3M1CB

Crystal structure of the conserved herpesvirus fusion regulator complex gh-gl
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
180
structure length
146
Chain Sequence
b'TEYVLRSVIAKEVGDILRVPCMRTPADDVSWRYEAPSVIDYARIDGIFLRYHCPGLDTFLWDRHAQRAYLVNPFLFAAGFLEDLSHSVDTQETTTRRALYKEIRDALGSRKQAVSHAPVRAGCVNFDYSRTRRCVGRRDPVLALSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title Crystal structure of the conserved herpesvirus fusion regulator complex gH-gL.
pubmed doi rcsb
source organism Human herpesvirus 2
molecule tags Viral protein
total genus 35
structure length 146
sequence length 180
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05259 Herpes_UL1 Herpesvirus glycoprotein L
B PF12524 GlyL_C dsDNA virus glycoprotein L C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3m1cB01
3M1CB
chains in the Genus database with same CATH superfamily
1PCXA 2EPNA 2OJED 2D5RB 3U9MA 4L6RA 3W4YA 2P0NA 4XEFA 4N6CA 3CSKA 1OW6A 2VH3A 3I5PA 4IARA 4U9EA 1Z6AA 4KNVA 3JRTA 3DZAA 5DQZA 3EGDB 4Q5SF 4CJGA 5A6JA 2HSBA 3HNLA 3TK0A 5E3CA 1ZU5A 4A4AA 3H2VA 1OCCC 1XZQA 2HMZA 5AC5A 2VCCA 2L9JA 1ORJA 1K05A 1OR3A 1BR1A 2UUIA 5B1AC 1EKYA 1Z7Qc 1M56C 3LNMB 4U5EE 1RJ9B 3TOLA 4CDYA 5KYUB 3UMKA 3KKBA 1A0BA 1LPEA 1R4TA 2O9XA 3F46A 3RFYA 4C3BA 1GM5A 4BJ6A 1ZW2A 1TWGA 3TULA 3O10A 3UGPA 4CSAA 2CGEA 3GM3A 2EIKC 1QLEC 1EI7A 3DJUB 4Z9IA 1AUEA 4IAQA 2A0UA 4MTOA 3EHNA 3TQOA 4U5BE 4IGGA 2VB6A 5K0IA 3QZCA 4AK9A 3MBGA 3RQGA 3X1OA 5JUAA 4C7OB 1M2VB 2IOQA 1RJ9A 2XLOA 4U5DE 5KYXB 3FDQA 2R25A 3B9QA 3B0UX 3U9JA 3JTLO 1E83A 1SZIA 3KPHA 3LJBA 4CJOA 1NSGB 4QI0A 5KYWB 5JRAA 2GDCA 1LI5A 256BA 4XEKA 1TWCA 1MMNA 3K1IA 2C03A 2J0XA 3Q6NA 4GYTA 2G3VA 4Z9HA 4OD4A 1CGNA 1NU9C 1M2VA 1ZZPA 1PV3A 2LQGA 2YL3A 4EBJA 3Q7LA 4P6IC 4ULVA 2A0BA 2MWQA 3W8IA 1YDIA 4B6IA 5KYXA 1QVXA 4DVYP 4NQFA 4PJMA 2M64A 1U6HA 1ZHTA 3PHF2 3EFOB 1MMAA 2JX0A 1ZVZA 4YK5A 4DXWA 1QPUA 4D4NA 3EH1A 2WVOA 3OEOA 2NUTA 3UMIA 3DKAA 3O55A 5F28E 1JOGA 3KYIA 1H9GA 1L7CA 1LS4A 2YVKA 3SEOA 1I5NA 5A6BD 2AVKA 2NSGA 2XLDA 4E18A 4DBRA 3FXHA 1M2OA 1TKNA 2EIJC 3BEHA 4JIOA 4BEJA 1T01A 3EHMA 4BG0A 4IB4A 1JAFA 3IHUA 3QTHA 1HW1A 4YL0A 1G4WR 5L0JA 4JURI 1OCRC 4K0DA 1G4US 3VAYA 3GWLA 5BUOA 5JT4A 3CZ6A 4N06A 1IW7F 4YJWA 2ZPAA 4BPMA 2XXAA 3PDMP 2Q9AA 5BQHA 1H7IA 3JRMO 1NU7D 2YLDA 3GM1A 4OD5A 4E7ZA 2V3CC 3EGXA 2AP3A 1VLSA 1KU2A 2R02A 4KI2A 1EQ1A 2Y69C 1F1MA 4CS9C 1VLTA 2WVNA 1J8MF 3DD7A 3LAYA 4JRZA 5D92A 4AL1A 2I8BA 3IEEA 4EBBA 2IYLD 3JCUQ 5E33A 1T5OA 2GAQA 3U8PA 3G50A 2IXPA 2NSFA 4WABA 1APCA 3SNHA 3KYJA 3L1MA 3OWTA 2ZXRA 4HEAJ 1HE9A 3V5XA 4YWQA 4ER9A 5AC4A 5JSLA 2KGOA 2L7AA 1ORSC 3NKDA 4JC7A 1Z23A 3TJ6A 3U2MA 4MS2A 4E0HA 3SP1A 4IJJA 3BRJA 3UMHA 4DOZA 3O6XA 4YL3A 1I4ZA 2VASA 1V55C 2OOCA 2Z15A 3ZWIA 3UR3C 3E9VA 2DYSC 3DM9B 5T3WA 4MQ9F 2JPUA 1WASA 4ANJA 3AQBA 1NFOA 4JE9A 1YZCA 2PX3A 3JYHA 4N6HA 3ZC4A 5JVEA 1K40A 4H4KC 2P1AA 2WB7A 5L3QA 1O3UA 4MVUA 2E87A 3UGOA 1C03A 1MMGA 4JTDB 4KNWA 1I4YA 3FAPB 2BE5F 4YT5A 2GA0A 1QQ3A 1YYJA 2Y3BA 4PJLA 5DLJA 2Q7RA 2YL0A 3US6A 4AX2A 4WJ0A 5TJ5E 2NUPA 4LDQA 4NCQA 4FAPB 3ATPA 3M4BA 2CW0F 4U5FE 5JLIA 2VCAA 4J7TA 4DRJB 3AQCA 5DS4A 1RMVA 3MLGA 4K7BA 4DJ9A 1PD0A 2LSEA 4MVSA 1ORYA 2TMVP 4U5HA 4G78A 3AG1C 1CPQA 2LCHA 1LE2A 3VM6A 1M57C 4FX5A 2GWWA 2M4EA 4O6NA 1SF8A 2W45A 2YWAA 3HLZA 4I3MA 1D0ZA 5HSWA 3QVZA 3C8ZA 4EIYA 3U3FA 1HMDA 3EG9B 1TWHA 5F5FA 5DQTA 3CAXA 2R7XA 2XS1A 2I15A 2XL8A 2WZFA 2RD9A 3G4ZA 1V74B 4JW1A 4BJTA 3S9OA 1VOMA 4NTFA 1E85A 1WATA 3SXYA 2OKUA 2J7PD 5EGYA 5IY5C 3SXMA 5KYYA 4RBNA 4MW8A 1LIHA 3DE8A 2AU5A 4MW3A 1RKEA 4M63A 2XLMA 4FWVA 2XLEA 1K04A 3C62A 3JT1A 3ZIBA 3MFNA 2LFDA 2XSEA 4JEAA 1Z63A 2R7VA 3C8GA 1CPRA 3EG9A 2WVQA 2A69F 1D1CA 4H54A 1OR2A 1WWPA 3DMDA 2KC3A 1H9TA 2Q3TA 1J8YF 2EPMX 4YL1A 1KTMA 2NUTB 4PACA 4AE4A 5L0IA 3ZG1A 2FFHA 1YVIA 2HJMA 5B3SC 1GGQA 1Q0GA 2L6HA 2RSEB 3NYLA 3QW1A 3WODF 1U0BB 4JTAB 4CS7A 5T3TA 3S29A 3LUTB 5L3VA 1U89A 4XTKA 3W2WA 4LACB 4XPYA 4IAOA 4F4BA 1FFHA 4EWCA 4P9FA 4I1OB 4G7OF 4MVRA 2R7UA 1LKXA 3MX3A 4XEVA 1FMVA 2P7VA 3ECSA 4X0RA 1NG1A 1ZU4A 3B71A 2PNOA 4R32A 2QUPA 3NMJA 3VF0A 1D1BA 3FOPA 3VRCA 2XXAB 3T6BA 4QI2A 2IXMA 3K7DA 2P61A 2PX0A 3EGXB 1CGOA 2AWYA 2QE9A 2YRFA 3JSZA 3NRHA 2J9UA 1Q0DA 1OCOC 2KQ9A 2OG2A 2LD6A 3DI5A 4AL0A 1TWAA 1T9KA 1FMWA 4CS9A 4CS8C 2A6HF 1ST6A 2KW3C 3JZ0A 1BDJB 2ICWG 1WGWA 4J32B 3FHDA 4O79A 4CIHA 2PFDA 4PFOA 2OEVA 3RYLA 4ZLCA 1HMOA 2A1DD 2XM0A 3Q6MA 5T1DB 1ZHWA 2W4MA 3RVYA 3U3BA 3RVZA 2BL2A 2P6VA 4CDVA 3LESA 1MNDA 1G8XA 3DAGA 3IQ6A 3T4RA 4E17A 1E2XA 2WZGA 2ZXPA 3QW0A 4Q7CA 3SXKA 1C17M 4E7SA 2J9BA 5A69A 1G5ZA 1YA7O 1SMYF 2HKVA 2LP4A 2OU6A 2Q9BA 2R7QA 3ABLC 3FAJA 4JJFA 4MNDA 4BEMJ 1Q0MA 5KYNA 3SZRA 4EKWA 4I1MA 4MTGA 4J7YA 3KH2A 4CBEA 2HFIA 3ZVRA 4JJGA 3X2QC 3L8JA 3SYNA 1HW2A 3ASNC 3GM2A 2J9WA 5BQIA 3NYMA 3DJNB 4DRIB 1A7EA 2A68F 1D0XA 2H8AA 2R7SA 3AJMA 2J9VA 5EK0A 5JP7A 2J46A 2X0CA 1L3PA 1Q0KA 3N0TA 1E86A 3LLKA 5JS5A 5COFA 2EIMC 2EINC 3RH3A 3GODA 2R7RA 1W2WA 1JR8A 2H7VC 1TFOB 2YL7A 3V5YA 2NUPB 4DBQA 2YKZA 1T6IA 1JRAA 2EPLX 1RKCA 1OKKA 3B0PA 5DVWA 5FCLA 3IQTA 2ZXWC 4KC9A 4Q4ZF 1HE1A 3N2ZB 4IWBA 1ZHXA 2CNWA 1VB5A 3VYWA 1JMWA 2D4UA 2FGYA 4OIRF 1O5HA 1OXKA 2Q9CA 3FMSA 3AG2C 3T6JA 2L6FA 2EILC 4D4XA 1UFBA 1YJGA 2L6GA 2LFFA 2L81A 4OIOF 2R05A 2DGJA 1LM3B 2DI3A 3GEIA 3JSEO 2GFHA 4BJ5C 2MHRA 3IQCA 5E3AA 1S05A 1Z5ZA 4RD9A 5KYYB 3H2UA 2Y3GA 4OIQF 3ZTMA 4J30B 5A6BA 2WL8A 1BZ4A 1RKEB 2W4BA 2JD3A 4CIPA 3FVYA 4U9DA 4GEHA 5L0HA 3U0CA 1MNEA 2XM4A 4N4WA 4XPWA 3GANA 4G0HA 4XLNF 1D1AA 2R9RB 3C8GB 2A6EF 2QTVA 3NMIA 3ZQYA 3V5ZA 1JPNA 1NLXA 1UG7A 1NFNA 1VYKA 2YZSA 2ZD9A 3AG4C 4LLEA 1S7ZA 3LS1A 4NC3A 4HE8D 5GPGB 2G3KA 4U5CE 1GS9A 2VCBA 4AE4B 2PF4E 3TD7A 2KYHA 2EPKX 2HJ3A 2DYRC 1A7VA 1BBHA 2ETSA 3LLIA 5B1BC 3N24A 2F22A 3ABMC 3S27A 4YT2A 3TJ5A 2KK1A 4MVOA 2J8WA 2XRHA 3HTKC 3S28A 1DOVA 4MVZA 1FFTC 3A9CA 3ZSUA 5E2QA 1WN0A 1AVOB 1OCZC 3NKEA 4U5GA 4JCZA 2J0WA 3V7OA 4XWJA 3C18A 3NMKA 4EHPA 3HNJA 3S0XA 3DAFA 2XL6A 1E84A 3RIPA 1Y4CA 1OQCA 3UNGC 4OINF 2YQYA 3A11A 3IPMO 2V26A 4WGYA 1NBBA 2XLHA 1ZHZA 3R7CA 3RF3A 5A6KA 5A6AA 3NDBB 1LVKA 3I4UA 2OEXA 1RCPA 3HNKA 3EGDA 3MYFA 3RQEA 3L0IA 3GORA 1TR2A 2YLGA 4PK4A 5B3IA 3J06A 3TOMA 4HFKB 4JEBA 3JYYA 4IRUA 4G7HF 3EJNA 4FESA 2IXOA 1ZHYA 3LNRA 4PFPA 3EZIA 5AGFA 2BC5A 3RQFA 4BJ6C 3AGTA 4JVSA 4PR9A 1VMAA 3W8HA 5L0FA 1A41A 1V4AA 3EZHA 4YN0B 5KYUA 4CSAC 3DWWA 1XWJA 2PP4A 3WHNA 1YAUO 3GWNA 1FTSA 4JCHA 4UDVA 2WZLA 2OJQA 3L8IA 5L0CA 1OKKD 5CI8A 1XZPA 4CS8A 2HS5A 2R7OA 2ZXOA 2QNLA 1H6GA 2CNWD 1D0YA 5F5HA 3DM5A 1DOWA 1LE4A 1YZAA 3KL4A 4MVMA 4BJ1A 2VC9A 3ZTZA 2HUJA 4C7OA 2B0HA 1QKRA 1LI7A 1V54C 3EH2A 3K6BA 3O39A 3CEXA 3EPVA 5L0DA 4DRHB 4LLCA 3WG7C 4LDRA 2Y3DA 1EA8A 2QLAA 3K66A 2XL4A 2R7TA 1FAPB 2B0JA 2X51A 4NTAA 2J45A 3K1IC 4DVZA 1LS1A 2Y39A 1OW7A 3LS0A 4EBKA 5KYWA 1NZEA 1BR4A 3K1HA 2AWCA 3NYJA 1GQAA 1QZXA 2YEVA 2IBFA 3C63A 3LEVA 4PJJA 2H7OA 2NPUA 2XLWA 4MVQA 3POVA 1VTMP 1B68A 2G62A 5COMA 2CCYA 3RW0A 2W9YA 2XS8A 1VYIA 2OQMA 3AGUA 2R7WA 2DB4A 1WOLA 4P9TA 1KNYA 3CQZA 3KMIA 3B0VC 1IZMA 3ABKC 3ITFA 3S90A 2ASRA 2CYDA 4Z9JA 3U5SA 3QMKA 4E0IA 2KJGA 3EQLF 3QVYA 2HV6A 1RXQA 3EFOA 2J7PA 3RKOF 3LEOA 2QY9A 4YT8A 4O7GA 3DXJF 4GQHA 3L34A 4ONSA 4JTCB 1YA9A 2H7BA 2IM8A 4W8PA 3ZQVA 2KSFA 2FAPB 2R03A 2YL1A 4W8KA 5BQGA 1TQGA 5HV9A 1PD1A 1BR2A 1SYQA 2OCCC 3OA1A 5COGA 1FNTc 3W2VA 2PBEA 3IQ5A 4JZAA 2C04A 1OW8A 3WAQA 1YYXA 3F47A 5DS6A 3I5QA 4ZLDA 4RDAA 1OXBA 1R5ID 2EPOA 3HJCA 3C8GD 5L0GA 3MYIA 4XPXA 4MTFA 1YLMA 3H65A 4LERA 2YHSA 1VK5A 4O6MA 3Q7GA 3FOOA 3AG3C 3SXZA 1ZW3A 2LK4A 1SR2A 1YARO 3E70C 3K33A 4HFFB 3M15A 4NY3A 4NTBA 4C3EA 3C7JA 1AEPA 4O6YA 4XQ1A 3T6GB 3U2LA 2HMQA 1T6UA 5CI9A 2YLIA 4BJ5A 3DE9A 1QSPA 5D91A 3GEHA 4C3DA 2XLVA 3M79A 4OIPF 4WGZA 1CGME 1T6QA 1Q0FA 3B29A 2MYSA 3NG1A 1O87A 4YT4A 5CIVA 4LDKA 3S84A 2Q00A 1A7DA 1M6TA 3HNIA 1Y6DA 2Y3HA 3PCVA 2NG1A 3ASOC 1MMDA 3M1CB 3T9OA 3PMRA 4I44A 3ZDLA 4A2NB 1Z3IX 2HSQA 1FR0A 3HKKA 2CDQA 1HY5A 4K1OA 5DS5A 4CX9A 3GEEA 3G4XA 3M4CA 3U8VA 4EUKB 5EHHA 1MQVA 2IXNA 4CDAA 4JKVA 1TFKB 2UUHA 2HZ8A 3R2PA 4ULWA 1N1CA 1C02A 2HV7A 4PJNA 4XLPF 4QDLA 3AOUA 1WTYA 1ZYRF 1JPJA 2LIGA 2Q4FA 4KBLA 4G7ZF 2KNHA 5FZTA
chains in the Genus database with same CATH topology
1PCXA 2D5RB 3CSKA 2VH3A 3I5PA 1Z6AA 4KNVA 3JRTA 3DZAA 5DQZA 3EGDB 4Q5SF 5E3CA 1ZU5A 1OCCC 2L9JA 5B1AC 1BR1A 1M56C 4U5EE 1RJ9B 5KYUB 3UMKA 3KKBA 3F46A 2O9XA 3RFYA 4C3BA 4BJ6A 1TWGA 3UGPA 4CSAA 2CGEA 2EIKC 1QLEC 3DJUB 3EHNA 4U5BE 2VB6A 3QZCA 4AK9A 4C7OB 3X1OA 1M2VB 2IOQA 1RJ9A 4U5DE 5KYXB 3B0UX 3B9QA 1SZIA 3LJBA 4QI0A 5KYWB 1TWCA 1MMNA 3Q6NA 2C03A 2J0XA 4GYTA 2G3VA 4OD4A 1NU9C 1M2VA 3Q7LA 4P6IC 2MWQA 3W8IA 4B6IA 5KYXA 4DVYP 4PJMA 1ZHTA 3PHF2 3EFOB 1MMAA 3EH1A 2WVOA 3OEOA 2NUTA 3UMIA 3SEOA 4DBRA 1M2OA 1TKNA 2EIJC 4BEJA 3EHMA 4JURI 1OCRC 4K0DA 3VAYA 5BUOA 3CZ6A 4N06A 1IW7F 4YJWA 2ZPAA 2XXAA 2Q9AA 1NU7D 4OD5A 4E7ZA 2V3CC 4KI2A 3EGXA 1KU2A 2Y69C 4CS9C 2WVNA 3DD7A 1J8MF 3LAYA 5D92A 4EBBA 2I8BA 3IEEA 2IYLD 3JCUQ 5E33A 2IXPA 3SNHA 4HEAJ 3OWTA 2ZXRA 2KGOA 3NKDA 1Z23A 3SP1A 4IJJA 3UMHA 4DOZA 3O6XA 2VASA 1V55C 2Z15A 3UR3C 3E9VA 2DYSC 3DM9B 5T3WA 4MQ9F 4ANJA 3AQBA 2PX3A 3JYHA 3ZC4A 4H4KC 2WB7A 5L3QA 2E87A 3UGOA 1MMGA 4KNWA 2BE5F 4YT5A 5DLJA 2Y3BA 4PJLA 4AX2A 4WJ0A 2NUPA 2CW0F 4U5FE 3AQCA 5DS4A 3MLGA 4K7BA 1PD0A 2LSEA 4U5HA 3AG1C 1M57C 4FX5A 2M4EA 4O6NA 1SF8A 2W45A 4I3MA 1D0ZA 5HSWA 3EG9B 1TWHA 5F5FA 5DQTA 2R7XA 4JW1A 2WZFA 4BJTA 1VOMA 5EGYA 5IY5C 2J7PD 5KYYA 4RBNA 4M63A 4FWVA 3ZIBA 3JT1A 2XSEA 1Z63A 2R7VA 3EG9A 2WVQA 2A69F 1D1CA 3DMDA 2Q3TA 1J8YF 2NUTB 4AE4A 3ZG1A 2FFHA 5B3SC 3NYLA 3WODF 4CS7A 5T3TA 3S29A 5L3VA 4XTKA 3W2WA 4LACB 4F4BA 4IAOA 4G7OF 1FFHA 4EWCA 2R7UA 4I1OB 1LKXA 3MX3A 1FMVA 2P7VA 3ECSA 4X0RA 1NG1A 1ZU4A 1D1BA 2XXAB 3T6BA 4QI2A 2IXMA 3K7DA 2PX0A 3EGXB 3JSZA 3NRHA 2J9UA 1OCOC 2KQ9A 2OG2A 1TWAA 4CS9A 1FMWA 4CS8C 2A6HF 1ST6A 2KW3C 4J32B 4O79A 4BG0A 1WGWA 4CIHA 3FHDA 2PFDA 4PFOA 4ZLCA 3RYLA 2A1DD 3Q6MA 5T1DB 1ZHWA 2W4MA 2P6VA 3LESA 1MNDA 1G8XA 3DAGA 3T4RA 2WZGA 2ZXPA 4Q7CA 4E7SA 3FDQA 3HLZA 4JJFA 1SMYF 3FAJA 2R7QA 2Q9BA 3ABLC 4MNDA 5KYNA 3SZRA 4I1MA 4CBEA 3KH2A 3ZVRA 4JJGA 3X2QC 3SYNA 3ASNC 2J9WA 3NYMA 3DJNB 2A68F 1D0XA 2R7SA 2J9VA 2J46A 3N0TA 3LLKA 2EIMC 2EINC 3RH3A 3GODA 2R7RA 1W2WA 2H7VC 4DBQA 2NUPB 5DVWA 3B0PA 1OKKA 5FCLA 2ZXWC 4KC9A 4Q4ZF 3N2ZB 4IWBA 1ZHXA 2CNWA 3VYWA 2FGYA 4OIRF 1O5HA 2Q9CA 3AG2C 3T6JA 2EILC 2L81A 4OIOF 2DGJA 2GFHA 4BJ5C 5E3AA 5KYYB 4RD9A 1Z5ZA 2Y3GA 4OIQF 4J30B 2WL8A 2W4BA 2JD3A 3FVYA 4GEHA 1MNEA 3GANA 4G0HA 4XLNF 1D1AA 2A6EF 2QTVA 1JPNA 1VYKA 2YZSA 3AG4C 4LLEA 1S7ZA 3LS1A 4HE8D 2G3KA 4U5CE 4AE4B 2PF4E 3TD7A 2DYRC 3LLIA 5B1BC 3N24A 3ABMC 3S27A 4YT2A 3HTKC 2XRHA 3S28A 1FFTC 3ZSUA 5E2QA 4U5GA 3NKEA 1OCZC 3V7OA 2J0WA 4XWJA 3S0XA 3DAFA 3RIPA 3UNGC 4OINF 2V26A 3NDBB 1ZHZA 1LVKA 3I4UA 3EGDA 3L0IA 1TR2A 4PK4A 4HFKB 4IRUA 4G7HF 3EJNA 4FESA 2IXOA 1ZHYA 3LNRA 4PFPA 3EZIA 4BJ6C 4JVSA 3W8HA 1VMAA 3EZHA 4YN0B 5KYUA 4CSAC 2PP4A 1FTSA 4JCHA 2WZLA 1OKKD 5CI8A 4CS8A 2R7OA 2ZXOA 2CNWD 1D0YA 5F5HA 3DM5A 3KL4A 4BJ1A 4C7OA 1V54C 3EH2A 3K6BA 3O39A 3EPVA 4LLCA 3WG7C 2Y3DA 3K66A 2XL4A 2R7TA 2B0JA 2X51A 2J45A 3K1IC 4DVZA 1LS1A 2Y39A 3LS0A 5KYWA 1NZEA 1BR4A 3K1HA 3NYJA 2YEVA 1QZXA 3LEVA 4PJJA 2H7OA 3POVA 2G62A 2W9YA 1VYIA 2R7WA 3CQZA 3KMIA 3B0VC 1IZMA 3ABKC 3ITFA 3QMKA 2KJGA 3EQLF 2HV6A 3EFOA 2J7PA 3RKOF 2QY9A 4YT8A 4O7GA 3DXJF 3L34A 2H7BA 4W8KA 1PD1A 1BR2A 2OCCC 3OA1A 3W2VA 4JZAA 2C04A 3F47A 5DS6A 3I5QA 4ZLDA 4RDAA 3HJCA 4LERA 3H65A 2YHSA 1VK5A 4O6MA 3Q7GA 3AG3C 3E70C 3K33A 4HFFB 4NY3A 4C3EA 4O6YA 5CI9A 4BJ5A 5D91A 4C3DA 4OIPF 3NG1A 2MYSA 1O87A 4YT4A 4YWQA 2Y3HA 2NG1A 3ASOC 1MMDA 3M1CB 3PMRA 4I44A 4A2NB 1Z3IX 2CDQA 5DS5A 5EHHA 2IXNA 4ULWA 1N1CA 2HV7A 4PJNA 4XLPF 4QDLA 1ZYRF 1JPJA 4KBLA 4G7ZF 2KNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1C B; 
#chains in the Genus database with same CATH topology
 1PCX A;  2EPN A;  2OJE D;  2D5R B;  3U9M A;  4L6R A;  3W4Y A;  2P0N A;  4XEF A;  4N6C A;  3CSK A;  1OW6 A;  2VH3 A;  3I5P A;  4IAR A;  4U9E A;  1Z6A A;  4KNV A;  3JRT A;  3DZA A;  5DQZ A;  3EGD B;  4Q5S F;  4CJG A;  5A6J A;  2HSB A;  3HNL A;  3TK0 A;  5E3C A;  1ZU5 A;  4A4A A;  3H2V A;  1OCC C;  1XZQ A;  2HMZ A;  5AC5 A;  2VCC A;  2L9J A;  1ORJ A;  1K05 A;  1OR3 A;  1BR1 A;  2UUI A;  5B1A C;  1EKY A;  1Z7Q c;  1M56 C;  3LNM B;  4U5E E;  1RJ9 B;  3TOL A;  4CDY A;  5KYU B;  3UMK A;  3KKB A;  1A0B A;  1LPE A;  1R4T A;  2O9X A;  3F46 A;  3RFY A;  4C3B A;  1GM5 A;  4BJ6 A;  1ZW2 A;  1TWG A;  3TUL A;  3O10 A;  3UGP A;  4CSA A;  2CGE A;  3GM3 A;  2EIK C;  1QLE C;  1EI7 A;  3DJU B;  4Z9I A;  1AUE A;  4IAQ A;  2A0U A;  4MTO A;  3EHN A;  3TQO A;  4U5B E;  4IGG A;  2VB6 A;  5K0I A;  3QZC A;  4AK9 A;  3MBG A;  3RQG A;  3X1O A;  5JUA A;  4C7O B;  1M2V B;  2IOQ A;  1RJ9 A;  2XLO A;  4U5D E;  5KYX B;  3FDQ A;  2R25 A;  3B9Q A;  3B0U X;  3U9J A;  3JTL O;  1E83 A;  1SZI A;  3KPH A;  3LJB A;  4CJO A;  1NSG B;  4QI0 A;  5KYW B;  5JRA A;  2GDC A;  1LI5 A;  256B A;  4XEK A;  1TWC A;  1MMN A;  3K1I A;  2C03 A;  2J0X A;  3Q6N A;  4GYT A;  2G3V A;  4Z9H A;  4OD4 A;  1CGN A;  1NU9 C;  1M2V A;  1ZZP A;  1PV3 A;  2LQG A;  2YL3 A;  4EBJ A;  3Q7L A;  4P6I C;  4ULV A;  2A0B A;  2MWQ A;  3W8I A;  1YDI A;  4B6I A;  5KYX A;  1QVX A;  4DVY P;  4NQF A;  4PJM A;  2M64 A;  1U6H A;  1ZHT A;  3PHF 2;  3EFO B;  1MMA A;  2JX0 A;  1ZVZ A;  4YK5 A;  4DXW A;  1QPU A;  4D4N A;  3EH1 A;  2WVO A;  3OEO A;  2NUT A;  3UMI A;  3DKA A;  3O55 A;  5F28 E;  1JOG A;  3KYI A;  1H9G A;  1L7C A;  1LS4 A;  2YVK A;  3SEO A;  1I5N A;  5A6B D;  2AVK A;  2NSG A;  2XLD A;  4E18 A;  4DBR A;  3FXH A;  1M2O A;  1TKN A;  2EIJ C;  3BEH A;  4JIO A;  4BEJ A;  1T01 A;  3EHM A;  4BG0 A;  4IB4 A;  1JAF A;  3IHU A;  3QTH A;  1HW1 A;  4YL0 A;  1G4W R;  5L0J A;  4JUR I;  1OCR C;  4K0D A;  1G4U S;  3VAY A;  3GWL A;  5BUO A;  5JT4 A;  3CZ6 A;  4N06 A;  1IW7 F;  4YJW A;  2ZPA A;  4BPM A;  2XXA A;  3PDM P;  2Q9A A;  5BQH A;  1H7I A;  3JRM O;  1NU7 D;  2YLD A;  3GM1 A;  4OD5 A;  4E7Z A;  2V3C C;  3EGX A;  2AP3 A;  1VLS A;  1KU2 A;  2R02 A;  4KI2 A;  1EQ1 A;  2Y69 C;  1F1M A;  4CS9 C;  1VLT A;  2WVN A;  1J8M F;  3DD7 A;  3LAY A;  4JRZ A;  5D92 A;  4AL1 A;  2I8B A;  3IEE A;  4EBB A;  2IYL D;  3JCU Q;  5E33 A;  1T5O A;  2GAQ A;  3U8P A;  3G50 A;  2IXP A;  2NSF A;  4WAB A;  1APC A;  3SNH A;  3KYJ A;  3L1M A;  3OWT A;  2ZXR A;  4HEA J;  1HE9 A;  3V5X A;  4YWQ A;  4ER9 A;  5AC4 A;  5JSL A;  2KGO A;  2L7A A;  1ORS C;  3NKD A;  4JC7 A;  1Z23 A;  3TJ6 A;  3U2M A;  4MS2 A;  4E0H A;  3SP1 A;  4IJJ A;  3BRJ A;  3UMH A;  4DOZ A;  3O6X A;  4YL3 A;  1I4Z A;  2VAS A;  1V55 C;  2OOC A;  2Z15 A;  3ZWI A;  3UR3 C;  3E9V A;  2DYS C;  3DM9 B;  5T3W A;  4MQ9 F;  2JPU A;  1WAS A;  4ANJ A;  3AQB A;  1NFO A;  4JE9 A;  1YZC A;  2PX3 A;  3JYH A;  4N6H A;  3ZC4 A;  5JVE A;  1K40 A;  4H4K C;  2P1A A;  2WB7 A;  5L3Q A;  1O3U A;  4MVU A;  2E87 A;  3UGO A;  1C03 A;  1MMG A;  4JTD B;  4KNW A;  1I4Y A;  3FAP B;  2BE5 F;  4YT5 A;  2GA0 A;  1QQ3 A;  1YYJ A;  2Y3B A;  4PJL A;  5DLJ A;  2Q7R A;  2YL0 A;  3US6 A;  4AX2 A;  4WJ0 A;  5TJ5 E;  2NUP A;  4LDQ A;  4NCQ A;  4FAP B;  3ATP A;  3M4B A;  2CW0 F;  4U5F E;  5JLI A;  2VCA A;  4J7T A;  4DRJ B;  3AQC A;  5DS4 A;  1RMV A;  3MLG A;  4K7B A;  4DJ9 A;  1PD0 A;  2LSE A;  4MVS A;  1ORY A;  2TMV P;  4U5H A;  4G78 A;  3AG1 C;  1CPQ A;  2LCH A;  1LE2 A;  3VM6 A;  1M57 C;  4FX5 A;  2GWW A;  2M4E A;  4O6N A;  1SF8 A;  2W45 A;  2YWA A;  3HLZ A;  4I3M A;  1D0Z A;  5HSW A;  3QVZ A;  3C8Z A;  4EIY A;  3U3F A;  1HMD A;  3EG9 B;  1TWH A;  5F5F A;  5DQT A;  3CAX A;  2R7X A;  2XS1 A;  2I15 A;  2XL8 A;  2WZF A;  2RD9 A;  3G4Z A;  1V74 B;  4JW1 A;  4BJT A;  3S9O A;  1VOM A;  4NTF A;  1E85 A;  1WAT A;  3SXY A;  2OKU A;  2J7P D;  5EGY A;  5IY5 C;  3SXM A;  5KYY A;  4RBN A;  4MW8 A;  1LIH A;  3DE8 A;  2AU5 A;  4MW3 A;  1RKE A;  4M63 A;  2XLM A;  4FWV A;  2XLE A;  1K04 A;  3C62 A;  3JT1 A;  3ZIB A;  3MFN A;  2LFD A;  2XSE A;  4JEA A;  1Z63 A;  2R7V A;  3C8G A;  1CPR A;  3EG9 A;  2WVQ A;  2A69 F;  1D1C A;  4H54 A;  1OR2 A;  1WWP A;  3DMD A;  2KC3 A;  1H9T A;  2Q3T A;  1J8Y F;  2EPM X;  4YL1 A;  1KTM A;  2NUT B;  4PAC A;  4AE4 A;  5L0I A;  3ZG1 A;  2FFH A;  1YVI A;  2HJM A;  5B3S C;  1GGQ A;  1Q0G A;  2L6H A;  2RSE B;  3NYL A;  3QW1 A;  3WOD F;  1U0B B;  4JTA B;  4CS7 A;  5T3T A;  3S29 A;  3LUT B;  5L3V A;  1U89 A;  4XTK A;  3W2W A;  4LAC B;  4XPY A;  4IAO A;  4F4B A;  1FFH A;  4EWC A;  4P9F A;  4I1O B;  4G7O F;  4MVR A;  2R7U A;  1LKX A;  3MX3 A;  4XEV A;  1FMV A;  2P7V A;  3ECS A;  4X0R A;  1NG1 A;  1ZU4 A;  3B71 A;  2PNO A;  4R32 A;  2QUP A;  3NMJ A;  3VF0 A;  1D1B A;  3FOP A;  3VRC A;  2XXA B;  3T6B A;  4QI2 A;  2IXM A;  3K7D A;  2P61 A;  2PX0 A;  3EGX B;  1CGO A;  2AWY A;  2QE9 A;  2YRF A;  3JSZ A;  3NRH A;  2J9U A;  1Q0D A;  1OCO C;  2KQ9 A;  2OG2 A;  2LD6 A;  3DI5 A;  4AL0 A;  1TWA A;  1T9K A;  1FMW A;  4CS9 A;  4CS8 C;  2A6H F;  1ST6 A;  2KW3 C;  3JZ0 A;  1BDJ B;  2ICW G;  1WGW A;  4J32 B;  3FHD A;  4O79 A;  4CIH A;  2PFD A;  4PFO A;  2OEV A;  3RYL A;  4ZLC A;  1HMO A;  2A1D D;  2XM0 A;  3Q6M A;  5T1D B;  1ZHW A;  2W4M A;  3RVY A;  3U3B A;  3RVZ A;  2BL2 A;  2P6V A;  4CDV A;  3LES A;  1MND A;  1G8X A;  3DAG A;  3IQ6 A;  3T4R A;  4E17 A;  1E2X A;  2WZG A;  2ZXP A;  3QW0 A;  4Q7C A;  3SXK A;  1C17 M;  4E7S A;  2J9B A;  5A69 A;  1G5Z A;  1YA7 O;  1SMY F;  2HKV A;  2LP4 A;  2OU6 A;  2Q9B A;  2R7Q A;  3ABL C;  3FAJ A;  4JJF A;  4MND A;  4BEM J;  1Q0M A;  5KYN A;  3SZR A;  4EKW A;  4I1M A;  4MTG A;  4J7Y A;  3KH2 A;  4CBE A;  2HFI A;  3ZVR A;  4JJG A;  3X2Q C;  3L8J A;  3SYN A;  1HW2 A;  3ASN C;  3GM2 A;  2J9W A;  5BQI A;  3NYM A;  3DJN B;  4DRI B;  1A7E A;  2A68 F;  1D0X A;  2H8A A;  2R7S A;  3AJM A;  2J9V A;  5EK0 A;  5JP7 A;  2J46 A;  2X0C A;  1L3P A;  1Q0K A;  3N0T A;  1E86 A;  3LLK A;  5JS5 A;  5COF A;  2EIM C;  2EIN C;  3RH3 A;  3GOD A;  2R7R A;  1W2W A;  1JR8 A;  2H7V C;  1TFO B;  2YL7 A;  3V5Y A;  2NUP B;  4DBQ A;  2YKZ A;  1T6I A;  1JRA A;  2EPL X;  1RKC A;  1OKK A;  3B0P A;  5DVW A;  5FCL A;  3IQT A;  2ZXW C;  4KC9 A;  4Q4Z F;  1HE1 A;  3N2Z B;  4IWB A;  1ZHX A;  2CNW A;  1VB5 A;  3VYW A;  1JMW A;  2D4U A;  2FGY A;  4OIR F;  1O5H A;  1OXK A;  2Q9C A;  3FMS A;  3AG2 C;  3T6J A;  2L6F A;  2EIL C;  4D4X A;  1UFB A;  1YJG A;  2L6G A;  2LFF A;  2L81 A;  4OIO F;  2R05 A;  2DGJ A;  1LM3 B;  2DI3 A;  3GEI A;  3JSE O;  2GFH A;  4BJ5 C;  2MHR A;  3IQC A;  5E3A A;  1S05 A;  1Z5Z A;  4RD9 A;  5KYY B;  3H2U A;  2Y3G A;  4OIQ F;  3ZTM A;  4J30 B;  5A6B A;  2WL8 A;  1BZ4 A;  1RKE B;  2W4B A;  2JD3 A;  4CIP A;  3FVY A;  4U9D A;  4GEH A;  5L0H A;  3U0C A;  1MNE A;  2XM4 A;  4N4W A;  4XPW A;  3GAN A;  4G0H A;  4XLN F;  1D1A A;  2R9R B;  3C8G B;  2A6E F;  2QTV A;  3NMI A;  3ZQY A;  3V5Z A;  1JPN A;  1NLX A;  1UG7 A;  1NFN A;  1VYK A;  2YZS A;  2ZD9 A;  3AG4 C;  4LLE A;  1S7Z A;  3LS1 A;  4NC3 A;  4HE8 D;  5GPG B;  2G3K A;  4U5C E;  1GS9 A;  2VCB A;  4AE4 B;  2PF4 E;  3TD7 A;  2KYH A;  2EPK X;  2HJ3 A;  2DYR C;  1A7V A;  1BBH A;  2ETS A;  3LLI A;  5B1B C;  3N24 A;  2F22 A;  3ABM C;  3S27 A;  4YT2 A;  3TJ5 A;  2KK1 A;  4MVO A;  2J8W A;  2XRH A;  3HTK C;  3S28 A;  1DOV A;  4MVZ A;  1FFT C;  3A9C A;  3ZSU A;  5E2Q A;  1WN0 A;  1AVO B;  1OCZ C;  3NKE A;  4U5G A;  4JCZ A;  2J0W A;  3V7O A;  4XWJ A;  3C18 A;  3NMK A;  4EHP A;  3HNJ A;  3S0X A;  3DAF A;  2XL6 A;  1E84 A;  3RIP A;  1Y4C A;  1OQC A;  3UNG C;  4OIN F;  2YQY A;  3A11 A;  3IPM O;  2V26 A;  4WGY A;  1NBB A;  2XLH A;  1ZHZ A;  3R7C A;  3RF3 A;  5A6K A;  5A6A A;  3NDB B;  1LVK A;  3I4U A;  2OEX A;  1RCP A;  3HNK A;  3EGD A;  3MYF A;  3RQE A;  3L0I A;  3GOR A;  1TR2 A;  2YLG A;  4PK4 A;  5B3I A;  3J06 A;  3TOM A;  4HFK B;  4JEB A;  3JYY A;  4IRU A;  4G7H F;  3EJN A;  4FES A;  2IXO A;  1ZHY A;  3LNR A;  4PFP A;  3EZI A;  5AGF A;  2BC5 A;  3RQF A;  4BJ6 C;  3AGT A;  4JVS A;  4PR9 A;  1VMA A;  3W8H A;  5L0F A;  1A41 A;  1V4A A;  3EZH A;  4YN0 B;  5KYU A;  4CSA C;  3DWW A;  1XWJ A;  2PP4 A;  3WHN A;  1YAU O;  3GWN A;  1FTS A;  4JCH A;  4UDV A;  2WZL A;  2OJQ A;  3L8I A;  5L0C A;  1OKK D;  5CI8 A;  1XZP A;  4CS8 A;  2HS5 A;  2R7O A;  2ZXO A;  2QNL A;  1H6G A;  2CNW D;  1D0Y A;  5F5H A;  3DM5 A;  1DOW A;  1LE4 A;  1YZA A;  3KL4 A;  4MVM A;  4BJ1 A;  2VC9 A;  3ZTZ A;  2HUJ A;  4C7O A;  2B0H A;  1QKR A;  1LI7 A;  1V54 C;  3EH2 A;  3K6B A;  3O39 A;  3CEX A;  3EPV A;  5L0D A;  4DRH B;  4LLC A;  3WG7 C;  4LDR A;  2Y3D A;  1EA8 A;  2QLA A;  3K66 A;  2XL4 A;  2R7T A;  1FAP B;  2B0J A;  2X51 A;  4NTA A;  2J45 A;  3K1I C;  4DVZ A;  1LS1 A;  2Y39 A;  1OW7 A;  3LS0 A;  4EBK A;  5KYW A;  1NZE A;  1BR4 A;  3K1H A;  2AWC A;  3NYJ A;  1GQA A;  1QZX A;  2YEV A;  2IBF A;  3C63 A;  3LEV A;  4PJJ A;  2H7O A;  2NPU A;  2XLW A;  4MVQ A;  3POV A;  1VTM P;  1B68 A;  2G62 A;  5COM A;  2CCY A;  3RW0 A;  2W9Y A;  2XS8 A;  1VYI A;  2OQM A;  3AGU A;  2R7W A;  2DB4 A;  1WOL A;  4P9T A;  1KNY A;  3CQZ A;  3KMI A;  3B0V C;  1IZM A;  3ABK C;  3ITF A;  3S90 A;  2ASR A;  2CYD A;  4Z9J A;  3U5S A;  3QMK A;  4E0I A;  2KJG A;  3EQL F;  3QVY A;  2HV6 A;  1RXQ A;  3EFO A;  2J7P A;  3RKO F;  3LEO A;  2QY9 A;  4YT8 A;  4O7G A;  3DXJ F;  4GQH A;  3L34 A;  4ONS A;  4JTC B;  1YA9 A;  2H7B A;  2IM8 A;  4W8P A;  3ZQV A;  2KSF A;  2FAP B;  2R03 A;  2YL1 A;  4W8K A;  5BQG A;  1TQG A;  5HV9 A;  1PD1 A;  1BR2 A;  1SYQ A;  2OCC C;  3OA1 A;  5COG A;  1FNT c;  3W2V A;  2PBE A;  3IQ5 A;  4JZA A;  2C04 A;  1OW8 A;  3WAQ A;  1YYX A;  3F47 A;  5DS6 A;  3I5Q A;  4ZLD A;  4RDA A;  1OXB A;  1R5I D;  2EPO A;  3HJC A;  3C8G D;  5L0G A;  3MYI A;  4XPX A;  4MTF A;  1YLM A;  3H65 A;  4LER A;  2YHS A;  1VK5 A;  4O6M A;  3Q7G A;  3FOO A;  3AG3 C;  3SXZ A;  1ZW3 A;  2LK4 A;  1SR2 A;  1YAR O;  3E70 C;  3K33 A;  4HFF B;  3M15 A;  4NY3 A;  4NTB A;  4C3E A;  3C7J A;  1AEP A;  4O6Y A;  4XQ1 A;  3T6G B;  3U2L A;  2HMQ A;  1T6U A;  5CI9 A;  2YLI A;  4BJ5 A;  3DE9 A;  1QSP A;  5D91 A;  3GEH A;  4C3D A;  2XLV A;  3M79 A;  4OIP F;  4WGZ A;  1CGM E;  1T6Q A;  1Q0F A;  3B29 A;  2MYS A;  3NG1 A;  1O87 A;  4YT4 A;  5CIV A;  4LDK A;  3S84 A;  2Q00 A;  1A7D A;  1M6T A;  3HNI A;  1Y6D A;  2Y3H A;  3PCV A;  2NG1 A;  3ASO C;  1MMD A;  3M1C B;  3T9O A;  3PMR A;  4I44 A;  3ZDL A;  4A2N B;  1Z3I X;  2HSQ A;  1FR0 A;  3HKK A;  2CDQ A;  1HY5 A;  4K1O A;  5DS5 A;  4CX9 A;  3GEE A;  3G4X A;  3M4C A;  3U8V A;  4EUK B;  5EHH A;  1MQV A;  2IXN A;  4CDA A;  4JKV A;  1TFK B;  2UUH A;  2HZ8 A;  3R2P A;  4ULW A;  1N1C A;  1C02 A;  2HV7 A;  4PJN A;  4XLP F;  4QDL A;  3AOU A;  1WTY A;  1ZYR F;  1JPJ A;  2LIG A;  2Q4F A;  4KBL A;  4G7Z F;  2KNH A;  5FZT A; 
#chains in the Genus database with same CATH homology
 1PCX A;  2D5R B;  3CSK A;  2VH3 A;  3I5P A;  1Z6A A;  4KNV A;  3JRT A;  3DZA A;  5DQZ A;  3EGD B;  4Q5S F;  5E3C A;  1ZU5 A;  1OCC C;  2L9J A;  5B1A C;  1BR1 A;  1M56 C;  4U5E E;  1RJ9 B;  5KYU B;  3UMK A;  3KKB A;  3F46 A;  2O9X A;  3RFY A;  4C3B A;  4BJ6 A;  1TWG A;  3UGP A;  4CSA A;  2CGE A;  2EIK C;  1QLE C;  3DJU B;  3EHN A;  4U5B E;  2VB6 A;  3QZC A;  4AK9 A;  4C7O B;  3X1O A;  1M2V B;  2IOQ A;  1RJ9 A;  4U5D E;  5KYX B;  3B0U X;  3B9Q A;  1SZI A;  3LJB A;  4QI0 A;  5KYW B;  1TWC A;  1MMN A;  3Q6N A;  2C03 A;  2J0X A;  4GYT A;  2G3V A;  4OD4 A;  1NU9 C;  1M2V A;  3Q7L A;  4P6I C;  2MWQ A;  3W8I A;  4B6I A;  5KYX A;  4DVY P;  4PJM A;  1ZHT A;  3PHF 2;  3EFO B;  1MMA A;  3EH1 A;  2WVO A;  3OEO A;  2NUT A;  3UMI A;  3SEO A;  4DBR A;  1M2O A;  1TKN A;  2EIJ C;  4BEJ A;  3EHM A;  4JUR I;  1OCR C;  4K0D A;  3VAY A;  5BUO A;  3CZ6 A;  4N06 A;  1IW7 F;  4YJW A;  2ZPA A;  2XXA A;  2Q9A A;  1NU7 D;  4OD5 A;  4E7Z A;  2V3C C;  4KI2 A;  3EGX A;  1KU2 A;  2Y69 C;  4CS9 C;  2WVN A;  3DD7 A;  1J8M F;  3LAY A;  5D92 A;  4EBB A;  2I8B A;  3IEE A;  2IYL D;  3JCU Q;  5E33 A;  2IXP A;  3SNH A;  4HEA J;  3OWT A;  2ZXR A;  2KGO A;  3NKD A;  1Z23 A;  3SP1 A;  4IJJ A;  3UMH A;  4DOZ A;  3O6X A;  2VAS A;  1V55 C;  2Z15 A;  3UR3 C;  3E9V A;  2DYS C;  3DM9 B;  5T3W A;  4MQ9 F;  4ANJ A;  3AQB A;  2PX3 A;  3JYH A;  3ZC4 A;  4H4K C;  2WB7 A;  5L3Q A;  2E87 A;  3UGO A;  1MMG A;  4KNW A;  2BE5 F;  4YT5 A;  5DLJ A;  2Y3B A;  4PJL A;  4AX2 A;  4WJ0 A;  2NUP A;  2CW0 F;  4U5F E;  3AQC A;  5DS4 A;  3MLG A;  4K7B A;  1PD0 A;  2LSE A;  4U5H A;  3AG1 C;  1M57 C;  4FX5 A;  2M4E A;  4O6N A;  1SF8 A;  2W45 A;  4I3M A;  1D0Z A;  5HSW A;  3EG9 B;  1TWH A;  5F5F A;  5DQT A;  2R7X A;  4JW1 A;  2WZF A;  4BJT A;  1VOM A;  5EGY A;  5IY5 C;  2J7P D;  5KYY A;  4RBN A;  4M63 A;  4FWV A;  3ZIB A;  3JT1 A;  2XSE A;  1Z63 A;  2R7V A;  3EG9 A;  2WVQ A;  2A69 F;  1D1C A;  3DMD A;  2Q3T A;  1J8Y F;  2NUT B;  4AE4 A;  3ZG1 A;  2FFH A;  5B3S C;  3NYL A;  3WOD F;  4CS7 A;  5T3T A;  3S29 A;  5L3V A;  4XTK A;  3W2W A;  4LAC B;  4F4B A;  4IAO A;  4G7O F;  1FFH A;  4EWC A;  2R7U A;  4I1O B;  1LKX A;  3MX3 A;  1FMV A;  2P7V A;  3ECS A;  4X0R A;  1NG1 A;  1ZU4 A;  1D1B A;  2XXA B;  3T6B A;  4QI2 A;  2IXM A;  3K7D A;  2PX0 A;  3EGX B;  3JSZ A;  3NRH A;  2J9U A;  1OCO C;  2KQ9 A;  2OG2 A;  1TWA A;  4CS9 A;  1FMW A;  4CS8 C;  2A6H F;  1ST6 A;  2KW3 C;  4J32 B;  4O79 A;  4BG0 A;  1WGW A;  4CIH A;  3FHD A;  2PFD A;  4PFO A;  4ZLC A;  3RYL A;  2A1D D;  3Q6M A;  5T1D B;  1ZHW A;  2W4M A;  2P6V A;  3LES A;  1MND A;  1G8X A;  3DAG A;  3T4R A;  2WZG A;  2ZXP A;  4Q7C A;  4E7S A;  3FDQ A;  3HLZ A;  4JJF A;  1SMY F;  3FAJ A;  2R7Q A;  2Q9B A;  3ABL C;  4MND A;  5KYN A;  3SZR A;  4I1M A;  4CBE A;  3KH2 A;  3ZVR A;  4JJG A;  3X2Q C;  3SYN A;  3ASN C;  2J9W A;  3NYM A;  3DJN B;  2A68 F;  1D0X A;  2R7S A;  2J9V A;  2J46 A;  3N0T A;  3LLK A;  2EIM C;  2EIN C;  3RH3 A;  3GOD A;  2R7R A;  1W2W A;  2H7V C;  4DBQ A;  2NUP B;  5DVW A;  3B0P A;  1OKK A;  5FCL A;  2ZXW C;  4KC9 A;  4Q4Z F;  3N2Z B;  4IWB A;  1ZHX A;  2CNW A;  3VYW A;  2FGY A;  4OIR F;  1O5H A;  2Q9C A;  3AG2 C;  3T6J A;  2EIL C;  2L81 A;  4OIO F;  2DGJ A;  2GFH A;  4BJ5 C;  5E3A A;  5KYY B;  4RD9 A;  1Z5Z A;  2Y3G A;  4OIQ F;  4J30 B;  2WL8 A;  2W4B A;  2JD3 A;  3FVY A;  4GEH A;  1MNE A;  3GAN A;  4G0H A;  4XLN F;  1D1A A;  2A6E F;  2QTV A;  1JPN A;  1VYK A;  2YZS A;  3AG4 C;  4LLE A;  1S7Z A;  3LS1 A;  4HE8 D;  2G3K A;  4U5C E;  4AE4 B;  2PF4 E;  3TD7 A;  2DYR C;  3LLI A;  5B1B C;  3N24 A;  3ABM C;  3S27 A;  4YT2 A;  3HTK C;  2XRH A;  3S28 A;  1FFT C;  3ZSU A;  5E2Q A;  4U5G A;  3NKE A;  1OCZ C;  3V7O A;  2J0W A;  4XWJ A;  3S0X A;  3DAF A;  3RIP A;  3UNG C;  4OIN F;  2V26 A;  3NDB B;  1ZHZ A;  1LVK A;  3I4U A;  3EGD A;  3L0I A;  1TR2 A;  4PK4 A;  4HFK B;  4IRU A;  4G7H F;  3EJN A;  4FES A;  2IXO A;  1ZHY A;  3LNR A;  4PFP A;  3EZI A;  4BJ6 C;  4JVS A;  3W8H A;  1VMA A;  3EZH A;  4YN0 B;  5KYU A;  4CSA C;  2PP4 A;  1FTS A;  4JCH A;  2WZL A;  1OKK D;  5CI8 A;  4CS8 A;  2R7O A;  2ZXO A;  2CNW D;  1D0Y A;  5F5H A;  3DM5 A;  3KL4 A;  4BJ1 A;  4C7O A;  1V54 C;  3EH2 A;  3K6B A;  3O39 A;  3EPV A;  4LLC A;  3WG7 C;  2Y3D A;  3K66 A;  2XL4 A;  2R7T A;  2B0J A;  2X51 A;  2J45 A;  3K1I C;  4DVZ A;  1LS1 A;  2Y39 A;  3LS0 A;  5KYW A;  1NZE A;  1BR4 A;  3K1H A;  3NYJ A;  2YEV A;  1QZX A;  3LEV A;  4PJJ A;  2H7O A;  3POV A;  2G62 A;  2W9Y A;  1VYI A;  2R7W A;  3CQZ A;  3KMI A;  3B0V C;  1IZM A;  3ABK C;  3ITF A;  3QMK A;  2KJG A;  3EQL F;  2HV6 A;  3EFO A;  2J7P A;  3RKO F;  2QY9 A;  4YT8 A;  4O7G A;  3DXJ F;  3L34 A;  2H7B A;  4W8K A;  1PD1 A;  1BR2 A;  2OCC C;  3OA1 A;  3W2V A;  4JZA A;  2C04 A;  3F47 A;  5DS6 A;  3I5Q A;  4ZLD A;  4RDA A;  3HJC A;  4LER A;  3H65 A;  2YHS A;  1VK5 A;  4O6M A;  3Q7G A;  3AG3 C;  3E70 C;  3K33 A;  4HFF B;  4NY3 A;  4C3E A;  4O6Y A;  5CI9 A;  4BJ5 A;  5D91 A;  4C3D A;  4OIP F;  3NG1 A;  2MYS A;  1O87 A;  4YT4 A;  4YWQ A;  2Y3H A;  2NG1 A;  3ASO C;  1MMD A;  3M1C B;  3PMR A;  4I44 A;  4A2N B;  1Z3I X;  2CDQ A;  5DS5 A;  5EHH A;  2IXN A;  4ULW A;  1N1C A;  2HV7 A;  4PJN A;  4XLP F;  4QDL A;  1ZYR F;  1JPJ A;  4KBL A;  4G7Z F;  2KNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...