3M1MA

Crystal structure of the primase-polymerase from sulfolobus islandicus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
331
structure length
320
Chain Sequence
SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEGEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVITLSKAWSVVKKYLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The archaeo-eukaryotic primase of plasmid pRN1 requires a helix bundle domain for faithful primer synthesis
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
molecule keywords ORF904
total genus 121
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
A PF13010 pRN1_helical Primase helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3m1mA01
1.10.1240.50 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 3m1mA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 3m1mA02
3M1MA 1RO2A 3H20A 1RO0A 1RNIA
chains in the Genus database with same CATH superfamily
2FMME 1UJZA 3NTEA 2N6ZA 4M0IA 1VQLP 2Z46A 4COCA 1Q6AA 1YHQP 4IZ6A 2GZFA 2PEIA 1JJ2O 2EHSA 4PWVB 4GR2A 3CCUP 5CZDB 2JB0A 3WHPA 3CCSP 3CCEP 2PBIA 1IMQA 4NEOA 1K7YA 3RG2A 2EHTA 2KORA 2VLNA 3CCRP 2GDXA 4IPYA 5HV8A 4XFZA 1Z6MA 4XROA 3CCJP 3G6EP 1YIJP 4R0MA 1X3OA 2VSQA 2CQ8A 3B5IA 1K98A 2J6YA 2EG5A 3CMEP 1A43A 4U0BA 4WYMA 3I55P 2K0DX 1RO2A 5C5EA 4HH3C 1Q81Q 1QTEA 2LL8A 2OTJP 2XXMA 2N6YA 3E2DA 3CCQP 2K93A 2GDWA 2GZJA 2EFJA 2VLPA 2MY5A 3IV9A 2FACA 4DG9A 1DV5A 1Q7YQ 4U0EA 3WBHA 4BPGA 4PXHB 3L9TA 1W53A 3GZMA 2AF8A 3G26A 1UZ3A 1K8AQ 1F80D 2KG8A 4U0DA 2FADA 2LTEA 2GZEA 1CEIA 3CE7A 2VLQA 1VQNP 2MR8A 4XFYA 2L6EA 1ZMBA 2MD9A 3GJNA 3DS0A 1BXIA 5I4TG 2KODA 2JAZA 2M8PA 2M5RA 2LIUA 2K2QA 2L0QA 1IMPA 2KOSA 1KLPA 2AFEA 5BS1A 2KW2A 2KGCA 3GKLC 2PENA 5DCKA 2DGYA 2ONTA 2PEOA 5HGOA 1NJIQ 1R8JA 7CEIA 3H20A 3MGEA 1MZ8A 2FQ2A 4HKGA 1L0HA 2KGAA 2Z45A 1KC8Q 4QKOA 2MVVA 1VQKP 3BULA 2XT1A 1QSAA 5HGNA 1S72P 3CCMP 3G28A 4XFXA 1EOQA 2XV6A 4U0FA 3EJDA 5F2NA 1FR2A 1EMVA 5KP7B 2FAEA 3LRYA 3CC2P 2LIWA 2MVUA 1M6NA 2M8LA 5BS2A 4H2YC 1VQ8P 1BMTA 3GZLA 3IVAA 4X8QA 1T8KA 4BPHA 1GXHA 5EJDA 2N5IA 2K0XA 4MRTC 1ACPA 2AVAA 2DNWA 2JYLA 3H47A 2NO8A 5JPAA 1VQOP 4HEHA 2PNGA 1YI2P 1YJNP 3EZXA 4H2WC 2PEJA 2J70A 2L9FA 4QNBA 2QA4P 3H0DA 1QVFO 2LPKA 3EJBA 3M1MA 1EIAA 5HGLA 3LMOA 3DPHA 3G21A 2K94A 1R5QA 2E1MA 2KGDA 2MR7A 2L4BA 2GYKA 3G1GA 1AF8A 2OARA 2FVAA 1A8OA 2GZGA 3G1IA 1SLYA 2KG9A 4XRQA 3CXCO 3EJEA 1RNIA 5HVCA 1UTUA 1VQMP 3CCVP 3BJDA 4CA3A 2KOPA 1VQ9P 3DS5A 1VQ6P 3P05A 2X2BA 1KD1Q 3G29A 2N5HA 1K73Q 1YJ9P 3OW2O 1QVGO 3NY7B 3B4QA 1E6JP 3VRLC 2AFDA 2FHSC 1BAJA 1IUQA 2ROQA 3DTJA 1Q6BA 2N50A 1V2ZA 5KP6B 1GPJA 4U0AA 2PEMA 3DS2A 3HYBA 1K9MQ 2PEQA 2J6ZA 2LOLA 3Q20A 2KOOA 1UNKA 2N98A 2K0YA 4GR6A 2Z44A 2JU2A 2LKIA 3CPWO 1HY8A 2KG6A 2BHVA 3DS4A 2EIAA 2I2XB 5KP8B 1SUYA 2CGQA 1Q86Q 3G0VA 1VHNA 1M1KQ 1GXGA 1RO0A 3G4SP 2JU1A 3CC4P 2JBGA 2PY8A 1M74A 1M6EX 2P9XA 3U43A 2CNRA 2OTLP 4M0MA 2CWOA 2GDYA 4UHPB 3CMAP 2K92A 1E0HA 1VQPP 3CD6P 2JYGA 2JGPA 2VLOA 1KQSO 3CCLP 2QEXP 3G71P 1YITP 3DS3A 2XZ0D 5HGMA 2GZIA 4U0CA 2KR5A 2KWLA 1M90Q 4G86A 2BUOA 1AYIA 1K30A 2CG5B 3H4EA 1VQ5P 2JQ4A 1YJWP 2PEKA 2FQ0A 1VQ4P 1SV1A 2JO0A 5EW5E 2K5XA 2MF4A 5F2KA 1AUMA 1OR5A 1D1DA 1N8RQ 1Q82Q 2FQ1A 3RG6C 2FVEA 1VQ7P 2XZ1C 2FVFA 2KGEA 4BPFA 1NQ4A 2LF4A 2QNWA 2M8NA 2WPTA 4COPA 2KOQA 2L22A 5C8DA 1QRJA 3HZQA 1HQBA 4JGIA 2LMLA 2ERHA 4PH1A 1L0IA 4F37A 1W2BO 3DS1A 3I56P 1ZNVA 1VKUA 4H2XC 5F2OA 3CC7P 1DNYA 4PH0A
chains in the Genus database with same CATH topology
2FMME 4QNBA 2QA4P 1M1KQ 3H0DA 1QVFO 3NTEA 1RO0A 4M0IA 3G4SP 1VQLP 3CC4P 2Z46A 2PY8A 3M1MA 1EIAA 4COCA 5HGLA 1YHQP 1M74A 2PEIA 1JJ2O 5BS1A 1M6EX 3DPHA 2P9XA 4GR2A 3G21A 3CCUP 2OTLP 4M0MA 2CWOA 3CMAP 2PENA 2E1MA 5DCKA 3CCSP 3G1GA 3CCEP 1VQPP 3CD6P 2OARA 2JYGA 2PBIA 2DGYA 2ONTA 2PEOA 5HGOA 1KQSO 3CCLP 1A8OA 2QEXP 1NJIQ 3G1IA 4XRQA 1UTUA 3CXCO 3G71P 1RNIA 3MGEA 3CCRP 1YITP 3H20A 1VQMP 3DS3A 3CCVP 4IPYA 4XFZA 5HGMA 4U0CA 4XROA 3CCJP 1VQ9P 1M90Q 3DS5A 1VQ6P 2Z45A 3G6EP 1YIJP 1KC8Q 2BUOA 1VQKP 2XT1A 3B5IA 3P05A 5HGNA 1S72P 1K30A 3H4EA 3CCMP 3G28A 1VQ5P 4XFXA 3G29A 1KD1Q 1EOQA 1YJWP 2PEKA 2XV6A 1K73Q 2EG5A 3CMEP 1A43A 4PH0A 4U0FA 3OW2O 1YJ9P 1QVGO 4U0BA 1E6JP 4WYMA 3VRLC 3I55P 1RO2A 5F2NA 1BAJA 1VQ4P 2JO0A 1IUQA 1Q81Q 5F2KA 3DTJA 3LRYA 1AUMA 2OTJP 3CC2P 1D1DA 1M6NA 1Q82Q 1N8RQ 3RG6C 2XXMA 2M8LA 5BS2A 3E2DA 4U0AA 1VQ7P 3CCQP 2PEMA 2LF4A 2EFJA 1VQ8P 3HYBA 2M8NA 3DS2A 4COPA 1K9MQ 2PEQA 1Q7YQ 4U0EA 4X8QA 3Q20A 3WBHA 4GR6A 3L9TA 1QRJA 2Z44A 3HZQA 3G26A 1UZ3A 1K8AQ 4PH1A 4U0DA 1W2BO 2JYLA 3DS1A 3H47A 3CPWO 3I56P 1Q86Q 5JPAA 1VQOP 2BHVA 3DS4A 2EIAA 1VQNP 4XFYA 2L6EA 1ZMBA 1YI2P 3DS0A 1YJNP 5I4TG 2KODA 5F2OA 3CC7P 2M8PA 2PEJA 3G0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RO2 A;  3H20 A;  1RO0 A;  1RNI A; 
#chains in the Genus database with same CATH topology
 2FMM E;  1UJZ A;  3NTE A;  2N6Z A;  4M0I A;  1VQL P;  2Z46 A;  4COC A;  1Q6A A;  1YHQ P;  4IZ6 A;  2GZF A;  2PEI A;  1JJ2 O;  2EHS A;  4PWV B;  4GR2 A;  3CCU P;  5CZD B;  2JB0 A;  3WHP A;  3CCS P;  3CCE P;  2PBI A;  1IMQ A;  4NEO A;  1K7Y A;  3RG2 A;  2EHT A;  2KOR A;  2VLN A;  3CCR P;  2GDX A;  4IPY A;  5HV8 A;  4XFZ A;  1Z6M A;  4XRO A;  3CCJ P;  3G6E P;  1YIJ P;  4R0M A;  1X3O A;  2VSQ A;  2CQ8 A;  3B5I A;  1K98 A;  2J6Y A;  2EG5 A;  3CME P;  1A43 A;  4U0B A;  4WYM A;  3I55 P;  2K0D X;  1RO2 A;  5C5E A;  4HH3 C;  1Q81 Q;  1QTE A;  2LL8 A;  2OTJ P;  2XXM A;  2N6Y A;  3E2D A;  3CCQ P;  2K93 A;  2GDW A;  2GZJ A;  2EFJ A;  2VLP A;  2MY5 A;  3IV9 A;  2FAC A;  4DG9 A;  1DV5 A;  1Q7Y Q;  4U0E A;  3WBH A;  4BPG A;  4PXH B;  3L9T A;  1W53 A;  3GZM A;  2AF8 A;  3G26 A;  1UZ3 A;  1K8A Q;  1F80 D;  2KG8 A;  4U0D A;  2FAD A;  2LTE A;  2GZE A;  1CEI A;  3CE7 A;  2VLQ A;  1VQN P;  2MR8 A;  4XFY A;  2L6E A;  1ZMB A;  2MD9 A;  3GJN A;  3DS0 A;  1BXI A;  5I4T G;  2KOD A;  2JAZ A;  2M8P A;  2M5R A;  2LIU A;  2K2Q A;  2L0Q A;  1IMP A;  2KOS A;  1KLP A;  2AFE A;  5BS1 A;  2KW2 A;  2KGC A;  3GKL C;  2PEN A;  5DCK A;  2DGY A;  2ONT A;  2PEO A;  5HGO A;  1NJI Q;  1R8J A;  7CEI A;  3H20 A;  3MGE A;  1MZ8 A;  2FQ2 A;  4HKG A;  1L0H A;  2KGA A;  2Z45 A;  1KC8 Q;  4QKO A;  2MVV A;  1VQK P;  3BUL A;  2XT1 A;  1QSA A;  5HGN A;  1S72 P;  3CCM P;  3G28 A;  4XFX A;  1EOQ A;  2XV6 A;  4U0F A;  3EJD A;  5F2N A;  1FR2 A;  1EMV A;  5KP7 B;  2FAE A;  3LRY A;  3CC2 P;  2LIW A;  2MVU A;  1M6N A;  2M8L A;  5BS2 A;  4H2Y C;  1VQ8 P;  1BMT A;  3GZL A;  3IVA A;  4X8Q A;  1T8K A;  4BPH A;  1GXH A;  5EJD A;  2N5I A;  2K0X A;  4MRT C;  1ACP A;  2AVA A;  2DNW A;  2JYL A;  3H47 A;  2NO8 A;  5JPA A;  1VQO P;  4HEH A;  2PNG A;  1YI2 P;  1YJN P;  3EZX A;  4H2W C;  2PEJ A;  2J70 A;  2L9F A;  4QNB A;  2QA4 P;  3H0D A;  1QVF O;  2LPK A;  3EJB A;  3M1M A;  1EIA A;  5HGL A;  3LMO A;  3DPH A;  3G21 A;  2K94 A;  1R5Q A;  2E1M A;  2KGD A;  2MR7 A;  2L4B A;  2GYK A;  3G1G A;  1AF8 A;  2OAR A;  2FVA A;  1A8O A;  2GZG A;  3G1I A;  1SLY A;  2KG9 A;  4XRQ A;  3CXC O;  3EJE A;  1RNI A;  5HVC A;  1UTU A;  1VQM P;  3CCV P;  3BJD A;  4CA3 A;  2KOP A;  1VQ9 P;  3DS5 A;  1VQ6 P;  3P05 A;  2X2B A;  1KD1 Q;  3G29 A;  2N5H A;  1K73 Q;  1YJ9 P;  3OW2 O;  1QVG O;  3NY7 B;  3B4Q A;  1E6J P;  3VRL C;  2AFD A;  2FHS C;  1BAJ A;  1IUQ A;  2ROQ A;  3DTJ A;  1Q6B A;  2N50 A;  1V2Z A;  5KP6 B;  1GPJ A;  4U0A A;  2PEM A;  3DS2 A;  3HYB A;  1K9M Q;  2PEQ A;  2J6Z A;  2LOL A;  3Q20 A;  2KOO A;  1UNK A;  2N98 A;  2K0Y A;  4GR6 A;  2Z44 A;  2JU2 A;  2LKI A;  3CPW O;  1HY8 A;  2KG6 A;  2BHV A;  3DS4 A;  2EIA A;  2I2X B;  5KP8 B;  1SUY A;  2CGQ A;  1Q86 Q;  3G0V A;  1VHN A;  1M1K Q;  1GXG A;  1RO0 A;  3G4S P;  2JU1 A;  3CC4 P;  2JBG A;  2PY8 A;  1M74 A;  1M6E X;  2P9X A;  3U43 A;  2CNR A;  2OTL P;  4M0M A;  2CWO A;  2GDY A;  4UHP B;  3CMA P;  2K92 A;  1E0H A;  1VQP P;  3CD6 P;  2JYG A;  2JGP A;  2VLO A;  1KQS O;  3CCL P;  2QEX P;  3G71 P;  1YIT P;  3DS3 A;  2XZ0 D;  5HGM A;  2GZI A;  4U0C A;  2KR5 A;  2KWL A;  1M90 Q;  4G86 A;  2BUO A;  1AYI A;  1K30 A;  2CG5 B;  3H4E A;  1VQ5 P;  2JQ4 A;  1YJW P;  2PEK A;  2FQ0 A;  1VQ4 P;  1SV1 A;  2JO0 A;  5EW5 E;  2K5X A;  2MF4 A;  5F2K A;  1AUM A;  1OR5 A;  1D1D A;  1N8R Q;  1Q82 Q;  2FQ1 A;  3RG6 C;  2FVE A;  1VQ7 P;  2XZ1 C;  2FVF A;  2KGE A;  4BPF A;  1NQ4 A;  2LF4 A;  2QNW A;  2M8N A;  2WPT A;  4COP A;  2KOQ A;  2L22 A;  5C8D A;  1QRJ A;  3HZQ A;  1HQB A;  4JGI A;  2LML A;  2ERH A;  4PH1 A;  1L0I A;  4F37 A;  1W2B O;  3DS1 A;  3I56 P;  1ZNV A;  1VKU A;  4H2X C;  5F2O A;  3CC7 P;  1DNY A;  4PH0 A; 
#chains in the Genus database with same CATH homology
 2FMM E;  4QNB A;  2QA4 P;  1M1K Q;  3H0D A;  1QVF O;  3NTE A;  1RO0 A;  4M0I A;  3G4S P;  1VQL P;  3CC4 P;  2Z46 A;  2PY8 A;  3M1M A;  1EIA A;  4COC A;  5HGL A;  1YHQ P;  1M74 A;  2PEI A;  1JJ2 O;  5BS1 A;  1M6E X;  3DPH A;  2P9X A;  4GR2 A;  3G21 A;  3CCU P;  2OTL P;  4M0M A;  2CWO A;  3CMA P;  2PEN A;  2E1M A;  5DCK A;  3CCS P;  3G1G A;  3CCE P;  1VQP P;  3CD6 P;  2OAR A;  2JYG A;  2PBI A;  2DGY A;  2ONT A;  2PEO A;  5HGO A;  1KQS O;  3CCL P;  1A8O A;  2QEX P;  1NJI Q;  3G1I A;  4XRQ A;  1UTU A;  3CXC O;  3G71 P;  1RNI A;  3MGE A;  3CCR P;  1YIT P;  3H20 A;  1VQM P;  3DS3 A;  3CCV P;  4IPY A;  4XFZ A;  5HGM A;  4U0C A;  4XRO A;  3CCJ P;  1VQ9 P;  1M90 Q;  3DS5 A;  1VQ6 P;  2Z45 A;  3G6E P;  1YIJ P;  1KC8 Q;  2BUO A;  1VQK P;  2XT1 A;  3B5I A;  3P05 A;  5HGN A;  1S72 P;  1K30 A;  3H4E A;  3CCM P;  3G28 A;  1VQ5 P;  4XFX A;  3G29 A;  1KD1 Q;  1EOQ A;  1YJW P;  2PEK A;  2XV6 A;  1K73 Q;  2EG5 A;  3CME P;  1A43 A;  4PH0 A;  4U0F A;  3OW2 O;  1YJ9 P;  1QVG O;  4U0B A;  1E6J P;  4WYM A;  3VRL C;  3I55 P;  1RO2 A;  5F2N A;  1BAJ A;  1VQ4 P;  2JO0 A;  1IUQ A;  1Q81 Q;  5F2K A;  3DTJ A;  3LRY A;  1AUM A;  2OTJ P;  3CC2 P;  1D1D A;  1M6N A;  1Q82 Q;  1N8R Q;  3RG6 C;  2XXM A;  2M8L A;  5BS2 A;  3E2D A;  4U0A A;  1VQ7 P;  3CCQ P;  2PEM A;  2LF4 A;  2EFJ A;  1VQ8 P;  3HYB A;  2M8N A;  3DS2 A;  4COP A;  1K9M Q;  2PEQ A;  1Q7Y Q;  4U0E A;  4X8Q A;  3Q20 A;  3WBH A;  4GR6 A;  3L9T A;  1QRJ A;  2Z44 A;  3HZQ A;  3G26 A;  1UZ3 A;  1K8A Q;  4PH1 A;  4U0D A;  1W2B O;  2JYL A;  3DS1 A;  3H47 A;  3CPW O;  3I56 P;  1Q86 Q;  5JPA A;  1VQO P;  2BHV A;  3DS4 A;  2EIA A;  1VQN P;  4XFY A;  2L6E A;  1ZMB A;  1YI2 P;  3DS0 A;  1YJN P;  5I4T G;  2KOD A;  5F2O A;  3CC7 P;  2M8P A;  2PEJ A;  3G0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...