3M1MA

Crystal structure of the primase-polymerase from sulfolobus islandicus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
331
structure length
320
Chain Sequence
b'SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEGEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVITLSKAWSVVKKYLEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF904
publication title The archaeo-eukaryotic primase of plasmid pRN1 requires a helix bundle domain for faithful primer synthesis
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 121
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
A PF13010 pRN1_helical Primase helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3m1mA01
1.10.1240.50 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 3m1mA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 3m1mA02
1RO2A 1RO0A 3M1MA 3H20A 1RNIA
chains in the Genus database with same CATH superfamily
1Z6MA 3IVAA 2EIAA 2XT1A 3DS5A 5HVCA 1M6EX 1VQ9P 2PEIA 2KODA 2PEQA 4XROA 3DS1A 4U0EA 2JYGA 5I4TG 1Q7YQ 3BJDA 3NY7B 2L4BA 1QSAA 1NQ4A 2PBIA 1UNKA 5HGNA 1VQNP 4BPFA 5BS1A 2LL8A 1ZNVA 4NEOA 2OTJP 5BS2A 5HV8A 2PEMA 3CMAP 3G1GA 2CNRA 1X3OA 2LPKA 3G29A 4PWVB 1SV1A 2QA4P 4G86A 3CE7A 2KW2A 3WBHA 3CC7P 5EW5E 2QNWA 1W2BO 4X8QA 3B5IA 5KP7B 1RO0A 2VLOA 2PEKA 3G26A 2J6ZA 2XXMA 3H4EA 2KGAA 1K9MQ 3L9TA 2KOOA 1KC8Q 4U0DA 1QRJA 2KWLA 4XFYA 1VQ5P 1K98A 2N50A 2KG8A 3GZMA 1UTUA 3VRLC 2KG9A 2OTLP 1E0HA 1A8OA 1W53A 3IV9A 3DS4A 2FVFA 1FR2A 2LMLA 2MVUA 2QEXP 1YJWP 2VLQA 1UJZA 1K73Q 3G28A 1VHNA 4M0IA 3G71P 3E2DA 3CC2P 2PEOA 2PNGA 3CCVP 2DGYA 1AYIA 3P05A 3WHPA 2EFJA 2N98A 2VLNA 1L0HA 3HYBA 2J70A 3CPWO 2DNWA 3CCSP 1VQ8P 2FVAA 1IMQA 2EHSA 2L9FA 3GZLA 5C8DA 2FQ2A 1D1DA 2JGPA 3I56P 2ROQA 3GKLC 3DPHA 1QVGO 2KGEA 4HKGA 3G21A 4U0BA 2K94A 2LF4A 2AVAA 1DNYA 4U0CA 1V2ZA 2AFDA 2FAEA 2CWOA 1YIJP 2E1MA 2AF8A 2PEJA 5HGLA 3DTJA 2FACA 1IMPA 2K0XA 2N5HA 2XZ0D 4WYMA 1ACPA 2GDYA 1CEIA 1Q82Q 5HGMA 4XFXA 1NJIQ 1SLYA 4IPYA 2JQ4A 2M5RA 3CCMP 5CZDB 4F37A 3EJDA 4COPA 2XZ1C 2FMME 3GJNA 3NTEA 1ZMBA 1AUMA 1KQSO 3RG2A 1YJ9P 2WPTA 3OW2O 2GZJA 2M8NA 4XFZA 1KD1Q 4IZ6A 5F2NA 2M8LA 3LMOA 1K7YA 3CD6P 1UZ3A 2K93A 2X2BA 2MR7A 1L0IA 1HY8A 2KG6A 1YJNP 1F80D 2GDXA 1VKUA 2CQ8A 3RG6C 3LRYA 1T8KA 2K2QA 2GZIA 3Q20A 2P9XA 1RO2A 1DV5A 3H20A 2ERHA 2KGCA 3CXCO 1QVFO 2K0DX 1KLPA 1YITP 1AF8A 2Z44A 1VQLP 1RNIA 3G4SP 1Q81Q 3DS2A 1VQOP 2NO8A 2VLPA 3DS0A 1M6NA 2KR5A 3DS3A 4U0AA 2GZEA 3HZQA 1VQMP 3CMEP 3G1IA 4BPGA 1M90Q 4PXHB 2GZGA 4XRQA 2AFEA 2L0QA 2BHVA 1N8RQ 2N6YA 2Z46A 4JGIA 2JB0A 3MGEA 2JU1A 1BAJA 2MR8A 1OR5A 2OARA 2Z45A 2PENA 4PH0A 1K30A 4DG9A 5F2KA 2JU2A 2LOLA 4CA3A 2L22A 2JO0A 1IUQA 2KOQA 2VSQA 2LIWA 4HH3C 2PY8A 1R5QA 4BPHA 2FADA 2J6YA 1MZ8A 1VQ4P 5C5EA 3H47A 4H2WC 3CCRP 1YI2P 2MVVA 2MD9A 3CCUP 1Q6AA 4R0MA 1Q6BA 4H2XC 4GR6A 4QNBA 5KP6B 2CGQA 5HGOA 1GXHA 1M1KQ 3CCJP 2KOPA 2FQ0A 3EZXA 2KOSA 2LIUA 2LKIA 2XV6A 2EG5A 2K5XA 4COCA 3BULA 1SUYA 1HQBA 3B4QA 3M1MA 4UHPB 1JJ2O 2MF4A 1EMVA 1Q86Q 3CCLP 3G6EP 1M74A 1BXIA 4MRTC 5F2OA 2KORA 2K92A 1A43A 2JBGA 3EJBA 1GXGA 4U0FA 2ONTA 2FVEA 2I2XB 1VQKP 7CEIA 3CC4P 1R8JA 5DCKA 1EOQA 2JAZA 4HEHA 2CG5B 4QKOA 2MY5A 1GPJA 4H2YC 3CCQP 2L6EA 2KGDA 2GDWA 3I55P 2BUOA 1EIAA 2EHTA 2GYKA 2N5IA 2M8PA 3H0DA 3U43A 1VQ7P 1VQPP 2JYLA 1YHQP 5EJDA 2N6ZA 1VQ6P 2FHSC 3EJEA 1S72P 3G0VA 2FQ1A 4PH1A 1BMTA 5JPAA 1K8AQ 2K0YA 4GR2A 5KP8B 1E6JP 1QTEA 3CCEP 2GZFA 4M0MA 2LTEA
chains in the Genus database with same CATH topology
2EIAA 2XT1A 3DS5A 2XV6A 3RG6C 1D1DA 2EG5A 3LRYA 1M6EX 1VQ9P 2PEIA 2KODA 2PEQA 3I56P 4COCA 4XROA 3DS1A 4U0EA 2JYGA 3DPHA 5I4TG 1Q7YQ 1QVGO 3Q20A 2P9XA 1RO2A 2PBIA 3M1MA 3H20A 5HGNA 3G21A 1VQNP 4U0BA 5BS1A 3CXCO 1JJ2O 1QVFO 2OTJP 1YITP 2LF4A 5BS2A 2Z44A 1Q86Q 1VQLP 1RNIA 3G4SP 2PEMA 3CMAP 1Q81Q 3G1GA 3CCLP 3G6EP 1M74A 3G29A 3DS2A 1VQOP 2QA4P 4U0CA 5F2OA 3WBHA 3DS0A 2CWOA 1YIJP 3CC7P 2E1MA 1W2BO 4X8QA 3B5IA 1M6NA 3DS3A 4U0AA 1A43A 3HZQA 1VQMP 1RO0A 2PEJA 2PEKA 3G1IA 5HGLA 1M90Q 3G26A 3CMEP 3DTJA 4XRQA 2XXMA 4U0FA 2BHVA 2ONTA 1N8RQ 2Z46A 1VQKP 3H4EA 3CC4P 3MGEA 4WYMA 1K9MQ 3L9TA 5DCKA 1EOQA 1KC8Q 1BAJA 4U0DA 1QRJA 2OARA 2Z45A 1Q82Q 5HGMA 2PENA 4XFXA 1NJIQ 4XFYA 4PH0A 3CCQP 1K30A 1VQ5P 4IPYA 2L6EA 3CCMP 5F2KA 1UTUA 4COPA 2FMME 3I55P 2BUOA 1EIAA 2JO0A 1IUQA 3VRLC 2OTLP 1A8OA 3NTEA 3DS4A 2M8PA 3H0DA 1ZMBA 2PY8A 1VQ7P 1VQPP 2QEXP 2JYLA 1YHQP 1YJWP 1AUMA 1KQSO 1K73Q 1YJ9P 3G28A 1VQ4P 3H47A 4M0IA 1VQ6P 3G71P 3CCRP 3OW2O 3E2DA 3CC2P 2PEOA 2M8NA 3CCVP 3G0VA 1YI2P 1S72P 2DGYA 4PH1A 4XFZA 1KD1Q 3P05A 5F2NA 2EFJA 2M8LA 5JPAA 3CCUP 1K8AQ 3HYBA 4GR6A 3CPWO 4QNBA 4GR2A 3CD6P 1UZ3A 1E6JP 3CCSP 1VQ8P 3CCEP 5HGOA 1M1KQ 3CCJP 4M0MA 1YJNP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO2 A;  1RO0 A;  3M1M A;  3H20 A;  1RNI A; 
#chains in the Genus database with same CATH topology
 1Z6M A;  3IVA A;  2EIA A;  2XT1 A;  3DS5 A;  5HVC A;  1M6E X;  1VQ9 P;  2PEI A;  2KOD A;  2PEQ A;  4XRO A;  3DS1 A;  4U0E A;  2JYG A;  5I4T G;  1Q7Y Q;  3BJD A;  3NY7 B;  2L4B A;  1QSA A;  1NQ4 A;  2PBI A;  1UNK A;  5HGN A;  1VQN P;  4BPF A;  5BS1 A;  2LL8 A;  1ZNV A;  4NEO A;  2OTJ P;  5BS2 A;  5HV8 A;  2PEM A;  3CMA P;  3G1G A;  2CNR A;  1X3O A;  2LPK A;  3G29 A;  4PWV B;  1SV1 A;  2QA4 P;  4G86 A;  3CE7 A;  2KW2 A;  3WBH A;  3CC7 P;  5EW5 E;  2QNW A;  1W2B O;  4X8Q A;  3B5I A;  5KP7 B;  1RO0 A;  2VLO A;  2PEK A;  3G26 A;  2J6Z A;  2XXM A;  3H4E A;  2KGA A;  1K9M Q;  3L9T A;  2KOO A;  1KC8 Q;  4U0D A;  1QRJ A;  2KWL A;  4XFY A;  1VQ5 P;  1K98 A;  2N50 A;  2KG8 A;  3GZM A;  1UTU A;  3VRL C;  2KG9 A;  2OTL P;  1E0H A;  1A8O A;  1W53 A;  3IV9 A;  3DS4 A;  2FVF A;  1FR2 A;  2LML A;  2MVU A;  2QEX P;  1YJW P;  2VLQ A;  1UJZ A;  1K73 Q;  3G28 A;  1VHN A;  4M0I A;  3G71 P;  3E2D A;  3CC2 P;  2PEO A;  2PNG A;  3CCV P;  2DGY A;  1AYI A;  3P05 A;  3WHP A;  2EFJ A;  2N98 A;  2VLN A;  1L0H A;  3HYB A;  2J70 A;  3CPW O;  2DNW A;  3CCS P;  1VQ8 P;  2FVA A;  1IMQ A;  2EHS A;  2L9F A;  3GZL A;  5C8D A;  2FQ2 A;  1D1D A;  2JGP A;  3I56 P;  2ROQ A;  3GKL C;  3DPH A;  1QVG O;  2KGE A;  4HKG A;  3G21 A;  4U0B A;  2K94 A;  2LF4 A;  2AVA A;  1DNY A;  4U0C A;  1V2Z A;  2AFD A;  2FAE A;  2CWO A;  1YIJ P;  2E1M A;  2AF8 A;  2PEJ A;  5HGL A;  3DTJ A;  2FAC A;  1IMP A;  2K0X A;  2N5H A;  2XZ0 D;  4WYM A;  1ACP A;  2GDY A;  1CEI A;  1Q82 Q;  5HGM A;  4XFX A;  1NJI Q;  1SLY A;  4IPY A;  2JQ4 A;  2M5R A;  3CCM P;  5CZD B;  4F37 A;  3EJD A;  4COP A;  2XZ1 C;  2FMM E;  3GJN A;  3NTE A;  1ZMB A;  1AUM A;  1KQS O;  3RG2 A;  1YJ9 P;  2WPT A;  3OW2 O;  2GZJ A;  2M8N A;  4XFZ A;  1KD1 Q;  4IZ6 A;  5F2N A;  2M8L A;  3LMO A;  1K7Y A;  3CD6 P;  1UZ3 A;  2K93 A;  2X2B A;  2MR7 A;  1L0I A;  1HY8 A;  2KG6 A;  1YJN P;  1F80 D;  2GDX A;  1VKU A;  2CQ8 A;  3RG6 C;  3LRY A;  1T8K A;  2K2Q A;  2GZI A;  3Q20 A;  2P9X A;  1RO2 A;  1DV5 A;  3H20 A;  2ERH A;  2KGC A;  3CXC O;  1QVF O;  2K0D X;  1KLP A;  1YIT P;  1AF8 A;  2Z44 A;  1VQL P;  1RNI A;  3G4S P;  1Q81 Q;  3DS2 A;  1VQO P;  2NO8 A;  2VLP A;  3DS0 A;  1M6N A;  2KR5 A;  3DS3 A;  4U0A A;  2GZE A;  3HZQ A;  1VQM P;  3CME P;  3G1I A;  4BPG A;  1M90 Q;  4PXH B;  2GZG A;  4XRQ A;  2AFE A;  2L0Q A;  2BHV A;  1N8R Q;  2N6Y A;  2Z46 A;  4JGI A;  2JB0 A;  3MGE A;  2JU1 A;  1BAJ A;  2MR8 A;  1OR5 A;  2OAR A;  2Z45 A;  2PEN A;  4PH0 A;  1K30 A;  4DG9 A;  5F2K A;  2JU2 A;  2LOL A;  4CA3 A;  2L22 A;  2JO0 A;  1IUQ A;  2KOQ A;  2VSQ A;  2LIW A;  4HH3 C;  2PY8 A;  1R5Q A;  4BPH A;  2FAD A;  2J6Y A;  1MZ8 A;  1VQ4 P;  5C5E A;  3H47 A;  4H2W C;  3CCR P;  1YI2 P;  2MVV A;  2MD9 A;  3CCU P;  1Q6A A;  4R0M A;  1Q6B A;  4H2X C;  4GR6 A;  4QNB A;  5KP6 B;  2CGQ A;  5HGO A;  1GXH A;  1M1K Q;  3CCJ P;  2KOP A;  2FQ0 A;  3EZX A;  2KOS A;  2LIU A;  2LKI A;  2XV6 A;  2EG5 A;  2K5X A;  4COC A;  3BUL A;  1SUY A;  1HQB A;  3B4Q A;  3M1M A;  4UHP B;  1JJ2 O;  2MF4 A;  1EMV A;  1Q86 Q;  3CCL P;  3G6E P;  1M74 A;  1BXI A;  4MRT C;  5F2O A;  2KOR A;  2K92 A;  1A43 A;  2JBG A;  3EJB A;  1GXG A;  4U0F A;  2ONT A;  2FVE A;  2I2X B;  1VQK P;  7CEI A;  3CC4 P;  1R8J A;  5DCK A;  1EOQ A;  2JAZ A;  4HEH A;  2CG5 B;  4QKO A;  2MY5 A;  1GPJ A;  4H2Y C;  3CCQ P;  2L6E A;  2KGD A;  2GDW A;  3I55 P;  2BUO A;  1EIA A;  2EHT A;  2GYK A;  2N5I A;  2M8P A;  3H0D A;  3U43 A;  1VQ7 P;  1VQP P;  2JYL A;  1YHQ P;  5EJD A;  2N6Z A;  1VQ6 P;  2FHS C;  3EJE A;  1S72 P;  3G0V A;  2FQ1 A;  4PH1 A;  1BMT A;  5JPA A;  1K8A Q;  2K0Y A;  4GR2 A;  5KP8 B;  1E6J P;  1QTE A;  3CCE P;  2GZF A;  4M0M A;  2LTE A; 
#chains in the Genus database with same CATH homology
 2EIA A;  2XT1 A;  3DS5 A;  2XV6 A;  3RG6 C;  1D1D A;  2EG5 A;  3LRY A;  1M6E X;  1VQ9 P;  2PEI A;  2KOD A;  2PEQ A;  3I56 P;  4COC A;  4XRO A;  3DS1 A;  4U0E A;  2JYG A;  3DPH A;  5I4T G;  1Q7Y Q;  1QVG O;  3Q20 A;  2P9X A;  1RO2 A;  2PBI A;  3M1M A;  3H20 A;  5HGN A;  3G21 A;  1VQN P;  4U0B A;  5BS1 A;  3CXC O;  1JJ2 O;  1QVF O;  2OTJ P;  1YIT P;  2LF4 A;  5BS2 A;  2Z44 A;  1Q86 Q;  1VQL P;  1RNI A;  3G4S P;  2PEM A;  3CMA P;  1Q81 Q;  3G1G A;  3CCL P;  3G6E P;  1M74 A;  3G29 A;  3DS2 A;  1VQO P;  2QA4 P;  4U0C A;  5F2O A;  3WBH A;  3DS0 A;  2CWO A;  1YIJ P;  3CC7 P;  2E1M A;  1W2B O;  4X8Q A;  3B5I A;  1M6N A;  3DS3 A;  4U0A A;  1A43 A;  3HZQ A;  1VQM P;  1RO0 A;  2PEJ A;  2PEK A;  3G1I A;  5HGL A;  1M90 Q;  3G26 A;  3CME P;  3DTJ A;  4XRQ A;  2XXM A;  4U0F A;  2BHV A;  2ONT A;  1N8R Q;  2Z46 A;  1VQK P;  3H4E A;  3CC4 P;  3MGE A;  4WYM A;  1K9M Q;  3L9T A;  5DCK A;  1EOQ A;  1KC8 Q;  1BAJ A;  4U0D A;  1QRJ A;  2OAR A;  2Z45 A;  1Q82 Q;  5HGM A;  2PEN A;  4XFX A;  1NJI Q;  4XFY A;  4PH0 A;  3CCQ P;  1K30 A;  1VQ5 P;  4IPY A;  2L6E A;  3CCM P;  5F2K A;  1UTU A;  4COP A;  2FMM E;  3I55 P;  2BUO A;  1EIA A;  2JO0 A;  1IUQ A;  3VRL C;  2OTL P;  1A8O A;  3NTE A;  3DS4 A;  2M8P A;  3H0D A;  1ZMB A;  2PY8 A;  1VQ7 P;  1VQP P;  2QEX P;  2JYL A;  1YHQ P;  1YJW P;  1AUM A;  1KQS O;  1K73 Q;  1YJ9 P;  3G28 A;  1VQ4 P;  3H47 A;  4M0I A;  1VQ6 P;  3G71 P;  3CCR P;  3OW2 O;  3E2D A;  3CC2 P;  2PEO A;  2M8N A;  3CCV P;  3G0V A;  1YI2 P;  1S72 P;  2DGY A;  4PH1 A;  4XFZ A;  1KD1 Q;  3P05 A;  5F2N A;  2EFJ A;  2M8L A;  5JPA A;  3CCU P;  1K8A Q;  3HYB A;  4GR6 A;  3CPW O;  4QNB A;  4GR2 A;  3CD6 P;  1UZ3 A;  1E6J P;  3CCS P;  1VQ8 P;  3CCE P;  5HGO A;  1M1K Q;  3CCJ P;  4M0M A;  1YJN P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...