3M1MA

Crystal structure of the primase-polymerase from sulfolobus islandicus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
331
structure length
320
Chain Sequence
SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEGEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVITLSKAWSVVKKYLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF904
publication title The archaeo-eukaryotic primase of plasmid pRN1 requires a helix bundle domain for faithful primer synthesis
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 121
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
A PF13010 pRN1_helical Primase helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3m1mA01
1.10.1240.50 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 3m1mA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 3m1mA02
3M1MA 1RNIA 1RO2A 3H20A 1RO0A
chains in the Genus database with same CATH superfamily
4H2XC 2JBGA 1MZ8A 1OR5A 2K0XA 2GDYA 1VQNP 5CZDB 2DNWA 4CA3A 2FHSC 2EHSA 1ACPA 2XZ0D 1Q7YQ 4F37A 3CCJP 2JGPA 5F2NA 5C5EA 2XT1A 4G86A 4U0DA 4GR6A 3M1MA 1UTUA 3DS2A 2KWLA 3GZMA 3G21A 2WPTA 3I55P 4HEHA 4U0BA 1SLYA 3E2DA 5KP6B 2AVAA 4XFZA 1VQLP 3LRYA 3LMOA 4BPHA 1QVFO 1VQ4P 1UNKA 3DS4A 4M0IA 2MR8A 1F80D 1V2ZA 1KLPA 1YJ9P 2KG9A 3EZXA 2LKIA 2KOSA 5HGLA 2FVEA 2MVVA 2FAEA 3EJDA 2GZEA 2KOOA 4DG9A 2Z44A 2K2QA 2GZGA 1IUQA 2PEKA 1RO2A 2KR5A 3BJDA 2N5IA 1KQSO 2E1MA 1VQ6P 1K30A 3G71P 1ZMBA 2XXMA 3L9TA 2N50A 3DS3A 3CCRP 2VLPA 4XROA 2OARA 2ONTA 5HGNA 2CQ8A 1YITP 4GR2A 4BPGA 2FVFA 2EG5A 2GYKA 4H2WC 2LIWA 2J6ZA 2Z46A 2K94A 1RNIA 1VQ5P 3RG6C 3G28A 2N5HA 1L0HA 3CCQP 3G1IA 1QTEA 2KOPA 1YIJP 3G29A 1Z6MA 2ROQA 1M74A 2FQ0A 2K0DX 2KGEA 5HVCA 1BAJA 2M8NA 5I4TG 2M8PA 4IZ6A 4U0FA 1IMQA 2MR7A 2PEOA 2PEMA 2PEQA 3G6EP 2FACA 4JGIA 3NY7B 4PH0A 5BS2A 4NEOA 4XRQA 2M8LA 2LIUA 2VLNA 5F2OA 2JU1A 1M6NA 3EJBA 3DPHA 1K7YA 4PH1A 3CCVP 1DNYA 1W2BO 3CCUP 2EFJA 3CPWO 3WHPA 2MVUA 3B5IA 5KP7B 4H2YC 2N6ZA 2XV6A 2AF8A 1BMTA 1L0IA 2N98A 2KORA 5BS1A 1YHQP 1QVGO 1K73Q 4IPYA 4QNBA 3IVAA 1IMPA 2JAZA 3U43A 4UHPB 1SUYA 1D1DA 3H20A 1AUMA 1YJNP 4X8QA 1NQ4A 2VLOA 2L4BA 2MY5A 2L0QA 1Q86Q 4COPA 3RG2A 2VLQA 1Q81Q 2I2XB 3CCMP 2PEJA 1HY8A 4COCA 4XFXA 2X2BA 2KG8A 2EHTA 4U0CA 3HZQA 2CNRA 1KD1Q 2J6YA 2KODA 2LF4A 3I56P 3CXCO 1VQ9P 1QRJA 3CC7P 1BXIA 1YI2P 4U0AA 2ERHA 3DS5A 3WBHA 2EIAA 1VQMP 1T8KA 1KC8Q 2JYLA 2KGAA 1VQPP 3CC4P 2L6EA 2FMME 1GXGA 2OTJP 2LL8A 3DS1A 5EJDA 2J70A 3CD6P 5HGMA 2PEIA 3DS0A 3GJNA 1Q82Q 4WYMA 2BUOA 2KOQA 2NO8A 2KW2A 2OTLP 2LOLA 1N8RQ 4HH3C 2PENA 1VQ8P 1Q6AA 2FVAA 2PNGA 3IV9A 1A43A 2KGDA 5C8DA 3H4EA 1AYIA 1VKUA 2PY8A 1GXHA 1Q6BA 1R5QA 2GDWA 2JO0A 1S72P 3G1GA 3G26A 5JPAA 2JYGA 3G4SP 2K5XA 3VRLC 3CMEP 1JJ2O 1E6JP 2FADA 4R0MA 3H0DA 2K93A 4PWVB 2CG5B 1M6EX 2BHVA 1YJWP 1GPJA 3CE7A 2GZIA 3GZLA 3DTJA 2JU2A 1UZ3A 4MRTC 1M90Q 5HGOA 3GKLC 1A8OA 4U0EA 2QA4P 2Z45A 2L9FA 4XFYA 4M0MA 2FQ2A 3P05A 2QEXP 5F2KA 1ZNVA 5HV8A 1EMVA 2LTEA 3OW2O 2FQ1A 1AF8A 4BPFA 1RO0A 1VQOP 3Q20A 3CCSP 2AFEA 2CGQA 2LMLA 3G0VA 1K9MQ 1R8JA 2LPKA 4PXHB 2L22A 1HQBA 1X3OA 3B4QA 3CCLP 4HKGA 5KP8B 1VQ7P 2KG6A 1K98A 2JB0A 3NTEA 2M5RA 3MGEA 1W53A 1VQKP 3CMAP 3CC2P 2GZFA 2XZ1C 1DV5A 2CWOA 2JQ4A 2P9XA 1VHNA 1M1KQ 1EIAA 2GZJA 5EW5E 7CEIA 1CEIA 2N6YA 1K8AQ 2MF4A 5DCKA 1QSAA 4QKOA 2DGYA 2PBIA 3CCEP 2AFDA 2K92A 2GDXA 1E0HA 3BULA 1EOQA 1SV1A 3HYBA 1FR2A 2VSQA 2K0YA 1UJZA 2QNWA 3H47A 3EJEA 1NJIQ 2KGCA 2MD9A
chains in the Genus database with same CATH topology
3RG6C 2KODA 2LF4A 3I56P 3CXCO 1VQ9P 1QRJA 3CC7P 1A8OA 3G28A 4U0EA 2QA4P 2Z45A 3CCQP 1YI2P 4U0AA 3G1IA 1YIJP 3DS5A 4XFYA 3WBHA 3G29A 4M0MA 1VQNP 3P05A 2EIAA 2QEXP 1M74A 1VQMP 5F2KA 1KC8Q 2JYLA 1BAJA 2M8NA 5I4TG 2M8PA 3OW2O 1VQPP 3CC4P 4U0FA 2PEOA 2L6EA 1Q7YQ 2PEMA 2PEQA 2FMME 2OTJP 3CCJP 5F2NA 3G6EP 1RO0A 1VQOP 3Q20A 3DS1A 2XT1A 3CCSP 3CD6P 4PH0A 5BS2A 4U0DA 4XRQA 5HGMA 2PEIA 3G0VA 4GR6A 3M1MA 3DS0A 2M8LA 3DS2A 1K9MQ 1UTUA 5F2OA 1Q82Q 3G21A 1M6NA 3I55P 4WYMA 3CCLP 3DPHA 4U0BA 3E2DA 2BUOA 4PH1A 3CCVP 2OTLP 4XFZA 1VQLP 1VQ7P 1W2BO 1N8RQ 3LRYA 1QVFO 1VQ4P 3CCUP 2PENA 3NTEA 3MGEA 2EFJA 3DS4A 4M0IA 3CPWO 1VQ8P 1VQKP 3B5IA 1YJ9P 1A43A 3CMAP 3CC2P 2XV6A 3H4EA 5HGLA 2CWOA 2PY8A 2P9XA 2Z44A 5BS1A 1IUQA 1YHQP 2PEKA 1QVGO 1K73Q 1RO2A 4IPYA 4QNBA 1M1KQ 2JO0A 1EIAA 1S72P 3G1GA 3G26A 1K8AQ 1KQSO 2E1MA 1VQ6P 5DCKA 1K30A 3G71P 2DGYA 5JPAA 2PBIA 2JYGA 3G4SP 3CCEP 1ZMBA 2XXMA 3L9TA 3DS3A 3VRLC 3CMEP 1D1DA 3H20A 1AUMA 3CCRP 1YJNP 1JJ2O 4X8QA 4XROA 1E6JP 2OARA 1Q86Q 4COPA 3H0DA 2ONTA 5HGNA 1YITP 1EOQA 1Q81Q 1M6EX 2BHVA 3HYBA 3CCMP 1YJWP 2PEJA 4GR2A 4COCA 4XFXA 2EG5A 2Z46A 3DTJA 1RNIA 3H47A 1UZ3A 1NJIQ 1VQ5P 4U0CA 3HZQA 1M90Q 5HGOA 1KD1Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RNI A;  1RO2 A;  3H20 A;  1RO0 A; 
#chains in the Genus database with same CATH topology
 4H2X C;  2JBG A;  1MZ8 A;  1OR5 A;  2K0X A;  2GDY A;  1VQN P;  5CZD B;  2DNW A;  4CA3 A;  2FHS C;  2EHS A;  1ACP A;  2XZ0 D;  1Q7Y Q;  4F37 A;  3CCJ P;  2JGP A;  5F2N A;  5C5E A;  2XT1 A;  4G86 A;  4U0D A;  4GR6 A;  3M1M A;  1UTU A;  3DS2 A;  2KWL A;  3GZM A;  3G21 A;  2WPT A;  3I55 P;  4HEH A;  4U0B A;  1SLY A;  3E2D A;  5KP6 B;  2AVA A;  4XFZ A;  1VQL P;  3LRY A;  3LMO A;  4BPH A;  1QVF O;  1VQ4 P;  1UNK A;  3DS4 A;  4M0I A;  2MR8 A;  1F80 D;  1V2Z A;  1KLP A;  1YJ9 P;  2KG9 A;  3EZX A;  2LKI A;  2KOS A;  5HGL A;  2FVE A;  2MVV A;  2FAE A;  3EJD A;  2GZE A;  2KOO A;  4DG9 A;  2Z44 A;  2K2Q A;  2GZG A;  1IUQ A;  2PEK A;  1RO2 A;  2KR5 A;  3BJD A;  2N5I A;  1KQS O;  2E1M A;  1VQ6 P;  1K30 A;  3G71 P;  1ZMB A;  2XXM A;  3L9T A;  2N50 A;  3DS3 A;  3CCR P;  2VLP A;  4XRO A;  2OAR A;  2ONT A;  5HGN A;  2CQ8 A;  1YIT P;  4GR2 A;  4BPG A;  2FVF A;  2EG5 A;  2GYK A;  4H2W C;  2LIW A;  2J6Z A;  2Z46 A;  2K94 A;  1RNI A;  1VQ5 P;  3RG6 C;  3G28 A;  2N5H A;  1L0H A;  3CCQ P;  3G1I A;  1QTE A;  2KOP A;  1YIJ P;  3G29 A;  1Z6M A;  2ROQ A;  1M74 A;  2FQ0 A;  2K0D X;  2KGE A;  5HVC A;  1BAJ A;  2M8N A;  5I4T G;  2M8P A;  4IZ6 A;  4U0F A;  1IMQ A;  2MR7 A;  2PEO A;  2PEM A;  2PEQ A;  3G6E P;  2FAC A;  4JGI A;  3NY7 B;  4PH0 A;  5BS2 A;  4NEO A;  4XRQ A;  2M8L A;  2LIU A;  2VLN A;  5F2O A;  2JU1 A;  1M6N A;  3EJB A;  3DPH A;  1K7Y A;  4PH1 A;  3CCV P;  1DNY A;  1W2B O;  3CCU P;  2EFJ A;  3CPW O;  3WHP A;  2MVU A;  3B5I A;  5KP7 B;  4H2Y C;  2N6Z A;  2XV6 A;  2AF8 A;  1BMT A;  1L0I A;  2N98 A;  2KOR A;  5BS1 A;  1YHQ P;  1QVG O;  1K73 Q;  4IPY A;  4QNB A;  3IVA A;  1IMP A;  2JAZ A;  3U43 A;  4UHP B;  1SUY A;  1D1D A;  3H20 A;  1AUM A;  1YJN P;  4X8Q A;  1NQ4 A;  2VLO A;  2L4B A;  2MY5 A;  2L0Q A;  1Q86 Q;  4COP A;  3RG2 A;  2VLQ A;  1Q81 Q;  2I2X B;  3CCM P;  2PEJ A;  1HY8 A;  4COC A;  4XFX A;  2X2B A;  2KG8 A;  2EHT A;  4U0C A;  3HZQ A;  2CNR A;  1KD1 Q;  2J6Y A;  2KOD A;  2LF4 A;  3I56 P;  3CXC O;  1VQ9 P;  1QRJ A;  3CC7 P;  1BXI A;  1YI2 P;  4U0A A;  2ERH A;  3DS5 A;  3WBH A;  2EIA A;  1VQM P;  1T8K A;  1KC8 Q;  2JYL A;  2KGA A;  1VQP P;  3CC4 P;  2L6E A;  2FMM E;  1GXG A;  2OTJ P;  2LL8 A;  3DS1 A;  5EJD A;  2J70 A;  3CD6 P;  5HGM A;  2PEI A;  3DS0 A;  3GJN A;  1Q82 Q;  4WYM A;  2BUO A;  2KOQ A;  2NO8 A;  2KW2 A;  2OTL P;  2LOL A;  1N8R Q;  4HH3 C;  2PEN A;  1VQ8 P;  1Q6A A;  2FVA A;  2PNG A;  3IV9 A;  1A43 A;  2KGD A;  5C8D A;  3H4E A;  1AYI A;  1VKU A;  2PY8 A;  1GXH A;  1Q6B A;  1R5Q A;  2GDW A;  2JO0 A;  1S72 P;  3G1G A;  3G26 A;  5JPA A;  2JYG A;  3G4S P;  2K5X A;  3VRL C;  3CME P;  1JJ2 O;  1E6J P;  2FAD A;  4R0M A;  3H0D A;  2K93 A;  4PWV B;  2CG5 B;  1M6E X;  2BHV A;  1YJW P;  1GPJ A;  3CE7 A;  2GZI A;  3GZL A;  3DTJ A;  2JU2 A;  1UZ3 A;  4MRT C;  1M90 Q;  5HGO A;  3GKL C;  1A8O A;  4U0E A;  2QA4 P;  2Z45 A;  2L9F A;  4XFY A;  4M0M A;  2FQ2 A;  3P05 A;  2QEX P;  5F2K A;  1ZNV A;  5HV8 A;  1EMV A;  2LTE A;  3OW2 O;  2FQ1 A;  1AF8 A;  4BPF A;  1RO0 A;  1VQO P;  3Q20 A;  3CCS P;  2AFE A;  2CGQ A;  2LML A;  3G0V A;  1K9M Q;  1R8J A;  2LPK A;  4PXH B;  2L22 A;  1HQB A;  1X3O A;  3B4Q A;  3CCL P;  4HKG A;  5KP8 B;  1VQ7 P;  2KG6 A;  1K98 A;  2JB0 A;  3NTE A;  2M5R A;  3MGE A;  1W53 A;  1VQK P;  3CMA P;  3CC2 P;  2GZF A;  2XZ1 C;  1DV5 A;  2CWO A;  2JQ4 A;  2P9X A;  1VHN A;  1M1K Q;  1EIA A;  2GZJ A;  5EW5 E;  7CEI A;  1CEI A;  2N6Y A;  1K8A Q;  2MF4 A;  5DCK A;  1QSA A;  4QKO A;  2DGY A;  2PBI A;  3CCE P;  2AFD A;  2K92 A;  2GDX A;  1E0H A;  3BUL A;  1EOQ A;  1SV1 A;  3HYB A;  1FR2 A;  2VSQ A;  2K0Y A;  1UJZ A;  2QNW A;  3H47 A;  3EJE A;  1NJI Q;  2KGC A;  2MD9 A; 
#chains in the Genus database with same CATH homology
 3RG6 C;  2KOD A;  2LF4 A;  3I56 P;  3CXC O;  1VQ9 P;  1QRJ A;  3CC7 P;  1A8O A;  3G28 A;  4U0E A;  2QA4 P;  2Z45 A;  3CCQ P;  1YI2 P;  4U0A A;  3G1I A;  1YIJ P;  3DS5 A;  4XFY A;  3WBH A;  3G29 A;  4M0M A;  1VQN P;  3P05 A;  2EIA A;  2QEX P;  1M74 A;  1VQM P;  5F2K A;  1KC8 Q;  2JYL A;  1BAJ A;  2M8N A;  5I4T G;  2M8P A;  3OW2 O;  1VQP P;  3CC4 P;  4U0F A;  2PEO A;  2L6E A;  1Q7Y Q;  2PEM A;  2PEQ A;  2FMM E;  2OTJ P;  3CCJ P;  5F2N A;  3G6E P;  1RO0 A;  1VQO P;  3Q20 A;  3DS1 A;  2XT1 A;  3CCS P;  3CD6 P;  4PH0 A;  5BS2 A;  4U0D A;  4XRQ A;  5HGM A;  2PEI A;  3G0V A;  4GR6 A;  3M1M A;  3DS0 A;  2M8L A;  3DS2 A;  1K9M Q;  1UTU A;  5F2O A;  1Q82 Q;  3G21 A;  1M6N A;  3I55 P;  4WYM A;  3CCL P;  3DPH A;  4U0B A;  3E2D A;  2BUO A;  4PH1 A;  3CCV P;  2OTL P;  4XFZ A;  1VQL P;  1VQ7 P;  1W2B O;  1N8R Q;  3LRY A;  1QVF O;  1VQ4 P;  3CCU P;  2PEN A;  3NTE A;  3MGE A;  2EFJ A;  3DS4 A;  4M0I A;  3CPW O;  1VQ8 P;  1VQK P;  3B5I A;  1YJ9 P;  1A43 A;  3CMA P;  3CC2 P;  2XV6 A;  3H4E A;  5HGL A;  2CWO A;  2PY8 A;  2P9X A;  2Z44 A;  5BS1 A;  1IUQ A;  1YHQ P;  2PEK A;  1QVG O;  1K73 Q;  1RO2 A;  4IPY A;  4QNB A;  1M1K Q;  2JO0 A;  1EIA A;  1S72 P;  3G1G A;  3G26 A;  1K8A Q;  1KQS O;  2E1M A;  1VQ6 P;  5DCK A;  1K30 A;  3G71 P;  2DGY A;  5JPA A;  2PBI A;  2JYG A;  3G4S P;  3CCE P;  1ZMB A;  2XXM A;  3L9T A;  3DS3 A;  3VRL C;  3CME P;  1D1D A;  3H20 A;  1AUM A;  3CCR P;  1YJN P;  1JJ2 O;  4X8Q A;  4XRO A;  1E6J P;  2OAR A;  1Q86 Q;  4COP A;  3H0D A;  2ONT A;  5HGN A;  1YIT P;  1EOQ A;  1Q81 Q;  1M6E X;  2BHV A;  3HYB A;  3CCM P;  1YJW P;  2PEJ A;  4GR2 A;  4COC A;  4XFX A;  2EG5 A;  2Z46 A;  3DTJ A;  1RNI A;  3H47 A;  1UZ3 A;  1NJI Q;  1VQ5 P;  4U0C A;  3HZQ A;  1M90 Q;  5HGO A;  1KD1 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...