QW1 A;  1RKE B;  3C63 A;  1YYX A;  2JPU A;  4LAC B;  2Q4F A;  4WAB A;  4CIH A;  2EPL X;  1OR3 A;  2VB6 A;  3IEE A;  2OG2 A;  4G0H A;  2LSE A;  5DVW A;  4XEV A;  5L0C A;  2QE9 A;  4L6R A;  3T6J A;  4JEB A;  3RVZ A;  2CGE A;  4YN0 B;  2EIJ C;  4JTC B;  4LDR A;  5EK0 A;  2A0U A;  2R7U A;  3DAF A;  2R7V A;  2R02 A;  1LPE A;  4NY3 A;  2A6H F;  1Z5Z A;  2GWW A;  2JD3 A;  1G8X A;  2NUT A;  3RH3 A;  3US6 A;  4EBB A;  4U5B E;  4E17 A;  2B0H A;  1BBH A;  5FZT A;  3DMD A;  1PCX A;  4HFK B;  4Q7C A;  1HW2 A;  3ZSU A;  4NTB A;  2J46 A;  4OIQ F;  4K1O A;  5KYX A;  1NBB A;  2HMQ A;  1HE9 A;  1YA7 O;  1M57 C;  1BR2 A;  4NTA A;  4U5E E;  4XPY A;  3C8G A;  3VRC A;  3HTK C;  4O7G A;  3RKO F;  3X2Q C;  1NLX A;  3W4Y A;  4MVM A;  5JRA A;  3MLG A;  3GEE A;  3ZTZ A;  5JUA A;  4E0H A;  1HE1 A;  1LS4 A;  3BRJ A;  3RFY A;  3WOD F;  3UR3 C;  3IPM O;  2R7O A;  4KNW A;  3VF0 A;  4EHP A;  5K0I A;  5B3S C;  2KNH A;  1YZC A;  3LEV A;  5E2Q A;  3SZR A;  1U0B B;  4YL3 A;  1V55 C;  1MMG A;  2NSG A;  2GDC A;  2HMZ A;  1NG1 A;  1FMW A;  3O39 A;  2LFF A;  4O6Y A;  3T6G B;  4CSA C;  1OR2 A;  5JVE A;  1V4A A;  2J9U A;  4JUR I;  1JAF A;  2OEV A;  4JE9 A;  3GOD A;  2A0B A;  3AG2 C;  1SZI A;  4MVZ A;  4U9D A;  1T5O A;  1H7I A;  4GEH A;  2Y39 A;  5T1D B;  5DS5 A;  4PFO A;  2W4B A;  3MX3 A;  3U9M A;  3BEH A;  3U2L A;  2EPK X;  1L3P A;  2HV6 A;  1CPR A;  4MW8 A;  3PDM P;  4KBL A;  4M63 A;  2LD6 A;  1NSG B;  2AP3 A;  4P6I C;  2VCA A;  3ZVR A;  2XM0 A;  4PFP A;  1WN0 A;  1SYQ A;  1OKK A;  1JPN A;  2G3K A;  2OCC C;  2P0N A;  3AQC A;  3MYF A;  2GFH A;  4JTD B;  2M64 A;  1FMV A;  5E3C A;  3K1I A;  3NMI A;  5L0F A;  4IAQ A;  1YLM A;  1ZZP A;  3TD7 A;  3KH2 A;  1A41 A;  1D0X A;  2P7V A;  2UUI A;  1O5H A;  1Z6A A;  1G4W R;  1VLS A;  1SMY F;  5T3T A;  2XLM A;  3B71 A;  3AGU A;  1LE4 A;  1YJG A;  3TJ6 A;  4MVQ A;  2R9R B;  5L0G A;  3RW0 A;  2YZS A;  3ECS A;  2RSE B;  3EJN A;  2YKZ A;  1IZM A;  3S84 A;  2WZL A;  2XRH A;  4YT5 A;  1CGN A;  5BUO A;  1OCO C;  2G62 A;  3RQF A;  1E83 A;  3JRM O;  3V7O A;  3SXK A;  4CS8 A;  1OCZ C;  1JRA A;  1H9T A;  1FAP B;  2CNW A;  5BQH A;  2RD9 A;  4OIN F;  2Q9A A;  1GS9 A;  2JX0 A;  2A1D D;  2HJ3 A;  3FAJ A;  2J0W A;  5JLI A;  1I5N A;  3HJC A;  1E86 A;  3AQB A;  3TQO A;  3QW0 A;  2E87 A;  4PJL A;  5CI8 A;  1PV3 A;  4WGZ A;  2YEV A;  2XLD A;  1D0Z A;  3EZH A;  1K40 A;  2EPM X;  3DXJ F;  1VB5 A;  1Q0M A;  4G7O F;  1GM5 A;  4K7B A;  3E9V A;  2XL6 A;  1ZHW A;  3WAQ A;  1BDJ B;  3L8I A;  1I4Y A;  2J9V A;  4JJF A;  4DXW A;  4CS7 A;  3B0V C;  3B0U X;  2IYL D;  1DOV A;  2OJQ A; 
#chains in the Genus database with same CATH homology
 1Z3I X;  4C7O B;  3K66 A;  1ST6 A;  3UNG C;  4DVZ A;  3LJB A;  1PD1 A;  1OCR C;  2P6V A;  3POV A;  1SF8 A;  4QDL A;  2H7B A;  4I1M A;  4YWQ A;  1BR1 A;  1D1A A;  2Z15 A;  3F47 A;  2IXN A;  5KYN A;  1VYI A;  2M4E A;  2EIM C;  2FGY A;  2CW0 F;  3S29 A;  4I3M A;  2PX3 A;  4HEA J;  2VH3 A;  4KI2 A;  3RYL A;  1OKK D;  1M2V B;  3VYW A;  4G7Z F;  1TWH A;  4BJ5 C;  3ZIB A;  4C3E A;  2R7Q A;  2KQ9 A;  3EHM A;  3Q6M A;  4XLN F;  3CZ6 A;  4GYT A;  2WZF A;  5DS6 A;  2DYS C;  3LES A;  5KYY A;  1S7Z A;  2WZG A;  4PJJ A;  4ZLD A;  2J7P A;  1J8Y F;  4AE4 A;  3EFO B;  1M2O A;  3X1O A;  2WB7 A;  4JZA A;  4PK4 A;  1BR4 A;  2XXA A;  4W8K A;  5E33 A;  3EGX A;  4F4B A;  5L3Q A;  2H7V C;  3LS0 A;  2R7X A;  3NG1 A;  5DQZ A;  1VOM A;  3SNH A;  2Q3T A;  2IXP A;  4LLC A;  3T4R A;  2QY9 A;  5HSW A;  3ZG1 A;  4BJ5 A;  2V3C C;  1D0Y A;  3I5Q A;  2FFH A;  4ULW A;  2HV7 A;  4BJT A;  1MNE A;  3DM5 A;  4IJJ A;  3KMI A;  3L34 A;  1TWC A;  2NUP B;  1Z63 A;  1TR2 A;  2WVO A;  3ABM C;  3DAG A;  2ZXP A;  2EIN C;  3UMI A;  3L0I A;  1IW7 F;  1MMN A;  2Q9C A;  3DJU B;  1NU9 C;  3EH1 A;  2WVN A;  4U5H A;  3N24 A;  3EHN A;  4CS9 C;  1RJ9 B;  1TKN A;  2NG1 A;  1FFH A;  3HLZ A;  3S0X A;  3EG9 A;  4OIO F;  1VK5 A;  2MYS A;  3Q7L A;  2NUT B;  2PFD A;  4U5C E;  4I1O B;  1LS1 A;  4H4K C;  4BG0 A;  2CDQ A;  4IRU A;  1TWA A;  2ZXR A;  5F5F A;  4RBN A;  1W2W A;  3ASN C;  3SYN A;  4AX2 A;  1LKX A;  1FTS A;  3DD7 A;  3K1I C;  5DQT A;  4RDA A;  3NKD A;  3CQZ A;  4C3B A;  4DBQ A;  3W8H A;  4O6M A;  2IXO A;  5KYW A;  2KGO A;  4KC9 A;  1JPJ A;  1MMD A;  1KU2 A;  1NZE A;  2YHS A;  3AG1 C;  5B1A C;  3B9Q A;  2VAS A;  3OWT A;  2A69 F;  2WVQ A;  5KYY B;  1OCC C;  4C7O A;  2L9J A;  3K6B A;  4U5F E;  3UGO A;  2ZXO A;  3H65 A;  1ZHT A;  4N06 A;  4Q4Z F;  1ZHZ A;  4BJ6 C;  3W8I A;  3NKE A;  4WJ0 A;  2W9Y A;  3EGD B;  3FVY A;  3FHD A;  3UMH A;  1J8M F;  2IOQ A;  5DS4 A;  3S28 A;  4KNV A;  1FFT C;  2Q9B A;  1WGW A;  2R7W A;  3N2Z B;  3LAY A;  3W2V A;  1QLE C;  2Y69 C;  3K33 A;  1ZHX A;  1ZU5 A;  3QMK A;  1Z23 A;  3K7D A;  3EG9 B;  4JVS A;  2PP4 A;  4IWB A;  4CSA A;  4YT8 A;  3N0T A;  3NDB B;  5EHH A;  3EPV A;  3O6X A;  2PX0 A;  2J0X A;  3EH2 A;  2EIL C;  3ABL C;  3DM9 B;  4HFF B;  4CS8 C;  5KYW B;  2W45 A;  3JYH A;  4OIP F;  3JSZ A;  2CNW D;  3I4U A;  4FX5 A;  3AG3 C;  5KYU A;  3ABK C;  4BEJ A;  4E7S A;  4ANJ A;  1M2V A;  3NYL A;  1MMA A;  3PHF 2;  4QI2 A;  2Y3D A;  5KYU B;  1QZX A;  2C03 A;  1O87 A;  2BE5 F;  4X0R A;  2NUP A;  2Y3H A;  3SP1 A;  1LVK A;  5L3V A;  4DBR A;  2G3V A;  2KW3 C;  3EGX B;  2R7R A;  3UMK A;  3JT1 A;  3F46 A;  2A6E F;  2DGJ A;  4A2N B;  2Y3B A;  1TWG A;  4ZLC A;  4FWV A;  3LLI A;  5D92 A;  2W4M A;  4O6N A;  4J30 B;  4CBE A;  5IY5 C;  4JCH A;  2DYR C;  1MND A;  4XWJ A;  2XL4 A;  4XTK A;  4BJ1 A;  4LER A;  2XXA B;  1VMA A;  4J32 B;  5D91 A;  4AK9 A;  1NU7 D;  3UGP A;  3EZI A;  3GAN A;  3VAY A;  2ZXW C;  4U5G A;  3WG7 C;  3NYJ A;  1V54 C;  3EQL F;  3NYM A;  3I5P A;  4B6I A;  3FDQ A;  1D1B A;  4OD4 A;  4XLP F;  2B0J A;  4Q5S F;  4JJG A;  2C04 A;  2V26 A;  2R7T A;  1D1C A;  3T6B A;  5DLJ A;  1RJ9 A;  3E70 C;  3M1C B;  2IXM A;  4K0D A;  3NRH A;  2PF4 E;  5B1B C;  4LLE A;  4YT4 A;  4OD5 A;  5FCL A;  1PD0 A;  2H7O A;  4QI0 A;  3DJN B;  4IAO A;  2R7S A;  4FES A;  3RIP A;  3ASO C;  2ZPA A;  3JRT A;  4AE4 B;  4MND A;  3ITF A;  1VYK A;  1ZYR F;  2I8B A;  1ZU4 A;  3DZA A;  3ZC4 A;  5KYX B;  3OEO A;  5E3A A;  3Q6N A;  5F5H A;  2X51 A;  4YJW A;  3LNR A;  4I44 A;  4RD9 A;  4PJN A;  2XSE A;  2J9W A;  3Q7G A;  3EGD A;  2QTV A;  4MQ9 F;  4G7H F;  2KJG A;  3EFO A;  1ZHY A;  2Y3G A;  4C3D A;  4JW1 A;  5EGY A;  3B0P A;  3OA1 A;  4HE8 D;  4YT2 A;  2WL8 A;  4BJ6 A;  2J7P D;  3JCU Q;  2O9X A;  4DOZ A;  3K1H A;  4DVY P;  2MWQ A;  3LLK A;  2D5R B;  4E7Z A;  3KKB A;  2EIK C;  3LS1 A;  3S27 A;  4O79 A;  3QZC A;  3SEO A;  4PJM A;  1M56 C;  2J45 A;  3PMR A;  5CI9 A;  3KL4 A;  4OIR F;  1N1C A;  3CSK A;  4U5D E;  2A68 F;  4CS9 A;  4EWC A;  5T3W A;  2L81 A;  3AG4 C;  4LAC B;  4CIH A;  2VB6 A;  3IEE A;  2OG2 A;  4G0H A;  2LSE A;  5DVW A;  3T6J A;  2R7U A;  2CGE A;  4YN0 B;  2EIJ C;  2R7V A;  3DAF A;  4NY3 A;  2NUT A;  2A6H F;  1Z5Z A;  2JD3 A;  1G8X A;  3RH3 A;  4EBB A;  4U5B E;  3DMD A;  1PCX A;  4HFK B;  4Q7C A;  3ZSU A;  2J46 A;  4OIQ F;  5KYX A;  3W2W A;  1M57 C;  1BR2 A;  4U5E E;  3HTK C;  4O7G A;  3RKO F;  3X2Q C;  3MLG A;  3RFY A;  3WOD F;  3UR3 C;  4KNW A;  2R7O A;  5B3S C;  2KNH A;  3LEV A;  5E2Q A;  3SZR A;  1V55 C;  1MMG A;  1NG1 A;  1FMW A;  3O39 A;  4CSA C;  4O6Y A;  2J9U A;  4JUR I;  3GOD A;  3AG2 C;  1SZI A;  5T1D B;  5DS5 A;  4GEH A;  2Y39 A;  4PFO A;  2W4B A;  3MX3 A;  2HV6 A;  4KBL A;  4M63 A;  4P6I C;  3ZVR A;  4PFP A;  1OKK A;  1JPN A;  2G3K A;  2OCC C;  3AQC A;  2GFH A;  5E3C A;  1FMV A;  3TD7 A;  3KH2 A;  1D0X A;  2P7V A;  1O5H A;  1Z6A A;  5T3T A;  1SMY F;  2YZS A;  3ECS A;  3EJN A;  1IZM A;  2WZL A;  2XRH A;  4YT5 A;  5BUO A;  1OCO C;  2G62 A;  3V7O A;  4CS8 A;  1OCZ C;  2CNW A;  4OIN F;  2Q9A A;  3FAJ A;  2A1D D;  2J0W A;  3HJC A;  3AQB A;  2E87 A;  4PJL A;  5CI8 A;  2YEV A;  1D0Z A;  3EZH A;  3DXJ F;  4G7O F;  4K7B A;  3E9V A;  1ZHW A;  4JJF A;  2J9V A;  4CS7 A;  3B0V C;  3B0U X;  2IYL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...