3M1CB

Crystal structure of the conserved herpesvirus fusion regulator complex gh-gl
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
180
structure length
146
Chain Sequence
TEYVLRSVIAKEVGDILRVPCMRTPADDVSWRYEAPSVIDYARIDGIFLRYHCPGLDTFLWDRHAQRAYLVNPFLFAAGFLEDLSHSVDTQETTTRRALYKEIRDALGSRKQAVSHAPVRAGCVNFDYSRTRRCVGRRDPVLALSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title Crystal structure of the conserved herpesvirus fusion regulator complex gH-gL.
pubmed doi rcsb
source organism Human herpesvirus 2
molecule tags Viral protein
total genus 35
structure length 146
sequence length 180
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05259 Herpes_UL1 Herpesvirus glycoprotein L
B PF12524 GlyL_C dsDNA virus glycoprotein L C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3m1cB01
3M1CB
chains in the Genus database with same CATH superfamily
1O87A 3EPVA 3WG7C 2XM0A 1YA7O 2NSFA 4IAOA 1MMNA 2IOQA 2Y69C 4YL3A 4J7TA 1S7ZA 3B0PA 1E2XA 4LDKA 4PACA 2J45A 3T6JA 1LVKA 5KYXB 1WN0A 3NYJA 1M2VB 4PR9A 1PCXA 1RKCA 3B9QA 4IJJA 1Z5ZA 3RW0A 3O10A 1BBHA 2BL2A 5D92A 4YT2A 1PV3A 3FOPA 4GQHA 1OQCA 4JKVA 1UG7A 2QUPA 3V7OA 2LD6A 1YARO 3AOUA 3MYIA 3SP1A 2A1DD 2FFHA 2DGJA 2Q9CA 3NG1A 4YK5A 1QVXA 3DZAA 1Z3IX 3PMRA 3PHF2 3AQCA 3I4UA 1TKNA 5L3VA 1OW7A 1R5ID 2L7AA 4CJOA 1E85A 5CI8A 1BR4A 4G78A 3MYFA 1APCA 1ZW2A 2EINC 4WABA 1MNDA 3HNJA 2ICWG 4NTFA 3QW1A 1D0XA 4EKWA 2QE9A 5A6KA 2P61A 4E0HA 5BQIA 1EQ1A 1JPNA 3T9OA 256BA 1DOWA 2J9UA 2QTVA 2LP4A 1PD1A 2L9JA 3HNKA 1M6TA 4CSAC 1NU9C 3JCUQ 3DD7A 3H2UA 3N0TA 5COFA 1T9KA 2XLOA 4BJ6A 2EIJC 3LNRA 4JURI 3W2WA 1Z63A 1YYJA 5T1DB 1F1MA 1RMVA 2CCYA 3OA1A 1VB5A 2NSGA 4BJ5A 1QZXA 3TJ6A 2A0BA 2YVKA 3GM3A 4JJGA 1V4AA 2XSEA 2YRFA 2J8WA 5GPGB 4EHPA 4G7HF 2R7XA 1YAUO 3JTLO 3FXHA 4PFPA 3CZ6A 1FAPB 2F22A 4Q7CA 3RYLA 1D0ZA 2DB4A 1RXQA 2WZFA 1WOLA 3HLZA 3ZIBA 1OCCC 3N24A 1NZEA 3S0XA 1LS4A 4IGGA 4G7OF 1TR2A 1VLSA 4KC9A 2QLAA 3LLKA 5L0JA 1E83A 3W4YA 5JT4A 2XLDA 3K66A 4CBEA 1HMDA 2OU6A 3DXJF 4BJ5C 1OCRC 2KW3C 5KYUB 1OKKD 4PJNA 4CS7A 5A6BD 2RD9A 4EUKB 4BEJA 4BEMJ 4IB4A 4JTDB 2J7PA 2NUTA 2PP4A 5KYYA 1Q0MA 4U5DE 3L1MA 2KJGA 2W9YA 3U9JA 3GORA 2R25A 1G5ZA 2YL0A 2YLIA 1N1CA 3ITFA 4PFOA 2YZSA 2HSBA 1ZHTA 1U0BB 4N6HA 2Y3BA 3KYIA 3SEOA 3SZRA 4G7ZF 5F5HA 3EQLF 3GODA 5F28E 1LE2A 3KPHA 2Z15A 3U8PA 4J32B 5EGYA 1V55C 5JLIA 2G3VA 2WVNA 3LUTB 4QI2A 2OJED 3F46A 4YWQA 3EGDB 4H54A 2WVOA 2YL1A 3DAGA 5E33A 2HSQA 1K40A 2VCBA 1Q0KA 1ORSC 5D91A 2AVKA 3RF3A 4OINF 1C17M 1NFNA 5AC4A 3AQBA 2PF4E 3TD7A 5COMA 1K05A 1LPEA 4XEVA 2A69F 5K0IA 1JOGA 3DWWA 1HMOA 2EPOA 3QMKA 1CGNA 5KYNA 1FFHA 2UUIA 1SF8A 1VYIA 3EFOA 3FMSA 3JSZA 4YT5A 1H9TA 1RCPA 3EJNA 3IQTA 2UUHA 2GWWA 3MLGA 2HMQA 3B0VC 1U6HA 2YQYA 3S27A 3NKDA 4HFKB 2AWYA 2OG2A 3K33A 4JTCB 2OEVA 1Z23A 5AGFA 4U9DA 5HV9A 3DI5A 2PX3A 4MS2A 5BQGA 4DBRA 4L6RA 1QKRA 1WASA 2H8AA 1YVIA 4KNVA 3LESA 3O55A 2GDCA 3E9VA 4BPMA 1WWPA 2V3CC 3HKKA 3SXKA 2GFHA 1M57C 2NUTB 2HJMA 3Q7LA 1HE1A 4XEFA 2HKVA 3QW0A 4U5CE 1ZU5A 2CYDA 3T4RA 3TQOA 1OW8A 3U2MA 3VYWA 3ZTMA 2KGOA 1JAFA 3QVYA 1CGOA 1K04A 3C8GD 4JEAA 3VAYA 4K1OA 1GQAA 3EZHA 4DRHB 5JRAA 2Q9AA 1LS1A 1NG1A 3UMIA 1H7IA 2XL6A 2IXNA 3PCVA 4N4WA 5JP7A 1OCOC 2ZXPA 3IHUA 4DRIB 2M64A 2X0CA 2ZXRA 2EIMC 4K0DA 2Q4FA 4AL0A 2J46A 4PK4A 3ZSUA 2W4BA 1C03A 3AJMA 4XPYA 1RJ9A 2L6GA 2NPUA 3HNLA 2XXAA 2Y3HA 2J9BA 2P1AA 3AGUA 3AG4C 3LS0A 3EGXB 4JW1A 4O7GA 3MFNA 3W8IA 1KTMA 2H7OA 2A0UA 3M79A 1OCZC 5B1BC 2H7VC 4MQ9F 2HS5A 3U3FA 3K7DA 1UFBA 4YN0B 2ASRA 4JJFA 3U8VA 1HW2A 1VYKA 1ZYRF 2HJ3A 2OKUA 3E70C 4CSAA 2NUPA 1Y6DA 4XWJA 2Q7RA 2HV6A 4JRZA 2YL7A 3O39A 1D0YA 3K1HA 1ZW3A 1Q0GA 4KNWA 2Q00A 4RDAA 1SYQA 3GM2A 3EG9A 3ZC4A 3ZQVA 4F4BA 3NDBB 1RKEB 1QSPA 3UGOA 2B0JA 1EKYA 1QPUA 1ZHXA 5JVEA 1U89A 4QI0A 3S9OA 3NMIA 1C02A 2D4UA 1BZ4A 2AU5A 4MVQA 4H4KC 3FAJA 4C3BA 2Y3GA 3GWLA 2XS1A 4FAPB 2A68F 1T6QA 2YKZA 3SYNA 3KMIA 5DQZA 1KNYA 4ZLCA 2VC9A 4WGYA 2XLEA 2ZD9A 3M4CA 1CPRA 3QTHA 1L3PA 4C3EA 5IY5C 3C62A 3WODF 3CQZA 1FNTc 1JR8A 2Q9BA 1E84A 2KSFA 2IBFA 5KYWA 1MMGA 3R2PA 4PJLA 3UNGC 3TOLA 4JVSA 4DRJB 4MTFA 1YDIA 4CS8C 1OKKA 1YZCA 2LK4A 1A7EA 3IQ5A 2Q3TA 4G0HA 5E2QA 3UR3C 1NBBA 2XM4A 2BE5F 2YL3A 5DS5A 2M4EA 2R7UA 2J0XA 4NCQA 3W8HA 3M1CB 4JE9A 1MQVA 4OIOF 4EBKA 2AWCA 3FHDA 3UGPA 2XLVA 4MVMA 3Q6MA 1AVOB 4JC7A 4OIPF 2J0WA 5L0GA 4M63A 4AK9A 1OR2A 3O6XA 1Y4CA 4W8KA 4CS9C 3T6BA 4RBNA 3JRMO 2EILC 3EG9B 5L0HA 4JTAB 5JUAA 2EPNA 5FZTA 3IEEA 4CDVA 3L8IA 1YLMA 1CGME 4OD4A 4IRUA 4MVOA 4YJWA 5DLJA 4D4NA 4CIPA 1SR2A 3HJCA 3V5ZA 2HMZA 2JX0A 5AC5A 1NSGB 2B0HA 4GYTA 1VK5A 5BUOA 5EHHA 3LEVA 1OR3A 2C04A 2CDQA 2QY9A 3EHMA 4P9FA 1YZAA 3DMDA 3ZG1A 3C7JA 1DOVA 2R7WA 1WGWA 4NQFA 4DBQA 4KI2A 3TULA 1JPJA 4AX2A 2D5RB 2IM8A 3V5YA 1ZHZA 3H65A 1BR2A 1HW1A 2P7VA 2R03A 3GWNA 3L8JA 5L0CA 1FR0A 2OEXA 2Y39A 4MNDA 1A41A 2CNWD 4IWBA 2C03A 4J30B 3RQGA 4E7ZA 3TK0A 1D1CA 1JRAA 1LM3B 2ETSA 2LCHA 3A11A 3SNHA 3QZCA 3VF0A 5DQTA 2KYHA 3GEEA 3RVZA 5JSLA 4W8PA 5BQHA 2RSEB 2MYSA 3FDQA 4NY3A 2XL4A 1VOMA 4K7BA 1T5OA 4U5BE 1GM5A 4EBBA 1E86A 4A4AA 2GA0A 4EBJA 4E17A 4DVZA 2JPUA 3Q7GA 4PJJA 3I5PA 5E3AA 4C7OA 3C63A 3U2LA 4HE8D 3SXZA 2YWAA 2WL8A 1S05A 3ASNC 2TMVP 1GGQA 3C8GA 2MWQA 1ZHWA 2OOCA 4WJ0A 1TWGA 3POVA 5COGA 5DVWA 5KYYB 1M2VA 4CJGA 3S90A 3S84A 3VM6A 1TWHA 3J06A 3HTKC 2FGYA 1A7VA 1TWCA 3CSKA 1LE4A 2R7QA 4HEAJ 1AEPA 2EPLX 4JEBA 1O3UA 2XLHA 3JSEO 1V54C 3AGTA 3Q6NA 4XPXA 3ZQYA 2OQMA 3RH3A 1AUEA 4YL1A 2MHRA 3CEXA 4LERA 3JYHA 3ZVRA 4Z9IA 4AE4A 2IXMA 5B3IA 2YHSA 4IAQA 3A9CA 2OCCC 4C3DA 1YA9A 2R7SA 2VASA 3OWTA 3U3BA 3K1IA 3DE8A 2PX0A 3JRTA 3NMKA 3SXMA 4HFFB 5A69A 5L0IA 3R7CA 1IW7F 1IZMA 4FX5A 2KC3A 5TJ5E 1ZVZA 1BDJB 3LAYA 5CIVA 1PD0A 4MTOA 3CAXA 4LDRA 4XEKA 5T3TA 3EFOB 1XZQA 4E7SA 1GS9A 4I1MA 4JCZA 3L0IA 2A6EF 2HZ8A 2L6FA 3DM9B 1EI7A 2XRHA 2EPKX 3JYYA 3JZ0A 4B6IA 4GEHA 2KNHA 3GEHA 2VCAA 3K1IC 3ABLC 2NG1A 1MNEA 2PNOA 5B1AC 3WAQA 4EIYA 2HUJA 2WZLA 4A2NB 4XQ1A 4YT8A 4MVZA 2P0NA 2PFDA 3IQ6A 2IXPA 3C8GB 1B68A 3G4ZA 1T6UA 3GANA 3NRHA 1NLXA 2XL8A 2GAQA 4LLCA 3UMHA 4UDVA 1O5HA 3RQEA 3ECSA 4LACB 1QLEC 4LLEA 1ZHYA 4CS8A 1LI5A 4U5HA 1R4TA 3LNMB 5CI9A 3VRCA 3DJUB 4I1OB 4XLPF 5KYUA 2OJQA 2LSEA 4JCHA 2I8BA 5FCLA 3RVYA 3MBGA 4JIOA 4OIRF 3US6A 4AE4B 4AL1A 1OXBA 3LS1A 1J8MF 3FVYA 3NYLA 4O79A 3UMKA 1A7DA 2O9XA 4DJ9A 1SMYF 1CPQA 4MW3A 3DM5A 3X1OA 2XS8A 4Q4ZF 2WB7A 2WZGA 2IYLD 5HSWA 4R32A 3BEHA 1YJGA 1T01A 3M15A 3C18A 2CGEA 1RJ9B 2XXAB 1KU2A 3NKEA 4DXWA 5A6AA 2KQ9A 4MTGA 5A6BA 3GEIA 4WGZA 4BJTA 1JMWA 1D1BA 3DJNB 2L6HA 4EWCA 2CW0F 4O6YA 3GM1A 3EGDA 2J9WA 3KL4A 1ORJA 3WHNA 1MMAA 2NUPB 4DVYP 3L34A 3EH1A 4U5GA 3PDMP 1OW6A 2DYSC 4Z9HA 2X51A 1TFOB 4BG0A 1SZIA 2FAPB 1ZZPA 1T6IA 2HV7A 2V26A 3ABMC 4NTBA 3ATPA 2R9RB 3S28A 4XTKA 3S29A 2AP3A 3K6BA 3KYJA 1G4US 1D1AA 4FESA 2G62A 3RQFA 3U0CA 3SXYA 4CDYA 1HE9A 4IARA 2XLWA 3LEOA 4FWVA 4BJ6C 2ZXWC 2CNWA 3B71A 2BC5A 4Q5SF 1WATA 1Z6AA 2KK1A 4N06A 2R7OA 4U5FE 1LKXA 2WVQA 3EZIA 3JT1A 4ONSA 4ZLDA 1VLTA 3M4BA 3QVZA 4XPWA 1FFTC 2G3KA 4BJ1A 3ABKC 5L0DA 2R7TA 5T3WA 2LQGA 3NMJA 2R02A 1VMAA 2HFIA 3RIPA 3V5XA 4ANJA 5F5FA 1I4ZA 4CIHA 3EHNA 4ULWA 1WTYA 5KYWB 3IQCA 4XLNF 5A6JA 1Q0FA 4RD9A 1ZU4A 2VH3A 2W45A 4P9TA 4Z9JA 1FTSA 2J7PD 5JS5A 1V74B 3ZTZA 1I5NA 2L81A 3DKAA 2A6HF 1FMWA 2E87A 2I15A 1LIHA 2J9VA 2YEVA 4QDLA 5DS6A 5DS4A 3FOOA 1TFKB 3OEOA 1XWJA 3U5SA 1EA8A 3LLIA 3TJ5A 1HY5A 4ULVA 2R7VA 3MX3A 3W2VA 1G8XA 2JD3A 4YL0A 1ST6A 3NYMA 1H6GA 3AG3C 1OXKA 3TOMA 3X2QC 3FAPB 5B3SC 4OIQF 5L0FA 4N6CA 2XLMA 4CS9A 5KYXA 5E3CA 1Z7Qc 3ZDLA 2VB6A 3EGXA 1W2WA 2R05A 4O6MA 4PJMA 3T6GB 3RKOF 3EH2A 3B0UX 4NC3A 2VCCA 1QQ3A 4I44A 5EK0A 4YT4A 1VTMP 2ZPAA 1L7CA 4P6IC 5L3QA 2R7RA 3AG1C 2DYRC 3DAFA 3BRJA 2LIGA 1G4WR 3IPMO 3RFYA 2P6VA 3H2VA 4CX9A 4MVRA 3ZWIA 4I3MA 2PBEA 1MMDA 3HNIA 2EPMX 3G4XA 3N2ZB 4E0IA 3I5QA 4ER9A 1XZPA 3C8ZA 2H7BA 4J7YA 1RKEA 1YYXA 1NU7D 4LDQA 4MVUA 1I4YA 2EIKC 3B29A 2Y3DA 4NTAA 4OD5A 1J8YF 2IXOA 3U9MA 2ZXOA 3DE9A 4O6NA 4CDAA 4U9EA 2DI3A 4X0RA 2W4MA 3LJBA 1LI7A 1ORYA 2YLDA 2LFFA 3F47A 1H9GA 1TWAA 4E18A 4JZAA 2LFDA 3G50A 4MVSA 1BR1A 1Q0DA 1TQGA 3KKBA 1NFOA 4U5EE 2QNLA 4D4XA 4KBLA 1FMVA 2YLGA 3KH2A 3AG2C 3ASOC 1M2OA 4C7OB 4DOZA 1A0BA 4MW8A 1M56C
chains in the Genus database with same CATH topology
1O87A 3EPVA 3WG7C 4IAOA 1MMNA 2IOQA 2Y69C 1S7ZA 3B0PA 2J45A 3T6JA 1LVKA 5KYXB 3NYJA 1M2VB 1PCXA 3B9QA 4IJJA 1Z5ZA 5D92A 4YT2A 3V7OA 3SP1A 2A1DD 2FFHA 2DGJA 2Q9CA 3NG1A 3DZAA 1Z3IX 3PMRA 3PHF2 3AQCA 3I4UA 1TKNA 5L3VA 5CI8A 1BR4A 2EINC 1MNDA 1D0XA 1JPNA 2J9UA 2QTVA 1PD1A 2L9JA 4CSAC 1NU9C 3JCUQ 3DD7A 3N0TA 4BJ6A 2EIJC 3LNRA 4JURI 3W2WA 1Z63A 5T1DB 3OA1A 4BJ5A 1QZXA 4JJGA 2XSEA 4G7HF 2R7XA 4PFPA 3CZ6A 4Q7CA 3RYLA 1D0ZA 2WZFA 3HLZA 3ZIBA 1OCCC 3N24A 1NZEA 3S0XA 4G7OF 1TR2A 4KC9A 3LLKA 3K66A 4CBEA 3DXJF 4BJ5C 1OCRC 2KW3C 5KYUB 1OKKD 4PJNA 4CS7A 4BEJA 2J7PA 2NUTA 2PP4A 5KYYA 4U5DE 2KJGA 2W9YA 1N1CA 3ITFA 4PFOA 2YZSA 1ZHTA 2Y3BA 3SEOA 3SZRA 4G7ZF 5F5HA 3EQLF 3GODA 2Z15A 4J32B 5EGYA 1V55C 2G3VA 2WVNA 4QI2A 3F46A 4YWQA 3EGDB 2WVOA 3DAGA 5D91A 4OINF 3AQBA 2PF4E 3TD7A 2A69F 3QMKA 5KYNA 1FFHA 3EFOA 1SF8A 1VYIA 3JSZA 4YT5A 3EJNA 3MLGA 3B0VC 3S27A 3NKDA 4HFKB 2OG2A 3K33A 1Z23A 2PX3A 4DBRA 4KNVA 3LESA 3E9VA 2V3CC 2GFHA 1M57C 2NUTB 3Q7LA 4U5CE 1ZU5A 3T4RA 3VYWA 2KGOA 3VAYA 3EZHA 2Q9AA 1LS1A 1NG1A 3UMIA 2IXNA 1OCOC 2ZXPA 2ZXRA 2EIMC 4K0DA 2J46A 4PK4A 3ZSUA 2W4BA 1RJ9A 2XXAA 2Y3HA 3LS0A 4JW1A 4O7GA 3AG4C 3W8IA 3EGXB 2H7OA 5B1BC 1OCZC 2H7VC 4MQ9F 3K7DA 4YN0B 4JJFA 1VYKA 1ZYRF 3E70C 4CSAA 2NUPA 4XWJA 2HV6A 3O39A 1D0YA 3K1HA 4KNWA 3ZC4A 4RDAA 4F4BA 3EG9A 3NDBB 3UGOA 2B0JA 1ZHXA 4QI0A 4H4KC 3FAJA 4C3BA 2Y3GA 2A68F 3SYNA 5DQZA 3KMIA 4ZLCA 4C3EA 5IY5C 3WODF 3CQZA 2Q9BA 5KYWA 1MMGA 4PJLA 3UNGC 4JVSA 4CS8C 1OKKA 5E2QA 3UR3C 2Q3TA 4G0HA 2BE5F 5DS5A 2M4EA 2R7UA 2J0XA 3W8HA 3M1CB 4OIOF 3FHDA 3UGPA 3Q6MA 4OIPF 2J0WA 4M63A 4AK9A 3O6XA 4W8KA 3T6BA 4RBNA 2EILC 3EG9B 3IEEA 4OD4A 4IRUA 4YJWA 5DLJA 3HJCA 4GYTA 1VK5A 5BUOA 3LEVA 2C04A 2CDQA 2QY9A 3EHMA 3DMDA 3ZG1A 2R7WA 1WGWA 4DBQA 4KI2A 1JPJA 4AX2A 2D5RB 1ZHZA 3H65A 1BR2A 2P7VA 2Y39A 4MNDA 4E7ZA 2CNWD 4IWBA 2C03A 4J30B 1D1CA 3SNHA 5DQTA 3QZCA 3FDQA 2MYSA 4NY3A 2XL4A 1VOMA 4K7BA 4U5BE 4EBBA 4DVZA 3Q7GA 4PJJA 3I5PA 5E3AA 4C7OA 4HE8D 2WL8A 3ASNC 2MWQA 1ZHWA 4WJ0A 1TWGA 3POVA 5KYYB 5DVWA 1M2VA 1TWHA 3HTKC 2FGYA 1TWCA 3CSKA 2R7QA 4HEAJ 1V54C 3Q6NA 3RH3A 4AE4A 4LERA 5EHHA 3JYHA 3ZVRA 2IXMA 2YHSA 2OCCC 4C3DA 2R7SA 2VASA 3OWTA 2PX0A 3JRTA 4HFFB 1IZMA 1IW7F 4FX5A 3LAYA 1PD0A 5T3TA 3EFOB 4E7SA 4I1MA 3L0IA 2A6EF 3DM9B 2XRHA 4B6IA 4GEHA 2KNHA 3K1IC 5B1AC 3ABLC 2NG1A 1MNEA 2WZLA 4A2NB 4YT8A 2PFDA 2IXPA 3NRHA 3GANA 4LLCA 3UMHA 1O5HA 3ECSA 4LACB 1QLEC 4LLEA 1ZHYA 4CS8A 4U5HA 5CI9A 3DJUB 4I1OB 4XLPF 5KYUA 2LSEA 4JCHA 2I8BA 5FCLA 4OIRF 4AE4B 3LS1A 1J8MF 3FVYA 3NYLA 4O79A 3UMKA 2O9XA 4Q4ZF 1SMYF 3X1OA 3DM5A 2WB7A 2WZGA 2IYLD 5HSWA 2CGEA 1RJ9B 2XXAB 1KU2A 3NKEA 2KQ9A 4BJTA 1D1BA 3DJNB 4EWCA 2CW0F 4O6YA 3EGDA 2J9WA 3KL4A 1MMAA 2NUPB 4DVYP 3L34A 3EH1A 4U5GA 2DYSC 2X51A 4BG0A 1SZIA 2HV7A 2V26A 3ABMC 3S28A 4XTKA 3S29A 3K6BA 1D1AA 4FESA 2G62A 4FWVA 4BJ6C 2ZXWC 2CNWA 4Q5SF 4N06A 1Z6AA 4U5FE 2R7OA 4ZLDA 1LKXA 2WVQA 3EZIA 3JT1A 1FFTC 2G3KA 4BJ1A 3ABKC 2R7TA 5T3WA 1VMAA 3RIPA 5F5FA 4ANJA 4CIHA 3EHNA 4ULWA 5KYWB 4XLNF 4RD9A 1ZU4A 2VH3A 2W45A 1FTSA 2J7PD 2L81A 2A6HF 1FMWA 2E87A 2J9VA 2YEVA 4QDLA 5DS6A 5DS4A 3OEOA 3LLIA 2R7VA 3MX3A 3W2VA 1G8XA 2JD3A 1ST6A 3NYMA 3AG3C 4OIQF 3X2QC 5B3SC 4CS9A 5KYXA 5E3CA 2VB6A 3EGXA 1W2WA 4PJMA 4O6MA 3RKOF 3EH2A 3B0UX 4I44A 4YT4A 2ZPAA 5L3QA 4P6IC 2R7RA 3AG1C 2DYRC 3DAFA 3RFYA 2P6VA 4I3MA 1MMDA 3N2ZB 3I5QA 5E33A 2H7BA 1NU7D 4OD5A 2EIKC 4CS9C 2Y3DA 1J8YF 2IXOA 2ZXOA 4O6NA 4X0RA 2W4MA 3LJBA 3F47A 1TWAA 4JZAA 1BR1A 3KKBA 4U5EE 4KBLA 1FMVA 3KH2A 3AG2C 3ASOC 1M2OA 4C7OB 4DOZA 1M56C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1C B; 
#chains in the Genus database with same CATH topology
 1O87 A;  3EPV A;  3WG7 C;  2XM0 A;  1YA7 O;  2NSF A;  4IAO A;  1MMN A;  2IOQ A;  2Y69 C;  4YL3 A;  4J7T A;  1S7Z A;  3B0P A;  1E2X A;  4LDK A;  4PAC A;  2J45 A;  3T6J A;  1LVK A;  5KYX B;  1WN0 A;  3NYJ A;  1M2V B;  4PR9 A;  1PCX A;  1RKC A;  3B9Q A;  4IJJ A;  1Z5Z A;  3RW0 A;  3O10 A;  1BBH A;  2BL2 A;  5D92 A;  4YT2 A;  1PV3 A;  3FOP A;  4GQH A;  1OQC A;  4JKV A;  1UG7 A;  2QUP A;  3V7O A;  2LD6 A;  1YAR O;  3AOU A;  3MYI A;  3SP1 A;  2A1D D;  2FFH A;  2DGJ A;  2Q9C A;  3NG1 A;  4YK5 A;  1QVX A;  3DZA A;  1Z3I X;  3PMR A;  3PHF 2;  3AQC A;  3I4U A;  1TKN A;  5L3V A;  1OW7 A;  1R5I D;  2L7A A;  4CJO A;  1E85 A;  5CI8 A;  1BR4 A;  4G78 A;  3MYF A;  1APC A;  1ZW2 A;  2EIN C;  4WAB A;  1MND A;  3HNJ A;  2ICW G;  4NTF A;  3QW1 A;  1D0X A;  4EKW A;  2QE9 A;  5A6K A;  2P61 A;  4E0H A;  5BQI A;  1EQ1 A;  1JPN A;  3T9O A;  256B A;  1DOW A;  2J9U A;  2QTV A;  2LP4 A;  1PD1 A;  2L9J A;  3HNK A;  1M6T A;  4CSA C;  1NU9 C;  3JCU Q;  3DD7 A;  3H2U A;  3N0T A;  5COF A;  1T9K A;  2XLO A;  4BJ6 A;  2EIJ C;  3LNR A;  4JUR I;  3W2W A;  1Z63 A;  1YYJ A;  5T1D B;  1F1M A;  1RMV A;  2CCY A;  3OA1 A;  1VB5 A;  2NSG A;  4BJ5 A;  1QZX A;  3TJ6 A;  2A0B A;  2YVK A;  3GM3 A;  4JJG A;  1V4A A;  2XSE A;  2YRF A;  2J8W A;  5GPG B;  4EHP A;  4G7H F;  2R7X A;  1YAU O;  3JTL O;  3FXH A;  4PFP A;  3CZ6 A;  1FAP B;  2F22 A;  4Q7C A;  3RYL A;  1D0Z A;  2DB4 A;  1RXQ A;  2WZF A;  1WOL A;  3HLZ A;  3ZIB A;  1OCC C;  3N24 A;  1NZE A;  3S0X A;  1LS4 A;  4IGG A;  4G7O F;  1TR2 A;  1VLS A;  4KC9 A;  2QLA A;  3LLK A;  5L0J A;  1E83 A;  3W4Y A;  5JT4 A;  2XLD A;  3K66 A;  4CBE A;  1HMD A;  2OU6 A;  3DXJ F;  4BJ5 C;  1OCR C;  2KW3 C;  5KYU B;  1OKK D;  4PJN A;  4CS7 A;  5A6B D;  2RD9 A;  4EUK B;  4BEJ A;  4BEM J;  4IB4 A;  4JTD B;  2J7P A;  2NUT A;  2PP4 A;  5KYY A;  1Q0M A;  4U5D E;  3L1M A;  2KJG A;  2W9Y A;  3U9J A;  3GOR A;  2R25 A;  1G5Z A;  2YL0 A;  2YLI A;  1N1C A;  3ITF A;  4PFO A;  2YZS A;  2HSB A;  1ZHT A;  1U0B B;  4N6H A;  2Y3B A;  3KYI A;  3SEO A;  3SZR A;  4G7Z F;  5F5H A;  3EQL F;  3GOD A;  5F28 E;  1LE2 A;  3KPH A;  2Z15 A;  3U8P A;  4J32 B;  5EGY A;  1V55 C;  5JLI A;  2G3V A;  2WVN A;  3LUT B;  4QI2 A;  2OJE D;  3F46 A;  4YWQ A;  3EGD B;  4H54 A;  2WVO A;  2YL1 A;  3DAG A;  5E33 A;  2HSQ A;  1K40 A;  2VCB A;  1Q0K A;  1ORS C;  5D91 A;  2AVK A;  3RF3 A;  4OIN F;  1C17 M;  1NFN A;  5AC4 A;  3AQB A;  2PF4 E;  3TD7 A;  5COM A;  1K05 A;  1LPE A;  4XEV A;  2A69 F;  5K0I A;  1JOG A;  3DWW A;  1HMO A;  2EPO A;  3QMK A;  1CGN A;  5KYN A;  1FFH A;  2UUI A;  1SF8 A;  1VYI A;  3EFO A;  3FMS A;  3JSZ A;  4YT5 A;  1H9T A;  1RCP A;  3EJN A;  3IQT A;  2UUH A;  2GWW A;  3MLG A;  2HMQ A;  3B0V C;  1U6H A;  2YQY A;  3S27 A;  3NKD A;  4HFK B;  2AWY A;  2OG2 A;  3K33 A;  4JTC B;  2OEV A;  1Z23 A;  5AGF A;  4U9D A;  5HV9 A;  3DI5 A;  2PX3 A;  4MS2 A;  5BQG A;  4DBR A;  4L6R A;  1QKR A;  1WAS A;  2H8A A;  1YVI A;  4KNV A;  3LES A;  3O55 A;  2GDC A;  3E9V A;  4BPM A;  1WWP A;  2V3C C;  3HKK A;  3SXK A;  2GFH A;  1M57 C;  2NUT B;  2HJM A;  3Q7L A;  1HE1 A;  4XEF A;  2HKV A;  3QW0 A;  4U5C E;  1ZU5 A;  2CYD A;  3T4R A;  3TQO A;  1OW8 A;  3U2M A;  3VYW A;  3ZTM A;  2KGO A;  1JAF A;  3QVY A;  1CGO A;  1K04 A;  3C8G D;  4JEA A;  3VAY A;  4K1O A;  1GQA A;  3EZH A;  4DRH B;  5JRA A;  2Q9A A;  1LS1 A;  1NG1 A;  3UMI A;  1H7I A;  2XL6 A;  2IXN A;  3PCV A;  4N4W A;  5JP7 A;  1OCO C;  2ZXP A;  3IHU A;  4DRI B;  2M64 A;  2X0C A;  2ZXR A;  2EIM C;  4K0D A;  2Q4F A;  4AL0 A;  2J46 A;  4PK4 A;  3ZSU A;  2W4B A;  1C03 A;  3AJM A;  4XPY A;  1RJ9 A;  2L6G A;  2NPU A;  3HNL A;  2XXA A;  2Y3H A;  2J9B A;  2P1A A;  3AGU A;  3AG4 C;  3LS0 A;  3EGX B;  4JW1 A;  4O7G A;  3MFN A;  3W8I A;  1KTM A;  2H7O A;  2A0U A;  3M79 A;  1OCZ C;  5B1B C;  2H7V C;  4MQ9 F;  2HS5 A;  3U3F A;  3K7D A;  1UFB A;  4YN0 B;  2ASR A;  4JJF A;  3U8V A;  1HW2 A;  1VYK A;  1ZYR F;  2HJ3 A;  2OKU A;  3E70 C;  4CSA A;  2NUP A;  1Y6D A;  4XWJ A;  2Q7R A;  2HV6 A;  4JRZ A;  2YL7 A;  3O39 A;  1D0Y A;  3K1H A;  1ZW3 A;  1Q0G A;  4KNW A;  2Q00 A;  4RDA A;  1SYQ A;  3GM2 A;  3EG9 A;  3ZC4 A;  3ZQV A;  4F4B A;  3NDB B;  1RKE B;  1QSP A;  3UGO A;  2B0J A;  1EKY A;  1QPU A;  1ZHX A;  5JVE A;  1U89 A;  4QI0 A;  3S9O A;  3NMI A;  1C02 A;  2D4U A;  1BZ4 A;  2AU5 A;  4MVQ A;  4H4K C;  3FAJ A;  4C3B A;  2Y3G A;  3GWL A;  2XS1 A;  4FAP B;  2A68 F;  1T6Q A;  2YKZ A;  3SYN A;  3KMI A;  5DQZ A;  1KNY A;  4ZLC A;  2VC9 A;  4WGY A;  2XLE A;  2ZD9 A;  3M4C A;  1CPR A;  3QTH A;  1L3P A;  4C3E A;  5IY5 C;  3C62 A;  3WOD F;  3CQZ A;  1FNT c;  1JR8 A;  2Q9B A;  1E84 A;  2KSF A;  2IBF A;  5KYW A;  1MMG A;  3R2P A;  4PJL A;  3UNG C;  3TOL A;  4JVS A;  4DRJ B;  4MTF A;  1YDI A;  4CS8 C;  1OKK A;  1YZC A;  2LK4 A;  1A7E A;  3IQ5 A;  2Q3T A;  4G0H A;  5E2Q A;  3UR3 C;  1NBB A;  2XM4 A;  2BE5 F;  2YL3 A;  5DS5 A;  2M4E A;  2R7U A;  2J0X A;  4NCQ A;  3W8H A;  3M1C B;  4JE9 A;  1MQV A;  4OIO F;  4EBK A;  2AWC A;  3FHD A;  3UGP A;  2XLV A;  4MVM A;  3Q6M A;  1AVO B;  4JC7 A;  4OIP F;  2J0W A;  5L0G A;  4M63 A;  4AK9 A;  1OR2 A;  3O6X A;  1Y4C A;  4W8K A;  4CS9 C;  3T6B A;  4RBN A;  3JRM O;  2EIL C;  3EG9 B;  5L0H A;  4JTA B;  5JUA A;  2EPN A;  5FZT A;  3IEE A;  4CDV A;  3L8I A;  1YLM A;  1CGM E;  4OD4 A;  4IRU A;  4MVO A;  4YJW A;  5DLJ A;  4D4N A;  4CIP A;  1SR2 A;  3HJC A;  3V5Z A;  2HMZ A;  2JX0 A;  5AC5 A;  1NSG B;  2B0H A;  4GYT A;  1VK5 A;  5BUO A;  5EHH A;  3LEV A;  1OR3 A;  2C04 A;  2CDQ A;  2QY9 A;  3EHM A;  4P9F A;  1YZA A;  3DMD A;  3ZG1 A;  3C7J A;  1DOV A;  2R7W A;  1WGW A;  4NQF A;  4DBQ A;  4KI2 A;  3TUL A;  1JPJ A;  4AX2 A;  2D5R B;  2IM8 A;  3V5Y A;  1ZHZ A;  3H65 A;  1BR2 A;  1HW1 A;  2P7V A;  2R03 A;  3GWN A;  3L8J A;  5L0C A;  1FR0 A;  2OEX A;  2Y39 A;  4MND A;  1A41 A;  2CNW D;  4IWB A;  2C03 A;  4J30 B;  3RQG A;  4E7Z A;  3TK0 A;  1D1C A;  1JRA A;  1LM3 B;  2ETS A;  2LCH A;  3A11 A;  3SNH A;  3QZC A;  3VF0 A;  5DQT A;  2KYH A;  3GEE A;  3RVZ A;  5JSL A;  4W8P A;  5BQH A;  2RSE B;  2MYS A;  3FDQ A;  4NY3 A;  2XL4 A;  1VOM A;  4K7B A;  1T5O A;  4U5B E;  1GM5 A;  4EBB A;  1E86 A;  4A4A A;  2GA0 A;  4EBJ A;  4E17 A;  4DVZ A;  2JPU A;  3Q7G A;  4PJJ A;  3I5P A;  5E3A A;  4C7O A;  3C63 A;  3U2L A;  4HE8 D;  3SXZ A;  2YWA A;  2WL8 A;  1S05 A;  3ASN C;  2TMV P;  1GGQ A;  3C8G A;  2MWQ A;  1ZHW A;  2OOC A;  4WJ0 A;  1TWG A;  3POV A;  5COG A;  5DVW A;  5KYY B;  1M2V A;  4CJG A;  3S90 A;  3S84 A;  3VM6 A;  1TWH A;  3J06 A;  3HTK C;  2FGY A;  1A7V A;  1TWC A;  3CSK A;  1LE4 A;  2R7Q A;  4HEA J;  1AEP A;  2EPL X;  4JEB A;  1O3U A;  2XLH A;  3JSE O;  1V54 C;  3AGT A;  3Q6N A;  4XPX A;  3ZQY A;  2OQM A;  3RH3 A;  1AUE A;  4YL1 A;  2MHR A;  3CEX A;  4LER A;  3JYH A;  3ZVR A;  4Z9I A;  4AE4 A;  2IXM A;  5B3I A;  2YHS A;  4IAQ A;  3A9C A;  2OCC C;  4C3D A;  1YA9 A;  2R7S A;  2VAS A;  3OWT A;  3U3B A;  3K1I A;  3DE8 A;  2PX0 A;  3JRT A;  3NMK A;  3SXM A;  4HFF B;  5A69 A;  5L0I A;  3R7C A;  1IW7 F;  1IZM A;  4FX5 A;  2KC3 A;  5TJ5 E;  1ZVZ A;  1BDJ B;  3LAY A;  5CIV A;  1PD0 A;  4MTO A;  3CAX A;  4LDR A;  4XEK A;  5T3T A;  3EFO B;  1XZQ A;  4E7S A;  1GS9 A;  4I1M A;  4JCZ A;  3L0I A;  2A6E F;  2HZ8 A;  2L6F A;  3DM9 B;  1EI7 A;  2XRH A;  2EPK X;  3JYY A;  3JZ0 A;  4B6I A;  4GEH A;  2KNH A;  3GEH A;  2VCA A;  3K1I C;  3ABL C;  2NG1 A;  1MNE A;  2PNO A;  5B1A C;  3WAQ A;  4EIY A;  2HUJ A;  2WZL A;  4A2N B;  4XQ1 A;  4YT8 A;  4MVZ A;  2P0N A;  2PFD A;  3IQ6 A;  2IXP A;  3C8G B;  1B68 A;  3G4Z A;  1T6U A;  3GAN A;  3NRH A;  1NLX A;  2XL8 A;  2GAQ A;  4LLC A;  3UMH A;  4UDV A;  1O5H A;  3RQE A;  3ECS A;  4LAC B;  1QLE C;  4LLE A;  1ZHY A;  4CS8 A;  1LI5 A;  4U5H A;  1R4T A;  3LNM B;  5CI9 A;  3VRC A;  3DJU B;  4I1O B;  4XLP F;  5KYU A;  2OJQ A;  2LSE A;  4JCH A;  2I8B A;  5FCL A;  3RVY A;  3MBG A;  4JIO A;  4OIR F;  3US6 A;  4AE4 B;  4AL1 A;  1OXB A;  3LS1 A;  1J8M F;  3FVY A;  3NYL A;  4O79 A;  3UMK A;  1A7D A;  2O9X A;  4DJ9 A;  1SMY F;  1CPQ A;  4MW3 A;  3DM5 A;  3X1O A;  2XS8 A;  4Q4Z F;  2WB7 A;  2WZG A;  2IYL D;  5HSW A;  4R32 A;  3BEH A;  1YJG A;  1T01 A;  3M15 A;  3C18 A;  2CGE A;  1RJ9 B;  2XXA B;  1KU2 A;  3NKE A;  4DXW A;  5A6A A;  2KQ9 A;  4MTG A;  5A6B A;  3GEI A;  4WGZ A;  4BJT A;  1JMW A;  1D1B A;  3DJN B;  2L6H A;  4EWC A;  2CW0 F;  4O6Y A;  3GM1 A;  3EGD A;  2J9W A;  3KL4 A;  1ORJ A;  3WHN A;  1MMA A;  2NUP B;  4DVY P;  3L34 A;  3EH1 A;  4U5G A;  3PDM P;  1OW6 A;  2DYS C;  4Z9H A;  2X51 A;  1TFO B;  4BG0 A;  1SZI A;  2FAP B;  1ZZP A;  1T6I A;  2HV7 A;  2V26 A;  3ABM C;  4NTB A;  3ATP A;  2R9R B;  3S28 A;  4XTK A;  3S29 A;  2AP3 A;  3K6B A;  3KYJ A;  1G4U S;  1D1A A;  4FES A;  2G62 A;  3RQF A;  3U0C A;  3SXY A;  4CDY A;  1HE9 A;  4IAR A;  2XLW A;  3LEO A;  4FWV A;  4BJ6 C;  2ZXW C;  2CNW A;  3B71 A;  2BC5 A;  4Q5S F;  1WAT A;  1Z6A A;  2KK1 A;  4N06 A;  2R7O A;  4U5F E;  1LKX A;  2WVQ A;  3EZI A;  3JT1 A;  4ONS A;  4ZLD A;  1VLT A;  3M4B A;  3QVZ A;  4XPW A;  1FFT C;  2G3K A;  4BJ1 A;  3ABK C;  5L0D A;  2R7T A;  5T3W A;  2LQG A;  3NMJ A;  2R02 A;  1VMA A;  2HFI A;  3RIP A;  3V5X A;  4ANJ A;  5F5F A;  1I4Z A;  4CIH A;  3EHN A;  4ULW A;  1WTY A;  5KYW B;  3IQC A;  4XLN F;  5A6J A;  1Q0F A;  4RD9 A;  1ZU4 A;  2VH3 A;  2W45 A;  4P9T A;  4Z9J A;  1FTS A;  2J7P D;  5JS5 A;  1V74 B;  3ZTZ A;  1I5N A;  2L81 A;  3DKA A;  2A6H F;  1FMW A;  2E87 A;  2I15 A;  1LIH A;  2J9V A;  2YEV A;  4QDL A;  5DS6 A;  5DS4 A;  3FOO A;  1TFK B;  3OEO A;  1XWJ A;  3U5S A;  1EA8 A;  3LLI A;  3TJ5 A;  1HY5 A;  4ULV A;  2R7V A;  3MX3 A;  3W2V A;  1G8X A;  2JD3 A;  4YL0 A;  1ST6 A;  3NYM A;  1H6G A;  3AG3 C;  1OXK A;  3TOM A;  3X2Q C;  3FAP B;  5B3S C;  4OIQ F;  5L0F A;  4N6C A;  2XLM A;  4CS9 A;  5KYX A;  5E3C A;  1Z7Q c;  3ZDL A;  2VB6 A;  3EGX A;  1W2W A;  2R05 A;  4O6M A;  4PJM A;  3T6G B;  3RKO F;  3EH2 A;  3B0U X;  4NC3 A;  2VCC A;  1QQ3 A;  4I44 A;  5EK0 A;  4YT4 A;  1VTM P;  2ZPA A;  1L7C A;  4P6I C;  5L3Q A;  2R7R A;  3AG1 C;  2DYR C;  3DAF A;  3BRJ A;  2LIG A;  1G4W R;  3IPM O;  3RFY A;  2P6V A;  3H2V A;  4CX9 A;  4MVR A;  3ZWI A;  4I3M A;  2PBE A;  1MMD A;  3HNI A;  2EPM X;  3G4X A;  3N2Z B;  4E0I A;  3I5Q A;  4ER9 A;  1XZP A;  3C8Z A;  2H7B A;  4J7Y A;  1RKE A;  1YYX A;  1NU7 D;  4LDQ A;  4MVU A;  1I4Y A;  2EIK C;  3B29 A;  2Y3D A;  4NTA A;  4OD5 A;  1J8Y F;  2IXO A;  3U9M A;  2ZXO A;  3DE9 A;  4O6N A;  4CDA A;  4U9E A;  2DI3 A;  4X0R A;  2W4M A;  3LJB A;  1LI7 A;  1ORY A;  2YLD A;  2LFF A;  3F47 A;  1H9G A;  1TWA A;  4E18 A;  4JZA A;  2LFD A;  3G50 A;  4MVS A;  1BR1 A;  1Q0D A;  1TQG A;  3KKB A;  1NFO A;  4U5E E;  2QNL A;  4D4X A;  4KBL A;  1FMV A;  2YLG A;  3KH2 A;  3AG2 C;  3ASO C;  1M2O A;  4C7O B;  4DOZ A;  1A0B A;  4MW8 A;  1M56 C; 
#chains in the Genus database with same CATH homology
 1O87 A;  3EPV A;  3WG7 C;  4IAO A;  1MMN A;  2IOQ A;  2Y69 C;  1S7Z A;  3B0P A;  2J45 A;  3T6J A;  1LVK A;  5KYX B;  3NYJ A;  1M2V B;  1PCX A;  3B9Q A;  4IJJ A;  1Z5Z A;  5D92 A;  4YT2 A;  3V7O A;  3SP1 A;  2A1D D;  2FFH A;  2DGJ A;  2Q9C A;  3NG1 A;  3DZA A;  1Z3I X;  3PMR A;  3PHF 2;  3AQC A;  3I4U A;  1TKN A;  5L3V A;  5CI8 A;  1BR4 A;  2EIN C;  1MND A;  1D0X A;  1JPN A;  2J9U A;  2QTV A;  1PD1 A;  2L9J A;  4CSA C;  1NU9 C;  3JCU Q;  3DD7 A;  3N0T A;  4BJ6 A;  2EIJ C;  3LNR A;  4JUR I;  3W2W A;  1Z63 A;  5T1D B;  3OA1 A;  4BJ5 A;  1QZX A;  4JJG A;  2XSE A;  4G7H F;  2R7X A;  4PFP A;  3CZ6 A;  4Q7C A;  3RYL A;  1D0Z A;  2WZF A;  3HLZ A;  3ZIB A;  1OCC C;  3N24 A;  1NZE A;  3S0X A;  4G7O F;  1TR2 A;  4KC9 A;  3LLK A;  3K66 A;  4CBE A;  3DXJ F;  4BJ5 C;  1OCR C;  2KW3 C;  5KYU B;  1OKK D;  4PJN A;  4CS7 A;  4BEJ A;  2J7P A;  2NUT A;  2PP4 A;  5KYY A;  4U5D E;  2KJG A;  2W9Y A;  1N1C A;  3ITF A;  4PFO A;  2YZS A;  1ZHT A;  2Y3B A;  3SEO A;  3SZR A;  4G7Z F;  5F5H A;  3EQL F;  3GOD A;  2Z15 A;  4J32 B;  5EGY A;  1V55 C;  2G3V A;  2WVN A;  4QI2 A;  3F46 A;  4YWQ A;  3EGD B;  2WVO A;  3DAG A;  5D91 A;  4OIN F;  3AQB A;  2PF4 E;  3TD7 A;  2A69 F;  3QMK A;  5KYN A;  1FFH A;  3EFO A;  1SF8 A;  1VYI A;  3JSZ A;  4YT5 A;  3EJN A;  3MLG A;  3B0V C;  3S27 A;  3NKD A;  4HFK B;  2OG2 A;  3K33 A;  1Z23 A;  2PX3 A;  4DBR A;  4KNV A;  3LES A;  3E9V A;  2V3C C;  2GFH A;  1M57 C;  2NUT B;  3Q7L A;  4U5C E;  1ZU5 A;  3T4R A;  3VYW A;  2KGO A;  3VAY A;  3EZH A;  2Q9A A;  1LS1 A;  1NG1 A;  3UMI A;  2IXN A;  1OCO C;  2ZXP A;  2ZXR A;  2EIM C;  4K0D A;  2J46 A;  4PK4 A;  3ZSU A;  2W4B A;  1RJ9 A;  2XXA A;  2Y3H A;  3LS0 A;  4JW1 A;  4O7G A;  3AG4 C;  3W8I A;  3EGX B;  2H7O A;  5B1B C;  1OCZ C;  2H7V C;  4MQ9 F;  3K7D A;  4YN0 B;  4JJF A;  1VYK A;  1ZYR F;  3E70 C;  4CSA A;  2NUP A;  4XWJ A;  2HV6 A;  3O39 A;  1D0Y A;  3K1H A;  4KNW A;  3ZC4 A;  4RDA A;  4F4B A;  3EG9 A;  3NDB B;  3UGO A;  2B0J A;  1ZHX A;  4QI0 A;  4H4K C;  3FAJ A;  4C3B A;  2Y3G A;  2A68 F;  3SYN A;  5DQZ A;  3KMI A;  4ZLC A;  4C3E A;  5IY5 C;  3WOD F;  3CQZ A;  2Q9B A;  5KYW A;  1MMG A;  4PJL A;  3UNG C;  4JVS A;  4CS8 C;  1OKK A;  5E2Q A;  3UR3 C;  2Q3T A;  4G0H A;  2BE5 F;  5DS5 A;  2M4E A;  2R7U A;  2J0X A;  3W8H A;  3M1C B;  4OIO F;  3FHD A;  3UGP A;  3Q6M A;  4OIP F;  2J0W A;  4M63 A;  4AK9 A;  3O6X A;  4W8K A;  3T6B A;  4RBN A;  2EIL C;  3EG9 B;  3IEE A;  4OD4 A;  4IRU A;  4YJW A;  5DLJ A;  3HJC A;  4GYT A;  1VK5 A;  5BUO A;  3LEV A;  2C04 A;  2CDQ A;  2QY9 A;  3EHM A;  3DMD A;  3ZG1 A;  2R7W A;  1WGW A;  4DBQ A;  4KI2 A;  1JPJ A;  4AX2 A;  2D5R B;  1ZHZ A;  3H65 A;  1BR2 A;  2P7V A;  2Y39 A;  4MND A;  4E7Z A;  2CNW D;  4IWB A;  2C03 A;  4J30 B;  1D1C A;  3SNH A;  5DQT A;  3QZC A;  3FDQ A;  2MYS A;  4NY3 A;  2XL4 A;  1VOM A;  4K7B A;  4U5B E;  4EBB A;  4DVZ A;  3Q7G A;  4PJJ A;  3I5P A;  5E3A A;  4C7O A;  4HE8 D;  2WL8 A;  3ASN C;  2MWQ A;  1ZHW A;  4WJ0 A;  1TWG A;  3POV A;  5KYY B;  5DVW A;  1M2V A;  1TWH A;  3HTK C;  2FGY A;  1TWC A;  3CSK A;  2R7Q A;  4HEA J;  1V54 C;  3Q6N A;  3RH3 A;  4AE4 A;  4LER A;  5EHH A;  3JYH A;  3ZVR A;  2IXM A;  2YHS A;  2OCC C;  4C3D A;  2R7S A;  2VAS A;  3OWT A;  2PX0 A;  3JRT A;  4HFF B;  1IZM A;  1IW7 F;  4FX5 A;  3LAY A;  1PD0 A;  5T3T A;  3EFO B;  4E7S A;  4I1M A;  3L0I A;  2A6E F;  3DM9 B;  2XRH A;  4B6I A;  4GEH A;  2KNH A;  3K1I C;  5B1A C;  3ABL C;  2NG1 A;  1MNE A;  2WZL A;  4A2N B;  4YT8 A;  2PFD A;  2IXP A;  3NRH A;  3GAN A;  4LLC A;  3UMH A;  1O5H A;  3ECS A;  4LAC B;  1QLE C;  4LLE A;  1ZHY A;  4CS8 A;  4U5H A;  5CI9 A;  3DJU B;  4I1O B;  4XLP F;  5KYU A;  2LSE A;  4JCH A;  2I8B A;  5FCL A;  4OIR F;  4AE4 B;  3LS1 A;  1J8M F;  3FVY A;  3NYL A;  4O79 A;  3UMK A;  2O9X A;  4Q4Z F;  1SMY F;  3X1O A;  3DM5 A;  2WB7 A;  2WZG A;  2IYL D;  5HSW A;  2CGE A;  1RJ9 B;  2XXA B;  1KU2 A;  3NKE A;  2KQ9 A;  4BJT A;  1D1B A;  3DJN B;  4EWC A;  2CW0 F;  4O6Y A;  3EGD A;  2J9W A;  3KL4 A;  1MMA A;  2NUP B;  4DVY P;  3L34 A;  3EH1 A;  4U5G A;  2DYS C;  2X51 A;  4BG0 A;  1SZI A;  2HV7 A;  2V26 A;  3ABM C;  3S28 A;  4XTK A;  3S29 A;  3K6B A;  1D1A A;  4FES A;  2G62 A;  4FWV A;  4BJ6 C;  2ZXW C;  2CNW A;  4Q5S F;  4N06 A;  1Z6A A;  4U5F E;  2R7O A;  4ZLD A;  1LKX A;  2WVQ A;  3EZI A;  3JT1 A;  1FFT C;  2G3K A;  4BJ1 A;  3ABK C;  2R7T A;  5T3W A;  1VMA A;  3RIP A;  5F5F A;  4ANJ A;  4CIH A;  3EHN A;  4ULW A;  5KYW B;  4XLN F;  4RD9 A;  1ZU4 A;  2VH3 A;  2W45 A;  1FTS A;  2J7P D;  2L81 A;  2A6H F;  1FMW A;  2E87 A;  2J9V A;  2YEV A;  4QDL A;  5DS6 A;  5DS4 A;  3OEO A;  3LLI A;  2R7V A;  3MX3 A;  3W2V A;  1G8X A;  2JD3 A;  1ST6 A;  3NYM A;  3AG3 C;  4OIQ F;  3X2Q C;  5B3S C;  4CS9 A;  5KYX A;  5E3C A;  2VB6 A;  3EGX A;  1W2W A;  4PJM A;  4O6M A;  3RKO F;  3EH2 A;  3B0U X;  4I44 A;  4YT4 A;  2ZPA A;  5L3Q A;  4P6I C;  2R7R A;  3AG1 C;  2DYR C;  3DAF A;  3RFY A;  2P6V A;  4I3M A;  1MMD A;  3N2Z B;  3I5Q A;  5E33 A;  2H7B A;  1NU7 D;  4OD5 A;  2EIK C;  4CS9 C;  2Y3D A;  1J8Y F;  2IXO A;  2ZXO A;  4O6N A;  4X0R A;  2W4M A;  3LJB A;  3F47 A;  1TWA A;  4JZA A;  1BR1 A;  3KKB A;  4U5E E;  4KBL A;  1FMV A;  3KH2 A;  3AG2 C;  3ASO C;  1M2O A;  4C7O B;  4DOZ A;  1M56 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...