3M1ZA

Crystal structure of the mutant v182a.v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIAGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 86
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m1zA00
1YTDA 3TAOA 4LUIA 1ME9A 1TMHA 3TXVA 4O19A 3PS7A 4DBEA 1KLZA 2R91A 3W2KA 1RR2A 2ABBA 4QJ1A 4QQ3A 3H53A 3LRMA 3LV5A 3U6WA 2NUXA 3M41A 1BEUA 3P5ZA 2FPYA 2B7OA 3W7QA 4DF2A 1B4EA 2A0NA 1ZFJA 1QWGA 1OX5A 5CKSA 1SQ7A 3PBYA 3QQ1A 2ABAA 1N8FA 3QSTA 1DOSA 1AL7A 2JK2A 2DZWA 1I45A 2VXNA 2Z2UA 4JXCA 2G95A 4LNYA 2NWSA 4O1CA 3TCEA 5AC8A 5F2LA 3UWYA 1DJNA 2EHHA 3KAOA 2XN0A 3HIJA 4FNTA 4J9JA 3HG5A 4CNPA 2C1HA 5G2IA 4WUIA 4Y6GA 2B7PA 3UWQA 4XKYB 1L6WA 3L0KA 3S6DA 1LOQA 4OQVA 5H2ZA 1WXJA 5CZTA 3W7JA 1GT8A 1SO5A 3BW2A 5LGXA 5E1QA 3RMJA 4RCXA 2PRHA 1J2WA 2H8ZA 4JTSA 5D03A 2QUVA 5D32A 1W5NA 3WJYA 1WYIA 4UTKA 3DKLA 4LW7A 5BOOA 4IOTA 3CWOX 4ONVA 1I4NA 1NFBA 1LORA 3DFSA 2G5WA 4LS2A 4AHQA 5HWMA 4HNVA 1ME7A 3NDOA 1XXXA 2A2IA 3C61A 3W2LA 2VENA 4OE7A 4M6QA 1ZCOA 4O8RA 1OX4A 1YXCA 4JD4A 5AHMA 3SZ8A 3VE7A 3PM6A 3TROA 1EP2A 1S5VA 4OV4A 3TSMA 2O7SA 4LV9A 2E6FA 2WV8A 2YDAA 4IXXA 1FCVA 1LOSA 4RZ6A 4BI5A 1VCGA 1TCDA 4JR5A 4O1BA 1Z48A 4OBTA 4MFDA 5D30A 4QITA 3P5YA 5F4XA 3G1YA 3G3DA 4M7SA 5FEZA 4Q4KA 2Z1BA 4RX0A 1DORA 3LBCA 3TQKA 1UUOA 2Y62A 2DORA 1H7PA 3PUOA 1GEQA 2C0AA 2CLIA 3SW6A 1PS9A 5G2HA 4MY1A 4R7JA 3W76A 1KW1A 4X22A 4MY9A 3BGJA 5FEXA 4B5NA 2E6AA 2H3BA 4GFSA 3QF0A 1OF8A 4O1DA 3NR0A 3R12A 3WK2A 5KMYA 1TV7A 4WZHA 1G4SA 4PL2A 4YCOA 4JTEA 2OX1A 2ZTKA 1XBYA 5E0KA 5J5RA 4TX9A 1KM2A 4K38A 4S2CA 1QO5A 1X1ZA 1L6SA 1J5TA 3N14A 4UTWC 1MXSA 1KFEA 1QOQA 2GUUA 5BRBA 3L66A 4JS3A 4WOZA 5J5DA 4LVFA 1G4TA 1JR1A 5HWJA 3GDTA 3PY2A 1WBJA 3FS2A 1VCVA 2ZRUA 4O50A 2R94A 3LHUA 4AF0B 1ALDA 1GTEA 4K8HA 4LS0A 1MEWA 1T96A 2ZTJA 2X1SA 1VLIA 3L21A 4PL1A 5HUPA 5MHBA 2VELA 1O4UA 3ATYA 5D2YA 2FDSA 2CFFA 4X3ZA 3W2UA 2GQ9A 3DFPA 3EX3A 2I1OA 2CLHA 3QW3A 1LM1A 3M5XA 4M5PA 4LWWA 3OEXA 3TAKA 2DU2A 1FXQA 1H60A 5LNRA 5D37A 4YWIA 3BGGA 2GQ8A 1KV5A 1OABA 3M5ZA 4QSHA 1DV7A 5HR6A 3GB6A 2X1UA 3HGJA 3BW3A 5DCBA 4MFEA 3LHTA 5F2MA 3N2MA 1XKYA 3W3OA 4K39A 4IMFA 5BMWA 3GR8A 3IVTA 4N4PA 3QFEA 3LDVA 4O16A 1H7OA 3CEPA 3SY5A 5F2IA 5EKYA 1VHNA 2W79A 2UV8G 3PVFA 2DZVA 3UZJA 1VQTA 1RQEA 1XFBA 3MHGA 3ZS4A 4O1AA 1RVGA 1EB3A 3W1MA 1VYPX 3LBMA 3QQ0A 2QCCA 3A9IA 1L2UA 4UTWA 1OFDA 1HO1A 2OT0A 4NXKA 3W85A 3CT7A 2GVGA 3M5VA 1QAPA 1VYRA 2PRLA 4OGZA 1OF6A 5C55A 4Q33A 3L67A 3LM7A 4D2JA 3I65A 1Z41A 1FWRA 3O07A 4MYAA 3W7NA 1K7EA 3S1WA 4JTKA 1LRQA 1SPQA 4IMGA 3CQ0A 3PB0A 3EX1A 3W1UA 1KM4A 3NQ6A 3W1AA 4O17A 3LTSA 1W5PA 3O63A 3SR7A 4E0CA 4UNLA 2V30A 1YXYA 3HGRA 2CZEA 4JNMA 3GX9A 1LCOA 4GUFA 3NQFA 3G1SA 3TJLA 3M44A 1W56A 2J27A 2ISSA 2RDTA 3C2FA 4IQLA 3N9RA 3TU9A 4LC8A 5F4SA 1P0KA 2CWNA 1ZALA 2A1YA 2CLFA 2ALDA 1KFCA 5KZDA 3LXBA 3UY8A 5BMXA 2YYTA 3MBFA 3IGSA 1M6JA 4GUHA 4YL2A 5AYXA 3GR7A 4MIMA 1ML1A 3PF3A 4MOZA 2Q3RA 4NNBA 3F4NA 4TMCA 4JTJA 1OHLA 3EX2A 4HNUA 1KM6A 4FNQA 2VOMA 3HMJG 2ATSA 3T7VA 5EPDA 5EYWA 3LB0A 4WOQA 2VEIA 3I6RA 3SGUA 3BLEA 4WJEA 2C6QA 1FBAA 4JTHA 1LLZA 3G0SA 5F2GA 3HPZA 1OX6A 5DY3A 4OWGA 3QC3A 2FFCA 1SO4A 2TPSA 1SZGA 3BARA 2YZRA 4Y8FA 3GXTA 3TNOA 2YGYA 1TQJA 2H90A 5FF7A 1IXQA 1WAUA 5HWNA 3W1PA 2NWRA 2XN2A 4NZFA 5K4XA 1ICQA 1JUKA 3LGEA 3UWWA 3F4WA 1ICSA 4NNCA 2B0MA 4XTIA 3W7RA 1J4EA 5K7JA 3NZRA 2J9YA 3STEA 4CCCA 1OFPA 1A5CA 2Y88A 3FA5A 3SSJA 5AHFA 3LCLA 4EIVA 3C2EA 4A21A 4GC4A 1OG0A 3I7SA 2HMCA 4YCPA 4UTJA 1H61A 1TV5A 3P61A 2E5BA 4LVAA 3LI0A 4A29A 3EXRA 4IPJA 3USBA 1F74A 4BR1A 1HL2A 1H62A 4JIQA 2JBMA 3C6CA 1QNVA 3UNDA 4JX4A 3IIOA 3B04A 1PHWA 2P10A 1S5WA 3M1ZA 3W86A 1W31A 4NU7A 1RPXA 5FEPA 4DBDA 1QO2A 2GPTA 4LRSA 3UWVA 3IEBA 2HS6A 1KBJA 3UD6A 4OHQA 1KM0A 1LYXA 5I3FA 5L9FA 3UYCA 3L0GA 5D33A 4DPQA 1DHPA 2ZRVA 4N4QA 3ELFA 2V0TA 2Y89A 4R33A 4GWEA 4EWND 3L5LA 3T78A 3GLCA 1B9BA 1JCMP 3A22A 2QDGA 2YXGA 4UUIA 4PC8A 2X1RA 3VI2A 3BK0A 4E2BA 3MI3A 2QCDA 3M47A 3IGUA 2QCEA 2GJNA 4K7YA 3TX9A 4AVFA 1PVNA 2EGZA 3M43A 3DFTA 4MPQA 4EVZA 1VGAA 2XFWA 3NO5A 5K9XA 2C15A 2QDHA 3VNDA 3QYQA 1EEPA 2V8ZA 2ZZ3A 1DVJA 4JTUA 4BI6A 3S1UA 1TJPA 4MVAA 4NJHA 4ZQMA 2AAMA 1GVRA 3TC6A 1XDMA 1W1ZA 1GTHA 4IPIA 1I2PA 1K7XA 4N9CA 3BV4A 3DZ1A 3PBVA 1QOPA 3THAA 4M6VA 3NG3A 2AQWA 4MLRA 4XUGA 1A5AA 3C0JA 4QIUA 5G2WA 1I2NA 3WFAA 4UFHA 3NQCA 1TPH1 3EKZA 4RKAA 3ABQA 2WSYA 2FPTA 1GVQA 1TREA 3NQDA 3MI6A 3E12A 1DJQA 4JX6A 4I7VA 3O1NA 3IGXA 3E02A 2Y61A 3U2OA 2A4AA 5DCEA 2WSQA 1VH7A 1TB3A 3EEGA 4ZL1A 2QF7A 3ABSA 4RXFA 1DKWA 1FCBA 2FLIA 4ZQOA 2Y7GA 5FF3A 4QAIA 1QR7A 2WJZA 4JY8A 5F4WA 3AJXA 3STGA 4Z08A 4DO6A 2CZ5A 6TIMA 3KRSA 1VRDA 1YTEA 2QCMA 1PL9A 2FTPA 4O18A 5TBOA 2OJPA 1GJPA 3LCHA 4HPXA 1GYLA 3KRZA 5D05A 1OYAA 3W84A 1Q6OA 1ICPA 3NM3A 4WD0A 4UFLA 3ZWSA 3HBLA 1WX0A 3L2IA 1LTDA 2Y6ZA 3IRDA 1IXNA 4Z0JA 1PV8A 4FX8A 5CGQA 1KTCA 3OVPA 2V82A 4CCDA 5HULA 2Y7DA 3LXAA 1KTBA 1FWSA 2E5CA 5DELA 1YADA 4L4MA 1RQHA 3LXCA 2E1DA 5K9DA 5AHIA 5LNSA 3NEVA 3INPA 5TQLA 1GWJA 2V5LA 5G5IA 1O5XA 3K30A 1JCXA 4IMCA 3M16A 3BVJA 3W88A 3FYOA 3CLMA 1QMLA 3P67A 4O54A 1XCFA 1UJPA 4BWLC 1C29A 3NL2A 2EKCA 3GDLA 4UFKA 1DQWA 4FIRA 5KITA 4UTLA 2ZZ4A 1NSJA 5G4EA 5FI8A 1H1YA 1LBMA 2A7PA 2YCEA 2JKAA 4KFPA 3GZ3A 1VPXA 2ZYFA 3G18A 3G22A 2C18A 4LU0A 4Z1BA 4ZQRA 4MLJA 1YTKA 3ABRA 2H8XA 4IMDA 4NJJA 1K3UA 3S1VA 2WO5A 1TPFA 2PCQA 2WOQA 3GK0A 1LBFA 1OFRA 2CZDA 1VJIA 1HUVA 1EUNA 1WBHA 3C3NA 3C4UA 3PG8A 4HN4A 3C2RA 1LZOA 4GXMA 3S5NA 4JYEA 4NT0A 2TYSA 2PURA 4CQ8A 3L5AA 1OFOA 3PC0A 1W37A 3FKKA 3HOJA 1F6PA 4ADTA 4MZ8A 1QCWA 5CPLA 2A85A 1EUAA 1X8FA 3LCXA 1TRIA 1ZAJA 4Z1CA 4FO4A 3TQ0A 4P2VA 1SSGA 4UR7A 1TPC1 1SFJA 5K4ZA 3PWAA 4ZQPA 5CPOA 4UTMA 2WKJA 1W0MA 1V7YA 5I3JA 2Z6IA 1E51A 1EWDA 2E6YA 5KTLA 1KBIA 4FB7A 1OK4A 3LHVA 1I2QA 3STFA 3LV6A 3W73A 1XC4A 2ZA2A 4AH7A 4YLWA 4BWLA 5AHEA 5I3HA 1K8YA 4GUIA 3CB8A 4CQAA 1GG0A 2I9EA 2NX9A 5C6MA 4AWSA 1MSSA 3A24A 3W7CA 1HFBA 3P8IA 4A2SA 3MP5A 3B0UX 2DZTA 2YPIA 2CLLA 4JYFA 3SFKA 4K6AA 3GAYA 5AFDA 3W7EA 3W9ZA 1FDZA 5CPNA 4FNRA 3GYEA 2BXVA 2DJLA 4H3DA 3QPYA 3IVSA 3LHZA 7TIMA 4ZQCA 3TMQA 5EL1A 5LSMA 3G0UA 1IGSA 1NEYA 3QMRA 3Q2DA 3OVRA 1W8SA 4O28A 5G1TA 3R89A 2R8WA 3DFOA 3P60A 3W1XA 2J24A 3DGRA 4X9SA 2A5HA 3TR2A 2YSWA 2Y63A 3MUXA 1SZFA 5FESA 3O6CA 4RZ4A 2Z0IA 3A5VA 3FYPA 5SWUA 3WK3A 1VZWA 6ALDA 5LKYA 3BG3A 5I3IA 2RKXA 5U7SA 5HNRA 1M7OA 4JIPA 5H91A 2BX7A 3LX9A 3LLDA 2J9ZA 1FQ0A 3EWWA 1IXPA 3Q94A 3TJXA 1TTJA 3TA6A 1G4EA 3P80A 3LCFA 2RDUA 4DQWA 3LRKA 1VC4A 1WDWA 2Z6JA 4MZYA 3SJ3A 3B05A 1MZHA 3TFXA 4UTUA 1K03A 4GE8A 2YW3A 4RR4A 1XUUA 1WOBA 4RLIA 3TSDA 2FQIA 3KVJA 3KVMA 3CM4A 2EF9A 4A22A 5KINA 2DZSA 2Y70A 3P74A 2C13A 4AAJA 5G1YA 3MO7A 2DJXA 1G67A 4AF0A 1U83A 4AMAA 4WX2A 4AB4A 4O15A 4Z1DA 1VCFA 3TC7A 3B06A 4JEQA 1X6UA 1AG1O 4HSOA 3MP4A 2Y7FA 3LTPA 3W7OA 2WNNA 5DLCA 2BZNA 3UXAA 3NGJA 3JS3A 1LRTA 1TPVA 3NAVA 1H50A 2BSLA 3C52A 1G6CA 4I9AA 1XI3A 2RHGA 2JKPA 2Y7EA 2IQTA 1N55A 3RNDA 4GBUA 5D02A 5BNKA 1NVMA 3LCIA 2V2CA 2ZZ7A 3TW7A 2J88A 1C9DA 1FUYA 1WQ5A 3O8AA 1EPXA 4HIBA 3DENA 1FCUA 1TPB1 1XBXA 3RU6A 4K37A 1EX5A 1MO0A 2EPHA 4UNKA 4XTDA 4Y96A 3ABOA 3G3MA 3MI2A 2PRMA 3ANYA 2ZZ2A 3SIZA 3N9SA 1P5BA 1FDJA 1TPEA 4ORMA 3A23A 1I2RA 2ZZ6A 2A7RA 4Z1AA 3FKRA 1HO4A 3LHYA 3LTYA 1KFJA 3G1FA 1NAL1 3O15A 3NL5A 4O57A 3M0ZA 1LOLA 3EX6A 1SW0A 3UWZA 1B4KA 1ADOA 3NQMA 4EOUA 3DU0A 2V2HA 1WA3A 2R14A 4ICNA 4UR8A 3W07A 2BWGA 1AW1A 3E96A 4Y9AA 1ONRA 1SO6A 5AOUA 3G1HA 4WY0B 2HTMA 2YFOA 4KWVA 4ZVJA 1SZNA 2HS8A 1F2JA 4LY8A 1T8XA 1G7UA 4PODA 3DAQA 3EWZA 2X30A 2BLEA 4U4MA 2JKEA 4O0KA 3WJSA 3A21A 2FIQA 2ZZ1A 1FX6A 1ZJIA 2B7QA 4TIMA 1EP1A 3WK1A 1GVOA 3W1TA 1TO3A 3MHUA 3O06A 1XBZA 5CG7A 1AK5A 3V1PA 2NV1A 4LRTA 3CIWA 4IMEA 5DCDA 3TIMA 1OFBA 4DF1A 5K9CA 2NX3A 3W7HA 2ZFAA 3IV3A 3MBDA 4IJBA 1QFEA 3NPXA 1F76A 2XN1A 1THFD 4JTLA 2VFHA 3RFAA 1QDSA 1T0OA 1SSDA 3W71A 1PE1A 1PCWA 3QH2A 4JDBA 2O7QA 2NZLA 2ZRWA 5T26A 3OG3A 1B3OA 1PIIA 1EIXA 2OZ0A 1NF0A 3W7IA 3KRUA 5AHNA 1I8JA 3OVQA 4UFIA 5G4WA 3L0NA 1IXOA 5KZEA 2NXIA 5HMSA 1I2OA 3YPIA 4CCEA 4HNTA 3Q37A 4E2DA 3E0IA 2ZRYA 1RZMA 3G1DA 3L5MA 1KA9F 1C8VA 3H55A 3DFQA 3BG9A 1PHQA 2WPBA 1UASA 4UTTC 5LHEA 4LVGA 4MUZA 3GNDA 3KX6A 1VYSX 3W1NA 5EY5A 1G4PA 4QM1A 1U5JA 1MEHA 4H4IA 4M6PA 1TSIA 2NX1A 4DELA 5E93A 2VFEA 5I3GA 3FEMA 4R53A 5BW6A 5TIMA 3QMSA 2YX0A 3W2MA 5LHFA 4XWUA 4XBSA 4N2YA 4DF0A 1F73A 4RK8A 2E77A 3S8HA 1GZGA 1OK6A 1CW2A 1JUEA 1SW3A 4TO8A 2E09A 3B0PA 4IWWA 4UCGA 3VKJA 5LNWA 3UQNA 1JVNA 3GDMA 4BF9A 1A5SA 3G1AA 3RF9A 5CPMA 1OYCA 3P8JA 4XZ9A 4HT3A 1AW2A 1TPWA 1FCQA 3FOKA 1RD5A 1SW7A 3CC1A 2FB3A 1IF2A 4UIOA 5HINA 5IM51 3BLIA 2ZRZA 3P84A 2QKFA 3S0CA 2ZZ5A 2P1FA 1K7FA 2JGQA 4QNEA 5K2ZA 3CPRA 2QCNA 3TFCA 3UWUA 1FWTA 4UFMA 3GVGA 3WJZA 3SI9A 3P62A 3PG9A 4WXZA 4IX2A 1ZHAA 2RFGA 5FEWA 4LUJA 1D9EA 2VC6A 1H63A 1HG3A 5HJLA 3GXNA 4O53A 1X7FA 3T44A 3W22A 3R2GA 1K8XA 2J6XA 4GUJA 4PA8A 4O0ZA 2C16A 2CLOA 3UY7A 4UTTA 1FWNA 1LP6A 3HG2A 2OT1A 4CNOA 4FX7A 1TTQA 3QM3A 4JDYA 1ZENA 3W2NA 4KWWA 1EP3A 3RLVA 1BWLA 4UTHA 4LVBA 4IGHA 1OFEA 2WQPA 3PULA 3DHDA 1TRDA 3NL3A 4O14A 4N02A 5EBUA 4EF8A 1DBTA 4M7TA 2QAFA 1VLWA 5D2VA 4DXVA 1Q3NA 2NXGA 3QZEA 5KZMA 1BWKA 3TE9A 4DO4A 4S1FA 4UC5A 1XBVA 3VFLA 2FB2A 1YPIA 1AW5A 4OT7A 1H7NA 1QPQA 2QJIA 2ATMA 3G24A 2YW4A 2CZFA 3CWNA 1FDYA 3CHVA 3FIGA 4BI7A 3QEZA 3S5OA 3FFSA 2H6RA 1LDCA 2ZA3A 3MHFA 2I14A 2YFNA 4K8EA 4A3UA 3LI1A 1SZEA 5D2XA 3RK8A 2TRSA 1QPOA 2E68A 5AHLA 2VKZG 1P0NA 1JULA 1UCWA 5DY2A 5L6UA 1KFLA 1O5KA 1G69A 4CLMA 4ZMGA 2LLEA 3E9AA 1GYNA 2B4GA 2Y85A 4JY9A 4ZZ9A 3MP3A 1GPWA 4MY8A 4W9TA 2CLMA 3FLUA 2WNZA 1GG1A 4N6FA 4HNNA 3NPUA 3Q58A 1OX4B 1H1ZA 2QCGA 5LZLA 1LBLA 4EF9A 2QAPA 4CNNA 4PTNA 2A6LA 3HO8A 1FY6A 1IIGA 4HKPA 1TJRA 3RLUA 4NVTA 3GKAA 2F84A 1LROA 1X1OA 4AWUA 3LRLA 4QNWA 3C2VA 1H5YA 3GKFA 2EAWA 2FJKA 3KHJA 3IVUA 4RZ5A 3CU2A 2H3DA 3IIXA 3KFTA 4R34A 4KKXA 3PB2A 3CIXA 3M6YA 2ZQ0A 4NUWA 2WNQA 5ABTA 3B0VC 1S5TA 2QCHA 1NF7A 3JR2A 4XKYA 3THQA 1UBSA 5DXYA 4LS1A 3EXTA 4ADSA 3LOTA 4A2RA 3W7LA 2Q8LA 2YYUA 1W3IA 2VEPA 4O52A 4PFMA 2V81A 1GVSA 2QJGA 3DFNA 3GDRA 3PUEA 3TUUA 5KSWA 4WY0F 3TXZA 1Q6LA 4UMAA 4LT9A 1W3TA 1JCYA 2VFDA 3WJXA 1JRCA 3EB2A 1DL3A 4I7WA 4LVDA 3S9YA 4JN6A 4S2BA 3TW6A 1W5MA 4O13A 4NX5A 4E38A 4FF7A 4I7UA 1A50A 3EWUA 4WQ6A 2Q8ZA 3R13A 2QUUA 4NZJA 3TK7A 1KM1A 2A21A 4NX0A 3W74A 4AEOA 1XUZA 4MKNA 3L9CA 4Y90A 3BLFA 4DPPA 1SO3A 2GJLA 3S5YA 3LLFA 3FJLA 3N34A 4DEFA 4PEKA 3H54A 4XBKA 2WSRA 3CTLA 3OHIA 3SECA 5U4NA 3HG4A 2E6DA 2C3ZA 3BW4A 1FXPA 1JCNA 2ZCGA 3CEUA 1GOXA 4P61A 1FWWA 1YLVA 3MYOA 3G0XA 3NQ7A 5CZSA 3FJ6A 4UMCA 1JCLA 2PC4A 3MWAA 5EA9A 3F1QA 2DP3A 1P1XA 1LLWA 2NLIA 5C2XA 1H7XA 2TSYA 1UB3A 1G7VA 2G97A 1R46A 1JQVA 1Q45A 3BO9A 4FXRA 3LERA 4OU1A 5IBXC 3TQVA 4ORIA 1YXDA 4YMZA 3W6YA 4RV8A 4JTFA 1A5BA 1TQXA 2QR6A 4POCA 4X2RA 4HPJA 1JCJA 4QISA 2NUWA 4JX5A 4JGDA 2GQAA 3M9YA 1TIMA 1TYGA 2X2GA 2G96A 4Q32A 4JTTA 1BTMA 1KM3A 5FF0A 3NZ1A 3DH7A 3D0CA 2GVJA 3KVKA 4UMBA 1TPUA 1W3NA 1H7WA 1DQXA 3GDKA 3P81A 1SR9A 5AYYA 1F6KA 1GQNA 3LCGA 2TMDA 4TU1A 5AB3A 2X1TA 4IX0A 1EWEA 1CI1A 3W1LA 3QJAA 3W83A 3ZFHA 3NM1A 2AGKA 1S3HA 1QPRA 3M5YA 4AWTA 5C5YA 2ZBTA 3UZ5A 3HPSA 3NQ2A 3EX4A 1TTPA 4FNSA 5CZ0A 1TTIA 4MYXA 5D38A 3O16A 4OV9A 4MZ1A 3WJWA 4N6EA 3MJYA 3HF3A 3OBKA 1ZAHA 4KFNA 3O6YX 4FHAA 2QUTA 1RQBA 3EXSA 2NV2A 4O10A 4TMBA 2ZDRA 4U28A 3ZR4A 1HTIA 2QJHA 3IIVA 4PH6A 4MJMA 3UPBA 3QPZA 4UFJA 3NQGA 1D3HA 1KFBA 3W2JA 4FNPA 5CSRA 1Z42A 3P7YA 4N9BA 3T55A 4O4WA 5HQEA 1N7KA 1F7BA 5IBXA 3SGZA 3DHFA 5D2WA 3GAKA 4NJIA 1XM3A 2W0UA 4RJEA 1ME8A 1JJKA 2GVLA 5GVJA 5EMUA 1O60A 3G8RA 3NA8A 3W87A 3W7PA 1JUBA 1O94A 1XL9A 3VCRA 8TIMA 3L68A 3EWXA 4IXHA 4O12A 1K02A 1D3GA 3N19B 1KV8A 3N3MA 3C56A 3G8EA 1A53A 2E5DA 4UTIA 1KFKA 1WV2A 4BK9A 1KLYA 4HSNA 5A8GA 1Q6RA 5DXXA 4MJZA 3NYZA 3W1RA 5DN1A 4N9DA 1OFQA 2C14A 3I7QA 2QEZA 5FF2A 3UPWA 5DBTA 2CLKA 3I7RA 3NL6A 1R47A 4FIQA 3KVLA 1ZNNA 4NQ1A 1KTNA 3E49A 5D2TA 3C2OA 1OYBA 1SFLA 2VEMA 2C19A 3GNNA 3NQVA 3ATZA 4FX6M 3NNTA 1OFAA 2ISWA 1TPDA 1R2SA 3KXQA 1UUMA 4FXSA 3B8DA 4O4VA 2DZXA 2X16A 3I68A 2HSAA 4GJ1A 4WXYA 3G1XA 2ZA1A 5HR7A 1O95A 3W7GA 2CW6A 3LHWA 5CSSA 4NJGA 1F5ZA 3DKJA 5F1UA 3PSWA 2W6RA 3PBUA 2NUYA 1R30A 3B03A 3PR2A 1P4CA 3MW7A 4TR9A 4ZQNA 1ZAIA 3R5EA 2VEKA 3W70A 3DBPA 4AHPA 1YPFA 5D04C 3IIZA 2JGYA 4CQ9A 1K8ZA 3TH6A 1B57A 2FPVA 3NQEA 2P0OA 5AYZA 4ALDA 3PAJA 3QW4B 4NXSA 4Z0SA 4LTSA 3HG3A 2J9XA 5I3KA 2BTMA 3MYPA 2DZUA 3U8GA 1H7RA 1R2RA 4ML9A 5LNUA 3NPWA 4WY0A 2YR1A 2A6NA 5AN7A 3R8RA 3W1QA 1W54A 1WOAA 2B7NA 3A5FA 2QCDB 3EKLA 4AXKA 3NVTA 4XQ6A 2V2DA 4GRSA 2KZHA 1JRBA 3TSBA 3GXPA 2PE4A 2OMAA 4K36A 3BG5A 5LNVA 2V9DA 3PUDA 4NNAA 1Y0EA 1H51A 1M5WA 2V5BA 3O6DA 5A5WA 2RH9A 4H6KA 3MMTA 1SU5A 5D09A 5HUOA 2F7FA 4YXGA 1SUXA 2QCLA 1YDOA 2CLEA 4GNJA 3HGSA 1YDVA 1OVDA 3W75A 4G1KA 3QMTA 3HJZA 3M7WA 4AHOA 3NXFA 4M19A 5AC6A 1KM5A 1AMKA 4PCFA 1ZY9A 5C54A 2CU0A 1YDNA 3NOEA 4ADUA 3STCA 4JTIA 4LV4A 1V5XA 3V75A 5FF4A 1W5OA 3PBWA 2A7NA 1Z44A 1YYAA 3JRKA 3TV8A 4UXDA 1EA0A 5DBUA 5F1VA 3S1XA 3KOFA 3DI1A 3T4CA 3NQAA 4JYDA 3NPVA 3T40A 3EWBX 1JQXA 2Q3OA 1CX9A 3TDFA 3W23A 1IIHA 1Q6QA 3P82A 2VFIA 3ZWTA 3QSRA 1VS1A 3QRHA 3HPXA 1AL8A 3O05A 1TV8A 3LCWA 3UXDA 4JICA 4C1LA 3HB9A 1VR6A 3VE9A 4FEZA 2QCFA 4RXGA 3OA3A 4KFOA 2OCZA 4GUGA 3F03K 1GVFA 4N9EA 2GOUA 3OIXA 3N2XA 1MEIA 4BFAA 5K3VA 1M7PA 2DZPA 5CZJA 1XDLA 4L4LA 3WK0A 1F05A 3HGOA 3W7MA 3EWYA 4LOCA 4HHPA 3W7KA 3TMLA 3NQ8A 1RV8A 4NJKA 2VFFA 4K7VA 2VFGA 3C8FA 3TKFA 3DI0A 5LGZA 1PCKA 4DO5A 3AO0A 3G1VA 2ISVA 1R2TA 3B4UA 3HQ1A 3S5ZA 3PSVA 3BPWA 1OJXA 1L6YA 1L9WA 4IUOA 3DXIA 3S42A 3L65A 4O11A 4FNUA 4LC6A 1BKSA 4C1KA 3W7DA 3IIPA 2NXHA 1LRNA 3N73A 1T99A 4JTGA 2RDWA 2D73A 5AC7A 2ZRXA 1W5QA 1VHCA 1QPNA 3W72A 3GIYA
chains in the Genus database with same CATH superfamily
1XLJA 4LUIA 3ZLHA 4JTAA 3B40A 4UOQA 2J66A 3EDEA 3PS7A 5ABFB 1KLZA 1RR2A 4QJ1A 5HMFA 1GOKA 3GG0A 3R25A 1GQLA 3U6WA 1Q7QA 3NXLA 4JOMA 3W7QA 3T0BA 3P0WA 1OX5A 4PTMA 1EYEA 1Q5MA 2ABAA 7REQB 3DN5A 2D2GA 3ONBA 2WZIA 1DPMA 2JK2A 2DZWA 2VXNA 2NWSA 4O1CA 3E38A 5F2LA 2Y5EA 3KAOA 2PDYA 3CPGA 3HIJA 4LYQA 3HG5A 3ZIZA 4AXNA 4EANA 2C1HA 2I5GA 4WUIA 4Y6GA 5A6TC 4ZSTA 3HQOA 1L6WA 2YL8A 4OQVA 3O7UA 2E0PA 4DNMA 1J96A 4V33A 4AZ5A 5IRPA 5HK4A 1SO5A 5LA1A 2VC9A 4RCXA 5CH9A 3WH5A 4JTSA 2HBXA 3UPMA 5DX7A 2E9BA 5XIAA 5BOOA 1CXHA 4ONVA 1I4NA 1KNWA 4DY1A 2VGGA 1WZAA 1ME7A 5FJUA 3WD0A 1XXXA 4IT1A 4AC1X 2CNCA 1NWTA 1X6NA 3THUA 3NZPA 1EP2A 2YCLA 1S5VA 4C1NB 2WV8A 2YDAA 4IJRA 1FCVA 3QOMA 4GFIA 3CQKA 5D30A 3DGBA 3QC0A 3G3DA 2BY2A 5FEZA 3GG8A 5A6JA 1DORA 4J3ZA 4QEEA 4Y9MA 2OU4A 3CHCA 3PUOA 4JIIX 1OD0A 2CLIA 1FHUA 1PS9A 5G2HA 2EPOA 4R7JA 4C6BA 3UBPC 4MY9A 1K4HA 5FEXA 4L9ZA 1JPMA 3SRKA 4GFSA 3QF0A 4V2XA 1ISZA 2YXXA 4O1DA 1HGWA 5BXTA 1SJDA 3RCNA 1T41A 4J35A 1U2YA 3W82A 4PRTA 1J8VA 4PL2A 4JTEA 1W9UA 3V5CA 5E0KA 2BS9A 4TX9A 4K38A 2EEXA 4C6OA 4LSBA 3IS4A 4E4PA 2FHBA 1PX8A 1KWKA 1L6SA 1J5TA 3C3UA 2GUUA 5BRBA 1PEZA 3MUY1 2VR5A 1WBJA 3H8AA 4XD3A 2R94A 3LG3A 1GTEA 1I0BA 4LS0A 2ZTJA 1JNDA 1NELA 2Y5JA 3KRBA 3KUMA 3GO2A 4X2PA 5HUPA 4JFUA 4GVGA 1O4UA 3ATYA 2VTFA 4GI8A 4X3ZA 3S2CA 1BTCA 3W2UA 2GQ9A 2OSYA 3EX3A 2CLHA 2HCVA 4AVNA 4DBUA 4IPLA 1HKWA 3M5XA 4CD7A 2G37A 2DU2A 1FXQA 1H60A 5LNRA 1MI3A 2I9UA 3CBWA 1UP2A 4D1IA 1PSCA 2XM1A 1ONWA 3GB6A 2X1UA 3VU2A 1E6SM 3BW3A 2OQHA 4KT2A 4MFEA 3WQ4A 3LHTA 3N2MA 1XKYA 3W3OA 4K39A 1RH9A 4N4PA 4C6LA 2D20A 3CEPA 3LMZA 3VOJA 3D3AA 5EKYA 1VHNA 2W79A 2UV8G 3PVFA 1RK5A 5XIMA 3GM8A 4BY3A 5HA7A 1BFNA 1UMYA 4PTVA 3QFWA 5JQ9A 4QEHA 3ZS4A 5AKQA 5EU9A 3ZJ8A 3GTXA 1BWVA 3CPUA 4ZODA 3ZLFA 4UTWA 3W85A 2O56A 1ZL1A 2OOGA 3CT7A 3CASA 3TJ4A 1LF1A 1OF6A 2YA1A 3LM7A 5BU6A 3I65A 1Z41A 1FWRA 2ZWYA 5HMEA 2DIKA 1W1IE 1E70M 4JTKA 1LRQA 1SPQA 1QI2A 4HK6A 4IMGA 3PB0A 3W1AA 4O17A 1W5PA 4E0CA 1YBQA 2KAUC 1ODZA 2CZEA 2GGJA 1NU5A 2E1WA 1OY0A 2WBGA 1E4NA 2W9MA 2RDTA 3VA8A 1FWIC 2D3LA 3V3WA 4PMJA 4RE0A 3VYLA 2ALDA 3LXBA 3G2GA 3IGSA 4JN7A 1ML1A 1PX3A 3PF3A 2Q3RA 4Q8NA 1QUMA 1B9ZA 2OLAA 1U1JA 1PIGA 2VDHA 3EX2A 4HNUA 1GORA 2DW6A 4C60A 2G3FA 2TODA 2OR2A 1HKKA 5GNZA 4WOQA 2HROA 7TAAA 3N1AA 3SGUA 4ZXOA 5G4HC 2C6QA 3AROA 4JTHA 1FA2A 1P6BA 3G0SA 5F2GA 2D2JA 4M56A 2ZIDA 4AZCA 1GHSA 3SY8A 4ZO6A 3VNIA 2YZRA 4CKQA 2H90A 2IPWA 1IXQA 1WAUA 3W1PA 1GGOA 3SCVA 1UR8A 3IV8A 1V3MA 3AHTA 3UWWA 2ALRA 4UWMA 2WVVB 2FVKA 2E28A 3ARQA 5K7JA 1CPUA 1OFPA 2Y88A 3FA5A 5AHFA 3LCLA 3C2EA 1VBRA 3MV11 1BYCA 1H61A 3ANUA 4ZO7A 3VD4A 1DXEA 3GC4A 5D9PA 2ZWZA 3C6CA 1XLDA 4FSAA 1V79A 3UNDA 1UC5A 2WWCA 3IIOA 4GQRA 1S5WA 3VX1A 4YHEA 1HL9A 4Q7BA 3TTEA 3WBAA 2FZBA 3WH8A 4LRSA 3T2PA 3UWVA 4JIEA 1E0XA 4GCAA 1CENA 5L9FA 4KS0A 4GQGA 3DC8A 4R3UA 1MDLA 3VC6A 3WFLA 3N17A 4NI3A 4JHMA 3FAXA 2Y89A 4GWEA 1LQAA 3GLCA 2YXGA 4DUOA 4HZ8A 4UUIA 1E5NA 2ESCA 1EC8A 3MI3A 4F3HA 2QCDA 4QTGA 3IGUA 4PCTA 2GJNA 4GYPC 4K7YA 4K8GA 4AVFA 1RHCA 2ZUNA 1PVNA 4MPQA 4AIEA 3AU6A 3NO5A 3V16A 1J93A 3QYQA 1EEPA 1DVJA 1HKJA 4HU3A 2DGAA 5MF5A 1FFQA 3QLDA 3S1UA 4MVAA 4ZQMA 3QV6A 2NT0A 3KS6A 1XDMA 1VJZA 1W1ZA 6PTDA 4IPIA 4C6CA 4N9CA 3DZ1A 3PBVA 5HBFA 4XZHA 4PCSA 3THAA 1ONEA 3B9OA 3NG3A 3C0JA 5G2WA 1PKMA 3NQCA 1QVBA 2JF7A 4RKAA 2FPTA 4C7DA 2ZE0A 4F2UA 3E12A 2J75A 2YOCA 3CMFA 3IGXA 4CU6A 5PTDA 1OCNA 2GVYA 3HQPA 5DCEA 2A3HA 3EEGA 4NSBA 2F6UA 5I0DA 1X1NA 3THCA 1UWQA 1PAMA 5HPCA 4RXFA 3AMCA 3CAQA 4Q4OA 3CQIA 2YCKX 3GE7A 4XZBA 3NO1A 2MUCA 3A3XA 2QCMA 2FTPA 5TBOA 1GJPA 3U3HA 4CN6A 3KRZA 8XIAA 1Q6OA 3SCPA 1LTDA 1IXNA 2GJXB 4Z0JA 1PV8A 3WCZA 5HULA 1TZZA 2Y7DA 1KTBA 1FWAC 1FWSA 2R9RA 5H8UA 1J0JA 2ACRA 1ISWA 4GI9A 1EJTC 4L4MA 3KWSA 1HL8A 3EA1A 2PLKA 1NOUA 3NEVA 2EBNA 3BL3A 2ZDSA 3V0UA 4N0RA 1RXOB 3F2DA 3GQYA 1EH9A 2QF8A 3S2NA 4TV5A 3VNLA 1E1EA 4MB3A 3H23A 3GW3A 2EPNA 3P67A 4O54A 1XCFA 1PZ3A 1UJPA 4BWLC 1C29A 3N6HA 2YL9A 4UTLA 3VX0A 2XFYA 3E0VA 2JKAA 3HJEA 1XIDA 2ZYFA 3CXOA 4PRRA 3AZRA 1B3VA 1A3HA 3WD4A 4DLMA 3ARSA 4XBJA 4MLJA 1YTKA 1K3UA 3BSHA 3AZTA 4ILSA 3EA2A 1OIFA 1VJIA 3LYEA 1WBHA 3CGTA 1E3XA 3BTNA 4IPNB 4HN4A 3C2RA 2CLPA 2TYSA 4A4AA 1BXBA 1OFOA 3L5AA 1NIUA 3PC0A 1XIBA 3HOJA 1F6PA 1W1VA 3BMVA 3KOWA 1QCWA 1UD3A 1X8FA 1TRIA 1B54A 1Q65A 2CETA 1UOKA 2XVPA 1NDYA 1V3LA 4MAVA 5K4ZA 3RPTA 1R7OA 2AAAA 5JH1A 1NJJA 2VNCA 4ZO9A 3FK4A 4XAYA 4QX4A 2WMJA 3TR9A 1JPKA 2E6YA 5KTLA 3TJIA 1TWIA 2W92A 1XC4A 2ZA2A 1H0IA 2C1GA 4YLWA 3REQA 4GUIA 3CB8A 3B8TA 2VC5A 3W7CA 2J7DA 3P8IA 1OWQA 3R7MA 1UD2A 1WDRA 3GU2A 2A3CA 4K6AA 2ANUA 4S3BA 1P0EA 4PMNA 4S3KA 4QDMA 1FDZA 3E0WA 3F7JA 4F66A 4MNLA 4HK7A 3SCQA 2Z1VA 3WMBA 3G0UA 1IGSA 1W2PA 1W8SA 5G1TA 3UXLA 2UY4A 2R8WA 2PFHA 3DFOA 4X9SA 1WNOA 3LA4A 3MUXA 5I09A 1PXGA 2GGHA 3F5JA 1XRVA 4LEFA 4I8DA 1PUDA 4V28A 3U2CA 4F79A 2J9ZA 1W3JA 2BY1A 4X61A 1W1TA 5HDRA 3IK4A 1YNYA 2BMBA 3Q67A 2XH7A 4L64A 1Q66A 3B9EA 3ZZ1A 3W4RA 4IPPA 2G4JA 1VC4A 2BG5A 4JPGA 2O55A 4UTUA 2IQ0A 4IISA 2B81A 2REQA 4GE8A 3VMOA 3OZOA 1XUUA 2GL5A 3WF4A 3VUPA 1P7TA 1WDDA 4ERAA 4H1ZA 3FCPA 4JNZA 2PGFA 4HCHA 1M3UA 2E40A 2W3ZA 4OOZA 3MO7A 3M0KA 1G67A 4CD8A 1ZU8A 4LF1A 4WX2A 4KETA 3T4WA 2QQ6A 3WLLA 3JZEA 4O15A 3KLKA 4D6EA 3RAOA 1DIDA 3TC7A 3EZ4A 1S39A 1X6UA 2XJ7A 1VFFA 1EO5A 2EKGA 2EPMX 4LCQA 2OTDA 1C9WA 1C8XA 3WLKX 5DLCA 5AY7A 4US5A 4AEEA 3NGJA 4E3VA 3UVAA 2V68A 3EMQA 4PUWA 3GNXA 2GWGA 2GUYA 1I6NA 2IW0A 3ZJKA 5AVHA 3RNDA 4FOUA 3SURA 4TVUA 3QR1A 4GBUA 3BLOA 2ZZ7A 4C7GA 2PU0A 4NY2A 1C9DA 4Q8PA 2OG9A 1EPXA 4HIBA 3ITCA 1BF6A 1JPDX 1ZP4A 4PUDA 3WLMA 1Y5XA 1G9HA 1P5BA 1XFCA 5CGMA 3A23A 4HYWA 1ZBWA 1E15A 4W87A 3KBMA 1SYTA 3G1FA 1NAL1 3O15A 4M24A 5TD4A 3M0ZA 5I06A 3WLNA 5DRIA 2VX4A 2VHLA 1ADOA 4U2YA 1L0PA 3NQMA 3UR2A 2R14A 6TAAA 3E96A 4Y9AA 1ONRA 1SO6A 4HPGA 3PPFA 2PF0A 1HW6A 4KWVA 1SZNA 1F2JA 4LY8A 1G7UA 4PODA 4RNIA 3DAQA 4US5D 2BLEA 3SGGA 1W9VA 3VKAA 3A21A 3VKDA 2ZZ1A 3AAMA 2PDIA 1EP1A 2O92A 2WAGA 1GVOA 1MRAA 2OWXA 3HV9A 1TO3A 3O06A 3WNPA 1C90A 1QNRA 3TVAA 1AK5A 1O66A 3V1PA 3SUUA 1OFBA 1HXJA 1QW7A 3W7HA 1XQKA 3OQ8A 3IV3A 1F76A 3NZGA 2ZUTA 1THFD 1V6VA 3RFAA 4P8WA 3DIPA 3V4BA 1Q6FA 1SSDA 3GVWA 1O6IA 7A3HA 3URBA 3H7UA 3OG3A 1PB0A 5AHNA 2G8ZA 2DPEA 1MFVA 2DSZA 4UFIA 4IQJA 1ENUA 1TV4A 5HMSA 3Q37A 3QTPA 1O5QA 4F8XA 5A8OA 3PK7A 1IHIA 2HEJA 4TX6A 1XJBA 1UASA 4UTTC 4LUSA 3GG7A 1DJXA 3AMDA 3NSMA 4Y2WA 1G4PA 3W26A 3L4UA 4AMCA 4NAFA 3IRSA 1CIUA 1JYNA 3U0HA 2Y8VA 2POZA 5LHFA 3BSMA 4IQDA 4XBSA 3N4EA 3OHMB 4DF0A 2E77A 3SN0A 3S8HA 1CXIA 2R82A 2E09A 4UCGA 4NF7A 1JVNA 3CQHA 1AJZA 1A5SA 3GVVA 5GJNA 1JCTA 5DMNA 2VDIA 4J3WA 3MUIA 1DE6A 1GVIA 4XZ9A 4HT3A 1TPWA 3B0YA 4BA0A 1SW7A 2DT0A 1TWDA 2FB3A 5I02A 3ZR5A 3SCWA 3CUIA 2ZRZA 4Y8EA 2QKFA 3S0CA 3KOXA 3WKZA 4LEQA 3OIHA 4XG1A 2Y1HA 2ZX6A 1T8QA 3ARYA 3P62A 3PG9A 4LY4A 1ZHAA 3R8HA 2RFGA 4BEQA 1D9EA 3QHOA 5KETA 3S47A 4OIFA 2VC6A 5HJLA 5C0QA 2VDGA 1LJYA 2J6XA 3CNYA 3P2VA 2C16A 2CLOA 3R11A 2OT1A 3WDIA 3TNBA 4CNOA 3TYCA 1ZENA 2J7GA 3DDMA 5H8PA 4UTHA 1UKOA 4LVBA 4S23A 4C6KA 2HZGA 3VOIA 4KCVA 4IICA 2HXTA 4WEVX 4H9ZA 2C91A 2QAFA 4U3AA 4DXVA 3H2FA 1Q3NA 3QZEA 2VOTA 2V63A 2UY2A 1XBVA 2ZXQA 3LSCA 1YPIA 1AW5A 2VR2A 1V3JA 2ZUWA 2QJIA 2GDQA 2H6RA 2WVUA 3LI1A 3HPFA 1DE5A 1L8PA 1QPOA 3SUTA 3CZ8A 3GFXA 4DJFA 2XVNA 4TV6A 1A5NC 1NFGA 4QLKA 4WK9A 2YBUA 1G69A 1TWSA 4ZMGA 2X0HA 4S3JA 2INEA 5HAOA 5BZAA 1A5UA 3SUVA 4CN1A 3N11A 3VTRA 3M4HA 1I60A 2VD8A 1H09A 1E9LA 3KBWA 5JH2A 1H1ZA 2VM8A 8RUCA 2OSXA 4ZE5A 4V1XA 1IIGA 1LL7A 4MM1A 3W28A 2F84A 4AWUA 3N2CA 1H5YA 1J10A 2EAWA 7REQA 3IVUA 4HA1A 5DT5A 1ECEA 4A3QA 4R34A 1RY8A 3ZYZA 1YKWA 3PB2A 4DJDC 2ZQ0A 1F07A 3M0YA 4YVPA 1US0A 3UGVA 3GNRA 2IMRA 3ERPA 5DXYA 1OCJA 3LOTA 1W3IA 2PWGA 1J2BA 4DJFD 1J6OA 1UWUA 4PFMA 2W67A 5CPQA 2QJGA 4JTQA 3DFNA 5KSWA 5LIKX 1V8EA 1UG6A 4LT9A 4L61A 1JCYA 3WJXA 1RAKA 3EB2A 2Z24A 1CGYA 3MZNA 5TNVA 1A0EA 3NFUA 3AUJA 4JN6A 4HPNA 3TOYA 3LGDA 2Q8XA 1Y65A 2XSXA 2IPFA 1FWFC 1ZQ5A 3PPGA 1A50A 3R13A 5JUVA 2AMGA 3GD6A 3KOYA 2BGSA 2O9OA 4NX0A 4V27A 3L2LA 3DFYA 3L9CA 3PNUA 2WC7A 3CMJA 3BZJA 2GJLA 3LLFA 4JKLA 3FJLA 3OBEA 4PEKA 2VZTA 3PTDA 4WR3A 3WLPA 4F0HA 1QTWA 3RX2A 4L4PA 4RDZA 3CEUA 4D1JA 5I5RA 1YLVA 1C8QA 1GZ1A 3EDKA 4IM4A 3MWAA 1KBBA 2ZX9A 3P3BA 4IIBA 4XV0A 5C2XA 2NLIA 1VB9A 5FAJA 2VC7A 2TSYA 1RSCA 1C92A 1VBHA 3B97A 5AVNA 2GZXA 4C65A 4H19A 4OU1A 5IBXC 1IZJA 2C1IA 2D2HA 3R58A 3W6YA 1A5BA 3WQDA 1RUSA 1DHKA 4X2RA 5LA2A 2NUWA 3FY1A 1CLVA 3M9YA 5LXEA 3APGA 1TVNA 2XIIA 2AGTA 4Q32A 1HQTA 3DH7A 2GVJA 1CXLA 1GJUA 3SCTA 1DQXA 4H9YA 5I2UA 3GDKA 1TG7A 4BKNA 1Q6CA 3KDOA 1PWMA 2PGWA 4HU8A 2R6OA 4IX0A 1KRBC 3FJ4A 3NM1A 2XWDA 3M5YA 2QPSA 2ZBTA 4RNJA 2BHYA 2XIQA 1ZLPA 3NYDA 4G9PA 3UJEA 2PBGA 3TWBA 7ENLA 4OV9A 1E1CB 3WJWA 4N6EA 2XVLA 3W29A 1ZAHA 3O6YX 1RQBA 3B8SA 3FGCB 2J7EA 1CXKA 3VOFA 3QPZA 4UFJA 3V18A 1KFBA 3W2JA 4WDWA 5CSRA 1RBAA 4O4WA 1IQ8A 2VX6A 1JYVA 3CS2A 3SGZA 1QATA 1B2YA 3RMEA 1XM3A 2OYLA 4GZIA 1JJKA 2GVLA 3MUAA 4S3EA 1MUWA 2EQDA 3VM5A 1JZ7A 3IARA 3W7PA 1O94A 3VCRA 1FWCC 4B16A 4IXHA 4NIRA 1GOQA 3U9IA 1LWHA 2ACQA 3LK6A 4J28A 1A53A 4AC7C 1VBUA 1WV2A 1Q85A 3NYZA 3W1RA 5DN1A 4D6HA 1OFQA 3IJLA 4CVUA 4QS6A 5DBTA 3NL6A 4UZSA 4EACA 3C0SA 2XPKA 2YXOA 1B31A 1FTXA 4XAPA 1GCYA 1TJ0A 2VEMA 4HCDA 3GNNA 2YDQA 3ATZA 1AH0A 1UP0A 3OGRA 3KXQA 1UUMA 3W37A 2P5NA 4O4VA 2DZXA 3QPEA 4GJ1A 4P8VA 2CXGA 1BVWA 5A6BA 1E43A 1F5ZA 2W4XA 5F1UA 2NUYA 1G01A 1P4CA 3MW7A 1EA9C 4PSPA 5I24A 3DBPA 4CEXC 3IIZA 2JGYA 3U48A 3VVGA 4CQ9A 1K8ZA 3ZT6A 3NQEA 3ZJ7A 3U7VA 4NXSA 2VT0A 3WIJA 2IUZA 3MYPA 4DIAA 4ML9A 5A2AA 2YR1A 4L9YA 1KCZA 4BQ4A 1C7SA 2J8GA 4ZOAA 1C3FA 1P48A 3WSUA 3PTMA 3QR3A 4UQAA 2HXUA 1GOMA 3GXPA 1JI1A 3UZXA 3CYVA 5I78A 2NQHA 3H4GA 2PC8A 1EQCA 4GPNA 4JKMA 3OU8A 1H51A 3BH4A 1IT7A 2PDKA 3FDKA 2RH9A 4H6KA 1W3LA 2I5QA 3VXGA 1AH4A 4YXGA 2PDFA 1MYRA 4WLCA 4A3HA 4XSLA 3HGSA 5A6BD 1CGUA 3ZVHA 1W1A1 3CK5A 1VEPA 3AXMA 3NCOA 1H3GA 5CZKA 3CWHA 3EEZA 3NOEA 3STCA 4PGLA 4AIUA 1V0KA 4MWAB 1M7XA 4AZ6A 3BJSA 3T08A 3GH5A 1HJVA 3KOFA 3NGFA 5F1VA 3S1XA 4JYDA 3K4WA 2OEJA 2GGEA 4I5UA 1Q6QA 1TR1A 3VINA 4G8TA 2Z2AA 3O05A 4IP4A 3LCWA 3E74A 3W0KA 3HB9A 3DESA 3O9NA 4HGXA 4FEZA 2BY0A 4RXGA 3V7PA 2GUBA 3OA3A 2OCZA 3NUKA 3AHZA 1GVFA 4LUTB 3ZSSA 5TAOA 3OIXA 2W27A 4RE4A 3BOFA 1MEIA 2ZUSA 1M7PA 2DZPA 5BRPA 3VZYA 3QZAA 4L4LA 1F05A 4IG2A 3W7MA 5FJRA 3EWYA 4Q3MA 4KBXA 1RV8A 2VFFA 4K7VA 3WDPP 3C8FA 4KEVA 4DO5A 5MKGB 2PODA 4PZVA 2WKGA 3G1VA 3W6LA 3BDKA 3SCRA 1R2TA 1BG4A 3B4UA 1WXZA 3VIOA 3LBOA 4Z42C 4GH1A 1UROA 1WB0A 2XYLA 1CGWA 1OINA 3QHNA 3WDHA 2GK1B 4JTGA 2D73A 3UNTA 2HPMA 4LB3A 3RJYA 3R8RA 1QPNA 3W72A 3GIYA 4FOJA 3R10A 2QIIA 1OCQA 3VCCA 2R91A 3N2TA 2D2OA 2ABBA 2CPUA 1R3YA 3H53A 3VD5A 4ICMA 3LRMA 1REQA 3WBYA 1HVXA 2B7OA 4DF2A 1K77A 3D6NA 6REQB 1TE6A 3PBYA 3QQ1A 2BB0A 1DOSA 1XX1A 2D0FA 2ON3A 1SR0A 2G95A 4JXCA 4LNYA 2XIBA 2G3NA 2DT2A 3AIEA 5G2IA 4YTSA 1OBAA 4S39A 3S6DA 1A0DA 3AC0A 2Z1KA 2VMFA 2VGBA 3UCDA 3ARTA 3BW2A 5LGXA 2H8ZA 3UZYA 1GKQA 2QUVA 1U5HA 4Z2JA 3DKLA 4LW7A 3CQJA 3CWOX 3PZ9A 4KF1A 4TVDA 1DIOA 3DFSA 3A4JA 4XVDA 4LS2A 5I79A 5HWMA 3BQ5A 2C79A 5DEZA 2A2IA 2Z25A 3WQ5A 5CC7A 4MB4A 3C61A 5IOBA 4AD1A 1B3XA 3QYSA 5LYRA 1XYAA 1FOBA 4OE7A 4O8RA 5JBDA 3T0TA 3A4WA 4ES4A 2F2KA 4PCPA 3RLGA 3LNMA 1QPKA 4L6DA 4JR5A 4Q22A 4HNCA 4W8BA 2GJPA 4B9ZA 4ERGA 2O4MA 3VIMA 4M7SA 1NP2A 1VAHA 3JUGA 3OGSA 2Y62A 1B3WA 1H7PA 4I90A 5ECVA 3RM9A 2C0AA 2YCIX 1RJQA 4LGXA 2VGFA 1Q8JA 1KXTA 1OF8A 2I5IA 5HQLA 3R12A 2YL6A 3KTSA 3WK2A 2IQDA 3MC5A 4WZHA 1G4SA 5A95A 5E0FA 4UTFA 5CBBA 1RP8A 2PTDA 2ZTKA 4H8VA 1XBYA 2Z28A 3IJ8A 1R7AA 2OOFA 3B8IA 1C93A 1DJYA 3S4TA 3WMCA 1QO5A 1X1ZA 1I1XA 3N14A 1MXSA 4EX4A 2WQDA 4JS3A 4REQA 4WOZA 5J5DA 2WZEA 1G4TA 4NZ3A 3L2MA 5DF0A 1TJ1A 3I4KA 4O50A 4PSRA 3RRXA 1ALDA 4NAEB 2IXVA 5MHBA 1R85A 3F4CA 5D2YA 2IS7A 2FDSA 2PDUA 3MMDA 2NSXA 5CLWA 4OBRA 3QW3A 4JFTA 1XIHA 2O9TA 4M5PA 3HTWA 3TAKA 4Z2IA 4LANA 4E3TA 4F40A 1MQPA 3WENA 4B5XA 2GQ8A 1E73M 5HR6A 3RCMA 3HGJA 4WHBA 3TQPA 1GW1A 4IP7A 5F2MA 1XLLA 1XLMA 2PDLA 5BMWA 3IVTA 2R1MA 2R1PA 1JZ5A 2ZX8A 3SY5A 4E8DA 2D69A 5BWFA 4XIMA 4J2MA 1XGEA 2PCEA 1YPXA 1WO2A 2IKIA 2FH8A 1B5TA 2HVNA 1E9YB 4JAWA 1OG6A 2WMHA 1EB3A 1JYXA 3A9IA 3WQWA 1OFDA 4NXKA 4W7WA 2VO5A 1QAPA 5C55A 4Q33A 4LYRA 3L67A 1DJIA 2VZSA 3VNZA 2Z1SA 3W7NA 4D6JA 3KLLA 1G0CA 1UBPC 2OGYA 1MNSA 3W1UA 1KM4A 3NQ6A 4E2OA 3LTSA 3O63A 3OQEA 3SR7A 1KD0A 1UPPA 1OIMA 3MA8A 4KRZA 3N6QA 3MDWA 3GX9A 3TONA 1ZJHA 3G1SA 1O12A 3TJLA 3M44A 4ZGYA 2QMKA 1W56A 2ISSA 4IL0A 3C2FA 1OT1A 3N9RA 1E6XM 2Y24A 3LZ3A 2A1YA 1IWBA 3MSGA 4PTDA 4OKDA 5KZDA 2YYTA 1M6JA 3FSTA 5AYXA 1EBHA 2E25A 3NZQA 3SADA 2VGIA 4TMCA 4IFKA 4JBRA 3T2OA 4H9XA 1R6WA 4NYYA 4D6CA 4Q8QA 1F6YA 1KM6A 1UOZA 2QV5A 2UY3A 5I6SA 3T7VA 1KO0A 3DYPA 5DO8A 3UESA 2VEIA 1EIBA 4WKAA 1M04A 1OX6A 4P5UA 5A6LA 2PD9A 3QC3A 2FFCA 2TPSA 3I6EA 1W9XA 4DWDA 4Y8FA 3GXTA 4H7ZA 4IH3A 3BLKA 3EBVA 2NWRA 1R9ZA 2VX5A 2PD5A 1GOIA 1W9DM 4XAZA 4XK2A 3LGEA 3VGFA 3SBFA 4D8LA 3F4WA 1ZTVA 1XLHA 2X1IA 1J4EA 1LL4A 3EGJA 1A5CA 1W2VA 2F38A 4A21A 4W86A 3I7SA 3NIYA 3P61A 4LVAA 2BFGA 3LI0A 4A29A 2JBMA 1J0ZA 1IE7C 4JX4A 3MS8A 2GDUA 3BSGA 3B04A 3M1ZA 1W31A 4HYRA 1XCXA 1FH7A 2I7GA 5FEPA 4DBDA 3UJ2A 5BCAA 3IEBA 2HS6A 4OHQA 9XIMA 3AWNA 3UYCA 5EMYA 1KCXA 4DPQA 1DHPA 3AXHA 2PTWA 1DJHA 2GSEA 2Q09A 3CV7A 1B9BA 3LPOA 3K46A 4B5SA 1XIFA 4ZR8A 5D9NA 4LAZA 2X1RA 5A8PA 1XYCA 2QCEA 4RPQA 4FR6A 1PBGA 5D8WA 2G41A 3IUDA 1W6TA 3AHVA 2PDPA 1D7FA 5K9XA 2YDSA 1T5AA 4AZIA 3VOGA 4HN8A 1TJPA 1EF2A 1QWKA 2XHYA 1GVRA 2AL2A 4PMRA 1I2PA 1UZ1A 4KERA 5REQB 1VFLA 3GHUA 4DJFC 3BOLA 1A5AA 1QHZA 2DEPA 3NURA 1I2NA 4QIUA 5DMLA 3GS6A 5FL0A 1TZ9A 4LXFA 3MCMA 4QQUA 4QJ5B 1TPH1 1R8LA 4QJ3B 3SUWA 1SJAA 4IIGA 2IPJA 4JFSA 1UKSA 3MI6A 4KRTA 3O1NA 4CEUC 3U2OA 1BYBA 4LQ1A 2WHKA 1ZP3A 5FACA 2GSJA 4J3SA 1DKWA 1FCBA 4GOAA 2ADAA 4QAIA 1QR7A 4AW7A 4JY8A 3AJXA 4Z08A 4HU4A 3VD9A 2CZ5A 6TIMA 4G7EA 3S6OA 1VRDA 2WJFA 1KB3A 2OJPA 4FK9A 4IIEA 2WHJA 1ICPA 3NM3A 4MB5A 3HBLA 3L2IA 3IRDA 2Y6ZA 4GYPA 3GUWA 1XG4A 5CGQA 1KTCA 3OVPA 4B5WA 1JDEA 2E5CA 1CXFA 3GG1A 3VM7A 4G5DA 3H12A 5DELA 4V15A 4C5ZA 1BD0A 3UR8A 3GC5A 2E1DA 5K9DA 2PDWA 5AHIA 5FKYA 2DV0A 3INPA 1HKVA 3WBEA 2P8CA 4DWSB 5T8GA 4M3PA 3K30A 3VKCA 3K8KA 3M16A 3RM8A 3E1F1 3W88A 3FYOA 3CLMA 1MZRA 2E9LA 1QMLA 2H9AB 1PO9A 2DZAA 2NVAA 2EKCA 3EOOA 5ABGA 1TCMA 2HV5A 1SMDA 2NQJA 3WDQA 2A7PA 3FN9A 4KFPA 4RPPA 3L4VA 3KM8A 3LM3A 2E9MA 1CB7B 3AMGA 1A5KC 4TXEA 2C18A 1TMQA 1XDJA 4ZQRA 1XGZA 3F4VA 3S1VA 2WO5A 3H22A 1TPFA 3S1GA 4NRSA 1J12A 2CZDA 1KCLA 1XIMA 1TV3A 3WBWA 3C4UA 4GXMA 1WPCA 2PURA 4ZFCA 1R3QA 3H7RA 3WEMA 1EDTA 4GZ7A 1EBGA 5CPLA 4XD4A 3LCXA 1W8GA 2QVNA 3IAQA 1ZBKA 4Z1CA 6A3HA 3TQ0A 4GX9A 1DYSA 2NLYA 3UJSA 1SFJA 3QZ6A 1H5VA 1MQQA 4JQ4A 1KFWA 4UTMA 2WKJA 3DERA 1XF0A 3Q65A 5CJMA 2WANA 1XLFA 1E51A 1GOWA 1ITUA 1UWRA 4AH7A 4BWLA 1S2CA 3G5EA 3WF2A 5I3HA 4NZCA 4CQAA 2XIMA 1GG0A 2BXYA 2DH3A 5C6MA 4GKTA 4W84A 2VQUA 3A24A 4AG0A 4LYPA 1GUVA 4MUPA 2YPIA 3UWEA 1QBBA 5CPNA 4RZBA 3LD5A 4I5XA 1TJ2A 2DJLA 3CHDA 3N6JA 4DUVA 3OGVA 5LSMA 4XO7A 4GXWA 1NEYA 3QMRA 1FHDA 4R7OA 4O28A 1AJ2A 3BC9A 3P60A 2PP0A 2E3ZA 3TR2A 2QNEA 3HPAA 3RHGA 1JG9A 1SZFA 1QHOA 1LUCB 4ZSUA 4RZ4A 5FD0A 3A5VA 5EB8A 5ECUA 4ATWA 3FYPA 4GG9A 3WK3A 6ALDA 2FHFA 5LKYA 5I3IA 1KGUA 2RKXA 2HRWA 5HNRA 2R1LA 2BX7A 3LLDA 1B1YA 1FQ0A 2D3NA 2QJMA 5DMMA 3EWWA 2HK0A 3EKGA 3Q94A 3HZ3A 3TJXA 2BVYA 1CLXA 3WQGA 3TA6A 1G4EA 2J77A 3P80A 1PYMA 3LRKA 3B05A 1LWJA 3RO8A 1J01A 1K03A 1WOBA 1JDAA 4QBXA 5LIWX 3TC3A 1VF8A 1OZQA 2FQIA 2YBVA 3TTQA 5J04A 3AI0A 1JPHA 4MHBA 3KVMA 5KEZA 3SSZA 2DZSA 1JZ6A 3P74A 2C13A 4AAJA 1UH4A 1Y7VA 4GQ0A 4AF0A 2OZ3A 1IGWA 4AMAA 4HTYA 2W62A 3I10A 1E4IA 3WUFA 4Z1DA 2Y0FA 1BRLA 1CXEA 3B06A 4JEQA 4HSOA 4DUXA 3W7OA 4HPHA 4MGGA 2EPLX 4B15A 2BZNA 3CHFA 3UXAA 4QGCA 4I5RA 3RX4A 3TTSA 1H50A 5AYIA 2BSLA 3C52A 3CZGA 1XI3A 2RHGA 1JD7A 1N55A 1XCWA 4LAMA 3URNA 3BICA 4C6IA 3URAA 4PFHA 5D02A 3BAJA 3LCIA 5FSEC 1H4PA 4L6OA 3TW7A 4W4QA 3PZVA 5RUBA 3QGAC 1WQ5A 1CZ1A 3DENA 1XBXA 3IJIA 1EX5A 1MO0A 2EPHA 4UNKA 4Y96A 1NDZA 2AKZA 1ZPTA 2E4TA 3FSUA 3ANYA 3S83A 4J4KA 1FDJA 1TPEA 4ORMA 1F8IA 1DJWA 2J62A 2GFTA 4LYKA 1L8NA 3AIBA 4O57A 2AOSA 1EYWA 3EX6A 1SW0A 2BNJA 5FL1A 3IUHA 2PF8A 4EOUA 3W07A 4C6DA 4L1WA 3VPLA 2DSWA 2YKKA 5HPOA 4WY0B 2HTMA 2YFOA 2HS8A 2A3AA 2BOFX 2WJDA 2ZC8A 3JVAA 4ZE4A 1T8XA 2Z27A 4U4MA 4CNUA 1IZKA 3WNOA 3GFYA 2CERA 5CAKA 2FIQA 2OGJA 1FX6A 1ZJIA 2B7QA 3ARVA 1K1DA 1MW3A 2B31A 3MHUA 2RDXA 3AIQA 1XBZA 1TWZA 2V38A 5CG7A 3UERA 2Y4SA 4LRTA 3CIWA 2NQ5A 3TIMA 4DF1A 4RE2A 5K9CA 1F3XA 2ZFAA 4IJBA 4ZEPA 1VBJA 1ZZMA 1ZSXA 5EMKA 1EJVC 4JTLA 4F2TA 4H04A 1T0OA 1M9HA 1PCWA 4P7NA 4Q8MA 5T26A 1PIIA 5ABHA 1EIXA 2FVLA 2DQWA 3KRUA 1I8JA 3WLHA 5G4WA 1IXOA 2NXIA 4HHLA 2WSPA 4S3AA 3E0IA 2ZRYA 1RZMA 2XH2A 3G1DA 1C8VA 3I3BA 2FDMA 4ATDA 1XD1A 2YJQA 3M0LA 1T6MA 4LAUA 3SFWA 1MQRA 4MUZA 3W1NA 5EY5A 1MEHA 2GJRA 1A47A 4P8XA 1UYQA 2VYOA 3CYJA 2NX1A 2VR4A 3S2JA 1KRAC 3FEMA 1VFOA 4X0NA 3QMSA 2YX0A 2GSHA 5T9BG 4N2YA 1EDGA 1UD6A 4IIFA 1XWYA 1S3TC 1QNSA 4FAMA 2JE8A 3BJTA 4AYSA 2UZ9A 4IWWA 3H2EA 3UQNA 2DUAA 2Z2BA 1AODA 4R88A 3G1AA 5CPMA 4M8UA 2R24A 3DHPA 3S3GA 3P8JA 3F5KA 4ZO8A 5T91A 3FOKA 1RD5A 1U33A 1R3RA 1J18A 3P84A 5FJOA 4CGTA 1UR3M 1K7FA 3VOHA 1YDYA 2WKLA 4PUMA 4QNEA 5K2ZA 3CPRA 2X0YA 1XLKA 3UWUA 1FWTA 4QP0A 3KTXA 4UFMA 3GVGA 3GUGA 2DSKA 1LT8A 4WXZA 1ADDA 4LUJA 1VP5A 3RG6A 4O53A 2PLCA 3R2GA 4K1WA 3EA3A 4PA8A 4F0SA 4QE4A 1DEDA 1E0TA 2OKTA 1FWNA 3RILA 4MG4A 4UTTA 1LP6A 3CIVA 1Q8AA 4ML4A 2IXUA 4FR1A 3C8NA 3MKKA 4CD5A 3WQ6A 3W2NA 5GPRA 4W7VA 3PJWA 1F9CA 5A94A 1XRSA 1M41A 1EP3A 3RLVA 1LG1A 3FA4A 2HWGA 3FDGA 1JGIA 1E0VA 1WAWA 2VP8A 2WQPA 3DHDA 4X9YA 3APYA 1TRDA 3NL3A 3EYPA 4N02A 1M01A 3O2LA 4G56A 1NM9A 2VD9A 1DBTA 3LQGA 5JXQA 2XISA 2J7FA 2NXGA 1BWKA 4S1FA 3ZM8A 1ZRQA 3II1A 3VFLA 1MUCA 4BQ2A 1Q6GA 2P53A 4WJ8A 4OT7A 1FHLA 4GA8A 1H7NA 1QPQA 4AYGA 1NQKA 2ATMA 4XUYA 2YW4A 2CZFA 3CWNA 3FIGA 3O0KA 4BI7A 3QEZA 3FFSA 2ZA3A 1ZUAX 2PWHA 4K8EA 4A3UA 2OELA 5D2XA 4A8IA 3FX4A 1XH0A 2BVWA 1AZ2A 4UOJA 1OEPA 4HNOA 2F61A 3SDOA 1KFLA 4ROPA 2BY3A 4CLMA 1GKRA 1U1HA 2LLEA 3HV8A 1KBKA 3WO8A 1GYNA 4RV3A 4PMOA 2WM1A 2B4GA 3GVRA 4W8AA 1GVEA 3TZFA 4MY8A 2IKJA 5M17A 4ATLA 3FLUA 3PN8A 4GYKA 3KTCA 3COTA 3WZ0E 1TE1A 3NTYA 1BG9A 4KEZA 2QAPA 2A6LA 1XLGA 3A4XA 3GXMA 2VX7A 3HO8A 3T2QA 3UJFA 3RLUA 1EF3A 2NT1A 4RW5A 3QR0A 1LROA 3MSYA 3LRLA 1A4MA 2HDJA 1UH3A 1XLBA 3GKFA 4AD2A 4RZ5A 3CU2A 2H3DA 4IQEA 5HOSA 2PZ0A 1PKLA 3WF1A 3WQFA 3M6YA 2WNQA 5ABTA 3CV2A 3QV9A 1JZ3A 3P93A 4O1EA 1LT7A 3IUIA 1FWHC 1UBSA 4LS1A 4DAFA 2BXZA 3UU0A 8CGTA 4EK7A 3OB8A 4C7FA 5CC6A 4A2RA 5IFTA 2Q8LA 2YYUA 2VEPA 2V81A 1GVSA 3PUEA 3TUUA 4R85A 4WY0F 4GNKB 1V6WA 3RN6A 2XG9A 3VNYA 4LVDA 2HVOA 2CXEA 4JQAA 3QKZA 4WDTA 4S2BA 1QJWA 3M7SA 1QASA 4O13A 1EGZA 1VPQA 4HMNA 3UEQA 4DAIA 3AFBA 3RJXA 2QW5A 4FF7A 3OPSA 4WQ6A 1W3KA 4HOXA 1KM1A 4FP1A 2W66A 2D0HA 2Q02A 3GZAA 3W74A 4PUJA 4GO8A 1XUZA 4Y90A 3BLFA 1EZ2A 3VCNA 4XZWA 2WSRA 2XTKA 3MV01 5HNNA 2E6DA 3WNNA 1FXPA 1JCNA 1NWSA 2ZCGA 1IV8A 4P61A 1FWWA 5B7YA 1FFRA 5BXPA 4JL2A 1MMFA 3NQ7A 4K3ZA 4UMCA 1JCLA 3KP1A 4YYFA 4DJDA 3PJUA 4PMZA 4H00A 4M82A 1P6WA 3WBXA 1XD0A 2G97A 3ECQA 5A6AA 1JQVA 3BO9A 5A2CA 4QSFA 1RP9A 2NW0A 4YMZA 3UZWA 1WDQA 4QISA 1JCJA 3EOLA 1D8WA 3M0HA 1TIMA 3EPOA 3MVIA 2OZ8A 2X2GA 3CZJA 1KM3A 2Y8KA 3NZ1A 3VC5A 3KVKA 3TYUA 2CYGA 3CUZA 5B80A 3WL1A 3M6DA 2O9RA 2DVUA 4Z2KA 3AU2A 4TU1A 5AB3A 2NQZA 1EWEA 3W1LA 3ZMRA 1AFSA 3ZFHA 3A12A 2AGKA 1S3HA 1QPRA 5C5YA 3WEZA 3TYBA 4KH2A 2QUNA 1YBQB 4GYFA 2J74A 4FNSA 5CZ0A 4MNMA 4QRNA 1V6UA 5D38A 1SM9A 4MZ1A 4A6GA 4OFCA 1I0DA 3BMWA 4DJDD 2YLAA 2XUCA 3MJYA 4L56A 4B5TA 1Z6KA 2PI6A 3EXSA 1JF6A 4O10A 4TMBA 3ZR4A 3IIVA 5DRCA 4R27A 1UD5A 2GLKA 4JTDA 1V7AA 4O0QA 1U1UA 4KIRA 1HNYA 5HQEA 5IBXA 3GAKA 4OECA 4RJEA 1JIBA 1XC6A 2EG8A 1A0CA 3KBSA 2PMQA 5GVJA 1OSEA 1XKJA 1O60A 5D9OA 2E8YA 3G8RA 1R87A 1TX0A 3W87A 1UR0A 4YJ5A 1JUBA 1XL9A 3L68A 1K02A 1D3GA 2ISDA 4H9UA 4AZCB 3G8EA 3FA3A 2E5DA 4BK9A 1KLYA 2FVMA 4HSNA 5A8GA 1MWOA 4XD5A 5DXXA 1BSLA 3TWAA 4EXBA 4N9DA 4ZB5A 2OWCA 2C14A 3FV9A 3PFRA 3ARXA 5FF2A 4PMQA 3C86A 3I7RA 3AYVA 1JZ8A 3BE7A 2Z7GA 1RPKA 3I6TA 4DYJA 1JZ2A 2QDEA 3C2OA 4RDWA 1OFAA 5LXXA 3SCOA 3UG5A 5I3DA 4FXSA 2VVNA 2W61A 2VEGA 5C9UA 5A6KA 4E8GA 2QLYA 3ZO9A 1VEOA 3BMXA 4B90A 2CW6A 3LHWA 4YVXA 1DIKA 2AKMA 5CSSA 5IXEA 3VZXA 4NJGA 1WDSA 2DT1A 3PSWA 5BWAA 2W5FA 3B03A 2G0WA 4TR9A 3R5EA 1PTAA 1RALA 4DXXA 4AHPA 4H6EA 5DFAA 1YPFA 4L6HA 4MKSA 1UKPA 3TH6A 2FPVA 4UQEA 2P0OA 4ALDA 5ENLA 3QW4B 4LTSA 3HG3A 1I9CB 3L4YA 3F4DA 2E7FA 4WKHA 3GTFA 1KGWA 1DXIA 4QR6A 3U8GA 3NPWA 2A6NA 2DT3A 1BQGA 5AN7A 1XPGA 2P88A 2WC4A 2WCGA 2PDQA 4EP8C 2CKRA 1WOAA 3A5FA 1SZRA 2QCDB 2QJJA 4FI4A 4AXKA 2ZE3A 3RIKA 5E70A 2KZHA 1Z89A 4JCMA 8A3HA 2PE4A 2PWFA 3HURA 1TFVA 4NZ4A 1J79A 3BG5A 2XZ7A 3TLLA 3PUDA 1Y0EA 4IFRA 1N8WA 5HUOA 2BVDA 1X38A 2Y2WA 4LCRA 2FZNA 4H01A 1SUXA 4GNJA 1W9PA 4AZ7A 1YDVA 4GIRA 1QNPA 2QZRA 4ACZA 4AHOA 3WMSA 4HJFA 1KM5A 2AQVA 3QTGA 3IWPA 4PCFA 1ZY9A 4DZAA 1FHVA 3OTRA 3TN6A 1YX1A 3CJPA 4LV4A 1V5XA 2HPIA 5HANA 2FGLA 2WMIA 4B3ZA 3LEPA 2O0TA 1TELA 3DI1A 1OQFA 1KC7A 2Q3OA 5A8QA 3CHEA 1CX9A 3ARRA 1E4LA 1CLKA 3TDFA 1IIHA 3W23A 3P82A 2VFIA 2HNEA 2OX4A 4D72A 1VS1A 2VZOA 1VR6A 1XICA 2QCFA 3MCOA 3UVIA 1ADSA 4GUGA 4KGLA 2F6XA 3WFZA 1VFUA 1V0NA 3RO6A 5CJ5A 4OJYA 1PYFA 1R3VA 4JTRA 4BFAA 3TYAA 5IFPA 3B4YA 1POKA 1XDLA 3GW0A 3WK0A 4R7WA 5M3WA 4NZ5A 1MW2A 3TMLA 4NJKA 1L6FA 2AL1A 3SQLA 1V02E 1E6ZA 4FXJA 5IDZA 4QJ4B 2WM0A 3AO0A 3I3EA 4GVFA 2ISVA 2QGHA 3PFMA 2XSBA 3FHQA 3CLWA 3S5ZA 3PSVA 3Q4DA 1S1PA 4ZTXA 3TW9A 3UW6A 4IUOA 3DXIA 5CXPA 3GBDA 3S42A 1K6AA 4O11A 4C1KA 4UQBA 3W7DA 2NXHA 1LRNA 3T9PA 1T99A 4V1YA 2RDWA 2FYMA 3KWXA 2ZRXA 4F0RA 3CUHA 4MDPA 1VHCA 6XIMA 4HYVA 4DJEC 1YTDA 4MJ2A 4UOZA 1TMHA 4AX6A 3TXVA 3C5QA 3MT1A 1WKEA 4O19A 3STPA 2QGYA 4DBEA 3W2KA 4QQ3A 1TV2A 4X63A 3VGBA 1V77A 3LV5A 1BEUA 3P5ZA 2FPYA 2A0NA 3H6OA 1TVPA 1DTUA 4ZXLA 1A3XA 3ITLA 5CKSA 5BRQA 2DUZA 1N8FA 3QSTA 1AL7A 1JDDA 3EAUA 2EJ1A 1I45A 2Z2UA 3BOXA 3P14A 1Z32X 1AH3A 2EG6A 1DJNA 2EHHA 1MUMA 2Z7KA 4BZYA 4GQQA 4Q4RA 4EKJA 1Z7AA 3UWQA 4XKYB 3L0KA 1V93A 2VRKA 5H2ZA 3ENLA 3K2GA 1TR9A 3W7JA 1ZJBA 5E1QA 2BVTA 1J2WA 2DZBA 4LAOA 2PDNA 3TYEA 4UTKA 2VL4A 4P7OA 1O5RA 4IOTA 5B7ZA 1SMAA 3OW1A 3REQB 4S3GA 5M03A 2R1KA 3ARWA 4QDPA 3BCJA 3PZIA 2OYMA 2FFIA 4X0VA 4AHQA 2DQXA 4OTKA 3RX3A 3NDOA 3QV8A 2VENA 4Q4SA 1ZCOA 3ISIX 1LG2A 1OX4A 4JD4A 3SZ8A 3VE7A 3PM6A 4OV4A 3TSMA 2O7SA 4IXXA 4O1BA 3GU1A 4ZOCA 4QITA 3P5YA 5M1TA 4GZJA 4Q4KA 1RK6A 2Z1BA 4URIA 1UUOA 4WSHA 1XISA 2DORA 1HKMA 4LAKA 1GEQA 5E0CA 3SW6A 3VGGA 4MY1A 1KW1A 2P8BA 2FZDA 4B5NA 3PJXA 3RXZA 2V5JA 3NR0A 2PEVA 2X42A 4NKCA 1TV7A 1UWAA 2QJNA 2WW5A 3JU2A 2DFAA 3MUCA 4M80A 2O9PA 3GH4A 2OX1A 5GNYA 4QAWA 3O6AA 2REQB 4FS9A 1P7TB 1WUFA 4S2CA 1EPVA 3CZLA 4I6VA 4IJCA 5EMJA 3SY1A 3E0LA 1M65A 2OFJA 2I16A 1QOQA 3AZSA 1YNPA 3L66A 4GYJA 1XSIA 5HWJA 3S9IA 3THDA 5JIWA 1XLIA 2OLSA 1UZDA 1TA3A 1VCVA 2ZRUA 3LHUA 1A5LC 4K8HA 4HD5A 1MEWA 4LCSA 1VLIA 4F48A 4PL1A 4F9JA 4DVOA 2VELA 3WDRA 6ENLA 1CTNA 1KRMA 2I1OA 3GSMA 3LY0A 4XX6A 1EGMA 1LM1A 1GONA 2QPUA 4OUIA 1SVDA 3OEXA 4D6IA 4JIRA 1VBGA 3MCNA 5D37A 4YWIA 4YYCA 5DQPA 1EJWC 2X09A 2XH0A 3M5ZA 3PJTA 2ICSA 4G2DA 3RPDA 5DCBA 1J0HA 4DNHA 3H4WA 4Q8UA 3T0CA 4FLSA 4O16A 3M07A 2X40A 2WLZA 1ZGDA 3CH0A 1AD4A 1UZHA 3UZJA 4G6CA 1IYXA 2J25A 1XFBA 2XFRA 4CCZA 5E5CA 3MHGA 2XZ9A 1ODUA 4O1AA 2FMNA 1QW9A 1RVGA 4U31A 1IEIA 4F9DA 3APTA 2CBVA 3WQ8A 2ACUA 1HO1A 1XQLA 3ANVA 5M5DA 2GVGA 3M5VA 1WKYA 2PRLA 4OGZA 4HB7A 2PUZA 3O07A 4Q7IA 4MYAA 3HFYA 1K7EA 3PPHA 4HQVA 3K4DA 2ZUVA 4UNLA 2V30A 3HGRA 3KOZA 1W1B1 1BQCA 4GUFA 1B0IA 3GRIA 4W7UA 3TU9A 4LC8A 5F4SA 1P0KA 2CWNA 1XYBA 1F3EA 4XO6A 1FKWA 1M03A 4MNJA 4OBSA 3UY8A 3MBFA 3T8LA 2PGEA 1LQ2A 3CZEA 4MIMA 1UR9A 4NNBA 3F4NA 2CCRA 4JTJA 3W81A 3S2MA 3ITXA 2QUMA 3N4FA 2PDGA 2VOMA 4XIAA 3HMJG 3F2CA 1DWFM 3MKCA 3LB0A 3PTKA 1XYFA 1P0BA 3I6RA 1CGTA 4W5UA 3U7BA 1FBAA 5HXMA 3AIUA 2YLLA 3NSXA 4OWGA 1SO4A 2XVGA 1RLDA 4LUSB 4YPJA 5EMLA 2YDRA 1TQJA 5HWNA 1W3HA 3GIQA 2XN2A 4NZFA 5K4XA 1ICQA 1QOXA 5CC5A 1JUKA 2ZUMA 3PP7A 2CHNA 3K4AA 3LN3A 4NP7A 3KBJA 4GI6A 2PLJA 2F9RA 2BHUA 4PYSA 1ICSA 3SEPA 1L6GA 4XTIA 3W7RA 3STEA 3WNMA 3SSJA 4G1NA 4EIVA 4DRSA 1E6QM 4WSKA 4XISA 4DBWA 1OG0A 4A8NA 4ECLA 2HMCA 4YCPA 4UTJA 3ITGA 2XDFA 3QGKC 3SAZA 1TV5A 4H8NA 3RCYA 1PZ1A 4BQ3A 3USBA 4BR1A 1HL2A 1H62A 4JIQA 5HATA 5IDIA 3AXKA 1F4AA 1QNVA 1E3ZA 2PWDA 3MB9A 3K13A 3W86A 4QXIA 3L4XA 1XGDA 2PAJA 1KR1A 3CZKA 3E2SA 2BGNE 4MWAC 5EFDA 1KBJA 3UD6A 1J5SA 1LYXA 4GACA 1X7IA 5E6ZA 4DZHA 5I3FA 5D33A 4N4QA 2OEKA 4D71A 3AISA 3ELFA 1K8CA 1O1HA 3D3FA 3PPCA 4BF7A 2A3BA 4J1OA 3IJDA 3VI2A 3M47A 3T42A 3G77A 2FHCA 2EGZA 2Q01A 3RU8X 3M43A 3DFTA 2PS2A 3W24A 1VGAA 2DIEA 2GYIA 2JQXA 2C15A 3PZTA 2QDHA 3VNDA 8XIMA 1HJQA 2ZZ3A 4W89A 4JTUA 2E67A 3DBNA 4NJHA 3W6MA 2AAMA 4Z2LA 1QK2A 4MWAE 3AMLA 1GTHA 1VFSA 1K7XA 2J7HA 3BV4A 1V6YA 1QOPA 1UKTA 3L23A 4B3LA 4JHZA 3PBGA 4M6VA 2HISA 2XU2A 4XUGA 4Q8OA 1D3CA 4UFHA 1F61A 2ASHA 5C9RA 1PIFA 2PWUA 4P7QA 3ABQA 1PKYA 4RW3A 2WSYA 1S38A 4FOKA 1AD1A 3R8GA 1KXQA 3NQDA 1KWGA 4PCNA 4YN5A 1DJQA 1R0MA 1GJWA 3E02A 2Y61A 3FAWA 4M1BA 2A4AA 3ITVA 1VH7A 3WUEA 1V08A 2QF7A 1E0WA 3ABSA 3N25A 2FLIA 4ZQOA 1TUFA 3UCQA 3WLOA 3STGA 3H2MA 4DO6A 2DDXA 2JALA 3KRSA 1YTEA 1V3HA 4AY7A 5D05A 1DP0A 5CPSA 1QXLA 3WQEA 4U2ZA 2CHRA 4C6FA 1WX0A 4KWUA 3EWDA 1DWAM 4CCDA 3LXAA 3PUGA 3WD1A 2CBJA 1QU4A 1JPIA 4WJXA 1YADA 3JZUA 4E4UA 1SGJA 3QV7A 3LXCA 4LJ3A 4GKLA 4WKFA 5LNSA 1S46A 3ALFA 1GWJA 1HJWA 2V5LA 5FA5A 5TQLA 1J0YA 1UMLA 1O5XA 1W9BM 1A80A 3SN4A 1TVLA 3I4EA 1JCXA 4D6GA 1EZWA 3UCCA 5CGTA 1TZ7A 1KXHA 4GO9A 5AZ0A 3NL2A 3GDLA 4UFKA 1DQWA 4FIRA 1UC4A 2D24A 1NSJA 2ZZ4A 2RAGA 3ARZA 5G4EA 4CNTA 3VOCA 5FI8A 4PE8A 2YCEA 4E2VA 2NVDA 3OLEA 3VABA 3MDUA 3G22A 4Z1BA 3ABRA 4IMDA 1IEVA 1XLEA 2WOQA 3CAVA 5ABFA 3GK0A 1OFRA 4IFOA 1JAKA 4K2SA 3QXBA 2OEMA 3KCJA 3PG8A 1F4HA 4O1FA 4JYEA 4NT0A 4MDOA 1FRBA 4QROA 3AYRA 3PZUA 1W37A 3FKKA 4QE5A 3WN6A 3XISA 4ADTA 1U22A 2V3DA 1MXGA 3OODA 1EUAA 1ZAJA 3USZA 3WH9A 1WXYA 4EXAA 4P2VA 5I00A 2PTXA 3RDKA 1SFSA 4UR7A 4PUKA 3EOSA 1R38A 2J4GA 1IWPA 3QN3A 1K9FA 3W25A 5CPOA 2OO6A 2RJHA 2AQOA 2HE8A 1EWDA 1KBIA 2DH2A 4FB7A 3STFA 4U10A 1K9TA 3LV6A 3W73A 5AHEA 1U5VA 1XW8A 2NX9A 4AWSA 3CMGA 4FPSA 5HNTA 5H1WA 3TTYA 1E5JA 1VFMA 2DZTA 4JYFA 3SFKA 4ERIA 2D23A 1LLOA 3GAYA 5AFDA 3VMPA 1JGMA 3VK5A 3VGEA 3W9ZA 2ZX7A 3P0XA 1Z8AA 2ZX5A 1A5OC 1HJXA 3DYOA 4FNRA 5GQBA 2BXVA 4C1NA 2NQ9A 4HHHA 3DEQA 2A79A 5EL1A 3TCSA 3OVRA 1BLIA 2Z29A 1XIEA 4PB4A 3CT2A 1R5YA 2TAAA 2J24A 3DGRA 4GJJA 1ZBVA 4B5UA 1EHAA 3BAXA 1JEZA 3O6CA 5SWUA 1VZWA 3BG3A 4HHMA 1XIGA 3W53A 4ZENA 5U7SA 2DUXA 1KXVA 1YHTA 3SCUA 3T09A 4JIPA 5JVLA 3UYIA 2YCJA 1OC7A 4RUBA 3TP4A 3GU9A 4XB3A 4IHCA