3M1ZA

Crystal structure of the mutant v182a.v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
218
structure length
218
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIAGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 86
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m1zA00
2CLEA 4AAJA 1DQXA 1EUNA 4Z0SA 4LVGA 3B05A 5D2XA 3P5ZA 3W2JA 1OFEA 4UTTC 3VFLA 2FJKA 2J88A 4JTSA 2YX0A 3EWZA 5KTLA 4QAIA 1DQWA 3EKLA 2ATMA 3W2LA 3W7OA 3MYPA 5LNRA 3NPUA 3L5MA 3A22A 4O8RA 2Q3RA 2VEKA 3EXSA 2RFGA 2QCGA 3M1ZA 2Q8LA 2NV1A 1TB3A 3LDVA 4UMCA 4FX7A 3SJ3A 1KLZA 3W1AA 3WK1A 4PL1A 4MZYA 1FQ0A 2OCZA 1HG3A 2BTMA 2JGYA 5G2IA 4I9AA 5KZMA 4OGZA 2VFIA 4NU7A 2YFOA 3TK7A 2H8XA 3EWYA 3GXNA 3M44A 3BLFA 2E1DA 3SFKA 4FNPA 3EX2A 3W2NA 4GUJA 1P0NA 3O07A 1JQVA 4H3DA 3GAYA 1MXSA 2E5BA 4O1CA 2WSQA 1EUAA 5D32A 4M19A 4CNOA 1KM3A 2PCQA 4E2DA 3H54A 4RZ5A 2QAPA 3MYOA 2VELA 1WAUA 1YDNA 1O94A 5D30A 4M5PA 4UTIA 4PCFA 3G8RA 3TAOA 5BMXA 3NL2A 1T0OA 3DU0A 1I2NA 2Y85A 1V7YA 3SW6A 5HULA 4PFMA 4CQ9A 2A2IA 1GT8A 2A85A 1TPWA 2Y63A 3PVFA 4BK9A 1W31A 1BEUA 5DELA 4MKNA 3BW2A 4WJEA 2J6XA 3M0ZA 3FLUA 4DO6A 4DXVA 2CZDA 5K4ZA 3MJYA 1XFBA 3KX6A 1S5VA 5H91A 1KBIA 4NT0A 3GXTA 1FWWA 1B9BA 3NPWA 5CSSA 2WSYA 1S5WA 5D03A 4RK8A 3C52A 4FX8A 1TRIA 3P81A 1QWGA 3CWOX 4LUJA 5EL1A 4MJMA 1JCNA 1SU5A 2FB3A 4HPXA 4P2VA 3MI3A 5D37A 5H2ZA 1X8FA 4MYXA 4ZQRA 4Y9AA 5EY5A 3R13A 3NQ6A 3IGSA 1AL8A 4UIOA 4LS2A 3L0NA 4WOZA 1PVNA 2H6RA 3KVMA 1VGAA 3GZ3A 1VPXA 1Z44A 3L66A 3L65A 4C1LA 4UR7A 3SGUA 4EF8A 2JBMA 3QMSA 1XM3A 3LOTA 1QPQA 1LRNA 3C2RA 4LU0A 4O0ZA 2ZA2A 4WQ6A 3G1DA 5EKYA 1W54A 2V81A 2QUUA 3O05A 2OMAA 4R53A 5FI8A 3OVRA 3QZEA 4ONVA 4DF1A 3C2FA 1LTDA 4EOUA 3LCWA 3SECA 2FTPA 1TRDA 1VLIA 4Y96A 1FDZA 1ADOA 2YW4A 3IVTA 3QSRA 3G3DA 5F2IA 1AL7A 1LORA 3B04A 5CZSA 1ONRA 1JCLA 3BLIA 1XBZA 1ZY9A 1I2OA 3GDTA 3OA3A 3E12A 2X1TA 5EMUA 4HSNA 4KKXA 4O4WA 1QNVA 2VKZG 1VCFA 3USBA 4MLJA 4AMAA 2QDHA 3M41A 2GOUA 1MEHA 2CZFA 3NGJA 2QCHA 1ML1A 3W73A 1I4NA 1NF0A 3KVJA 3PUDA 1SFLA 1H50A 4DF2A 4MYAA 5EPDA 4PL2A 4JTJA 2CLMA 1DJQA 3G1HA 1P0KA 2QEZA 2YYTA 4CCEA 4UTHA 3ATZA 3T44A 1LRTA 1TV8A 1X6UA 1XDMA 3EX4A 4ADTA 3TXZA 1GTHA 3STCA 1VHNA 1FCBA 1JCXA 3CPRA 1D3HA 1XCFA 1XUUA 5L6UA 4IMGA 1VS1A 2WSRA 4FO4A 4XWUA 3S0CA 5CKSA 2Z2UA 3LBMA 4YMZA 4UTMA 1DJNA 4Z0JA 2VFDA 4BFAA 2V9DA 1LDCA 2PRMA 4MFDA 1KA9F 2QKFA 5FEPA 1XDLA 3NQGA 5F4SA 2BX7A 1WA3A 3S8HA 1VR6A 4O57A 3LRLA 1LZOA 3QJAA 5KITA 1ALDA 5G2WA 4H4IA 5A8GA 3GDKA 3CIWA 4WY0B 1X1OA 1NFBA 3G1XA 3U2OA 4JS3A 1ZNNA 1IIGA 4PC8A 2CLFA 5F2LA 3TROA 4P61A 1PS9A 1N8FA 1YYAA 5DN1A 5DLCA 1N7KA 3PUOA 4TO8A 2VFEA 1W0MA 1QFEA 3I65A 4POCA 1D3GA 2HTMA 3W1NA 1TPC1 3I6RA 2V2HA 3SZ8A 2ZZ6A 1D9EA 2QJHA 5AHIA 4OV4A 3SSJA 2H90A 3WJSA 5K9CA 4QITA 3W9ZA 5DBTA 3KRZA 1ICQA 3T55A 3UPBA 5E1QA 3SGZA 1KBJA 3QMTA 1TYGA 4ORIA 2FIQA 3BG3A 3G0UA 4O16A 3FJ6A 1GWJA 1W5NA 1WYIA 2DZSA 3UY8A 4O1BA 3G1VA 1VC4A 3LGEA 4I7WA 2BLEA 3P5YA 4K38A 1YPIA 3TX9A 1EP3A 3ZFHA 1C9DA 2OZ0A 3P8JA 3NQFA 1FXPA 3BPWA 3NA8A 4CQ8A 3T40A 2FPVA 3ABQA 1OVDA 3UQNA 3RNDA 4LW7A 4HHPA 1FDJA 3LV5A 3IGUA 5TIMA 3RK8A 3O8AA 5BOOA 1LOLA 3NQDA 2F7FA 4LVBA 4UNKA 3DFTA 3TU9A 3BK0A 1K3UA 1C29A 4JEQA 4AVFA 3UPWA 4GWEA 3LHUA 4GRSA 5U7SA 5D02A 1HO4A 6ALDA 4K37A 1FY6A 1TCDA 3B4UA 1NF7A 3NL6A 3W2MA 4MZ8A 2RDUA 3LCHA 1XBYA 3IGXA 4M7SA 1F5ZA 2VFFA 3QW4B 5IM51 4IJBA 3GR7A 1H51A 4JIQA 3TJLA 3STFA 4LVAA 2GQ8A 1OYAA 3MMTA 3AO0A 3GDMA 4S1FA 4BWLA 1VYPX 3DZ1A 1H7WA 3G8EA 3F4NA 2CU0A 3NO5A 3DFNA 4JNMA 5HNRA 5AHEA 3NOEA 4O50A 1O5KA 3W1TA 5I3KA 2QJGA 1TPEA 1PCKA 1R2SA 2LLEA 4MOZA 2WKJA 1L6WA 3KFTA 4M6VA 3W07A 4AB4A 5LZLA 3GLCA 4UUIA 3GXPA 3M5YA 4UFHA 3E9AA 2QCLA 2ZRYA 2H8ZA 3E0IA 4WY0A 4TX9A 3NQCA 4X2RA 3U8GA 3W7GA 4UCGA 4UTUA 3INPA 5TQLA 5F4XA 3NG3A 5C55A 3FS2A 3N9SA 3BW4A 4OT7A 3TSBA 5CZJA 3W1LA 1G67A 1XI3A 4O4VA 5LGZA 3O6CA 4GBUA 4UFMA 3UWQA 3L2IA 1OFDA 2D73A 2CLKA 2VFHA 4LNYA 4OBTA 1P5BA 2ZTKA 3TR2A 2Y7EA 3PBUA 1GVRA 2V2DA 4QNEA 4NJHA 3BGJA 4RLIA 2Y7GA 4AEOA 3P74A 3THAA 3HMJG 4JX5A 5G1TA 5DCDA 4ZQNA 4Z1CA 4S2BA 3Q2DA 1HFBA 2GVJA 2Q8ZA 4E38A 4N9BA 5HWJA 1OABA 3PSVA 3M5VA 2X1SA 2Z6JA 2QCDB 1EA0A 3G22A 1WX0A 2O7QA 4N9DA 5HMSA 1YTKA 4JTEA 2TPSA 4H6KA 4MZ1A 2DP3A 1SR9A 1H5YA 2G5WA 1I2QA 1VCGA 3DI0A 3W7RA 1LLZA 3NQVA 3P8IA 1KM2A 1OHLA 4L4MA 4K7YA 2ISSA 3ZWSA 2EF9A 4EIVA 1ZAHA 4N4QA 3T7VA 3MHFA 3G1YA 3AJXA 3LI0A 3P62A 1TIMA 2JKEA 2NUXA 3F4WA 4LS0A 3H55A 2CW6A 1T99A 5D2YA 3RFAA 3DENA 3DAQA 1E51A 4GUIA 4UC5A 5F4WA 4WXZA 3LTYA 2V82A 1ME9A 3NVTA 2OT1A 1UCWA 2VOMA 1JCMP 1XKYA 2ZZ1A 3LERA 3W7CA 1L2UA 2ZZ5A 3PY2A 2YDAA 3C61A 1ZFJA 2DU2A 1KFJA 1TTPA 3UWVA 2FDSA 1NAL1 3HQ1A 3GDLA 3S1VA 5D2VA 3GKAA 1QO5A 4RZ4A 2HS8A 4L4LA 2J9XA 4IUOA 1R30A 5AC7A 1GYLA 2WOQA 3G1AA 3UWZA 1IIHA 3HBLA 4JTUA 4LV4A 3Q94A 3R2GA 5I3FA 2RDTA 3W83A 1VLWA 4FNUA 2H3DA 4JTKA 2VC6A 3VE7A 5DY3A 4RR4A 4AWUA 5C2XA 1B57A 1GVOA 1LOQA 3GIYA 2RHGA 4M7TA 4A2SA 4YCOA 1Q6QA 1XXXA 1OX5A 1K8XA 4ALDA 5CGQA 3FYOA 5CPLA 3THQA 4MIMA 4CNNA 5IBXA 2A7PA 1I2RA 4K36A 3LTSA 3TA6A 2C13A 2E6DA 2X1UA 4S2CA 4GFSA 1H7RA 1OX6A 1W3NA 3M47A 4O54A 1BWKA 3LCIA 4IMCA 4Z1DA 3EWXA 4Y6GA 3TSDA 5F2GA 3W7IA 5HR6A 3T4CA 4U4MA 4JYDA 1J5TA 2NWRA 2GVGA 1G7UA 2NXHA 2JKAA 3DBPA 4JDYA 1KM5A 1Q45A 4O10A 3HG2A 3NPXA 3WFAA 2P10A 2YYUA 5FF7A 2QCDA 3NL5A 3W86A 1WOBA 2NLIA 3M43A 1KFEA 3HOJA 3VNDA 1AW1A 2X2GA 3W71A 5D2WA 2G95A 4XQ6A 5EYWA 1MO0A 2B7NA 7TIMA 4HKPA 4JICA 4Q33A 3L0KA 1K7EA 4R33A 2B4GA 3NM3A 3RLVA 3F1QA 4JTFA 5AC8A 3P84A 1TO3A 2P1FA 3W74A 5G4WA 3GVGA 4M6PA 1IF2A 4QSHA 4NZFA 5CG7A 2A6NA 5AC6A 2ZZ4A 3STEA 8TIMA 1A5AA 1WOAA 1VJIA 3QEZA 3OIXA 4AXKA 1DVJA 4OHQA 3S5ZA 5HWMA 2F84A 3S1XA 3O6YX 5CZTA 3W7PA 4ORMA 2JK2A 1Q6RA 4XTDA 5AYYA 1RQHA 3QSTA 1ZJIA 5BW6A 1TV5A 4O1DA 5LHFA 1KTBA 1GQNA 4KWVA 3M16A 3N14A 3Q37A 4R7JA 3W2KA 1GVSA 3W87A 2V2CA 3A21A 3W75A 3EXTA 3O06A 3LRMA 3NQAA 4UTLA 1FWTA 4XZ9A 2CLHA 4KFPA 2Z6IA 3HIJA 1AK5A 2NZLA 4PEKA 2FFCA 4HNUA 3QYQA 5BMWA 5G1YA 4DPPA 3CHVA 4XTIA 3HGOA 3QC3A 1GJPA 3UWYA 1G6CA 4TIMA 2J9YA 3GAKA 4WOQA 1JULA 3GK0A 3W23A 5K9XA 2ZRUA 3OVPA 2GJLA 2JKPA 4ML9A 1W5QA 3LCXA 4N6EA 1W37A 1W56A 3EEGA 1OJXA 1JCYA 4JYFA 3LRKA 5CPMA 1NVMA 1ICPA 3BLEA 3LHWA 5KSWA 1R46A 4FNTA 3TKFA 2QCMA 1JRBA 4JTGA 3FFSA 1KTNA 3KHJA 5FEZA 3W7DA 2CZEA 5AHFA 1SSGA 3CEUA 1F74A 1YLVA 2EHHA 4FXRA 1TREA 2G97A 3WJXA 3A9IA 1SZEA 4HN4A 3SI9A 1L9WA 2B7PA 5AFDA 4PTNA 3N73A 1U5JA 4B5NA 3N2MA 2VXNA 1DORA 2W79A 1QO2A 3FKKA 3IV3A 4IPJA 2X30A 4NVTA 3N9RA 3DI1A 4DEFA 1F6KA 5HR7A 3W88A 3BARA 4QM1A 5C5YA 1GVFA 1GVQA 3DFPA 1H63A 1S3HA 1OK6A 2CFFA 3EX1A 1WBHA 4O14A 5HUOA 2NUWA 3GYEA 3O6DA 1SQ7A 4MUZA 1MSSA 5FF0A 1Y0EA 3WK0A 1KW1A 4LVFA 1VYRA 5AOUA 2PE4A 3YPIA 3P61A 2PRHA 1C8VA 1LBLA 5LNSA 1SZNA 1FWSA 4CLMA 2Y88A 2E09A 4DF0A 2RH9A 2YW3A 2X1RA 3M5ZA 3JRKA 1K7XA 3KRSA 3W7HA 1KFBA 5KZEA 3QPZA 4ZVJA 1UASA 2E77A 2PURA 3W7JA 4O1AA 2DZPA 2V8ZA 3LLDA 3C56A 3G3MA 1VCVA 2ZDRA 2A5HA 4BWLC 1I45A 3WK2A 3R89A 4IGHA 4K7VA 2EPHA 1OF6A 4FX6M 4ZL1A 4MJZA 1EB3A 4K8HA 1OFOA 1A5CA 1K8ZA 3NZ1A 4UFJA 4O18A 4YWIA 1KV5A 3LCGA 1JUKA 5D04C 2E68A 3BVJA 1GG1A 5I3GA 4XBSA 3GKFA 5HWNA 1XBVA 1UUMA 3SR7A 2R94A 1H61A 3O63A 4ADSA 1TTQA 4UFIA 3TFCA 1OX4B 2HSAA 4IXXA 4N02A 5F2MA 4LRSA 1O60A 4K8EA 3B8DA 4BI6A 3TE9A 4BI7A 3PF3A 1IXQA 1QMLA 3HGJA 5LNWA 4ZMGA 2Z1BA 2VEMA 4DQWA 4WZHA 2ZZ3A 4XKYB 1KV8A 2GVLA 3G18A 3IEBA 2C14A 4GJ1A 3MBDA 1J4EA 1TPB1 2ZZ7A 4HSOA 3G1SA 2GQ9A 1K03A 1FWNA 1H62A 3ZWTA 3M5XA 3PM6A 3A24A 4CQAA 2TMDA 3O1NA 1G4PA 2XN0A 1XL9A 2ZRVA 3W1XA 1AW2A 1PHWA 2BWGA 4QNWA 4NXSA 4A21A 2WJZA 3WK3A 2W0UA 2YFNA 1XBXA 3TIMA 4BF9A 4UTWC 4O12A 2DZUA 1TSIA 3LHYA 1FXQA 2PC4A 4DPQA 3ABSA 3MWAA 3W85A 1RQBA 3NXFA 1LYXA 5FEXA 3PB2A 2YSWA 4CCDA 1F2JA 3IIZA 1NEYA 3IRDA 4MLRA 4RX0A 2QDGA 3PR2A 4KFOA 4UFLA 3A5VA 3NNTA 3NQ2A 4N2YA 3C6CA 4GNJA 1OFQA 2VEPA 4DELA 1YPFA 3LI1A 3E49A 3W7KA 3PBYA 3UNDA 1G69A 3PAJA 1KLYA 1RD5A 5AHLA 4A22A 4AF0B 1QPOA 1QDSA 4JTLA 4JX4A 5T26A 5C6MA 4IX2A 1OF8A 1DBTA 4Q4KA 4XBKA 4HIBA 4WXYA 3BW3A 2ZRZA 3MBFA 4RV8A 3DKLA 2NWSA 1H7OA 2WO5A 3MO7A 4Z1AA 3W1MA 1Z41A 1H7NA 4GUGA 1EIXA 1R47A 2DJLA 2V5LA 1ZAJA 4MY9A 1KFLA 3LTPA 1A5BA 4FIQA 3WJYA 4JXCA 1QR7A 3KXQA 4K6AA 3KVLA 1CX9A 1L6YA 3L9CA 1QAPA 1RV8A 4AHPA 4FEZA 3B03A 1LP6A 4PODA 4O19A 6TIMA 4YCPA 1TPH1 1JUBA 3CM4A 2AAMA 3RLUA 3PBVA 1PCWA 3UZJA 4JD4A 3MP5A 1JQXA 2W6RA 3CC1A 1SPQA 2Y70A 1MEIA 3N3MA 4E0CA 1OX4A 1VRDA 1LBMA 2ALDA 2HMCA 4OWGA 3ABRA 4AHQA 5KZDA 1IXNA 4UTWA 4WUIA 4ZZ9A 4IMEA 5EBUA 3TQVA 3M6YA 4XKYA 4FF7A 2RDWA 4WY0F 4DBDA 5HINA 1UB3A 3MP3A 3S6DA 1GG0A 1QPNA 3NM1A 1I2PA 3TQ0A 2QAFA 2ZA1A 3EB2A 2TSYA 1OYBA 1Q6OA 1M7PA 2BZNA 4JYEA 1KFCA 1W5PA 1Z42A 2C18A 3L67A 2C15A 5DXXA 5IBXC 4ICNA 5DBUA 3I68A 4X9SA 3UXAA 3SY5A 1W5OA 1TJPA 4GE8A 3DXIA 3S1WA 5CZ0A 2OX1A 4EVZA 1UBSA 2WPBA 1JUEA 2CLLA 4RKAA 2YPIA 3D0CA 3PB0A 2DZWA 3DFOA 1G4EA 4Z08A 3W7NA 5DCBA 4IOTA 4U28A 4LRTA 5AB3A 2J9ZA 3ELFA 3DH7A 1GOXA 3N34A 2ZFAA 3TAKA 2ZBTA 4LVDA 4O52A 5F1VA 3UY7A 1JVNA 3CEPA 5A5WA 3PS7A 4QJ1A 4NJGA 2B7QA 4NX5A 5LNVA 3LBCA 1WDWA 1YADA 3N19B 3R8RA 3TFXA 5LKYA 2P0OA 4AF0A 3G24A 2YCEA 3LLFA 3B06A 3OHIA 2QCEA 1EEPA 3L5AA 3TW6A 1Q6LA 1F6PA 3TV8A 4AWSA 1OFRA 1RZMA 3ZS4A 2JGQA 4NNBA 1PIIA 1PV8A 2GJNA 3F03K 1K8YA 1A53A 1WBJA 2AGKA 4OV9A 1TTJA 3TSMA 4O13A 1R2RA 1XC4A 3KOFA 3QFEA 4GUHA 2AQWA 3I7QA 3FA5A 3EX3A 5D33A 3DKJA 1LLWA 1YTDA 3LCLA 1I8JA 4CNPA 1K7FA 4NJIA 1YTEA 1SO3A 1TMHA 3ABOA 3ATYA 4Q32A 3HGRA 1FCUA 4GXMA 4FNSA 3S5OA 3HPZA 2WNQA 1T8XA 3A5FA 2YXGA 4FXSA 2YR1A 3BO9A 2Y62A 5GVJA 4MPQA 3P67A 3GX9A 3QM3A 1AMKA 5K4XA 1VH7A 2A6LA 1SZFA 3HG4A 4X22A 1ZALA 5HUPA 3NAVA 1MEWA 1TQJA 2ATSA 4MY1A 2ZZ2A 3QW3A 1CW2A 1SSDA 5CSRA 1JCJA 1HUVA 1PE1A 4HPJA 3OVQA 3P80A 2IQTA 1G4SA 3W3OA 4LUIA 4RCXA 2DZTA 3TUUA 3LXAA 1X7FA 3S5NA 4A29A 4DO5A 1O5XA 1XUZA 4KWWA 2KZHA 4QISA 1OG0A 5LHEA 3GR8A 1N55A 4K39A 4TR9A 4A3UA 1FDYA 2E5DA 5SWUA 3TC6A 4O15A 3HPSA 3LHZA 2X16A 1F73A 3PWAA 1Q3NA 3FYPA 2DZVA 2ZYFA 3UYCA 3V75A 2XN2A 4G1KA 3LX9A 5AHNA 2ISVA 3TNOA 3BG9A 3C2VA 1W3TA 4JIPA 3ANYA 4JN6A 2Q3OA 2DZXA 3BG5A 3JR2A 3NQ8A 3W6YA 2Z0IA 4HNVA 4C1KA 3UWWA 2FPTA 3G1FA 4Y8FA 2OJPA 2ZRXA 4JTIA 3HF3A 2ZCGA 3SIZA 2G96A 3NL3A 2BXVA 3H53A 1HO1A 2R8WA 3BV4A 3CLMA 1OFBA 1SZGA 1FUYA 1IGSA 4UNLA 1LOSA 2V0TA 1BTMA 1RPXA 1ICSA 2ZA3A 1SFJA 3TJXA 5DY2A 3KRUA 3P60A 2EKCA 4UTTA 4NXKA 2EGZA 3S1UA 2VFGA 2WNNA 1SW7A 2OT0A 1UJPA 1T96A 1OFPA 4FNQA 4YLWA 4ZQMA 2E6AA 1P1XA 2CWNA 3M9YA 3P82A 4D2JA 1THFD 4WX2A 4I7UA 1VQTA 1KTCA 1P4CA 3I7RA 2YZRA 5CPOA 3FOKA 2DJXA 1GEQA 1DV7A 3KVKA 4IMDA 5D05A 3EWUA 2EAWA 1H1ZA 3UD6A 2NV2A 5LGXA 3W7LA 1JRCA 3C2OA 4RXGA 5D2TA 2E6FA 3L21A 3W1UA 4MFEA 3WJZA 4PH6A 3TMLA 5AHMA 4JX6A 3IVSA 4RXFA 5K2ZA 1DHPA 5D09A 3W7QA 2B0MA 4RJEA 2NX9A 3QMRA 4O28A 1TTIA 1GZGA 1TQXA 2C19A 3IVUA 1SW3A 3MUXA 3PUEA 1W8SA 2C6QA 4NZJA 2Y7FA 1OFAA 1FCQA 5LSMA 4IMFA 1O95A 3EKZA 1LROA 4O11A 1WV2A 5L9FA 2FQIA 3PC0A 5G4EA 3NPVA 3PG8A 1AW5A 4AH7A 5LNUA 1F76A 4IXHA 1EP2A 1KM0A 4OU1A 3TH6A 1U83A 5TBOA 3GNDA 4FNRA 1EWEA 1LCOA 1V5XA 4NJKA 5BNKA 4GC4A 1G7VA 1M6JA 1W3IA 3QPYA 1H1YA 5DCEA 4ADUA 3DHFA 5BRBA 2V5BA 4MY8A 2I14A 4CCCA 2GUUA 3CIXA 5U4NA 2CLIA 4UR8A 3NQEA 1ME7A 3B0PA 3EX6A 4LV9A 2Y7DA 3MHGA 3Q58A 2A1YA 4N9EA 2FB2A 2I9EA 4IPIA 4QIUA 1H7XA 4HNNA 2TYSA 4BR1A 3DHDA 2ABBA 5J5DA 1KM1A 2ZTJA 3NR0A 4HNTA 3GNNA 3V1PA 2UV8G 3B0UX 2C16A 4BI5A 1LBFA 2O7SA 2VEIA 3CB8A 3OBKA 5E0KA 4IX0A 3R5EA 3UXDA 4NX0A 1F7BA 3QQ0A 2ISWA 1OK4A 4J9JA 3LV6A 3STGA 5FESA 3E96A 2QUTA 4NNCA 5HQEA 4NUWA 4ZQCA 4MVAA 2RKXA 3DGRA 5K3VA 1KM4A 1YXCA 1WQ5A 3RU6A 2VENA 3I7SA 5DXYA 4R34A 4TMBA 4JY9A 1S5TA 4DBEA 5MHBA 2HS6A 3NDOA 4W9TA 3FEMA 1EWDA 2I1OA 4UMBA 3R12A 2CZ5A 4N9CA 1M5WA 3MP4A 5E93A 1DKWA 1TPUA 1FWRA 3TXVA 4OE7A 1TJRA 3MW7A 3LB0A 4NQ1A 3IIOA 4N6FA 1MZHA 3ZR4A 2NX1A 3VI2A 4PA8A 2B7OA 3PSWA 3LHTA 4ZQOA 2J27A 2Y6ZA 1IXOA 3C4UA 3QRHA 1B3OA 4UTJA 3G0XA 4EF9A 4LC8A 4JR5A 4YL2A 1EPXA 3HPXA 1GPWA 5C54A 3G0SA 2A0NA 4TMCA 4LOCA 1G4TA 3CQ0A 1CI1A 2NXIA 3EWBX 1TV7A 2FLIA 3HB9A 4O0KA 5HJLA 2H3BA 3LCFA 3B0VC 1FBAA 1J2WA 2E5CA 1PHQA 3PG9A 3IIVA 5I3HA 1B4KA 3W84A 4AWTA 3TC7A 2PRLA 4JDBA 1F05A 3L5LA 5G2HA 1TPVA 3MI2A 4NNAA 2TRSA 1H60A 1QOQA 5KINA 2QUVA 3K30A 1A5SA 3W72A 4X3ZA 1VYSX 1UUOA 4Y90A 1QCWA 1R2TA 3DFQA 1BKSA 3LXCA 1YDVA 4JTTA 1QOPA 1W1ZA 1YDOA 3NEVA 3W22A 4O53A 2E6YA 3W1QA 3JS3A 3GB6A 3UZ5A 5FF4A 1HTIA 3VKJA 2QCCA 2NX3A 3RMJA 1ZCOA 3CTLA 2YGYA 2BSLA 1VZWA 3PULA 2Y89A 1IXPA 3W1PA 1W5MA 5AN7A 1L6SA 3VE9A 4I7VA 4UFKA 3S9YA 4AHOA 3HG3A 4YXGA 1LRQA 1EX5A 3EWWA 4IQLA 4LTSA 1ZENA 3W2UA 3N2XA 1RR2A 1X1ZA 2Y61A 5D38A 4LY8A 1GTEA 4LS1A 3MHUA 2A4AA 3OG3A 3NYZA 1WXJA 1DL3A 4FB7A 1ZAIA 1TPFA 1M7OA 1B4EA 2R14A 4ZQPA 3FIGA 3LHVA 4UTKA 3C0JA 2NXGA 4TU1A 1O4UA 3IIXA 2C3ZA 3NQ7A 1ME8A 3CWNA 3S5YA 3FJLA 2QR6A 2XFWA 5I3JA 5AYZA 3DFSA 1Z48A 2WQPA 4IWWA 3S42A 1K02A 2QCNA 3PBWA 4JTHA 4LWWA 5FEWA 1HL2A 1GYNA 3KAOA 2WV8A 3FKRA 5CPNA 1SO4A 3EXRA 1VHCA 2V30A 1RQEA 3QQ1A 2J24A 2QJIA 5EA9A 1ZHAA 1TPDA 4N4PA 4DO4A 1KM6A 1SW0A 3LXBA 3CU2A 3HGSA 3IIPA 4E2BA 4Z1BA 2QF7A 1JR1A 4LC6A 3A23A 2DORA 5K9DA 1H7PA 3TW7A 3TMQA 2ABAA 3W7EA 3TCEA 3LM7A 1FX6A 3W70A 1AG1O 3TDFA 1PL9A 2GPTA 2NUYA 1NSJA 4NJJA 3O15A 1YXYA 1SO6A 4KFNA 3O16A 2A21A 4FHAA 4FIRA 4HT3A 2XN1A 1SO5A 3W1RA 3C3NA 4O17A 4A2RA 1FCVA 3WJWA 1DOSA 4WD0A 3VCRA 2QCFA 3C2EA 3W76A 2ZQ0A 1JJKA 1A50A 5AYXA 2FPYA 3CT7A 2C0AA 5ABTA 3U6WA 1EP1A 3HG5A 1LM1A 5KMYA 3UWUA 1SUXA 1OYCA 3QH2A 1BWLA 5FF3A 3MI6A 2CLOA 4XUGA 2WNZA 4JGDA 3NZRA 5G5IA 3HJZA 4OQVA 5K7JA 4QQ3A 3P7YA 2A7RA 3NQMA 5F1UA 3L68A 5I3IA 3TQKA 3E02A 4M6QA 4UXDA 3GDRA 2ZRWA 2C1HA 3HO8A 1KFKA 4EWND 5FF2A 4GUFA 4UMAA 2A7NA 3BGGA 3W7MA 2R91A 3M7WA 4JY8A 5J5RA 3QF0A 1QPRA 4LT9A 3L0GA 4RZ6A 3RF9A 1RVGA 3T78A 3OEXA 3C8FA 2GQAA 1YXDA
chains in the Genus database with same CATH superfamily
2CLEA 2PUZA 4QDMA 5M03A 1OFEA 3TN6A 1T5AA 2YX0A 3EWZA 4R7WA 2HXTA 5KTLA 4DN1A 3EKLA 4DJED 4HK5A 5AYIA 3NPUA 1UBPC 3L5MA 2HCVA 4B5WA 2CC0A 3ZIZA 2VEKA 1GJWA 1G0CA 2QCGA 3TJIA 2ISDA 2BXYA 3ITVA 1L6GA 1FQ0A 1KCKA 1BKHA 4W5ZA 5G2IA 1HIZA 2YFOA 2PSNA 3GXNA 1ADDA 4FNPA 1PO9A 3EX2A 3W2NA 3K5XA 4H3DA 2E5BA 2WSQA 3VDHA 2DZAA 3WF0A 4AW7A 3HPAA 1ZCCA 1WAUA 1YDNA 5D30A 4PCFA 1A3XA 2OQHA 3DU0A 1KFWA 5C9ZA 1QXLA 4S3GA 3PANA 1D7KA 4EX4A 3MANA 1TPWA 3PVFA 3BGAA 3N4AA 1GPFA 3CUFA 4MUPA 1GKQA 5DT7A 1E1CB 5K4ZA 4LJ3A 3WLTA 3EB3A 4NT0A 4L61A 1WB0A 1B9BA 5CSSA 2NT0A 1S5WA 3HA1A 4OFCA 5A6BD 1QWGA 4LUJA 4MJMA 2FB3A 3AWNA 2XFRA 2OWCA 3MUIA 5H2ZA 3HFTA 3MCMA 1YE4A 3R13A 1E4LA 3GTXA 1AL8A 1JZ6A 1EKOA 4UIOA 4I3GA 4LS2A 4ZCWA 2DT3A 4WCJA 2PLJA 5FJOA 1QPQA 1LRNA 2PWHA 3FJ4A 4PBGA 4V1YA 4LU0A 4O0ZA 4WQ6A 4DWSC 3OGSA 3L4VA 4GYFA 4AD0A 5FI8A 4QJ4B 4L7ZA 3OVRA 4ONVA 4DWDA 4JPGA 4EOUA 1FHDA 1GVEA 5A8PA 3AS3A 1ADOA 5FD0A 1Q65A 2F2HA 4Q4OA 3IVTA 4BEQA 9XIAA 5CZSA 3FHAA 2BASA 1ONRA 1XBZA 1ZY9A 1F3TA 3HPFA 3H12A 3THCA 1XYFA 2XJ7A 2WZIA 1GOQA 4GACA 4DUVA 2VKZG 2GOUA 1V6XA 4FOUA 3NGJA 1E6SM 2QCHA 3W73A 1OD8A 1SFLA 5FL0A 3U5YA 1PBGA 3EOSA 4H83A 3EAUA 4AZ6A 3UPMA 1HJQA 3OVGA 1DJQA 5HDRA 2QEZA 1R85A 3MWCA 1XLJA 1TMLA 3VGDA 1DYSA 3ATZA 3T44A 1XDMA 2WSKA 5HQMA 1HT6A 4S3DA 1VD6A 2I56A 1R3VA 3TXZA 2OR2A 3CPRA 1D3HA 1HF6A 2L5HA 2QPXA 3VNKA 5L6UA 4ZE5A 2C0HA 3BSGA 4IMGA 1VS1A 1C7TA 3EA3A 2WSRA 2WWDA 4XWUA 1XYLA 1RBLA 3BJSA 3CAWA 1KO0A 3N6HA 2OVLA 4DNMA 2QQ6A 4XAGA 4BFAA 5MF5A 3O9NA 2UY3A 3R43A 1SJCA 1KA9F 4QEEA 4XAPA 1XHGA 3S8HA 3UR8A 4XVDA 4EPKA 4AIUA 2FVKA 5G2WA 4HZ8A 3WSUA 3GDKA 4WY0B 3RO8A 1X1OA 2EG6A 4K1GA 3WLPA 1J9YA 2FZNA 2DV0A 3BLKA 3VOJA 1IIGA 1RH9A 4KERA 1GQKA 4UOQA 1IEIA 3JU2A 1N8FA 1J11A 1N7KA 3PUOA 4DJDC 4MKVA 1W0MA 1IR2A 3I65A 3C3UA 2HTMA 1JDAA 5D8ZA 3ITTA 4HYWA 2VP8A 1W9BM 5EMJA 2H90A 1QI5A 3KOWA 2E40A 4WJXA 2IKJA 5G4HC 3FVMA 2WMFA 4MHBA 2QV5A 3WEMA 3QMTA 1TYGA 2PTYA 3BG3A 4C6EA 3EMQA 2WSPA 3FJ6A 1GWJA 1XLHA 1L8PA 4XV0A 1CB7B 3UY8A 1TELA 4O1BA 3G1VA 1ZJHA 2VQUA 1YPIA 1DJWA 5CGMA 1FXPA 4TV6A 3BPWA 2WJFA 4CQ8A 2C71A 2FPVA 4MSSA 4PN2A 2PU0A 3PTMA 4QXIA 3PZMA 2Q6ZA 1EFZA 4MB1A 3NQDA 4LVBA 1VEPA 2QT3A 2WZEA 3TU9A 4NZ5A 3BK0A 5TF0A 1JNEA 3UPWA 4GRSA 1HO4A 6ALDA 1B31A 3B4UA 1YRRA 3W2MA 2RDUA 3LCHA 1XBYA 1F5ZA 2VFFA 4KH2A 5H8MA 3SIMA 3TJLA 2ICSA 4PBFA 1V3LA 3LGGA 2GQ8A 2TODA 3AOFA 1NIUA 1I75A 1J0YA 4ZXLA 7PTDA 4LB3A 1KBKA 4JNMA 5HNRA 3OU8A 3WQ6A 2X0HA 4BA0A 2HNEA 3H26A 4EP8C 2QJGA 1TPEA 2LLEA 3VX1A 4U10A 4JKKA 4M6VA 2PTWA 5LA1A 3OBEA 3W07A 5LIXX 4B3ZA 3LY0A 5HMFA 4GY7A 3SFWA 4JQ1A 2QCLA 4TX9A 3WD1A 4H9VA 1PKLA 5HK4A 2NSOA 5CBBA 3N9SA 4A3YA 2ZUWA 3GVRA 1XI3A 4GBUA 3UWQA 3VUSA 4J5NA 2D73A 4PB5A 4MNKA 2VFHA 4LNYA 3L12A 3TR2A 2Y7EA 3G6LA 3DYOA 3AIQA 4QNEA 1M41A 4RLIA 5FSDC 3KZSA 4X63A 3U7BA 3D47A 4Z42C 3H2FA 1HFBA 4WDTA 4BQ4A 1OABA 2Y1HA 2VGGA 2VC9A 2X1SA 4MG4A 5D9PA 2QCDB 3ZJ6A 1A80A 3GG0A 4EXQA 1YE6A 4H6KA 4MZ1A 3AYSA 2G5WA 4GQQA 2OGYA 4AWEA 3ZWSA 2EF9A 3WNMA 4EIVA 1ZAHA 3LI0A 3P62A 3GVWA 1T99A 3PZUA 1X96A 5C9XA 4AD2A 4GUIA 1WNOA 3HM7A 4OTKA 1GKRA 2V82A 2EPLX 1JCMP 4DY1A 1Z7AA 2CHOA 4JTDA 1L2UA 2F8QA 2WYSA 3V3WA 4MNLA 4F2TA 4GABA 4JNZA 1ZFJA 2UBPC 1JAKA 1TTPA 1MDRA 4MJ4A 3GDLA 3VO0A 1OT1A 2XIBA 4QAWA 3CZGA 3DESA 5GNXA 1TVPA 4IUOA 3CV6A 5AC7A 3KBSA 1TX0A 1FWCC 4FF5A 1IIHA 3KRBA 1A0EA 2BVYA 1F8IA 3HBLA 4JTUA 1V3HA 1A0CA 2H3DA 2W9MA 4B16A 2GFTA 1QT1A 1E4IA 2OSYA 5DEZA 2X05A 1AD1A 1DWFM 4A2SA 1Q6QA 2YBUA 4PTXA 4RDVA 1K8XA 1RY0A 4C6JA 3E5BA 3WMBA 2Z2AA 3S47A 4F0HA 1MUMA 4YHEA 5E0FA 1EC8A 8A3HA 3A13A 1J96A 2WZHA 4S2CA 1H7RA 1OX6A 3OLEA 4A35A 4O54A 1YW1A 1BWKA 2XZ7A 4ZO7A 3WH7A 1YIXA 4C6KA 3W7IA 3MVIA 3T4CA 4U4MA 2PDFA 2NQJA 2NWRA 4PR4A 2PWFA 3W6LA 2JKAA 3REQB 3SDOA 1KM5A 3FSUA 2YCIX 4PMUA 3NPXA 3WFAA 3LQGA 1QBBA 3NL5A 3V0UA 3UF9A 4PMVA 3HOJA 4NL1A 3KTXA 1XP3A 3W71A 1ISZA 1MO0A 2I5QA 2QPUA 1E9ZB 1GHSA 3TYAA 1K7EA 2B4GA 3KLKA 1EGMA 4IM4A 2WJDA 4JTFA 1TO3A 3RO6A 2P1FA 4AVOA 3W74A 5G4WA 4M6PA 5CG7A 4RDYA 3QY6A 5LIKX 5AC6A 4UZSA 3STEA 8TIMA 1FFQA 1EJTC 4HCDA 3S5ZA 2F84A 3WUGA 4YHGA 3GXIA 3U4FA 5CZTA 2EO7A 4XZBA 1RALA 1E6NA 1TX2A 3A47A 6XIMA 4H7VA 4R7JA 3GG8A 3W2KA 4IG2A 1OEPA 2E8ZA 5IRPA 2QMJA 5I07A 3EXTA 3O06A 2PDQA 3T0TA 5A8OA 1H4PA 3HIJA 2B81A 1AK5A 1P48A 5EB8A 4PEKA 2RAGA 3OBAA 3QYQA 5BMWA 1FP8A 4DPPA 1CGXA 4B2DA 1J6PA 1ADSA 2GDQA 2QS8A 3TJ4A 3GK0A 3QV6A 2GJLA 3D5HA 3H24A 4TVUA 3LG3A 4ERGA 1W56A 3F2BA 1A5UA 2VRJA 3HFYA 5HMDA 3P0WA 5CPMA 3BLEA 2J66A 4RE0A 3I3BA 3TKFA 3UCCA 1UWUA 1W3JA 4JTGA 3DIPA 3DHUA 4GMEA 1AJ0A 5BRQA 2CZEA 2HZGA 5AHFA 2AQVA 3WUEA 3CEUA 3LPOA 3GXFA 3RJXA 3A9IA 2B7PA 4PTNA 1PZ0A 5I00A 3KHDA 1DORA 1QO2A 4PUJA 3MJMA 3FKKA 4HA0A 2H9AA 5HOSA 4NVTA 1KR1A 3N9RA 3DI1A 3SCVA 1REQB 4DEFA 2TAAA 3BARA 1LWJA 3WL0A 1O68A 5DQPA 2Z1KA 3AYRA 1H63A 1WBHA 3C8NA 1ZS2A 3BCJA 2AMXA 1C92A 2NUWA 1KQZA 3O6DA 3OQEA 4MUZA 3AHYA 5FF0A 3K8KA 1F9CA 3K8LA 1HL8A 1OBAA 3UESA 5HNNA 3SJNA 1VYRA 4LNCA 2PRHA 2P76A 4NYUA 2VT0A 1E6XM 1LBLA 4REQA 2Y88A 2RH9A 4C6OA 4NAFA 1NARA 3M5ZA 3W7HA 1KFBA 4B3KA 3T09A 1UPPA 3W7JA 3AMKA 4O1AA 1E9LA 2X8RA 3W82A 4OUIA 1N2VA 4R85A 3AZTA 1KCZA 1LWIA 1Z89A 4IGHA 4PTWA 4K8HA 1OFOA 2R9RA 4R9OA 1RA5A 1KV5A 1IZCA 3CV7A 1JD7A 3N6JA 3LCGA 4RNJA 5I3GA 2I9UA 4XBSA 3GKFA 3NZPA 3NSNA 2P8CA 1XBVA 1R3WA 4ADSA 3OLIA 1TTQA 3AXHA 4ZXOA 4Y9MA 4AD3A 3SY1A 4J27A 4TXEA 2Z1BA 4L6OA 2ONEA 4WZHA 5M5DA 1KV8A 3UT0A 3URAA 3G18A 2F2KA 3IEBA 4WSHA 1EEXA 5HJXA 3PJWA 4M29A 3SCSA 1FWNA 1BSLA 3ZWTA 3M5XA 5CC7A 1JDDA 4M80A 4J3SA 3CAVA 4JIRA 2BWGA 2J7BA 1VBJA 2D22A 1R6WA 2IXUA 3E2RA 4MNMA 3SCRA 4QR6A 3RMEA 1XBXA 4CNTA 3PZ9A 5C2GA 2DVXA 3LHYA 2XIOA 2Z1WA 3SO7A 4NYYA 3EA2A 3T1GA 1FWAC 1GUVA 3MWAA 3CO8A 3PB2A 2YSWA 5DO8A 1F2JA 3IIZA 4RX0A 3OZYA 3EMCA 3NQ2A 3NNTA 3GTIA 4N2YA 3C6CA 3NUKA 4CD8A 5CSUA 3UU0A 2G3FA 5T9CE 2VEPA 4DELA 3M07A 3RR4A 2OODA 3LI1A 4U2YA 4OJYA 3PAJA 1KLYA 3BJFA 4A22A 3NURA 1IEVA 5T26A 4EXAA 4IX2A 3ITOA 4Q4KA 1T6MA 3AS0A 1O5QA 3GVQA 2A3LA 4HIBA 2NWSA 2BBFA 1NFGA 4NI8A 3TC3A 3L4WA 1H7NA 1EIXA 4IJCA 2RGLA 1KFLA 4OOZA 3VC5A 2J62A 4ACZB 1YEYA 4CVWA 3WJYA 4JXCA 1QR7A 2HE8A 4K6AA 3UG3A 3L9CA 5REQA 4AHPA 4FEZA 4XSLA 1MNZA 4EACA 4J2PA 3AIRA 1I9CB 1DE6A 1TPH1 2V5DA 4ILSA 3SN1A 2XPKA 4F4RA 1KRCC 2AAMA 4U33A 1OM0A 4H7CA 3RLUA 4OUEA 1PCWA 4JD4A 1LL4A 1XR2A 2OOFA 3WNLA 1OX4A 4LUYA 4HOWA 5C70A 2ALDA 3NO1A 4CKQA 4JQ4A 1P7TA 2XU2A 4UTWA 4WUIA 3WBXA 3UR2A 2GSJA 5EBUA 3TQVA 2J7CA 3MC5A 4KRZA 4DBDA 5HINA 1UB3A 3MP3A 1CXLA 4Q4RA 1PXGA 3NM1A 2OG9A 2QAFA 1M7PA 1Q6OA 2BZNA 4JYEA 2Y5JA 3ES7A 3C0QA 5DBUA 1Q7MA 5EFDA 4CEUC 1ELSA 2RUSA 1S1RA 3VNYA 1TJPA 3CBWA 2G3NA 2OX1A 3RX2A 2EPMX 4D8AA 2QGHA 2DVTA 1UBSA 2VQTA 3MSRA 4YTUA 1YKWA 3D0CA 3PB0A 4PMJA 1PEZA 1VP5A 3IUDA 5HPCA 1UP2A 3QKEA 4I8YA 5DCBA 4LRTA 2QUNA 3VKDA 3DH7A 4LVDA 4ZSUA 1K9EA 3PS7A 3GFYA 4QJ1A 2ZKMX 4NJGA 3URQA 2PDKA 2PDWA 4NX5A 5FJPA 4S3FA 3RPDA 1CNVA 1R9YA 1WDWA 3QR3A 4ZEPA 4V27A 2HRWA 4C6FA 3GS6A 1S2WA 4A3RA 4E4PA 4LCQA 5DMLA 4IIHA 4XZHA 1XIBA 1EEPA 5CBJA 1F6PA 4AWSA 1RCOB 1OFRA 1PIIA 3F03K 1VF8A 2PD5A 3J7HA 1IGWA 3GC2A 3A64A 3TSMA 3WL1A 2AQWA 2GK1A 4L64A 3UXLA 3EX3A 3WLJA 4HMCA 4CNPA 1MW2A 3MVTA 3NTYA 4E8CA 1K7FA 4NJIA 4C7GA 4DJFC 1ENUA 3MSDA 1L0PA 4Q8TA 4X0NA 3ABOA 2BGSA 3ATYA 4WDUA 4LYKA 4AQLA 1AUSL 4IFKB 3W02A 3TYEA 4GXMA 1AODA 2WNQA 5IXEA 3CZKA 3ICJA 4IP4A 4K68A 4L4PA 1FHUA 3BO9A 4YVVA 5DMMA 4MPQA 4ASTA 3P67A 3QM3A 3BXWA 3OQ8A 4ZSTA 5IFTA 2QIWA 3B9DA 3DUGA 1Q6EA 2Q01A 4F9DA 1RLDA 8XIMA 4J40A 1SZFA 3HG4A 4X22A 1ZALA 3QN3A 3S83A 1MEWA 1UD4A 1TQJA 4MY1A 4IUGA 5CSRA 1LLOA 4KESA 1TZ9A 5CPQA 2VJXA 3MQTA 3TUUA 1L8NA 3S5NA 2WC7A 4S3BA 3S2JA 2WB5A 2KZHA 5LHEA 3M46A 4A3UA 1WZMA 3UCQA 2YXOA 4IP7A 1TUXA 3RM4A 5IHRA 4O15A 1RK6A 1PDYA 2X16A 3E5PA 4JCLA 3FYPA 1VEMA 3LQLA 1S5MA 2E9BA 5I78A 3ITYA 3QTGA 4JIPA 1OWQA 3N4EA 1BVWA 4IFOA 3OW1A 4DWSB 2VDGA 4GI9A 3ITGA 3W6YA 4HNVA 1OZMA 4JTIA 2ZCGA 4PRTA 3HU7A 4U31A 4R9XA 2G96A 1ODUA 1HO1A 1S46A 2QW5A 4NY2A 1XLGA 3WG6A 1SZGA 1IGSA 1YQ2A 2XM2A 1MRAA 2PF0A 4AMCA 3V5OA 4HJFA 1UC5A 3P60A 4L80A 2EEXA 3M7SA 1UJPA 1OFPA 1JEZA 3QY8A 1XYMA 2E6AA 2PGEA 3RLGA 4H7ZA 2D0FA 4ZR8A 4Q8WA 4WX2A 3SAZA 3IPWA 4XIMA 4AZCB 4UQDA 1VQTA 5AVHA 3VZZA 3E74A 4ECLA 2YZRA 1YMYA 4QDPA 2PDNA 3AHXA 3KVKA 5D05A 1XPGA 2NV2A 1K70A 5LGXA 3W7LA 3C2OA 5D2TA 4IPNB 2YDQA 3W1UA 4LAOA 5I6SA 3TMLA 4INFA 4JX6A 5JIWA 3SQSA 1DHPA 3W7QA 2B0MA 4RJEA 3F5LA 4O28A 4US6A 1BQCA 1JF5A 1GZGA 4B3LA 4J1OA 2C19A 2GUBA 2F9RA 1KGWA 3MUXA 3WLLA 1EL3A 3CYJA 3GW0A 3PUGA 1W8SA 1OFAA 1FCQA 5CC3A 1K4GA 3MUY1 4GYKA 1NQ6A 6TAAA 1WV2A 3DX5A 3PC0A 3NPVA 1XD1A 1BWVA 2QLYA 2OO6A 4W87A 3EDJA 1U83A 1LCOA 2PGWA 1G7VA 3N15A 5M1TA 3ZVHA 5DMYA 5FSEC 3DHFA 2PDLA 3BOFA 3O3RA 2GUUA 3CIXA 5U4NA 3TYCA 3AMGA 2QJJA 1XG4A 2VZOA 4PULA 3B0PA 1U5HA 1UC4A 4ZB2A 3EX6A 3MHGA 3Q58A 1XLDA 6CGTA 1IWAA 5H1WA 3LMYA 4HNNA 3E0VA 1ZUAX 3ERPA 4ES4A 2HBVA 3UXIA 3QZ6A 4GFIA 4P7OA 5ECVA 3V1PA 3L4ZA 2G4FA 3UR7A 3FSTA 1I6NA 3CB8A 3OBKA 5E0KA 4IX0A 3MDUA 3N13A 1M9HA 3ANVA 3LA4A 5K3VA 3UXKA 4JCMA 1KM4A 1YXCA 3RU6A 1DJXA 2VENA 3I7SA 4W7VA 5DXYA 2V5KA 4JY9A 4GI6A 2P50A 3NDOA 4W9TA 1XF0A 1EWDA 4PMZA 2I1OA 2B31A 5GJMA 4N9CA 1DKWA 1FWRA 4NHVA 3MW7A 4N6FA 3ZR4A 4ZO6A 3WQEA 1ISVA 3L4YA 2NX1A 1A47A 4PA8A 4DAFA 3OA5A 1KCXA 2XIQA 3U2EA 4F9JA 7ENLA 3UG4A 4F0SA 5LYRA 2DSVA 2IMRA 5J04A 3O7UA 3G0SA 2A0NA 4GCAA 4TMCA 3T2PA 4S3JA 1TV7A 2PDJA 4PEEA 2OXNA 3LCFA 1FBAA 1IZJA 3VILA 2OZ3A 2E5CA 3R94A 1PHQA 3IIVA 1B4KA 3K8MA 2CITA 5A6AA 1W1VA 2BODX 3L5LA 3TEVA 3MI2A 2HROA 4C60A 1QI3A 1H60A 1MUCA 2WLZA 1QOQA 3EOLA 4JIEA 5KINA 2QUVA 1UQYA 1K77A 2IS7A 4GGHA 3L4UA 4EXBA 2HPMA 1TWDA 1C91A 3DFQA 4GJIA 1BKSA 3LXCA 1YDVA 3VIIA 1SVDA 3NEVA 4O53A 3TW9A 1FWEC 3UZ5A 5FF4A 1JYNA 1HTIA 4XISA 4OKDA 4PTDA 1UKQA 5CAKA 3CTLA 3KWSA 3T0AA 4MF4A 4CQCA 2YGYA 2BSLA 1Y5WA 1IXPA 1KXTA 5AN7A 4I7VA 3UNTA 2VDIA 2D2JA 3HG3A 4GX8A 4YXGA 3EWWA 3NGFA 2VWSA 2P3ZA 1RR2A 1GTEA 3CZ8A 1OT2A 4LS1A 2GWGA 2BS9A 3LZ5A 3NYZA 1WXJA 2Q8XA 3IJLA 3VA8A 1EJRC 3DC0A 2O9OA 4FB7A 4XX6A 1J0KA 4AZHA 5B80A 1V8EA 3C0JA 1J12A 3GUGA 3ZJKA 4TU1A 4GKLA 4DBUA 4C65A 5C7VA 5CLWA 4CGTA 2QR6A 4ZOBA 2GYIA 4J3WA 4IWWA 5I23A 3S42A 4LWWA 1AH4A 5FEWA 6A3HA 3KAOA 2WV8A 5CPNA 2VGIA 4AIBA 3EXRA 2PBOA 4J3UA 1LL6A 5GPRA 2Y24A 2ADAA 1ZHAA 4U5KA 4N0RA 2DGAA 3CH9A 3WLIA 1UMLA 4E2BA 4V15A 4Z1BA 3K4AA 1R0MA 4C5ZA 1JR1A 3TZNA 4KGJA 1HZYA 3EDKA 4LC6A 2DORA 2HDJA 1EDGA 2ABAA 3DGBA 4GI8A 1E5JA 1J18A 1FWHC 3LPFA 4DYKA 3W00A 3KL0A 3W70A 2NUYA 4KMQA 1NSJA 3O15A 3O16A 1LQ0A 2A21A 4UQ9A 4FIRA 3OGVA 4GQ0A 2OSWA 1UA7A 4DHGA 4HK6A 2JF6A 1FP9A 1TV2A 2ZC1A 2FPYA 2C0AA 3U6WA 1ZBKA 4IMAA 1LM1A 1B3WA 1Q8AA 2NQHA 4WGHA 1SUXA 4G1NA 1OYCA 1J6OA 1BWLA 3BICA 5FF3A 4RW5A 3AAMA 1J2BA 4HD5A 3URBA 4LEQA 4OQVA 5K7JA 3XISA 1XH0A 5FAJA 2A7RA 3WENA 1XIDA 4M6QA 2X7WA 2WAGA 3HO8A 1C8YA 3EWCA 4GUFA 4YNGA 3W7MA 4FXFA 1QJWA 4IGNA 4JFVA 4WKAA 3QF0A 1UWTA 2FTWA 3RCMA 4ACZA 2C91A 4RZ6A 2BVDA 3RF9A 3T78A 3OEXA 3S3GA 2GQAA 1L6FA 4G7EA 1EUNA 3C86A 2XVKA 3B05A 5RUBA 3G1RA 3P5ZA 3VFLA 1XLLA 4X0VA 3LNPA 3A22A 2PCEA 2Q3RA 4JTCA 4MWAC 3TLQA 3M1ZA 3O2LA 2J7HA 4DLMA 1XISA 1D7FA 2BMBA 4FS9A 1QASA 2NV1A 3OYZA 2XFYA 1TB3A 3C2YA 3QR1A 3SJ3A 1DXFA 3W1AA 3WK1A 4PL1A 1O5RA 4MZYA 4GC3A 1HG3A 3R58A 2RJGA 2VTFA 1P1MA 1C8QA 1WUEA 4DB7A 2D23A 2E9MA 4NU7A 3EWYA 4O8AA 2E1DA 2PGFA 2YBTA 3E2VA 1P0NA 1JQVA 1X97A 3TN3A 1EUAA 4QP0A 2PCQA 4RZ5A 1HKVA 2PDYA 3AIUA 3ZQ9A 4AZBA 1T0OA 1A4MA 1I2NA 1X1NA 4GI4A 2NLYA 5HULA 1GT8A 2A85A 2NQZA 4G9PA 1W31A 3IGHX 3RITA 1XIJA 5DELA 1EYEA 4MKNA 2ZX6A 3M0ZA 4E6MA 4DXVA 2VRQA 2YL8A 3GBEA 2W5FA 3EGJA 4PUEA 3P81A 5EL1A 4E2OA 3CJPA 1SMAA 1SU5A 3M0KA 3MI3A 3N6QA 5CPSA 2VVNA 4Y9AA 5JUVA 3GNXA 5EY5A 3LBOA 3CZEA 4H00A 1FWDC 1KC7A 1I0DA 3KVMA 4C1LA 2FZBA 4UR7A 3SGUA 3NO3A 3WDRA 3QMSA 4HB7A 2NVAA 2ZA2A 2AOSA 2YCLB 2ACQA 5EKYA 1W54A 3O05A 1QUMA 2CETA 4TTGA 3ZR5A 2FTPA 1VLIA 4Y96A 4DZHA 1W9PA 1ZB5A 1ZP4A 3MKCA 5GQBA 2E67A 1K9FA 1R3SA 5F2IA 1AL7A 3MUZ1 3R4IA 3XIMA 3OA3A 4PCSA 4ZFCA 5EMUA 2YBVA 4W89A 4R27A 4LAMA 1NOFA 4DI9A 1QATA 4O4WA 1R86A 4QDWA 5JH1A 4EAMA 3O0KA 3USBA 2GGIA 3DDMA 2CZFA 1I4NA 1EC7A 1NF0A 3KVJA 1F8MA 2VX4A 3PUDA 3WDHA 1RCQA 5EPDA 4PL2A 1Z32X 4HYVA 3G1HA 1EC9A 1P0KA 3MSYA 2W66A 2IKIA 3NVDA 2YYTA 4UTHA 2J8GA 2PWDA 2Y0FA 4H1ZA 2V67A 2CCRA 1VHNA 3PPCA 1JCXA 4HSHA 4IIEA 2Z4GA 3A3WA 3VDGA 4FXJA 4ZGYA 4IL2A 1XFCA 3DOPA 5CKSA 4U5IA 5CAHA 1WUFA 1DJNA 3EOEA 3MKKA 2XGBA 2VFDA 3DG3A 4H9MA 4PGLA 1UKTA 5FAGA 1X6NA 3WNPA 2PRMA 4YYCA 5AECA 3TTQA 3AIWA 1MYRA 3IJ8A 3TN5A 3T9PA 2GGHA 3V0SA 2DFAA 1T41A 2BX7A 3AU2A 4O57A 2FH6A 3LRLA 1LZOA 4H4IA 1TWSA 3TR9A 3A4XA 2OO0A 1JL8A 2CPUA 4PE8A 2CLFA 3PK7A 3W81A 3TROA 2HK1A 1PS9A 4H9YA 4QTGA 3DEQA 3TN4A 2WVUA 1AQHA 3L23A 4A4AA 3ARQA 4POCA 1D3GA 2KAUC 3W1NA 2V2HA 5I3DA 3SZ8A 5C9UA 3ITXA 4R7OA 3FAXA 4BCEA 5JVLA 4I9MA 2QJHA 1EQCA 2DIEA 5K9CA 4CD7A 2PZ0A 3UPBA 1Q6DA 2AKZA 2YLLA 1YNQA 3WELA 4M56A 4ENLA 3MMWA 5LXXA 3P14A 1VC4A 3CUXA 3LGEA 3P5YA 2FVMA 3S4TA 2WMIA 3TX9A 1EP3A 3NQFA 3VDAA 1E6PA 3QFWA 2X2YA 4H8NA 3BQ6A 3LUTA 4Z2KA 3T40A 3ABQA 1OVDA 3UQNA 2A79A 3RNDA 5H6HA 3MSGA 4HHPA 1FDJA 3VZYA 2NQ5A 3O8AA 4TQTA 1LOLA 4UNKA 1E6ZA 3FN9A 3CK5A 1VKFA 3UBPC 3CWHA 3WQGA 2O4QA 3APTA 4AVFA 3UJSA 3WMSA 3LZ3A 2BHZA 1FY6A 1TCDA 1E72M 1JXKA 1NDYA 4GY1A 3NL6A 1H09A 5AC5A 3WMLA 3QW4B 3PBMA 4IJBA 1H51A 2PDPA 3MMTA 1B90A 3AO0A 3GDMA 4BWLA 3DZ1A 1RP8A 1H7WA 3F4NA 2CU0A 1PYMA 4IF2A 3RX3A 4B15A 1SJDA 2YJQA 3CQHA 3B9OA 5I3KA 1R2SA 5I5RA 3NOYA 3BSHA 1L6WA 4CUCA 3B0XA 1VRXA 2WBGA 4QE5A 5LZLA 2QDEA 5HBFA 3M5YA 4UFHA 2HNHA 3H2CA 1F3WA 1JGIA 1CWYA 3OTRA 3GHUA 2H8ZA 4X2RA 1QNQA 3W7GA 4UCGA 1XX1A 3INPA 1GVIA 5TQLA 3SRKA 1XIHA 3NG3A 1LQ2A 1EZWA 2ZX9A 5C55A 4XG1A 1E15A 3FS2A 1UMYA 4IQEA 5BRPA 5FOOA 4OT7A 4P8WA 1E6QM 5CZJA 1G67A 3H2NA 4O4VA 3UGRA 3L2IA 4UR9A 1DIOA 1P5BA 2ZTKA 2WBKA 3QHOA 3QHNA 4IHCA 5A8NA 1OC7A 3I6TA 3THAA 1U5VA 3ISIX 3AFBA 4YTTA 5DCDA 4ZQNA 4Z1CA 3Q2DA 3V1HA 2GVJA 1Q66A 2Q8ZA 2DW7A 3PFRA 1C9WA 1SM9A 3U0HA 1V6TA 2YIHA 3S6TA 3EBVA 1KRMA 2E8YA 2DSWA 3GH4A 3ITLA 3V4BA 5C9WA 1WX0A 1KGXA 1RJRA 2O7QA 3VIMA 2DH3A 1YTKA 3OYXA 4JTEA 4ATLA 3ARUA 2DP3A 1SR9A 1H5YA 2POZA 4OIFA 5A8QA 1ESWA 3W7RA 1LLZA 3SQLA 1KM2A 1TV4A 4K7YA 1M65A 3RLHA 3WF1A 4GNVA 3VOHA 4N4QA 3BL3A 3G1YA 1GZJA 3A4WA 3WY1A 2NUXA 2ZUUA 3JZEA 1H3GA 1E51A 3HJEA 5F4WA 4J2MA 4AZIA 1UCWA 2VOMA 2Z1XA 5JQ9A 3QTPA 4LPCA 2ZZ1A 3W7CA 2YDAA 3C61A 4XVEA 3UG8A 3H2AA 1KFJA 3MS8A 2REQA 4C6CA 1NAL1 3GIQA 1XLCA 4ROPA 3S1VA 4OVXA 2J9XA 4QG6A 4KPLA 1XD0A 1E0UA 2QULA 1VFHA 1VBHA 2WOQA 2PDMA 2IPFA 1B3VA 3R2GA 4PSPA 5I3FA 4MADA 3VNMA 3CMJA 3PZIA 2QIIA 6REQA 1JDCA 4KEVA 3VE7A 5DY3A 5C2XA 3GHRA 2RHGA 4YCOA 2V3EA 3JVAA 3TTYA 4LCSA 4DM2A 2CIPA 1B5TA 5BROA 5CSYA 4JKLA 4ALDA 5CGQA 3FYOA 4Y9OA 4GA8A 3THQA 5HATA 4IPPA 5J8LA 2YL9A 3TA6A 2E6DA 5JBDA 4GFSA 2CNCA 1W3NA 4R88A 3M47A 1VFMA 1VPQA 5FCZA 3EWXA 3TSDA 2WCAA 5HR6A 2W61A 1J5TA 2C1IA 2GVGA 2NXHA 3DBPA 3UZWA 2DSZA 2WVTA 4O10A 3HG2A 4PUMA 3WCZA 4AZGA 3CLWA 3H70A 3M43A 3H6OA 2G95A 4XQ6A 7TIMA 3VGBA 2OEKA 1LJYA 3TCSA 4R33A 1OY0A 5ABGA 3GXMA 3QQWA 2J25A 1IF2A 4QSHA 3VK5A 2ACSA 1VJIA 3UERA 2BB0A 1YNYA 2ODOA 4KBXA 4XD6A 4OHQA 3PPGA 4NRRA 3O6YX 1UD2A 2X0YA 4PCTA 4ORMA 3G6MA 4XTDA 3VOCA 1RQHA 1E71M 2R1LA 1ZJIA 4E2VA 4JHOA 3CMGA 4IQJA 2IQ0A 1HJXA 4NF7A 3ARPA 4JNYA 4I90A 3A21A 1TMQA 1BVNP 3OLDA 2Z29A 1O1HA 2XINA 1VFLA 3LRMA 5M17A 2D2HA 1XQKA 3LNMA 2CLHA 3PAOA 2Z6IA 4CU7A 2NZLA 1ZSXA 2FZMA 3GH5A 2XGZA 4HNUA 3R11A 4H6RA 3CHVA 1DHKA 1GJPA 2O9TA 1ZZMA 2J9YA 4MWAE 3PPHA 1XIGA 3GAKA 3OVPA 4HHLA 1W5QA 1W37A 1LG1A 1JCYA 4JYFA 3ZT6A 1AD4A 1JPIA 2NV9A 3I3EA 1O66A 1ICPA 4K1WA 4FNTA 5CCZA 1R3TA 2QCMA 4GZJA 4B5XA 3FFSA 1KTNA 4N7QA 4PMDA 3R0UA 5FEZA 1DJGA 3W7DA 1SZEA 5E6ZA 4HN4A 3SI9A 1L9WA 3N73A 2VXNA 3UZXA 4M24A 2CYGA 2FGLA 3IV3A 4XD4A 1KD0A 4W5UA 2R1NA 1ECEA 2JALA 2ZICA 2EJAA 1FH9A 1TIWA 4QM1A 5C5YA 4AD1A 1EHAA 1S3HA 1OK6A 2Z26A 4O14A 3USZA 1CGYA 1CCWB 4HNCA 4NRSA 1KCLA 1Y0EA 2DSUA 1KW1A 4LVFA 1UR1A 5CJNA 3RPTA 1Y5VA 2PE4A 4ERIA 3WD2A 4PMOA 3BE7A 3IK4A 5LNSA 2OYMA 2GVEA 3PZVA 1LF1A 1SZNA 1FWSA 4DF0A 4MTVA 1QVBA 2YL6A 1XIEA 1H1NA 3CH0A 3QPZA 1UASA 4PBEA 4DJFD 1RCXB 5HJYA 2DZPA 4HOZA 2VGFA 4CD6A 3HV9A 4L6DA 1AJ2A 1VCVA 5ENLA 4K7VA 4ZL1A 1JD9A 1EB3A 2NT1A 4FSAA 1A5CA 3NZ1A 2OU4A 2V5JA 3IJIA 3EDDA 2PP0A 1OC5A 5D04C 4V2XA 1FWFC 3PPFA 1XWYA 1Y5XA 1IE7C 2R94A 1GQLA 3RCNA 3SN0A 1RP9A 2VCCA 3IWPA 4UFIA 2J7FA 3V5CA 1JFXA 1HNYA 1K6AA 4IXXA 4N02A 4HJWA 5F2MA 1O60A 4K8EA 2AL1A 3B8DA 4CQBA 4BI7A 1IXQA 2FH8A 2V63A 4YWSA 1H0GA 4GVFA 4I9JA 1N82A 4C7DA 1HL9A 2GVLA 4LSBA 3FY1A 4LANA 2C14A 3GC5A 3MBDA 3M64A 3G1SA 1JZ8A 1K03A 5A3HA 3A24A 1NP0A 5FA5A 1G4PA 5A6KA 2PDHA 4RL3A 1VB9A 2ZRVA 1IQ8A 3K1GA 4QNWA 4LUTB 2P3EA 4PTVA 4G2DA 3EOOA 1V4YA 1FH8A 2YFNA 3TIMA 4DIAA 2O56A 2D24A 1TSIA 3MMDA 1V0LA 3WO8A 2GVYA 4DPQA 1BGAA 5MKGB 1Z8AA 2Z1VA 4CNSA 3VVGA 3ABSA 4CCDA 3BMXA 3L7RA 1Q6FA 1NEYA 3L4TA 2PLCA 3VFCA 3A5VA 4JTQA 1QW7A 1EBHA 4GNJA 1HP4A 4C5YA 2FYMA 3SSZA 3W28A 1YPFA 3PBYA 1P6BA 3BQ5A 2AL2B 2INFA 4Q6XA 4L1GA 4AF0B 3NWRA 1QPOA 2PD9A 4OOUA 1QDSA 4JTLA 4JX4A 2GJPA 1OF8A 2C79A 1Q5MA 3WNNA 4D6IA 4A3HA 1MDLA 2OWWA 4WXYA 4RV8A 1UG6A 3Q4DA 4IPLA 2WO5A 1MUWA 3MO7A 5A6LA 1R3YA 1F61A 3JUGA 4Z1AA 3W1MA 1D8CA 1NJJA 1WP6A 1TUFA 1R47A 2DJLA 1JG9A 2V5LA 3KDOA 1WKEA 2QDDA 3LTPA 3ZO9A 3KXQA 1TA3A 3KVLA 1QAPA 2VR2A 6TIMA 2PDGA 2XM1A 3LGDA 2W63A 3CS2A 2W4XA 2G3JA 1AVAA 4Q4MA 2QHAA 4HHHA 4KWUA 3MP5A 1JQXA 2OKTA 2W6RA 1J10A 3N3MA 4E0CA 3IJ9A 1CXIA 1B3YA 1VRDA 1LBMA 4OWGA 3II1A 3OHMB 1DWGM 2PBGA 1IXNA 3UA3A 3OG2A 3T8LA 3M6YA 4XKYA 3DHPA 3BLLA 5I02A 1S2UA 3W29A 3HQOA 2BY1A 3TQPA 2ZA1A 1PX4A 3EB2A 5LIWX 3UCDA 3CB3A 3L67A 5DXXA 3WKZA 4WR3A 3BOXA 3G2GA 3E0LA 3DXIA 1E3XA 4LAZA 1E70M 2OLHA 2CLLA 2YPIA 2DZWA 3DFOA 5LA0A 3W7NA 4X60A 1GKPA 2DQXA 4F66A 3N2BA 1AJZA 2ZDSA 3BCDA 5AZ1A 1F4AA 3N34A 4YS1A 2ZBTA 3VINA 1NWUA 3WLMA 3UY7A 4MM1A 1JVNA 3F7JA 2PU1A 4JN7A 4DLFA 2FJUB 3LBCA 3WQVA 4D6GA 3AXMA 3R8RA 1MRQA 4GK8A 4JBRA 2PPGA 5LKYA 1HKJA 2GGGA 3G24A 1I1WA 2YCEA 1PAMA 3HTWA 4XSMA 2INZA 1JF6A 1XLAA 3FGCA 3ZS4A 5I09A 1V0MA 3IK2A 1K4HA 3CUJA 2AGKA 2HISA 3QFEA 3KOFA 4GUHA 5CZKA 3VM5A 4MWAB 3I7QA 4BY3A 4Q4PA 3AI0A 3ZLFA 1XRTA 1J79A 1W3KA 5D33A 3DKJA 4NZCA 3S1GA 2FGBA 1V3JA 4AYGA 4O0QA 1TMHA 1HKWA 4ICMA 1Q4NX 3HGRA 4FNSA 3VOIA 3HPZA 4GCXA 1T8XA 2YR1A 1XLFA 1IEXA 5BXRA 3SCWA 3NSXA 3U2CA 1PZ2A 1QHZA 1UD5A 4QROA 4C1NB 2A6LA 5ABFA 1JCTA 3RRXA 3KOYA 3SQMA 5HUPA 1XGEA 1C7SA 3NAVA 3KCLA 2PF8A 2ZZ2A 3VIFA 2BY3A 1CW2A 2VUYA 1JCJA 4S38A 2WHJA 2EKGA 5PTDA 3P80A 2IQTA 3W3OA 4LUIA 4MDPA 2DZTA 3LXAA 1X7FA 4A29A 4KCVA 4DO5A 1CXFA 1EGVA 4QISA 3BH4A 4F0MA 3GR8A 2YKKA 4IQDA 1N55A 2E5DA 5SWUA 2XH7A 5A2AA 2WHKA 3FXGA 3RUBL 2D2GA 1QU4A 3PP7A 3KZPA 4ATWA 4Y2WA 2DZVA 3UYCA 3U5UA 3V75A 1XSJA 1XPYA 4JQAA 3QLDA 4RPQA 3BG9A 3C2VA 4H2HA 3WH6A 4GYPA 5IOBA 4QS6A 1UWAA 2ZUVA 2Q3OA 3JR2A 5CC6A 2E1WA 2FPTA 2X42A 2OJPA 3GC4A 1FTXA 1IYXA 1ISYA 1F6YA 4UZUA 1KXHA 1OFBA 1UUQA 3V36A 4UNLA 2V0TA 4KW2A 3CUHA 3NJ3A 1PYFA 2DVUA 2XIJA 4LXFA 3KRUA 2DSKA 4UTTA 4NXKA 2WCGA 2PDXA 3UFYA 3S1UA 2VFGA 3H21A 2WNNA 4RNFA 2CWNA 2OEJA 3M9YA 3BAKA 3ZM8A 1VFTA 2P53A 3VKBA 3WQDA 3VD7A 1KTCA 1GZ1A 4LAUA 1XLBA 3ONCA 4IMDA 5JU6A 3BC9A 1KR0A 1UR0A 2VOTA 3IUIA 1JRCA 3WF3A 2E6FA 1XIIA 1LUCB 2EJ1A 5AHMA 4RXFA 5D09A 2GDVA 2NX9A 3EEZA 1R7OA 3W37A 3GM8A 3T0DA 1WDRA 1A3HA 3BANA 4NZJA 4QQUA 4B5TA 1YBQB 3PTQA 2WVVB 1H49A 2CBVA 5L9FA 5DMNA 1AW5A 1V6VA 2WHMA 5LNUA 2WQDA 4MJ2A 2J74A 1F76A 3VU2A 1EP2A 4H8HA 3UVIA 3WLHA 3GNDA 2NQ9A 4HQVA 4NJKA 2V69A 2D69A 3VCCA 3AZRA 2MUCA 2Z00A 4ADUA 1D2KA 4MY8A 2I14A 2JEQA 1YDYA 3VCNA 3ZMRA 5JH2A 3NQEA 3ABXA 3SCNA 3T42A 4LV9A 3WQ4A 3WQWA 2JFEX 2FB2A 3GNOA 2I9EA 4BR1A 3DC8A 3DHDA 3KS5A 2ZUTA 1Z69A 3NR0A 4MKSA 5A6JA 5F7UA 4KWOA 5BU6A 2OWXA 3B0UX 4XZLX 1LBFA 4XO7A 2J7DA 4D6CA 4PUUA 5T91A 3QQ0A 2FFIA 2ISWA 1UP0A 5E9XA 5FESA 4HZMA 4MVAA 3EPMA 2PC8A 1FHVA 2OZ8A 2FTYA 4H9XA 4QE4A 3TWAA 3LLXA 1DWIM 2G0WA 3RDKA 4PRWA 2BGQA 5E93A 1I60A 3VZXA 1W32A 1QW8A 4GISA 4A8NA 3UGVA 1YX1A 2Y6ZA 2AGTA 3E2SA 3UJ2A 1BRLA 1L2QA 4B9YA 3G0XA 4EF9A 4JR5A 1EPXA 4H8VA 1RBAA 2VVSA 3HPXA 1GPWA 2J7GA 4NZ4A 5C54A 3B9NA 3UZZA 1UJQA 3E6EA 1CI1A 2FLIA 3HB9A 3N11A 2VWTA 2DPEA 1ZQ5A 1J2WA 3W4RA 1LQAA 4CNUA 4RV3A 5I3HA 3W84A 4AWTA 4NAEB 1XSKA 1KBBA 4JDBA 1F05A 4GHRA 4NNAA 2BOFX 4ZTXA 4KIEA 3N25A 5E0CA 2OB3A 3VOGA 1TJ0A 2PTXA 4ZB5A 1QOPA 2E3ZA 2KX9A 4AIEA 1YDOA 1OIMA 3W22A 2YL5A 2E6YA 3F4DA 2Z24A 1VAHA 3R8GA 1KQYA 3FYYA 3R25A 2WMGA 1FWBC 4WSJA 3VE9A 2IXVA 4AY8A 7XIMA 3WLKX 4W7WA 4IQLA 3HZ3A 1TVLA 1WDQA 1HVQA 1EDTA 3MHUA 2A4AA 3ECQA 2V5CA 3OG3A 3BAXA 4FLQA 1DL3A 2XTKA 2R6OA 1TE1A 2VZTA 3JW7A 5JBFA 1UKOA 2Y8VA 1KB3A 3FIGA 5M2FX 1G5AA 2DT1A 2NXGA 1O4UA 3AHZA 3NQ7A 3CWNA 3S5YA 2XFWA 4X61A 1Z48A 2ZX7A 1K02A 4YTSA 4JTHA 3P93A 1GYNA 4GO8A 1AA1B 5GNYA 3WH8A 4US5A 3H2EA 4LBSA 3CHDA 1SO4A 1VHCA 3QQ1A 5EA9A 2RDXA 1KNWA 4N4PA 4C6PA 1KM6A 2J8FA 1EJ7L 2J75A 5A94A 2VZVA 4DJEA 3ID7A 2QF8A 5K9DA 3TMQA 3W7EA 1OGSA 1FH7A 3GNPA 1XC6A 4AX7A 3SUWA 3QV8A 4KEMA 2VNCA 3THDA 1YXYA 2JF7A 4FHAA 1UWIA 4F79A 3C3NA 4O17A 3AZSA 3ORWA 3WJWA 1UR2A 4WD0A 3VCRA 2QCFA 3W76A 3OB8A 2ZQ0A 1JJKA 1A50A 4Z2IA 3CT7A 5ABTA 4PMYA 7REQA 1DIKA 4LYPA 4TTUA 2Z2BA 1DXIA 5KMYA 1E9YB 2PP3A 4FPSA 3AIBA 3MV11 4LCRA 2GJXA 5IHSA 1RAKA 3PNZA 5G5IA 1QW9A 1JI1A 3HJZA 3BTNA 1JDFA 1BLIA 1IT7A 3P7YA 1HVXA 5I3IA 5TNVA 3GDRA 2ZRWA 1S38A 2C1HA 4HTBA 4UMAA 2A7NA 2R91A 2EXOA 5JXQA 1HP5A 4LT9A 4J4KA 5A6BA 1VEOA 1F3EA 1HGWA 4AAJA 5D2XA 5H8UA 2FJKA 4JTSA 1W1B1 1Z6KA 1DQWA 3NYDA 3MDWA 1G94A 2ATMA 3U57A 3W2LA 4HU8A 1W1YA 3BZJA 3LN3A 5LNRA 1OC6A 3M0HA 3QZAA 2IPWA 4O8RA 2A3HA 3EXSA 2Q8LA 1D8WA 5G1MA 1NELA 4QEHA 4WJ8A 3H2OA 2VCBA 3GH7A 2EPKX 3LDVA 4UMCA 4FI4A 4Z2GA 1KLZA 1J0IA 1NFPA 1S3TC 3TZFA 3AS1A 1UR9A 1BTCA 5KZMA 3WF4A 4OGZA 1CENA 1VBRA 2VFIA 1XRVA 3CPUA 4O1CA 4YIWA 1JZ2A 4M19A 1KM3A 4E2DA 4B5UA 3EKGA 2QAPA 2O0TA 4UTIA 3TAOA 3NL2A 1FOBA 2DDXA 3KBWA 4L6HA 4BHYA 1UW9A 1V7YA 3SW6A 2A2IA 4UWMA 4GXPA 3H23A 1K6WA 1UKPA 2DZBA 3QOMA 4DO6A 5BCAA 3LPGA 3ABZA 1XFBA 1JAEA 3KX6A 1FWWA 3GUWA 3NPWA 2F61A 2YXXA 4RK8A 2WANA 4FX8A 2QYGA 1A5LC 4UOJA 4L9YA 4HPXA 4P2VA 2AAAA 4L5ZA 1X8FA 1WDDA 4F3HA 3IGSA 1FHLA 4V33A 3M0XA 4WOZA 4QX4A 3C0SA 3L65A 2XH4A 3FDKA 4EF8A 2JBMA 5A6MA 3LOTA 4PCPA 3CV1A 2ZIDA 4LFYA 4AG0A 4J3TA 2QUUA 2OMAA 3L2LA 4B92A 3QZEA 4DF1A 2FVLA 2ZVRA 2A3CA 4P8UA 1LTDA 2CERA 1Q13A 4L65A 3S2NA 2X40A 4KEUA 4RDWA 2G4JA 1FRBA 2O9RA 1TRDA 5BU9A 3SUTA 2O9PA 1GOMA 2UY4A 1E0TA 4JTAA 3QSRA 5FKYA 1LORA 3B04A 1XYAA 4B4FA 3MV01 3BLIA 1I2OA 3GDTA 3E12A 1PKNA 3CUZA 3FEQA 4HSNA 4KKXA 4QRNA 3IAPA 3WDIA 1VCFA 1CT5A 4MLJA 4C1NA 1QTWA 1XLEA 2QDHA 3M41A 1ML1A 1H50A 3H7VA 4XZMX 2MANA 4IJRA 3TYUA 1XINA 2CLMA 2ZE0A 2Y4SA 3F5JA 1PDZA 1JXJA 1QHPA 2WJEA 4GQBA 1X6UA 2OZTA 3P3BA 1XRSA 1WPCA 3EX4A 4ADTA 1GTHA 1BXBA 4QCFA 2XFFA 1XCFA 1YNPA 1E73M 1XUUA 1X98A 1XYZA 3T0CA 9XIMA 3LBMA 1ZTVA 3JZUA 3FA3A 3GNRA 2FDMA 2VO5A 1B0IA 2A3AA 4GIRA 1E1CA 4GVHA 2QKFA 5FEPA 1XDLA 1ZBWA 3CAKA 3NQGA 3WFLA 5F4SA 1VR6A 1W91A 1ALDA 3DYPA 5A8GA 1E43A 3Q45A 3R1ZA 3BAWA 3G1XA 4HVXA 3U2OA 4L1WA 1ZNNA 3VNJA 4R5EA 4PC8A 3POCA 4ML4A 4E4UA 4P61A 3SCTA 1YYAA 3SUVA 1V7AA 4TO8A 3W26A 1UHVA 4Y7EA 3CASA 1QFEA 2ZXBA 1TPC1 2ZZ6A 5T8GA 1V08A 4M6UA 1D9EA 5AHIA 3KCOA 3SSJA 1IEQA 4BQ3A 1TZ7A 3O6AA 3KUMA 3KRZA 5DBTA 3T55A 3N2TA 3SGZA 3WLRA 2NVDA 3CUIA 4UB9A 3G0UA 1OGGA 4GQGA 5TD4A 1W5NA 1WYIA 2VX5A 1OINA 1Q85A 4I7WA 2BLEA 1W1IE 3ZFHA 1C9DA 1UZDA 1GW9A 3K46A 2WC4A 3A9BA 5FJRA 3RK8A 3U4AA 1RLCL 2F7FA 2XHYA 3DFTA 3IJ6A 3WDJA 1C93A 1UD6A 3LPPA 1Z3NA 1K3UA 4Q7IA 4JEQA 1CECA 1DWAM 4GYJA 3LHUA 1U2YA 5U7SA 4K37A 1J01A 3OO2A 1NF7A 2PMQA 4A05A 3C0LA 3SEPA 3U9IA 5C71A 2CKRA 3MA8A 3GFXA 4JIQA 4ZODA 3STFA 4LVAA 2JEPA 1TFVA 4S1FA 1VYPX 3RPMA 4CN4A 3WQ8A 3NO5A 3W25A 3OZMA 3DFNA 3KEHA 3WZ0E 3NOEA 5BXPA 3CUGA 4O50A 1LL7A 1O5KA 4EWJA 3W1TA 4WIWA 4MOZA 3DCPA 3KFTA 1ITQA 3GLCA 4UUIA 3VIJA 4A6GA 3GXPA 1XH2A 3E9AA 2PWVA 1QNOA 4HK7A 2ZRYA 4WY0A 3NQCA 3TTEA 1EDQA 4UTUA 1WZLA 5F4XA 4QJ5B 4WHBA 2P5NA 3N18A 4QFUA 3BW4A 3A6OA 3GVVA 2X41A 2FZ8A 3TSBA 3W1LA 5LGZA 2HJPA 4PUWA 4JHZA 4J28A 4WK9A 4GIAA 2CLKA 2J6VA 3OODA 1H0IA 2GGJA 5IDZA 3CL8A 4UNIA 1EXPA 2V2DA 4NJHA 4HA3A 3BGJA 1IEWA 2PEVA 3P74A 3HMJG 1M3UA 5G1TA 2VC5A 4S2BA 4LGXA 3V18A 1W1A1 4NG3A 5A8MA 4E38A 2QJNA 4N9BA 5HWJA 2FZDA 3PSVA 3KLLA 3M5VA 4KETA 1XLIA 1GNXA 2GWNA 1XYBA 2XWDA 1XICA 1SZRA 3M0MA 1EA0A 1PJ9A 3G22A 3PHAA 4N9DA 5C7HA 5HMSA 4ZOCA 2TPSA 2OKOA 1I2QA 2O4MA 3DI0A 3P8IA 1OHLA 4L4MA 4W88A 2OYLA 3ARZA 1PWMA 1AZ1A 3FW6A 2DW6A 2QMKA 4B91A 4W85A 1V6UA 5HNTA 1EHNA 2ZOXA 3MB9A 3AJXA 4GOAA 2WMJA 1XIMA 4LYRA 3VD4A 1M04A 4JL1A 3F4WA 4LS0A 2VCAA 3RFAA 3DENA 3T8QA 1PTGA 1ZPTA 4WXZA 3LTYA 2WM0A 2OT1A 2XVNA 2OEMA 2ZZ5A 3PY2A 3DBNA 1CGTA 3AROA 4IG2B 5I0DA 4LBRA 1ZP3A 4ACYA 5B7YA 1E4MM 3AYTA 4JL2A 4Y9PA 2VHLA 3HQ1A 4XAZA 4ZO9A 2D20A 1B9ZA 2E4TA 2HPIA 4W86A 3GKAA 4RZ4A 2NQLA 1MXGA 3VPLA 3PZGA 1BYCA 3TTSA 1BXNA 1R30A 1C90A 4C6QA 3RAOA 1QK0A 1GYLA 3KS6A 1O12A 2YOCA 3UWZA 1MFVA 1ECQA 2GJRA 1CIUA 1GCYA 2Z27A 4LV4A 3Q94A 3W83A 2GZXA 1OSEA 4F0KA 2VC6A 4J3ZA 3GE7A 1PZ3A 4K2SA 1HQTA 3GIYA 4HA4A 5EMKA 1M7XA 2YDRA 4IISA 1A5NC 4MB5A 1QK2A 1XXXA 4HNOA 4MPKA 4KWSA 1CGVA 3NFUA 3CQIA 1BG4A 5CPLA 3OZPA 2CESA 4CNNA 5IBXA 1EJSC 1GEHA 3EMZA 3WBYA 2H9AB 2A7PA 4K36A 3LTSA 3QGKC 1X39A 4KCTA 5A1AA 1J0JA 3OP2A 1XLKA 4DUWA 3S9IA 3D3FA 3ZJ8A 4DNHA 4DM1A 5F2GA 3TLLA 3QYSA 3PZOA 1DJZA 1JNDA 1UZHA 5E6YA 1HJVA 2P10A 2YYUA 3KBJA 2QCDA 5FACA 1KFEA 4REQB 1AW1A 2WCSA 5XINA 3B40A 4JICA 4NAFB 4Q33A 3L0KA 1TWZA 2HVOA 3F1QA 5AC8A 1NU5A 3P84A 3E1F1 4I5UA 3GVGA 4WEVX 1WZAA 2ZZ4A 3PBGA 2ALRA 3OIXA 4AXKA 1FVPA 5HWMA 3S1XA 3W0KA 1T7LA 3W7PA 2JK2A 3W6MA 1OQFA 1Q6RA 2GGEA 5AYYA 4FMVA 3ZXWA 3QSTA 3AMDA 1JPDX 1TV5A 2ESCA 5DT5A 1E6RA 4O1DA 1KTBA 1DJYA 1GQNA 3N9KA 2EQDA 3Q37A 2W27A 2EG8A 4LAKA 2V2CA 3K4DA 3W75A 3FX4A 4G5DA 4PFHA 3ZYZA 1U1UA 4UTLA 1DJHA 3VKAA 1FWTA 1M68A 2XH0A 4S3AA 2FFCA 1WDSA 3WH9A 2F6XA 2VR4A 5G1YA 1IT8A 3VKKA 1UPMB 1X38A 3UWYA 2XVGA 4WOQA 3W23A 4CEXC 4PCNA 3LCXA 4J3XA 1WE5A 3LRKA 1NVMA 3W27A 3B8VA 4FLRA 1JRBA 3WQCA 4W4QA 1S1PA 7ODCA 4U2ZA 2V3DA 2JQXA 1F74A 4XAFA 1DTUA 2G97A 3WJXA 1ODZA 5AFDA 4ATDA 1KBLA 3VDBA 3QR0A 3DFHA 4BZYA 4B5NA 3N2MA 2W79A 2BNJA 2PWUA 1HKIA 3UEQA 1KKRA 1RBOB 4M1BA 5HR7A 3FK4A 3TVAA 3W88A 5GNZA 2R82A 1GVFA 4F2BA 3DFPA 3EX1A 2CFFA 4XD3A 1BGGA 2BHUA 4HHMA 5GJPA 5HUOA 3BZGA 4KRUA 4PMQA 1SQ7A 1Q4WA 3REQA 3WK0A 1UWQA 3NIYA 8CGTA 1C8VA 1A3WA 3GW3A 3M0LA 2HVNA 3QGVA 4CLMA 2E09A 3WYZA 3E2QA 2XSAA 2X1RA 3JRKA 1K7XA 5KZEA 2E77A 3DG6A 2V8ZA 2ON3A 3LLDA 1YPXA 3C56A 4S23A 3G3MA 3UA4A 3DERA 2XVLA 2FGZA 2ZDRA 2A5HA 4BWLC