3M1MA

Crystal structure of the primase-polymerase from sulfolobus islandicus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
331
structure length
320
Chain Sequence
SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEGEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVITLSKAWSVVKKYLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The archaeo-eukaryotic primase of plasmid pRN1 requires a helix bundle domain for faithful primer synthesis
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
molecule keywords ORF904
total genus 121
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
A PF13010 pRN1_helical Primase helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3m1mA01
1.10.1240.50 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 3m1mA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 3m1mA02
1RO0A 1RO2A 1RNIA 3H20A 3M1MA
chains in the Genus database with same CATH superfamily
4PWVB 4COPA 2JB0A 1ZNVA 4IPYA 1IMQA 1M6NA 2N98A 2MY5A 1N8RQ 1GPJA 2GZEA 1M90Q 1A8OA 4QKOA 1UTUA 1KLPA 5KP8B 2EFJA 1K98A 1VHNA 2PEMA 3EJBA 4U0FA 2PEOA 2J6ZA 1EOQA 2XT1A 3G71P 2LF4A 1Q6BA 3WHPA 3VRLC 1Q81Q 2Z44A 2KGCA 2N6ZA 3BULA 3M1MA 2JU2A 1DV5A 1RO2A 4HH3C 3CE7A 4R0MA 2FMME 4XROA 2XZ0D 1YI2P 1YJNP 1SUYA 1UNKA 4XFZA 2Z45A 2MD9A 3CCJP 2BHVA 1VQ7P 1L0IA 1W2BO 2ERHA 3CC4P 1M6EX 1V2ZA 1VQ9P 5F2KA 1NJIQ 3CCQP 2JU1A 2JBGA 2FADA 1GXHA 4HEHA 2FQ1A 2JO0A 3CCLP 2PBIA 3LRYA 4BPFA 3L9TA 3B5IA 3RG2A 3EJDA 2GZJA 2N5IA 1KQSO 1R8JA 2EIAA 4M0MA 5HV8A 1CEIA 3H4EA 2GZFA 1SV1A 2VLPA 1K7YA 3G0VA 1VQNP 4XFXA 1IUQA 3LMOA 3DS4A 2GYKA 4DG9A 7CEIA 1KD1Q 1EMVA 1R5QA 2KOOA 4G86A 2L6EA 3GKLC 2VLQA 3CCEP 2K2QA 4WYMA 1ACPA 3I56P 2AFEA 1KC8Q 2M8LA 2AVAA 3DS3A 1AF8A 2KOPA 4U0AA 1OR5A 2JQ4A 3G4SP 5C5EA 2K93A 2N5HA 4HKGA 1YJWP 2M5RA 2N50A 4U0EA 1HQBA 1VQPP 5CZDB 5HGOA 1AUMA 2GDXA 4COCA 3H20A 2BUOA 2LTEA 1JJ2O 2FVEA 4PH0A 2LIUA 2GZGA 1ZMBA 1E0HA 4MRTC 2MVVA 3Q20A 1M74A 2CNRA 2QEXP 3CMAP 3WBHA 3H47A 3DPHA 3B4QA 2FVAA 2FQ0A 2MR7A 1VKUA 1YITP 2KGDA 2EHTA 1W53A 2LIWA 2E1MA 1L0HA 4QNBA 1YHQP 3CXCO 4H2YC 2JYLA 3BJDA 1K9MQ 3CCUP 5KP7B 1YIJP 1M1KQ 5HGLA 2CQ8A 1T8KA 1Q6AA 3CPWO 1VQ5P 3CC2P 2WPTA 2EG5A 4PH1A 1VQMP 3P05A 1QTEA 2L9FA 3CCSP 1EIAA 5BS1A 2KORA 2ONTA 2DNWA 2I2XB 2VLOA 3EJEA 4F37A 2PEQA 2VSQA 2M8NA 4U0DA 1AYIA 2OARA 1A43A 1GXGA 4NEOA 1VQ8P 4H2WC 2PNGA 1K8AQ 2PEIA 2XV6A 1FR2A 1UJZA 5HVCA 4JGIA 2LMLA 2KGEA 4UHPB 3NTEA 1Q82Q 3I55P 3G6EP 5C8DA 1K73Q 1MZ8A 2Z46A 4U0CA 5BS2A 2XXMA 2KOSA 4BPGA 5EJDA 1K30A 3U43A 1RNIA 2CG5B 1BAJA 2QA4P 3GJNA 2FAEA 2GZIA 3H0DA 1VQ6P 3OW2O 1IMPA 2M8PA 1YJ9P 3G29A 1SLYA 2K94A 2JAZA 1S72P 3NY7B 4X8QA 3CC7P 1VQLP 2KGAA 1BMTA 1NQ4A 1RO0A 3CMEP 2KOQA 2K0XA 2K92A 2CGQA 4IZ6A 2NO8A 1QVGO 2PEJA 2PENA 2LL8A 2FHSC 2VLNA 3RG6C 1Q7YQ 2KODA 1Q86Q 3MGEA 2K5XA 2OTLP 3EZXA 3CCMP 2OTJP 1VQOP 1VQ4P 2L4BA 3CD6P 2FACA 3DS1A 2X2BA 3HZQA 2AFDA 2K0DX 2KG6A 4GR6A 2XZ1C 4U0BA 2N6YA 2JYGA 2PEKA 2KR5A 3GZMA 5DCKA 2L0QA 2KW2A 2L22A 2EHSA 3GZLA 5F2NA 4M0IA 5HGMA 2ROQA 1BXIA 4XFYA 1X3OA 3CCRP 3IV9A 1VQKP 2KG9A 2QNWA 2FQ2A 2JGPA 4H2XC 4XRQA 2MF4A 3IVAA 4GR2A 5F2OA 1QRJA 3G28A 1HY8A 2MR8A 2CWOA 2LPKA 1UZ3A 5JPAA 2FVFA 2DGYA 4BPHA 2GDWA 2LOLA 4PXHB 3E2DA 2J6YA 2KWLA 5EW5E 2P9XA 1QSAA 3DS0A 2LKIA 3CCVP 3G1IA 2J70A 3DTJA 2K0YA 3DS5A 3G26A 1Z6MA 1D1DA 5HGNA 3G21A 1E6JP 2AF8A 1F80D 2MVUA 3DS2A 2KG8A 3HYBA 3G1GA 4CA3A 2GDYA 1DNYA 5I4TG 1QVFO 5KP6B 2PY8A
chains in the Genus database with same CATH topology
1VQNP 5BS1A 4XFXA 3CCMP 4COPA 2ONTA 1IUQA 2OTJP 3DS4A 1VQOP 4IPYA 1KD1Q 1VQ4P 3CD6P 1M6NA 2PEQA 1N8RQ 3DS1A 2M8NA 4U0DA 2L6EA 3HZQA 3CCEP 2OARA 1M90Q 1A43A 1VQ8P 4WYMA 4GR6A 1A8OA 4U0BA 2JYGA 2PEKA 1UTUA 3I56P 5DCKA 1K8AQ 3G0VA 1KC8Q 2PEIA 2EFJA 2M8LA 2XV6A 3DS3A 5F2NA 2PEMA 4U0AA 4U0FA 4M0IA 5HGMA 3NTEA 1Q82Q 2PEOA 3G4SP 4XFYA 1EOQA 3I55P 1YJWP 2XT1A 3G6EP 3CCRP 1K73Q 4U0CA 2Z46A 3G71P 4U0EA 2LF4A 5BS2A 1VQPP 2XXMA 1VQKP 3VRLC 1Q81Q 2Z44A 5HGOA 1AUMA 4XRQA 1K30A 4COCA 3H20A 2BUOA 3M1MA 1JJ2O 4GR2A 1RO2A 4PH0A 1RNIA 5F2OA 1QRJA 3G28A 1ZMBA 1BAJA 2FMME 4XROA 2CWOA 2QA4P 3Q20A 1YI2P 1YJNP 1M74A 3H0DA 1UZ3A 1VQ6P 5JPAA 4XFZA 2Z45A 3OW2O 2DGYA 2QEXP 3CCJP 3CMAP 2M8PA 3WBHA 1YJ9P 3E2DA 3H47A 2BHVA 1VQ7P 3G29A 1W2BO 3DPHA 3CC4P 1M6EX 2P9XA 1VQ9P 5F2KA 1NJIQ 3DS0A 3CCVP 1S72P 3G1IA 3CCQP 1YITP 4X8QA 3CC7P 1VQLP 3DTJA 2E1MA 4QNBA 2JO0A 3DS5A 1YHQP 3CCLP 3G26A 3CXCO 1D1DA 2PBIA 3LRYA 5HGNA 3L9TA 1RO0A 3G21A 3CMEP 2JYLA 3B5IA 1E6JP 1K9MQ 3CCUP 1YIJP 1QVGO 1M1KQ 5HGLA 3CCSP 1KQSO 2EIAA 2PEJA 2PENA 3DS2A 3HYBA 3CPWO 1VQ5P 3CC2P 3G1GA 4M0MA 3H4EA 5I4TG 2EG5A 4PH1A 1VQMP 3RG6C 3P05A 1Q7YQ 1QVFO 2KODA 1Q86Q 2PY8A 3MGEA 2OTLP 1EIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO0 A;  1RO2 A;  1RNI A;  3H20 A;  3M1M A; 
#chains in the Genus database with same CATH topology
 4PWV B;  4COP A;  2JB0 A;  1ZNV A;  4IPY A;  1IMQ A;  1M6N A;  2N98 A;  2MY5 A;  1N8R Q;  1GPJ A;  2GZE A;  1M90 Q;  1A8O A;  4QKO A;  1UTU A;  1KLP A;  5KP8 B;  2EFJ A;  1K98 A;  1VHN A;  2PEM A;  3EJB A;  4U0F A;  2PEO A;  2J6Z A;  1EOQ A;  2XT1 A;  3G71 P;  2LF4 A;  1Q6B A;  3WHP A;  3VRL C;  1Q81 Q;  2Z44 A;  2KGC A;  2N6Z A;  3BUL A;  3M1M A;  2JU2 A;  1DV5 A;  1RO2 A;  4HH3 C;  3CE7 A;  4R0M A;  2FMM E;  4XRO A;  2XZ0 D;  1YI2 P;  1YJN P;  1SUY A;  1UNK A;  4XFZ A;  2Z45 A;  2MD9 A;  3CCJ P;  2BHV A;  1VQ7 P;  1L0I A;  1W2B O;  2ERH A;  3CC4 P;  1M6E X;  1V2Z A;  1VQ9 P;  5F2K A;  1NJI Q;  3CCQ P;  2JU1 A;  2JBG A;  2FAD A;  1GXH A;  4HEH A;  2FQ1 A;  2JO0 A;  3CCL P;  2PBI A;  3LRY A;  4BPF A;  3L9T A;  3B5I A;  3RG2 A;  3EJD A;  2GZJ A;  2N5I A;  1KQS O;  1R8J A;  2EIA A;  4M0M A;  5HV8 A;  1CEI A;  3H4E A;  2GZF A;  1SV1 A;  2VLP A;  1K7Y A;  3G0V A;  1VQN P;  4XFX A;  1IUQ A;  3LMO A;  3DS4 A;  2GYK A;  4DG9 A;  7CEI A;  1KD1 Q;  1EMV A;  1R5Q A;  2KOO A;  4G86 A;  2L6E A;  3GKL C;  2VLQ A;  3CCE P;  2K2Q A;  4WYM A;  1ACP A;  3I56 P;  2AFE A;  1KC8 Q;  2M8L A;  2AVA A;  3DS3 A;  1AF8 A;  2KOP A;  4U0A A;  1OR5 A;  2JQ4 A;  3G4S P;  5C5E A;  2K93 A;  2N5H A;  4HKG A;  1YJW P;  2M5R A;  2N50 A;  4U0E A;  1HQB A;  1VQP P;  5CZD B;  5HGO A;  1AUM A;  2GDX A;  4COC A;  3H20 A;  2BUO A;  2LTE A;  1JJ2 O;  2FVE A;  4PH0 A;  2LIU A;  2GZG A;  1ZMB A;  1E0H A;  4MRT C;  2MVV A;  3Q20 A;  1M74 A;  2CNR A;  2QEX P;  3CMA P;  3WBH A;  3H47 A;  3DPH A;  3B4Q A;  2FVA A;  2FQ0 A;  2MR7 A;  1VKU A;  1YIT P;  2KGD A;  2EHT A;  1W53 A;  2LIW A;  2E1M A;  1L0H A;  4QNB A;  1YHQ P;  3CXC O;  4H2Y C;  2JYL A;  3BJD A;  1K9M Q;  3CCU P;  5KP7 B;  1YIJ P;  1M1K Q;  5HGL A;  2CQ8 A;  1T8K A;  1Q6A A;  3CPW O;  1VQ5 P;  3CC2 P;  2WPT A;  2EG5 A;  4PH1 A;  1VQM P;  3P05 A;  1QTE A;  2L9F A;  3CCS P;  1EIA A;  5BS1 A;  2KOR A;  2ONT A;  2DNW A;  2I2X B;  2VLO A;  3EJE A;  4F37 A;  2PEQ A;  2VSQ A;  2M8N A;  4U0D A;  1AYI A;  2OAR A;  1A43 A;  1GXG A;  4NEO A;  1VQ8 P;  4H2W C;  2PNG A;  1K8A Q;  2PEI A;  2XV6 A;  1FR2 A;  1UJZ A;  5HVC A;  4JGI A;  2LML A;  2KGE A;  4UHP B;  3NTE A;  1Q82 Q;  3I55 P;  3G6E P;  5C8D A;  1K73 Q;  1MZ8 A;  2Z46 A;  4U0C A;  5BS2 A;  2XXM A;  2KOS A;  4BPG A;  5EJD A;  1K30 A;  3U43 A;  1RNI A;  2CG5 B;  1BAJ A;  2QA4 P;  3GJN A;  2FAE A;  2GZI A;  3H0D A;  1VQ6 P;  3OW2 O;  1IMP A;  2M8P A;  1YJ9 P;  3G29 A;  1SLY A;  2K94 A;  2JAZ A;  1S72 P;  3NY7 B;  4X8Q A;  3CC7 P;  1VQL P;  2KGA A;  1BMT A;  1NQ4 A;  1RO0 A;  3CME P;  2KOQ A;  2K0X A;  2K92 A;  2CGQ A;  4IZ6 A;  2NO8 A;  1QVG O;  2PEJ A;  2PEN A;  2LL8 A;  2FHS C;  2VLN A;  3RG6 C;  1Q7Y Q;  2KOD A;  1Q86 Q;  3MGE A;  2K5X A;  2OTL P;  3EZX A;  3CCM P;  2OTJ P;  1VQO P;  1VQ4 P;  2L4B A;  3CD6 P;  2FAC A;  3DS1 A;  2X2B A;  3HZQ A;  2AFD A;  2K0D X;  2KG6 A;  4GR6 A;  2XZ1 C;  4U0B A;  2N6Y A;  2JYG A;  2PEK A;  2KR5 A;  3GZM A;  5DCK A;  2L0Q A;  2KW2 A;  2L22 A;  2EHS A;  3GZL A;  5F2N A;  4M0I A;  5HGM A;  2ROQ A;  1BXI A;  4XFY A;  1X3O A;  3CCR P;  3IV9 A;  1VQK P;  2KG9 A;  2QNW A;  2FQ2 A;  2JGP A;  4H2X C;  4XRQ A;  2MF4 A;  3IVA A;  4GR2 A;  5F2O A;  1QRJ A;  3G28 A;  1HY8 A;  2MR8 A;  2CWO A;  2LPK A;  1UZ3 A;  5JPA A;  2FVF A;  2DGY A;  4BPH A;  2GDW A;  2LOL A;  4PXH B;  3E2D A;  2J6Y A;  2KWL A;  5EW5 E;  2P9X A;  1QSA A;  3DS0 A;  2LKI A;  3CCV P;  3G1I A;  2J70 A;  3DTJ A;  2K0Y A;  3DS5 A;  3G26 A;  1Z6M A;  1D1D A;  5HGN A;  3G21 A;  1E6J P;  2AF8 A;  1F80 D;  2MVU A;  3DS2 A;  2KG8 A;  3HYB A;  3G1G A;  4CA3 A;  2GDY A;  1DNY A;  5I4T G;  1QVF O;  5KP6 B;  2PY8 A; 
#chains in the Genus database with same CATH homology
 1VQN P;  5BS1 A;  4XFX A;  3CCM P;  4COP A;  2ONT A;  1IUQ A;  2OTJ P;  3DS4 A;  1VQO P;  4IPY A;  1KD1 Q;  1VQ4 P;  3CD6 P;  1M6N A;  2PEQ A;  1N8R Q;  3DS1 A;  2M8N A;  4U0D A;  2L6E A;  3HZQ A;  3CCE P;  2OAR A;  1M90 Q;  1A43 A;  1VQ8 P;  4WYM A;  4GR6 A;  1A8O A;  4U0B A;  2JYG A;  2PEK A;  1UTU A;  3I56 P;  5DCK A;  1K8A Q;  3G0V A;  1KC8 Q;  2PEI A;  2EFJ A;  2M8L A;  2XV6 A;  3DS3 A;  5F2N A;  2PEM A;  4U0A A;  4U0F A;  4M0I A;  5HGM A;  3NTE A;  1Q82 Q;  2PEO A;  3G4S P;  4XFY A;  1EOQ A;  3I55 P;  1YJW P;  2XT1 A;  3G6E P;  3CCR P;  1K73 Q;  4U0C A;  2Z46 A;  3G71 P;  4U0E A;  2LF4 A;  5BS2 A;  1VQP P;  2XXM A;  1VQK P;  3VRL C;  1Q81 Q;  2Z44 A;  5HGO A;  1AUM A;  4XRQ A;  1K30 A;  4COC A;  3H20 A;  2BUO A;  3M1M A;  1JJ2 O;  4GR2 A;  1RO2 A;  4PH0 A;  1RNI A;  5F2O A;  1QRJ A;  3G28 A;  1ZMB A;  1BAJ A;  2FMM E;  4XRO A;  2CWO A;  2QA4 P;  3Q20 A;  1YI2 P;  1YJN P;  1M74 A;  3H0D A;  1UZ3 A;  1VQ6 P;  5JPA A;  4XFZ A;  2Z45 A;  3OW2 O;  2DGY A;  2QEX P;  3CCJ P;  3CMA P;  2M8P A;  3WBH A;  1YJ9 P;  3E2D A;  3H47 A;  2BHV A;  1VQ7 P;  3G29 A;  1W2B O;  3DPH A;  3CC4 P;  1M6E X;  2P9X A;  1VQ9 P;  5F2K A;  1NJI Q;  3DS0 A;  3CCV P;  1S72 P;  3G1I A;  3CCQ P;  1YIT P;  4X8Q A;  3CC7 P;  1VQL P;  3DTJ A;  2E1M A;  4QNB A;  2JO0 A;  3DS5 A;  1YHQ P;  3CCL P;  3G26 A;  3CXC O;  1D1D A;  2PBI A;  3LRY A;  5HGN A;  3L9T A;  1RO0 A;  3G21 A;  3CME P;  2JYL A;  3B5I A;  1E6J P;  1K9M Q;  3CCU P;  1YIJ P;  1QVG O;  1M1K Q;  5HGL A;  3CCS P;  1KQS O;  2EIA A;  2PEJ A;  2PEN A;  3DS2 A;  3HYB A;  3CPW O;  1VQ5 P;  3CC2 P;  3G1G A;  4M0M A;  3H4E A;  5I4T G;  2EG5 A;  4PH1 A;  1VQM P;  3RG6 C;  3P05 A;  1Q7Y Q;  1QVF O;  2KOD A;  1Q86 Q;  2PY8 A;  3MGE A;  2OTL P;  1EIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...