3M1ZA

Crystal structure of the mutant v182a.v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIAGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 86
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m1zA00
4YMZA 3VKJA 4S2CA 3MMTA 4RV8A 4N2YA 4AWTA 3M9YA 1OF8A 3E0IA 4GC4A 3M0ZA 1LRNA 3HG2A 4M5PA 2YW3A 5AHLA 2E5DA 1FCQA 3CWOX 2JK2A 4WZHA 3RNDA 2NV1A 2X2GA 4FIQA 3W1MA 5DLCA 1KFKA 5BNKA 1H7NA 1H51A 3BARA 3NQGA 4HSNA 4O19A 1LZOA 3W2KA 3FS2A 2QCFA 3Q37A 3W84A 1I2RA 5CZ0A 5CZJA 5DN1A 1F2JA 1WXJA 4ZL1A 1R2RA 3P8IA 5K4ZA 3G24A 3OEXA 4DO4A 1XBZA 1W56A 3A9IA 4AHQA 3FJ6A 5F4SA 4UTTA 2AAMA 4WY0F 1JJKA 2VOMA 4HPJA 4ICNA 2WQPA 4RLIA 3EX1A 2BX7A 5CPMA 1OFRA 3STCA 2UV8G 4WOZA 5LGXA 2Z6IA 1NVMA 2FLIA 1ZENA 2ZRXA 3IV3A 2VFHA 3MUXA 4JYDA 1GOXA 5FF4A 4DF2A 1I2OA 1MO0A 4OV4A 3G1FA 1ZY9A 4H6KA 2NXGA 3HPXA 3M44A 4K7YA 3PWAA 1M7PA 2CFFA 1SR9A 3CHVA 5D05A 3QM3A 1UUOA 2ALDA 3LI1A 2WJZA 3ABRA 1AMKA 3W1QA 1YDVA 1G7UA 4LU0A 3QMSA 5C2XA 2BWGA 3W7GA 4O50A 3S5OA 3SR7A 4O52A 4KFPA 1FCBA 3CTLA 1LBMA 4YCPA 4RCXA 4WUIA 2ZZ1A 3EX3A 1EX5A 1F05A 1ZAJA 4Z0JA 5GVJA 1Q45A 5EPDA 3TAOA 4FEZA 3LHWA 2RDTA 3SW6A 3WJYA 2YDAA 1VLIA 4X9SA 4CCDA 2Y89A 3W7OA 1DJNA 1OFPA 1PE1A 3QW3A 2CLIA 4LV9A 1XUZA 3FEMA 1IXOA 1TO3A 5BOOA 1G69A 3QMRA 3HG3A 3W7KA 1H5YA 4XKYB 2NWRA 2DZWA 5KITA 1SZGA 3T7VA 4A3UA 1XUUA 3KXQA 2YFOA 2QAFA 3LCIA 5KTLA 1EWEA 3M16A 3QEZA 4JXCA 2GOUA 5KZDA 3E96A 1QNVA 3G1YA 3CPRA 1DBTA 1O94A 2EGZA 1K7EA 4LUIA 4YLWA 3UWQA 1GYNA 3I68A 3L68A 1KFEA 4GUGA 3IIXA 1YDNA 4UTKA 1VH7A 2C18A 5K2ZA 1QOPA 3B0PA 4UTWA 4E0CA 2X1SA 3P81A 5AHNA 1GVQA 3AJXA 3UWWA 4XBSA 2ZRUA 1BTMA 3W1LA 1MSSA 1G4SA 1MEIA 3PS7A 3O63A 1H50A 1THFD 3RLVA 4JNMA 1Q3NA 5AYYA 2V82A 3ZS4A 4XUGA 4LVBA 1EP1A 1RR2A 1JRBA 4RZ5A 3ZFHA 3W7MA 2F84A 5H91A 2OCZA 4WXYA 5AHEA 4UTMA 1DHPA 1VZWA 3KAOA 2VEPA 3DKJA 2A7NA 1FDJA 4H4IA 3CEUA 2ZQ0A 1X6UA 4WY0B 2FFCA 1D9EA 3W70A 1B9BA 2DJLA 2RDUA 1K8YA 4XKYA 5HR6A 2XN2A 1DQXA 2Y63A 3FFSA 1KM1A 3W76A 3L5LA 3GB6A 4HNNA 3QQ1A 2GJNA 3BW3A 4MJMA 5HR7A 2E68A 1FWNA 4JN6A 3STEA 4ZQPA 3O15A 2Z2UA 3C2VA 1SZFA 5CPNA 3TJLA 1JCLA 4A21A 3TSDA 1TV8A 2X1UA 1IGSA 1H7PA 1FX6A 3TDFA 1WDWA 4UFIA 3W7JA 4FHAA 3O8AA 3U8GA 3W7CA 1R2SA 4DXVA 3FLUA 1RQHA 2B7OA 4UUIA 1PVNA 1Q6LA 1S3HA 4JTJA 2V9DA 4CCCA 4AF0A 1FWSA 2A4AA 1LBLA 4WXZA 3H55A 3L5MA 3W7LA 3GNDA 1RPXA 3N3MA 3M5VA 1W5OA 2OT1A 4RXGA 5EA9A 1UBSA 3WJSA 3UWVA 5K9DA 3UZ5A 3GIYA 3GAKA 3I65A 1W31A 4DPQA 4GUHA 1LRQA 2FIQA 5K9CA 1O95A 2NV2A 3PM6A 3EWXA 2C6QA 4C1KA 3WJXA 3STGA 2CLFA 1VS1A 2DZPA 5CZTA 4UFHA 1R30A 5FEZA 3W7EA 1JR1A 3LXBA 1TJPA 4NX0A 3BVJA 2A21A 3SJ3A 3VFLA 1OFEA 1VYSX 3DHDA 2TMDA 4LV4A 1I8JA 3G1DA 3MBFA 3W71A 2YGYA 2Q8LA 4JTTA 4LY8A 5D2VA 1CI1A 3HPSA 4JS3A 4XTIA 4CQ8A 2Y88A 5IBXA 1W5MA 4HN4A 1VJIA 2PRMA 3TUUA 3N2MA 3MHFA 3L0KA 4R53A 4EWND 2ZZ3A 3CM4A 2I9EA 5D03A 1H7WA 2Y70A 1GYLA 4Q4KA 4H3DA 3PVFA 4IUOA 2YXGA 3TX9A 4ZMGA 1CW2A 1OG0A 2QCMA 5J5DA 2QCDA 1LOSA 4Z1CA 1QCWA 2QUTA 5G2WA 1D3HA 2XN0A 4BI5A 5FF3A 2PRHA 1VGAA 4LRSA 5D38A 3TW6A 5DY2A 3IGSA 2JBMA 2WNZA 3B05A 3P84A 3OVPA 1OABA 3LLFA 4O14A 3W75A 1W5NA 3C2OA 3VE7A 3THAA 4JX6A 1G4EA 3F4WA 1S5WA 4JTIA 4LW7A 3MP3A 1R2TA 1TSIA 5DCEA 4GE8A 4JX4A 4X22A 3M41A 3C0JA 1O5XA 1EB3A 5D2XA 2FTPA 5EL1A 2ZZ7A 3OVQA 1B3OA 3ABOA 1LORA 3C4UA 5LNRA 3P82A 2OMAA 1YDOA 2B7PA 1GVRA 4FXRA 2GPTA 1VCFA 4QJ1A 4NNBA 3LDVA 4FX6M 3IIPA 1TQJA 4ORIA 1WOBA 4WY0A 1O5KA 3GNNA 1PCWA 2ZRVA 4OQVA 3LM7A 4I7UA 2JKAA 1TJRA 2DZUA 5HQEA 3LRMA 3TIMA 4JY9A 4HKPA 1GG1A 5C55A 1KLZA 3C61A 2VKZG 4LS2A 1OX4A 4KWWA 1XL9A 2ATMA 1GWJA 3TV8A 4K7VA 3GDTA 1GTHA 3PBVA 1OVDA 1EP3A 3C3NA 3FYOA 1P1XA 1TPEA 3SIZA 4QQ3A 5EY5A 4GFSA 2H3DA 1SUXA 1G6CA 3BG9A 5U7SA 2H90A 1F6KA 3RFAA 1SPQA 1Y0EA 3UY8A 3W74A 5KZMA 2DU2A 3QW4B 4UTTC 2V0TA 4AHPA 3NQ6A 2QDHA 5F4XA 5HWMA 1HFBA 3N34A 1W3NA 4ZVJA 3G0UA 5LNUA 2ISSA 4MZ8A 3OIXA 1KW1A 1JCNA 4PTNA 1TRIA 3NGJA 4JTLA 2H3BA 3G0XA 1KM0A 3W88A 1SZNA 3VNDA 3PB2A 3KX6A 1KM6A 2CWNA 2RKXA 2WO5A 4O17A 2BSLA 1TV7A 2Y85A 3GKAA 3MP4A 1TIMA 4NZFA 5D02A 3KVJA 5HNRA 1VC4A 3R12A 3KFTA 5DY3A 2YX0A 1AK5A 3NQ8A 4CQ9A 3B06A 2DJXA 1QDSA 3NQ7A 3LX9A 1OFQA 1VYRA 3CT7A 3W7QA 2YW4A 2QR6A 3MWAA 1VRDA 2JKPA 4TO8A 3E12A 3QJAA 5D33A 1YYAA 2VEIA 5I3KA 2QCCA 3KRUA 1K7XA 4JIQA 2A85A 4DO5A 3KHJA 4K8HA 2ZFAA 1N7KA 2FPTA 2FPYA 4QSHA 4AMAA 2G5WA 2E6FA 2ZRYA 3HBLA 3EXRA 4NXSA 1TPH1 4JR5A 2A1YA 3EWUA 1I2NA 4LVAA 2Y7EA 3NG3A 3NL6A 2RH9A 4FO4A 2WNNA 1A5AA 3B04A 1HO4A 1A5SA 2J27A 4A29A 4IOTA 1KA9F 3W1NA 4E38A 4N6FA 1F7BA 1T0OA 1Z48A 3C2RA 4IPIA 3W2MA 4MIMA 3LXAA 1TPFA 4OU1A 3DFSA 4AB4A 3GDKA 3M5YA 4L4LA 4UIOA 1AL8A 4LVDA 4PEKA 4CCEA 3G8RA 4KFOA 4Y96A 3DENA 1MZHA 4ZQRA 4IGHA 5BMWA 1LOLA 5K7JA 1KV8A 4UTJA 1X1OA 3P61A 2A6LA 1OYAA 1OHLA 5F2GA 1TPVA 2YPIA 1F74A 3LCXA 2QUVA 2QCDB 4O12A 3M5ZA 2A6NA 4NUWA 3I7RA 4OWGA 4LC6A 5CGQA 4LVFA 3GR7A 4WD0A 5CSRA 4CNOA 3TMLA 3NEVA 3C6CA 2EAWA 2XN1A 2R91A 2JKEA 3P62A 2W6RA 3HQ1A 1EIXA 4ADSA 5G1TA 3HF3A 3ATYA 3EKZA 4Q32A 1VR6A 3OA3A 1EUAA 1LOQA 2VC6A 2IQTA 1KFCA 2VXNA 2V5BA 4K39A 3IVUA 2ZBTA 1TRDA 3NL3A 3HOJA 4KWVA 2NX3A 3MP5A 3C2FA 3IRDA 4JTFA 3G1AA 2YFNA 4FX7A 4MYAA 5F2MA 1WOAA 4IX0A 3TH6A 2NLIA 1XFBA 1PS9A 4IWWA 4MPQA 1H1ZA 1H7OA 3G1XA 1E51A 3GDLA 1GVSA 3UY7A 4DF1A 1IXNA 3LTSA 2NXHA 2VFFA 3I7QA 4Z08A 2E6AA 4FF7A 1UASA 3R13A 4QNEA 5E93A 1J2WA 3B4UA 3W87A 3TU9A 3W2NA 2LLEA 4O1AA 3O16A 3M5XA 1W1ZA 1M7OA 1F6PA 4WX2A 4XZ9A 5G4WA 1F5ZA 1RQBA 5FEPA 5FF7A 3O6YX 3UD6A 4ZQMA 4O4WA 1ME7A 2DZVA 4QISA 3C52A 4IMEA 3BW2A 3FKKA 2ZTJA 2NWSA 3DKLA 2HS6A 1EEPA 1BWKA 5EKYA 2OJPA 3W7DA 2Z0IA 1ZAIA 3BPWA 1XM3A 1ALDA 4UTUA 1FXPA 3CU2A 1JUEA 2Y7DA 3TROA 3S9YA 1GVOA 1FQ0A 1LP6A 4QNWA 2DZTA 3IEBA 1XC4A 3K30A 1NAL1 4ORMA 2PE4A 4TMBA 3SI9A 3UZJA 3QF0A 1OF6A 5AHFA 5LNSA 2Y61A 4HNVA 3SZ8A 4JTGA 4O16A 3NOEA 2C19A 2FJKA 1I45A 3IIVA 2ISWA 2H8ZA 1RV8A 1YTKA 3IGUA 3BW4A 2BTMA 1ZAHA 1XBXA 4AWSA 1OFDA 2NUXA 4UR7A 3HG4A 4PCFA 4OBTA 1FCVA 4OE7A 1IXQA 4UFKA 3W2LA 1XBYA 3N73A 3L67A 3MO7A 3QSRA 3FOKA 2X1RA 5AHIA 1OK6A 3W1XA 3ZWSA 5HMSA 3Q94A 4A22A 1TB3A 3THQA 4JICA 1W3IA 1R46A 3MBDA 5TIMA 1A5BA 7TIMA 3F1QA 3A22A 2X1TA 4OHQA 1IF2A 1FDYA 1U5JA 3LV6A 1ZNNA 1OYBA 3L21A 3GZ3A 3TSMA 5I3FA 2F7FA 3CB8A 3W23A 3QYQA 1VHCA 2OX1A 1GTEA 2V8ZA 2V2CA 1KLYA 4Y9AA 3C56A 3CIWA 3ELFA 3FKRA 4OT7A 5HJLA 2DZSA 2CLKA 3TC7A 2Z6JA 4O57A 3DFPA 2XFWA 1XCFA 2QCLA 1KTNA 3QH2A 3W6YA 1ZFJA 3QMTA 1JCMP 1JCYA 3NA8A 6TIMA 3NM1A 4UNLA 1L6WA 4MJZA 1EUNA 4MY9A 4AEOA 3USBA 1YTEA 5MHBA 5F2LA 5C54A 4DEFA 3GXNA 4FNUA 1W5QA 3EWZA 3EXTA 3DH7A 3IVTA 1GZGA 3W3OA 1DVJA 2CLMA 3CC1A 4O53A 3VE9A 4RXFA 4N9EA 3TR2A 4FXSA 3NNTA 1SU5A 2ZRZA 3GR8A 5FF0A 4N9CA 3VI2A 3PUEA 2QKFA 1FWRA 3O6DA 3QRHA 3MHUA 2ZA2A 5G1YA 4L4MA 3O06A 1Q6OA 4Y8FA 3W86A 1TV5A 2E77A 1YXDA 2FQIA 3MI6A 5E1QA 3WK0A 3GKFA 5CKSA 3A24A 2ZA3A 3W1AA 1OK4A 4N02A 1GEQA 1Q6QA 1KFLA 2P1FA 3MI2A 1DORA 4MFEA 2EHHA 2O7QA 2WKJA 4LC8A 3M6YA 5SWUA 3NL5A 1PV8A 4ZQCA 4K37A 4NQ1A 2HTMA 1LM1A 3L0GA 1N8FA 1PHQA 3B0UX 3S8HA 1FBAA 4G1KA 2ZCGA 1IIGA 1SO5A 3G3MA 1L6SA 3F03K 3LHVA 3INPA 5K9XA 4UC5A 3LTYA 4IJBA 3LLDA 3LI0A 4HT3A 4IXHA 2I1OA 5L6UA 3P5ZA 4RKAA 2Y7FA 1M6JA 1MEWA 1H62A 4GBUA 2B7QA 4UCGA 3JRKA 4IMCA 3P8JA 2E6YA 3P67A 4ZQNA 3R8RA 3I7SA 4NJJA 2O7SA 3W2JA 1H7RA 1NFBA 2OZ0A 1G7VA 4XQ6A 4R7JA 3S5YA 3UPWA 1XBVA 3SGUA 5AC8A 4MUZA 4YL2A 2E5BA 1EPXA 2ABAA 3RU6A 5LZLA 4AF0B 4KFNA 4S2BA 4UTHA 3LCFA 1KFBA 3L5AA 4EF8A 4WJEA 2AGKA 4M7TA 2Q3RA 5DXYA 1LROA 3OVRA 1HG3A 3P7YA 2JGQA 3HB9A 3A5VA 3EWWA 3JR2A 2J24A 4ALDA 2QCGA 3GXTA 1K7FA 5CG7A 1QPNA 3PSVA 1QPOA 5CPOA 1G67A 3HO8A 3B0VC 1RZMA 4K6AA 2Q8ZA 5F1VA 5HUPA 3NPVA 3TK7A 5D37A 2C3ZA 1P0NA 5C5YA 1A5CA 1WAUA 2HMCA 5HUOA 1KBIA 1GPWA 3ZWTA 1NF0A 3NPXA 3EX2A 1VQTA 3OG3A 4O28A 2QJGA 2E6DA 3LHZA 5H2ZA 2W79A 4GUJA 5U4NA 1H60A 1SO4A 3LERA 1O60A 1F76A 4TR9A 3TJXA 3PULA 1K02A 3E9AA 4I7WA 3W73A 1TPB1 1U83A 1D3GA 3TC6A 4JDBA 2AQWA 1S5TA 4OV9A 5EMUA 1ME9A 3CWNA 3LRLA 3NYZA 2C16A 3EB2A 3LHTA 2VENA 1L6YA 4UMCA 3RK8A 3WJZA 1TCDA 3FIGA 4P2VA 1H1YA 2J9XA 4NJGA 3P80A 3BG3A 1H63A 4M7SA 3DBPA 1KM3A 1ML1A 1WV2A 1LTDA 3U6WA 3WK1A 2R14A 1WQ5A 3GYEA 3Q58A 2NX9A 5I3GA 4Z1DA 4Y90A 3YPIA 1YXCA 2GVGA 4NU7A 1SO6A 2BXVA 4UNKA 4XBKA 4O1CA 3DFNA 3W22A 2A5HA 1PL9A 3EKLA 3PY2A 5D32A 1XXXA 1A53A 2GQ9A 3BGJA 4CQAA 3MI3A 1BWLA 3KRZA 1OYCA 1Z42A 1ZALA 3NQCA 1UB3A 3TKFA 4QITA 4NNCA 1OJXA 2P0OA 4JTKA 3G18A 4IQLA 3N14A 2Y62A 5EBUA 3L2IA 1SSGA 2GJLA 4AVFA 2D73A 4NXKA 1PCKA 4EOUA 5FF2A 2ABBA 1QWGA 2ZZ5A 5TQLA 2ZYFA 3O6CA 3PAJA 4JX5A 4CLMA 4QM1A 3V75A 3LXCA 3LOTA 2EPHA 2JGYA 4P61A 4RZ6A 4MY8A 1L2UA 4O54A 4LS1A 2V81A 4LTSA 2DZXA 3UWYA 2FPVA 1HL2A 1TPWA 1OX4B 3LGEA 2NXIA 3LV5A 1X7FA 3ABQA 1JCJA 2A0NA 4A2SA 5DBUA 1WBHA 4O18A 4BFAA 2H6RA 3STFA 4DO6A 1SZEA 1K8ZA 4IX2A 5AB3A 3QFEA 4YXGA 1UCWA 5LNVA 1X1ZA 2B7NA 3CIXA 2ZZ2A 2YR1A 2RFGA 2FB2A 3W9ZA 3IGXA 3PBUA 2CLOA 4E2DA 1G4TA 3M1ZA 1DJQA 2R94A 2VFDA 2E1DA 2V2HA 4U28A 4E2BA 1CX9A 1NSJA 3G22A 1Q6RA 1KBJA 4AXKA 5L9FA 1X8FA 3NQMA 2A2IA 2EF9A 2ATSA 5K4XA 5LGZA 1RD5A 3P5YA 3LBMA 4HNTA 1GG0A 5CSSA 1P5BA 4POCA 5FEWA 3NQVA 5LNWA 3TAKA 1N55A 3FYPA 3LRKA 1NEYA 3HGJA 1ZCOA 4MOZA 3NXFA 3RF9A 4JTEA 3NVTA 2QAPA 4JTUA 4K36A 3LCWA 2J6XA 3RMJA 5DCDA 4BK9A 4X2RA 3NZRA 4RJEA 2VEKA 4NX5A 2E5CA 4RR4A 3NAVA 1QFEA 2NX1A 3T40A 2VFEA 3CLMA 3NQDA 1OFOA 2C0AA 3E02A 1HO1A 3ANYA 1B4EA 4N4QA 5HWJA 5TBOA 4K8EA 5KSWA 3T44A 3LHYA 4O15A 1K8XA 4FNTA 1QO5A 4HNUA 4GXMA 3GDMA 2J9YA 3S5ZA 1I2QA 4EF9A 5C6MA 1XDMA 3TXZA 2C13A 1Z41A 3N9SA 3UWUA 1KTBA 3PG8A 2ISVA 1ICQA 3R5EA 6ALDA 2Y7GA 2RHGA 3ATZA 1YTDA 2P10A 3GK0A 4IMFA 1LLZA 2WSRA 1W37A 3T4CA 4PFMA 4YWIA 3BV4A 3PUDA 1VCVA 2QCHA 5LKYA 3MHGA 2G97A 4IMGA 4PL1A 4DPPA 5CPLA 4MLRA 2B0MA 3QQ0A 3PG9A 3EEGA 3MW7A 3WFAA 3EX6A 2TRSA 1J5TA 1G4PA 3FJLA 1JUKA 1QMLA 1VPXA 1Z44A 3H54A 4UFJA 2TPSA 1AW5A 1WYIA 3EWBX 1UJPA 1QR7A 2YZRA 3SFKA 1AL7A 4MFDA 4O4VA 3TXVA 2YYTA 3TFCA 3HIJA 1QPRA 5I3JA 2A7RA 1RQEA 1I2PA 3WJWA 3NPUA 8TIMA 2V30A 2HS8A 3A21A 3GLCA 1OX5A 4O10A 5FI8A 2PURA 2PC4A 1VYPX 1SQ7A 1FXQA 4CNPA 4JY8A 4B5NA 4UTWC 3O1NA 5ABTA 3IVSA 4BR1A 3ABSA 1OFBA 3R2GA 4WQ6A 3PC0A 3Q2DA 2A7PA 4O0KA 5BRBA 3S42A 1EA0A 1TTPA 4FNPA 3PF3A 3DGRA 2CLEA 3I6RA 4BWLC 4IMDA 2QDGA 3VCRA 2J88A 3A23A 5HINA 3TQ0A 2H8XA 3N9RA 3NR0A 3ZR4A 1BKSA 1TTQA 1XI3A 1GT8A 3GXPA 3H53A 3JS3A 1V5XA 3NQAA 4O0ZA 3G1VA 3HMJG 4M6VA 1S5VA 4O1DA 5IBXC 1P4CA 4O8RA 3LB0A 5FESA 3GVGA 3DZ1A 1DL3A 4MVAA 3UYCA 2VELA 2FB3A 1KM2A 1WA3A 3A5FA 4M19A 4O13A 4FB7A 3LCGA 2G96A 2VFIA 3M7WA 1TQXA 1HTIA 1QPQA 3T78A 5I3HA 1SW0A 3S1WA 4YCOA 3FA5A 3C8FA 1C8VA 3TA6A 1PIIA 4AWUA 4JGDA 1KTCA 3GDRA 3G0SA 1TTIA 1XDLA 3DAQA 2V5LA 5G5IA 2CZEA 3S1UA 1T99A 3U2OA 3TSBA 4DQWA 2X30A 4Q33A 5AYZA 1EWDA 2Z1BA 5DCBA 1KM5A 4J9JA 4HPXA 3IIOA 4U4MA 2BLEA 1TPUA 1T8XA 3BGGA 3S6DA 4NZJA 2KZHA 4DF0A 3KVLA 4UFLA 4UTIA 5FEXA 3NZ1A 3UNDA 1DOSA 1SFLA 2ZDRA 1RVGA 2R8WA 2WOQA 2CZ5A 4Z0SA 3IIZA 3L65A 3SY5A 5KMYA 5A5WA 4FIRA 4MY1A 1F73A 4AAJA 5DELA 4BWLA 3BLFA 3BK0A 1A50A 4GNJA 2GVJA 4M6QA 3WK3A 3NO5A 1ICPA 2YYUA 5D2YA 2QJIA 4UR8A 1IIHA 4EIVA 3KVKA 3T55A 4CNNA 2C15A 4HIBA 3L66A 5AC7A 3HJZA 4O1BA 3BLIA 5DXXA 3W1RA 4Z1AA 4IXXA 5K3VA 1DKWA 1VHNA 4JYEA 2QJHA 3BO9A 3O05A 3R89A 3SSJA 1JCXA 1ZJIA 4NT0A 4FNQA 5G4EA 4ADTA 2E09A 5E0KA 5AN7A 5G2HA 2FDSA 4NVTA 1EP2A 3HGSA 2ZZ4A 3G3DA 3LTPA 2Y6ZA 3N2XA 1SW3A 2RDWA 3DU0A 1P0KA 1I4NA 3NQEA 3QZEA 4JTSA 2TYSA 1QOQA 1YLVA 2W0UA 2CLHA 3E49A 1K3UA 4HHPA 3C2EA 5AYXA 3KVMA 1GVFA 5J5RA 3W72A 1JUBA 2GQAA 3W07A 3DFTA 1MEHA 1H7XA 3W7HA 4JDYA 4KKXA 1ADOA 3W7PA 5AFDA 3D0CA 4C1LA 2YSWA 2QCEA 4PC8A 4D2JA 1TPDA 1TPC1 4BI7A 4DBDA 1TMHA 1W0MA 3OBKA 1BEUA 3QSTA 3TW7A 1AW1A 2PCQA 1B57A 3G8EA 1L9WA 3DFOA 1LDCA 1TTJA 1O4UA 1KFJA 3MJYA 4NNAA 5CZSA 2ZRWA 4DELA 2CLLA 3W2UA 1JRCA 5F2IA 3W1UA 3PSWA 4TU1A 1W3TA 1GJPA 4RX0A 1MXSA 3AO0A 5G2IA 5T26A 3S1XA 4LUJA 3SECA 4ZQOA 1FCUA 4NJKA 1IXPA 2WSYA 5LSMA 1JVNA 3LHUA 4AH7A 1DQWA 1ONRA 4LS0A 1YXYA 3V1PA 3QPYA 4QIUA 2TSYA 2ZTKA 3QC3A 4GJ1A 1YPIA 4N9BA 3W83A 4GUIA 1SSDA 1HUVA 2QUUA 1LRTA 3GX9A 3TQVA 3PBWA 1DV7A 3W1TA 2C1HA 4TX9A 2DP3A 4UTLA 5KINA 5HULA 4MYXA 4JEQA 1GQNA 2EKCA 1SW7A 2ZA1A 4W9TA 2VEMA 1SO3A 1FWWA 2GVLA 4FNRA 4I9AA 4JD4A 3HGOA 5EYWA 2X16A 3B8DA 4JIPA 4R33A 2QCNA 3M43A 1PHWA 3LCLA 2WV8A 3DFQA 1TYGA 4JTHA 4ONVA 4EVZA 1B4KA 3NPWA 4A2RA 3LCHA 4JYFA 4FX8A 1OX6A 4UXDA 3NL2A 3MYPA 4QAIA 3UXAA 4LWWA 2QF7A 3P74A 1C29A 4HSOA 3NDOA 4O11A 1OFAA 3HPZA 4IPJA 4NJIA 3DI1A 3L0NA 4PA8A 3CQ0A 3PR2A 1V7YA 3EXSA 4LRTA 2B4GA 4TIMA 1QAPA 4GUFA 3EX4A 5D2TA 1KV5A 1JQVA 2NUWA 3QPZA 1VCGA 2Q3OA 3BLEA 1LBFA 4XTDA 1AG1O 3HGRA 5A8GA 3TQKA 5BW6A 4PH6A 2WSQA 3WK2A 3TMQA 2ZZ6A 5D04C 1H61A 4NJHA 3N19B 1TREA 1W8SA 2G95A 2V2DA 1NF7A 1ME8A 3KOFA 1LCOA 2GUUA 4DBEA 4BI6A 5KZEA 4BF9A 3UQNA 1FUYA 2WPBA 3PUOA 1AW2A 3S1VA 3DXIA 4MZ1A 1UUMA 3TE9A 1FDZA 5LHEA 3P60A 1R47A 4S1FA 3DHFA 3NQ2A 3UWZA 2HSAA 3L9CA 2WNQA 3CEPA 4UMBA 4XWUA 4RK8A 1C9DA 4RZ4A 2NUYA 2GQ8A 1J4EA 3O07A 2CW6A 3PB0A 2YCEA 2BZNA 2OT0A 5F1UA 2VFGA 1YADA 1FWTA 3UXDA 3RLUA 1K03A 4MLJA 1XKYA 4MKNA 3MYOA 1LYXA 1T96A 5AOUA 3EWYA 4X3ZA 1WBJA 4GRSA 3M47A 3TCEA 1W5PA 1ICSA 4R34A 1YPFA 1M5WA 5AC6A 1WX0A 3NQFA 3W7NA 4ADUA 5IM51 2CZDA 4K38A 2CU0A 3TFXA 4I7VA 3S0CA 4LVGA 4LOCA 1KM4A 3GAYA 1LLWA 3PBYA 2PRLA 2DORA 1QO2A 3W85A 4PODA 1ZHAA 4UMAA 3OHIA 1VLWA 1JQXA 5BMXA 3G1HA 3B03A 2NZLA 5DBTA 4ML9A 2C14A 4MZYA 3W7RA 4TMCA 4WOQA 3UPBA 2I14A 5D2WA 4N9DA 3DI0A 4GWEA 4Z1BA 3TNOA 5LHFA 3W1PA 5D30A 4M6PA 3KRSA 5I3IA 4N4PA 3G1SA 4Y6GA 5D09A 3HG5A 1W54A 3LBCA 3S5NA 3W7IA 2QEZA 4PL2A 3NM3A 5F4WA 1SFJA 5HWNA 4UFMA 3F4NA 4LT9A 4OGZA 5AHMA 4FNSA 1JULA 4LNYA 2CZFA 3BG5A 4N6EA 3SGZA 1FY6A 4AHOA 4ZZ9A 2J9ZA
chains in the Genus database with same CATH superfamily
2WWDA 3VKJA 4S2CA 4JNZA 4KWOA 2Q71A 4BY3A 1OF8A 3CQIA 4GC4A 3EDFA 4M5PA 2V3FA 2PAJA 1UH2A 5B7YA 4LYKA 3PAOA 2JK2A 2VT0A 4WZHA 3VKBA 3SGGA 2G3FA 2D0GA 1R3YA 3BGAA 4FIQA 5BNKA 2PTDA 3UVIA 3H7UA 1H51A 3BARA 4O19A 2NT1A 5CAHA 3W2KA 4AX7A 2YLLA 2ZXQA 4ZTXA 1WXJA 5A8NA 1SMAA 3WELA 1CZ1A 1XBZA 4PSRA 1PJ9A 2QLYA 2OYLA 1DXIA 1Z6KA 3V5CA 3S47A 2NSOA 3SADA 3BZGA 5CPMA 3STCA 3RR1A 1Q8JA 2UV8G 4WOZA 3GFYA 1QTWA 4HA1A 3CGTA 1NVMA 3IV3A 2BFGA 1GOXA 2BHZA 1JZ4A 4DF2A 3GWQA 4OV4A 4G2DA 3M44A 1HJWA 3H7RA 3PWAA 2CFFA 2PTWA 1J93A 3QM3A 4BHYA 2ALDA 3ABRA 3MCOA 1AMKA 4K1WA 1G7UA 5C2XA 3S5OA 5M5DA 4GK8A 3GUWA 3HMCA 3F5JA 4E8GA 1H1NA 4RCXA 4WUIA 3WSUA 3RO8A 1Q7QA 1RD6A 3EX3A 1F05A 4EAMA 5GVJA 2XIJA 5EPDA 2WB5A 5A6LA 3LHWA 5A8MA 4S3DA 2RDTA 1FWHC 1FH7A 2YDAA 1SM9A 4JTAA 3RN6A 1VLIA 4CCDA 1CB2A 2OEMA 2Y89A 3RXZA 3W7OA 3AS3A 1QHOA 6TAAA 5IRPA 3ARPA 1RBLA 1UJQA 2VR2A 4D6HA 3FEMA 3VOCA 1CGXA 1IXOA 3B8IA 5BOOA 1G69A 3QMRA 4W7VA 3M07A 3QV6A 1XUUA 1OCQA 2QAFA 3M16A 5I06A 3QEZA 4JXCA 2GOUA 2D0FA 2VC5A 1TA3A 4LUIA 1GOQA 4E4FA 3L68A 1D7FA 3ECQA 1E43A 4E0CA 4D8ZA 1CLVA 1HGYA 1GVQA 3UWWA 3WBAA 1P1MA 3LEPA 1G4SA 3GTNA 3RLVA 1H2JA 1OGBA 1YQ2A 3KEHA 5ABFB 4FI4A 4LVBA 3AMGA 1RR2A 4UB9A 4RZ5A 1UZ1A 4LFYA 3UG4A 2F84A 2W66A 3BL3A 4YN5A 1O1HA 1D8WA 1DHPA 2QDDA 2GFTA 4PUNA 4QHRA 2VMFA 3BOLA 2ZQ0A 3UFYA 2ZC8A 4WY0B 3AIUA 1RJPA 2GJPA 1K8YA 5HR6A 2XN2A 3REQA 3WBWA 4C6DA 2Y63A 1KM1A 3W76A 3QQ1A 3SAZA 3BW3A 4DYEA 2YCLA 2DW6A 4JN6A 1CNVA 3O15A 3ARWA 3C2VA 3R0KA 2VP8A 4JEJA 5CPNA 4PBGA 3TJLA 1JCLA 3UG3A 1JNDA 2OSXA 3CQJA 4O1FA 3LUTA 4K8GA 2ZUVA 1R2SA 1RQHA 2B7OA 1CT5A 1KKOA 1UW9A 4JTJA 2Y5JA 1ISYA 2V9DA 4CCCA 3VMPA 1FWSA 2A4AA 1LBLA 2VDIA 3F4DA 3OO2A 4HK7A 4RE2A 4A8NA 3PUGA 3S4TA 3M5VA 4S39A 1D8CA 3WJSA 1XYFA 4Q8OA 3UZYA 2O4MA 4BJHA 1XIJA 5EMKA 4A3YA 1M53A 3QHOA 2Z27A 3FSTA 4GUHA 2IPJA 5HMEA 3PM6A 1DWHM 1E9ZB 3UXLA 3VIOA 2OXNA 2CLFA 1VS1A 3MSRA 5CZTA 4ZB2A 3IAQA 1J0JA 3V0UA 4YHEA 4JCMA 2A21A 4E4UA 1KGUA 3VFLA 1OFEA 2ZX8A 3ALFA 1I8JA 1RH9A 2YGYA 5AZ1A 4NIRA 5D2VA 1Y8BA 3ZYZA 1VJIA 2GYIA 3EOOA 3WN6A 3WENA 2J7DA 4R53A 4J3UA 2BY1A 2ZZ3A 3CM4A 1CXHA 2OFJA 1W2VA 3WZ0E 4DWSC 4HZMA 1JD9A 3BLLA 3QR1A 4H3DA 2ZOXA 2CYGA 5J8LA 3WD2A 1PKMA 5J5DA 5KEZA 1HKVA 1LOSA 2JFEX 3OOQA 4GCXA 1SFSA 1PWMA 3M0LA 5FF3A 4DXKA 2PRHA 3GM8A 5D38A 9CGTA 5FL0A 4DM2A 2EQDA 1SR0A 3P84A 4O14A 3DDMA 1G4EA 1S5WA 4JTIA 4JQ4A 2YA0A 4DVOA 3MP3A 3EWDA 4XBJA 4JX4A 4X22A 5D2XA 1BRLA 3OVQA 1VBGA 3T81A 5D9OA 3ABOA 1LORA 3FHAA 3TTOA 3E2QA 4GZ7A 1TE1A 1YDOA 3V7PA 2B7PA 2A79A 2DSZA 1R87A 2GPTA 2O9RA 4XX6A 2V5CA 4XG1A 5C71A 4GPNA 3GNNA 1VFSA 1PCWA 9XIAA 2WZIA 1MW2A 1W3KA 2JKAA 4U33A 4MUPA 3RHGA 1L6GA 3TIMA 1WNOA 4WDXA 1GG1A 1KLZA 2EO7A 3C61A 4Q6JA 3GY1A 1OX4A 3LPPA 1YIXA 2QUNA 4AUBA 1GTHA 1OVDA 1TPEA 2AOSA 3V0SA 4QQ3A 5CJMA 3N12A 3NSXA 2QJMA 4GIYA 1SUXA 4LBRA 1WDSA 4M8UA 4XZIA 3QW4B 1WB0A 4QRNA 4UTTC 2V0TA 4AHPA 1KBLA 1GOOA 3WF1A 2QNEA 4LCSA 5TAOA 2P50A 3G0UA 1D2KA 1W2PA 2ISSA 4TOQA 4PTNA 3OG2A 4JTLA 1F4AA 5E6ZA 1KM0A 1SZNA 1GVEA 3VNDA 3IPWA 3KX6A 3ZVHA 1O1ZA 6XIAA 2WO5A 3CASA 2OYKA 5D02A 1TIMA 3KVJA 5HNRA 2WC7A 4QSFA 3E0FA 1UKTA 5KETA 3NQ8A 4U2ZA 5C9UA 1HKWA 1QDSA 1OFQA 1XLEA 2QR6A 5AVNA 3FAXA 4C6LA 4TO8A 4RW5A 1H3GA 2ZUSA 3CHDA 1J0KA 1BPLB 1K7XA 1A3XA 3CT2A 3KHJA 4I9JA 2ZFAA 2GQ3A 2FPTA 3RJXA 1KCZA 2WZMA 3TYCA 3B8UA 4J2PA 2A1YA 4H9MA 1US0A 4ENLA 2J25A 3TYBA 3WQDA 4HPGA 1OY0A 4LQ1A 1HO4A 1KA9F 1T0OA 1Z48A 3W2MA 1WAWA 3GYCA 1TPFA 2ON3A 4DZIA 2DIKA 2W91A 3OZMA 3GDKA 3M5YA 5BXPA 1GHSA 1AL8A 4JOMA 3UNTA 1OCBA 3UZXA 4ERIA 4E5TA 4Y96A 4ZQRA 1LOLA 5I5RA 5K7JA 1E3ZA 5A69A 4UTJA 5FCZA 5E0CA 2CERA 1TPVA 2YPIA 1MRAA 3RLHA 4C6CA 1VENA 3M5ZA 3I7RA 2D23A 5CGQA 5A2BA 4NAEB 3GR7A 3TN5A 3ZLFA 3L4YA 3NEVA 4Q8TA 1RY8A 1GPFA 4JQ1A 4F66A 3ATYA 1CXIA 4AMCA 1IT0A 1TV3A 1VAHA 2Y5EA 2IQTA 1CGWA 1KFCA 3VO0A 3AALA 2WAGA 4KWVA 1GOKA 1RBAA 3IRDA 2OZ8A 2P88A 4H9UA 3PNUA 2ZX9A 4L56A 4MYAA 4ATDA 1W9UA 4GO9A 2WHKA 4PMYA 1T5AA 1XFBA 3SRHA 2XVKA 2HPMA 1PS9A 3G1XA 1GVSA 2XH0A 2ZE0A 3A47A 3UY7A 3H12A 4GIEA 1KQZA 3POHA 3TTSA 1UASA 3E6EA 3LMYA 3N4FA 3OQEA 5E93A 3NSMA 3BXWA 2EJAA 3W2NA 1W91A 4OBSA 5DF0A 2BBFA 3AROA 3M5XA 4WX2A 1F6PA 4XZ9A 2J4GA 2PWDA 4JKKA 3UD6A 5BCAA 3AISA 1VIZA 4QISA 3FKKA 5CSUA 1BQGA 4KW2A 1FWJC 5EKYA 2OJPA 1CGYA 1JCTA 2BGSA 4KCWA 1ALDA 4NHVA 3TCSA 1JUEA 4H83A 4QLKA 1LP6A 4QNWA 4AISA 4C5YA 2PLMA 1NAL1 1U5VA 1ZQ5A 4TMBA 3SI9A 4RV3A 2PWEA 3UZJA 2VDHA 4PCSA 4H19A 3EDDA 3VIPA 3ITCA 4HNVA 4B9ZA 2J62A 2Z7GA 1I45A 3IIVA 2ISWA 3GFXA 4RDVA 1YTKA 3WMCA 3QYSA 1QT1A 1I9CB 2BTMA 4ZO7A 4QDPA 1ZZMA 3L67A 1BXCA 3MO7A 1TUXA 2X1RA 3SM0A 2YCIX 3IJDA 2WMHA 5JXQA 1R46A 1AFSA 1QXLA 1EXBA 4JTDA 3F1QA 1IF2A 1FDYA 4A3HA 1OYBA 3IUDA 1U5HA 2JALA 3O0KA 4DZ5A 4KEZA 2QZRA 3GZ3A 3FDGA 2F7FA 4GY7A 3DG6A 1KLYA 4JQ3A 3FKRA 4OT7A 2DZSA 1JXJA 2G4FA 4WK9A 1HNYA 3EEZA 4I8YA 1J0IA 3TYUA 2V63A 2EXOA 1ZFJA 4ZO9A 1JCMP 1ELSA 2AGTA 6TIMA 1L6WA 1WDDA 2XSAA 4MJZA 4PTWA 4JBRA 5F2LA 4DEFA 1CBGA 4IPLA 2F2HA 1S39A 2PTXA 1Z8AA 1PB0A 4GY0A 5LIUX 4FNUA 4XVDA 2WANA 4V2XA 2CLMA 3ANVA 4RXFA 3TR2A 1SU5A 4FP1A 1XIMA 5CPTA 3PUEA 2XVNA 4I6VA 3WL1A 2BS9A 3ZMRA 3QRHA 1BYBA 1KWKA 2OG9A 1FTXA 3O06A 3SCWA 4Y8FA 2FQIA 3MI6A 3WK0A 3WY1A 4MNKA 2W5FA 1DJWA 5CKSA 1GEQA 4H00A 1W8GA 1K6WA 4LC8A 2XGBA 1JNEA 3CUHA 1PV8A 3E0LA 4K37A 1NJJA 2WWCA 3T8LA 1N8FA 1PHQA 2GDUA 1FBAA 2CEQA 1SO5A 5BZAA 3F03K 3LTYA 4WIWA 3AIVA 4IXHA 4GCAA 2QXWA 2XH7A 4IMCA 2E6YA 4RDWA 3DFHA 4C6IA 1EDTA 4MKVA 1BWVA 3F5KA 3RPDA 3D5HA 3R8RA 1PWLA 4LNCA 3I7SA 4NJJA 3W2JA 1VFOA 3L2LA 3WBEA 3K8MA 1HQTA 3UXKA 4XQ6A 4R7JA 2G41A 5A3HA 4EANA 3UPWA 5D4YA 3SGUA 4C1NB 2Z2BA 4MUZA 2J7BA 1KC7A 3EOSA 3LNMA 3L5AA 1K9EA 3UGVA 4C6BA 4HCHA 4QEEA 2NQLA 3OVRA 5GNZA 1HG3A 1XIEA 3HB9A 3A5VA 4CU6A 1XLAA 3OODA 1QPNA 2BB0A 2XIMA 1CGTA 2VGIA 4DUOA 5D37A 2C3ZA 1P0NA 1A5CA 1WAUA 2W62A 4LGXA 1KBIA 3CQKA 1VQTA 3OG3A 3IARA 1M7XA 2W79A 5U4NA 3GXMA 1SO4A 3DG3A 2AQOA 1K02A 3PTQA 3E9AA 1ZJBA 4Q4OA 2ICSA 3TR9A 2B31A 1B9ZA 2O4QA 3KZPA 2AQWA 1S5TA 4OFCA 5EMUA 1ME9A 3CWNA 3LHTA 2HVOA 1X6NA 3TP4A 3RK8A 1R3WA 3FIGA 3N6QA 1FWEC 3ZJ7A 1H1YA 4NJGA 3CAQA 1HF6A 5TD4A 5T9CE 1H63A 4CCZA 4EXBA 2GLKA 4H2CA 3VKAA 3C3UA 3B40A 5I3GA 4Z1DA 4EX4A 2GVGA 4NU7A 1SO6A 2RUSA 3WH8A 4Z2KA 3CHCA 1D3CA 5DRIA 5A8OA 3MI3A 1BWLA 3K8LA 3UR8A 5FSDC 3QGVA 1W1B1 1X6LA 1ZALA 4S3FA 1UB3A 2HE5A 2NQHA 2Z1SA 4QITA 4BS0A 1W32A 1XFCA 3OW1A 3QTPA 4WJ8A 4AIBA 3L2IA 1PCKA 4IP7A 4EOUA 5FF2A 2ZZ5A 4Y9OA 3RX2A 3PPGA 4QM1A 1U33A 3LOTA 2JGYA 3GXIA 3SQLA 4O54A 1GUVA 2CESA 3DC8A 2DZXA 2FPVA 1JDFA 1Z89A 3H2CA 4GA8A 3LGEA 3ABQA 4JQAA 3TTQA 1E6RA 2PP3A 4QGCA 1UR3M 5DBUA 1QI3A 4QEHA 2QQ6A 1TX2A 1TWZA 5LNVA 3CIXA 1E0TA 1R7OA 2ZZ2A 3P93A 4QG9A 2FB2A 3W9ZA 2W61A 3NVDA 3IGXA 5CG0A 1M3UA 1VPYA 3H26A 5I09A 3M1ZA 5FKYA 2V2HA 4U28A 3NO3A 4B3KA 1ZJAA 3UZZA 2MANA 3NFUA 3TQPA 1VFTA 3NCOA 1DJXA 2D1ZA 2G37A 3XISA 2AAAA 5L9FA 2A2IA 2EF9A 5HANA 1UD8A 3EPNA 2I5QA 4HNTA 1GG0A 1P5BA 1EJSC 5FEWA 1WKFA 3VGBA 1N55A 1EOMA 4M56A 3GVRA 3HFTA 4NF7A 1B3XA 7PTDA 2QAPA 4JTUA 3LCWA 3ZO9A 2J6XA 1OB0A 5DCDA 1ZLPA 4BK9A 4X2RA 2VEKA 4RR4A 4JIHA 3LGDA 3KBMA 4AQLA 4WSHA 4REQB 3E5BA 2PP1A 1OFOA 2C0AA 4FALA 1R3TA 4C5ZA 1B4EA 3ZLHA 4K8EA 5ABHA 5KSWA 3MV11 5T8GA 4RL3A 1QO5A 1HL8A 3GDMA 1MDRA 4YVPA 3RG6A 1TELA 3S5ZA 1DXFA 1J6PA 1XISA 2Y0FA 2C13A 4ZE5A 2XISA 4UBPC 3UWUA 2GGJA 2ISVA 3ME3A 1IHIA 3UF9A 2RHGA 3CBWA 2PU0A 3VZXA 1SZRA 2WSRA 3T4CA 4PFMA 5HDRA 2G97A 2HEJA 2WSPA 2E9BA 5EB8A 3P3BA 3WCZA 3PG9A 3EEGA 4KEUA 1JUKA 1Z44A 4H9VA 3V0TA 2VVNA 3VX1A 2TPSA 1AW5A 1DJZA 1UJPA 2YDRA 2ODOA 1AL7A 2V5KA 3R4IA 3ZR6A 4D72A 1GK8A 4O4VA 3KE0A 2YYTA 4QLJA 1YKWA 3BAYA 1RQEA 3TVAA 3NPUA 2IPWA 2HS8A 2VJXA 3GLCA 3GO2A 5FI8A 1F61A 1GW9A 1HKJA 4AX6A 4CEXC 1KR0A 4NG3A 2GJRA 3E2RA 1J0HA 3MQTA 1ODUA 4Y9PA 1I0BA 4HSHA 5DMNA 4WQ6A 1RSCA 5EMJA 4IIFA 3B97A 3ITXA 3FYYA 2OTDA 1TTPA 3U57A 3DGRA 4Q8MA 4BWLC 4NZ1A 2QDGA 3VCRA 3TQ0A 3N9RA 3NR0A 5B80A 1KBKA 2WHLA 3JS3A 4JIEA 1M7JA 5EFDA 3MUZ1 2Z7KA 4HNCA 2VRJA 3LB0A 4O8RA 3WLSA 1XG3A 3VCNA 3G1RA 4UQEA 4MWAE 3L2MA 4O13A 3VUPA 4FB7A 2G96A 1N2VA 1F3WA 3F7JA 2WVUA 3WLQA 1MYRA 1SW0A 4YCOA 2XIIA 5FJOA 4AWUA 2X09A 3DECA 4GI4A 4R5EA 1EO7A 1PIFA 3GNXA 4Q33A 1EWDA 2FZNA 4XD5A 7XIMA 5DCBA 1KM5A 3QOMA 2WSKA 3WQ8A 3AS0A 4Y2WA 2BLEA 4LYQA 1XIBA 4QFUA 4GYJA 2WVVA 4IIEA 2KZHA 3EB3A 3K8KA 5FEXA 4FLRA 4JTRA 3IIZA 4HTBA 4W5UA 4ZSTA 3RR4A 5KMYA 3QY7A 4F0SA 4MY1A 3A9BA 1F73A 4AAJA 1NOWA 5DELA 3VPLA 3BLFA 1ICPA 3ITLA 3C86A 4EIVA 3SQMA 1FWCC 4L7ZA 3BLIA 2QJHA 2VQTA 3O05A 1XLBA 1JCXA 1ZJIA 4E4PA 4ADTA 4NI8A 5E0KA 3OYXA 2F9RA 5FJJA 2PF8A 1E6XM 1A5OC 1QI5A 4DJDC 3NQEA 4DBSA 3IANA 4PTDA 4HN8A 5HMFA 1PBGA 3OLEA 3L4XA 1K3UA 4HHPA 4F2BA 1KQYA 1XLDA 4ATLA 5J5RA 1BG9A 3W72A 1KCXA 3U9IA 2GQAA 3W07A 1MEHA 4EE9A 4KKXA 3BLDA 3M0XA 2J66A 5AFDA 3PZVA 1GQIA 1UZDA 4GOAA 3NURA 1Q2RA 1XGZA 4IGSA 1TPDA 4BI7A 1K4HA 3QOKA 4DBDA 3OBKA 2VWSA 4P8WA 1TTJA 5BU9A 3MJYA 1LUCB 4NNAA 5CZSA 1BYCA 1G1YA 1R0MA 3A6OA 2E25A 1W3TA 3VABA 3DIPA 5T26A 2ONEA 1GKQA 1GVIA 3F5LA 4M0XA 2IPGA 3T2OA 3JZEA 3N15A 1GZJA 2YBUA 4AW7A 1BVNP 2WC4A 1F8IA 5LSMA 1E1EA 4V15A 4LS0A 2XH2A 3V1PA 4TQTA 2C8NA 3FJ4A 2DVXA 4GJ1A 1S2WA 4AY7A 1SSDA 2QUUA 1LRTA 4AVOA 3GX9A 3TQVA 2VNCA 1QBAA 1DV7A 4UTLA 3CV1A 4YWSA 4AEFA 5BOFA 3MMDA 3P2VA 4W9TA 4OOZA 3WNNA 2F6UA 1EHAA 3B8TA 3GTHA 1Q7MA 1H09A 3TJ4A 4HA3A 1Z32X 4S3AA 2OQLA 3UCDA 3Q45A 1R3SA 3NIYA 3PP7A 4Q4SA 2ZX6A 4WCJA 3KDNA 1CXEA 4YU1A 3STPA 1W17A 4DRSA 1BXNA 1V4YA 4HSOA 3LPGA 3ES7A 3H2MA 4IPJA 1E4NA 5D8WA 1SJBA 3A4JA 4ZTYA 1VPQA 2B4GA 1QAPA 4GUFA 3M0MA 1MXGA 1KV5A 1JPMA 2Q3OA 3VINA 3GC2A 3HGRA 1XLMA 2VRQA 4U5KA 3GD6A 1QI0A 1C8YA 3DHPA 4PH6A 6PTDA 2WSQA 3WK2A 1IZKA 3LLXA 4NZ3A 1VD6A 1BF2A 4DBEA 4LJ3A 1JI1A 1R9YA 1F07A 2XGZA 3VOFA 3EYPA 1QVBA 3PN8A 3QV7A 3DXIA 2PSNA 4H7VA 2PB1A 5M1TA 1R47A 3NQ2A 3EGJA 4G7EA 3GHSA 5I7GA 2AL2A 3H2AA 5JH2A 4UMBA 3WYZA 4MNJA 1C7SA 3HTWA 1PZ0A 4RK8A 3R6IA 5E09A 2PDXA 2EG8A 4JHZA 3GHUA 3VU2A 3BAKA 2YCEA 2BHYA 1IT8A 5F1UA 1AJZA 1DWIM 2BMBA 3UXDA 5TNVA 4WDWA 2BXZA 3VNMA 1ISVA 2X7WA 4Q4MA 4TXEA 2XWDA 3BLOA 2QIIA 5AOUA 3EWYA 5JMUA 1XKJA 1JYVA 5H8PA 1UMYA 3M47A 3CZGA 1ZBKA 3WLNA 5AC6A 4E2OA 4ADUA 2CZDA 1J12A 4HYRA 3PTKA 3Q4DA 1JZ2A 2Z29A 2F2KA 4LVGA 4NAEA 4MJ4A 4Q8PA 2D3LA 3VNKA 5CC3A 2PRLA 2DORA 4C6OA 3AU2A 4HA4A 4GGBA 3B03A 4RPPA 2NZLA 5DBTA 1D7KA 4TMCA 3UPBA 1R85A 5D2WA 3EA1A 4M6UA 1YBQA 2QS8A 3WLKX 3DG7A 1H0IA 1PEZA 3LK6A 3THUA 4XAFA 4YYCA 1MNZA 4IJCA 4FOKA 2WMIB 4X9YA 1B3ZA 3MMWA 3F4NA 2DH2A 4OJYA 2CITA 4LNYA 2CZFA 5EU9A 3S2MA 3SY1A 4ZZ9A 4AHOA 2HJPA 4RDZA 3MMTA 3DBNA 1V77A 3IK4A 4L5ZA 2TODA 4IL2A 1F3EA 2PGRA 3WUBA 5AHLA 3MA8A 1B90A 2G3IA 3KOZA 5DRCA 5GNYA 2Q02A 4C6FA 1OWQA 3RNDA 2HBVA 3W1MA 5DLCA 1KFKA 3HN3A 4HHMA 1H7NA 1RY0A 5A2AA 4R88A 3WNMA 2F38A 4HSNA 3CZKA 4W84A 1EDGA 3FS2A 5A2CA 2OWCA 5CZ0A 5DN1A 2WCGA 2NQ5A 4GNKB 3SO7A 1H5VA 3P8IA 3AMLA 1UP0A 5CC6A 3G24A 2JIWA 4DO4A 3A9IA 2WK2A 4AHQA 4LY4A 4IM4A 2VOMA 1P43A 1UA7A 3LQGA 4CN1A 2WQPA 1UOZA 3EX1A 3LPOA 4UQAA 4FLQA 2E7FA 3TN4A 1OFRA 5LGXA 4E8DA 2Z6IA 1B3VA 4GBDA 4QX4A 2CHRA 2VL4A 3KTXA 1DQUA 2VFHA 3MUXA 4JYDA 3WD0A 1US3A 5FF4A 2BVYA 4YS1A 3EMCA 1KKRA 2RGMA 4JQ2A 4K7YA 5BWFA 3TNBA 5D05A 4HA0A 4JFTA 3LI1A 4ZODA 2WJZA 5CLTA 3AWOA 4PMJA 2V5DA 4AZIA 4E2VA 3DYOA 3SR7A 1KCKA 3LGGA 4L64A 1LBMA 5HPOA 1C93A 2ZZ1A 3SJNA 1ZAJA 3K46A 1EGMA 1CEOA 3TAOA 4FEZA 4WGXA 2J7GA 4IL0A 3SW6A 3ZVHB 3XINA 1U2YA 4X9SA 3ICJA 1PE1A 2CLIA 3VD5A 1QU4A 4PSPA 2F6KA 1B30A 3APTA 3H4WA 2D3NA 4UOQA 2NWRA 3WMLA 2W27A 4CN6A 5GJNA 3PNZA 3KXQA 2YFOA 2HDJA 3LCIA 5KTLA 5KZDA 4JFWA 3E96A 3G1YA 1NP0A 3CPRA 1DBTA 1O94A 4NZCA 4YLWA 1MWOA 1KFEA 4GUGA 1YDNA 1VH7A 2C18A 5K2ZA 1ZRQA 1QOPA 2O55A 3AJXA 3S2JA 3T08A 4XBSA 4DJDD 4J3SA 2ZRUA 1BTMA 3W1LA 1MSSA 1MEIA 1H50A 4PMQA 1Q3NA 2AQVA 3NSNA 2XIBA 4L80A 3BICA 1JRBA 4H6QA 1GNXA 2XSXA 3ZFHA 5IDZA 4GQBA 3SN4A 1A80A 3U2CA 4B2DA 4C6MA 4N0RA 3KAOA 1K1DA 3WF2A 2A7NA 1FDJA 3ZVIA 2X41A 2FFCA 2XDFA 5CH9A 1B9BA 2DJLA 4CD5A 4XKYA 3EOUA 3CV6A 1SJCA 1Z3NA 3WUGA 3FFSA 3GH5A 4B5TA 4IFKB 2E68A 1FWNA 3STEA 1Y7VA 1PZ1A 2Z2UA 4Z2HA 5CGTA 3WDRA 4A21A 3SQSA 4AZ6A 2ZDSA 3PJXA 4Y8EA 4FHAA 2Z25A 3W7CA 5FAGA 1IEVA 3FLUA 4ZE4A 1YEYA 3R8HA 1X96A 5C9RA 2FGZA 4WXZA 3KTCA 2EEXA 3H55A 4QE1A 4DIAA 4N7QA 3VKCA 1W5OA 4RXGA 4E6MA 3WLTA 1L0PA 3UWVA 3LS9A 5H6HA 1X97A 5K9DA 1G9HA 4X63A 2SFPA 1P7TA 3UW6A 3BCDA 3OZPA 1EIBA 1LRQA 5K9CA 3VGEA 1IYXA 1EXPA 2C6QA 4C1KA 3WJXA 3WBYA 3STGA 2DZPA 4UFHA 8RUCA 1R30A 4G56A 2PZ0A 1PX3A 1BSLA 1TJPA 4NX0A 3E0WA 3DHUA 3WEOA 5LIXX 3DHDA 1Q6DA 1DIOA 4LV4A 1EQCA 1W3LA 3FV9A 2O9TA 4XZMX 4PRTA 4TTUA 2Q8LA 4LY8A 4ERGA 1VFHA 1ZTVA 3HPSA 4CQ8A 3K2GA 2Y88A 4W88A 5IBXA 1W5MA 3WBXA 4HN4A 2PRMA 3EKGA 2NVAA 3L0KA 4EWND 4B3LA 4U2YA 2I9EA 5D03A 1H7WA 1GYLA 4Q4KA 5HQMA 5GNXA 2Y8VA 4JIIX 4B5SA 4IUOA 3LA4A 3AJ7A 3HV8A 1OG0A 3I6TA 3ZSTA 4MJ2A 3UERA 2QCDA 4OZOA 2WPGA 4Z1CA 4DI9A 2BNJA 1CGVA 3URAA 2ACUA 3FY1A 2INFA 3EBVA 2XN0A 4W5ZA 1NU5A 1VGAA 2CIPA 6ENLA 3QTGA 3ZT5A 3ARXA 3SCTA 5DY2A 2WYSA 4S38A 1QUMA 1OABA 2J74A 3VE7A 3THAA 4KEVA 4AY8A 4H9YA 4ML4A 4PB3A 1V7AA 2V69A 3M41A 4LAZA 1EB3A 2FTPA 3T9PA 1OCNA 2V6AA 1RP9A 5TF0A 1HT6A 4UQCA 2Q09A 3KCOA 3AU6A 4FZIA 1HVQA 3VDHA 4UOZA 1GVRA 4FXRA 2YCLB 3LDVA 4FX6M 3IIPA 3MB9A 2DSUA 3PBGA 3MPGA 4AY1A 1AMYA 3PTMA 2TAAA 2FMOA 3ITTA 1UWQA 4JY9A 2PDJA 1VFUA 3ID7A 1AQFA 3SDOA 4M3PA 3N29A 1UP2A 1R38A 4L4OA 1XL9A 5FJTA 2ATMA 3HM7A 1XIIA 1GWJA 2V3GA 3VGFA 1MW3A 2GL5A 3PBVA 3I3DA 1EP3A 4HMNA 1ESWA 3N04A 4C6QA 3SIZA 1YW1A 1NWRA 3BMWA 3KBSA 1FH8A 4MWAD 4Z2GA 2WMGA 1G6CA 3PPFA 5U7SA 3RFAA 1SPQA 1JIBA 1GEHA 3FK4A 3CL7A 3K4DA 3W74A 5KZMA 4YNGA 1ONEA 5HWMA 5JIWA 3N34A 4ZVJA 1IGWA 2JIEA 3NJ3A 5LNUA 7CGTA 4C6PA 4GVHA 2FMNA 1EX1A 1VRXA 3BH4A 4GX9A 3AOFA 1LG1A 3BOXA 2FZDA 3S9ZA 3W88A 4A8RA 4GVIA 1WCGA 1NQKA 1DTUA 1KM6A 4GABA 2PDUA 1AA1B 1QI2A 3NDYA 2RKXA 3OVGA 4ZR8A 4QLLA 1JZ8A 3MP4A 3BDKA 4NZFA 4NRRA 1OQFA 1AQMA 1JYNA 3IACA 1B3YA 5DY3A 2YX0A 1AK5A 2P0IA 5T9BG 3B06A 3NQ7A 5EGRA 3CH9A 3CT7A 3WMBA 1TMLA 3W7QA 1E56A 2YKKA 1XLFA 1O68A 4IGMA 3RM4A 1V6YA 3CV7A 2XH4A 5GJMA 5I3KA 1QHPA 2QCCA 3WH5A 4GIAA 2A85A 4DO5A 2JE8A 2FPYA 4QSHA 1RK6A 1GVYA 4ATWA 4QS6A 3KLLA 4JR5A 3EWUA 4LVAA 4DXXA 3NL6A 1UWRA 2UY5A 5HNNA 1XP3A 3OYZA 2CETA 2R82A 2IKGA 1TUFA 3PHAA 1A5SA 4A29A 3AFBA 4GVFA 4IPIA 3A3XA 2R6OA 1YRRA 4AB4A 1JL8A 1Q65A 3P14A 3LZ3A 4XUYA 1FVPA 2IMRA 1B54A 4CCEA 4KFOA 1LQ0A 3WQVA 3RM8A 2BDQA 4Y9MA 1XJBA 3T07A 1X1OA 3PK7A 1OHLA 4JPGA 1F74A 2QCDB 2A6NA 3JZUA 1CXKA 3MT1A 2CKSA 4LVFA 1JDDA 2XIOA 1XRSA 5CSRA 4CNOA 2CBVA 1XF0A 3KP0A 1UWSA 2XSBA 2W4XA 3HQ1A 4P7RA 2I5GA 3HF3A 4Q32A 3EKZA 3OA3A 1EUAA 3AYSA 4EACA 3N2OA 3WLRA 2V5BA 3R94A 1BTCA 2ZBTA 1UMLA 3SBFA 2NX3A 3C2FA 3CO4A 4IFRA 3ONCA 4ZOBA 4XZBA 1XRTA 3G1AA 2YFNA 1JZ6A 3DGBA 1WOAA 2BY2A 1JF5A 3SUUA 3CHFA 1OIMA 2MUCA 4DF1A 1IXNA 3LTSA 2YZ5A 3A4XA 4EWJA 2NXHA 2VFFA 4Z08A 2E6AA 2DSWA 3ZJ8A 2VC9A 3GTIA 3R13A 2FH8A 3GXDA 1FHDA 1KXTA 2FH6A 3B4UA 4J35A 2NT0A 3O16A 3APGA 3HV9A 3B9NA 2QULA 1BGGA 1RQBA 5FEPA 4X61A 1E1FA 1ME7A 4K2SA 4Z2JA 2XWEA 2DSKA 1EEPA 5HQLA 3W7DA 4PMZA 1ZAIA 2HQAA 3BPWA 1BF6A 3WUEA 1FXPA 4F9JA 5C2GA 3CU2A 4IG2A 4MHBA 3TROA 3MMUA 1V03A 1R9ZA 3CWHA 3BTNA 3K30A 1KGWA 4QDMA 1P0EA 1ZSXA 5I24A 4PMUA 4ZFMA 4ORMA 3TTYA 4HB7A 1R3QA 5LNSA 4O16A 3NOEA 1UIOA 3TZNA 3UR2A 3TONA 1TR1A 1QHZA 1BSIA 3WDPP 4IIHA 1ZAHA 2WVTA 4UR7A 2DUXA 3HG4A 2BVDA 4AZ5A 1IXQA 1TZ7A 3UVAA 3QSRA 3QZAA 3FOKA 2Z24A 2RDXA 1OK6A 3HJEA 3Q94A 5TIMA 1A5BA 3NYDA 4UWMA 3OHMB 4PE8A 1GQKA 4P8UA 4OHQA 3S2CA 4LYPA 3AZRA 3TSMA 3WEZA 5I3FA 2E9MA 1FKXA 3W23A 4AU0A 3C56A 3ELFA 2PCEA 1J5SA 1HVXA 2IW0A 2Z6JA 3QQWA 4KMQA 1PX8A 2XFWA 1XCFA 4HCDA 3W6YA 4LEFA 2D22A 4AEOA 1YTEA 3IJ9A 1TWIA 4IHCA 1FWFC 4ZO8A 1UQZA 3DH7A 4GNVA 2BOEX 1DVJA 3W3OA 3GTXA 1SMDA 4Q8UA 1OIFA 4J3TA 1T7LA 3OZOA 4IFKA 1PKNA 2QKFA 3MWCA 4A05A 1JXKA 3O6DA 4D1IA 5XINA 3E1F1 5G1YA 2WQDA 4L4MA 2PWUA 2ZUWA 1E9YB 3VX0A 4QP0A 4H8UA 3URQA 3VKDA 1AZ2A 2BOFX 3SURA 2ZA3A 3WQ6A 4FR6A 2P1FA 4X60A 4MFEA 1UUQA 4AZGA 4WKAA 4ZQCA 1AD1A 4H9XA 1XLJA 2FKPA 3WLLA 1OC7A 4R7WA 4CU8A 3L0GA 2ZCGA 4UQDA 1L6FA 2X7VA 3KP1A 3SCOA 2WZEA 1VEPA 4UC5A 2D2HA 6REQA 2GDVA 3LLDA 1OEPA 1AD4A 2A3HA 4GBUA 2O92A 2B7QA 4K3ZA 4UCGA 4QJ5B 3JRKA 5C70A 2YDQA 2VX6A 2WKGA 3UCQA 3ITOA 4HZ8A 4S3GA 4US5D 3AZSA 3SCNA 2OZ0A 4KWSA 2GGGA 3S5YA 4C91A 4B9YA 1VP5A 4YL2A 1BYDA 4KFNA 1IR1A 4UNIA 4UTHA 3SY8A 1RCXB 1X1NA 4WJEA 1UKSA 1IEIA 2AGKA 4P7QA 4M7TA 4AD0A 5DXYA 4TTGA 1QI4A 1LROA 1UC4A 5FACA 1E0VA 2QMJA 3EWWA 4J3ZA 3V4BA 4LUTA 2QCGA 3GXTA 3PSVA 1QPOA 5CPOA 1G67A 3HO8A 2FFIA 2Q8ZA 1IZCA 5F1VA 5HAOA 3TK7A 2PGWA 1GJWA 2MNRA 4GQGA 4FF5A 1GPWA 2WC3A 3S3GA 1E9IA 4AD4A 4J7RA 4GI9A 3FA3A 4PUWA 3QPEA 4W86A 1H60A 1S2UA 1FHVA 1HL9A 1F76A 4TR9A 3TJXA 2INZA 1DJIA 3W73A 3CJPA 4U10A 1P0BA 3RPTA 4GI6A 1V0LA 1TPB1 1XYCA 1Q7ZA 4XAYA 1U83A 1W9VA 1A0CA 1XCXA 4R7OA 4JDBA 2DGAA 3KL0A 4G8TA 3RCMA 3H21A 3BC9A 3LRLA 2C16A 3T0BA 4Z2LA 4REQA 4TVDA 4NI3A 4UMCA 3WJZA 1TCDA 2QGYA 3WF0A 4PULA 3P80A 3GBDA 2J8FA 4NKCA 1SVDA 4PUEA 5A8QA 2X0SA 3SCVA 2L5HA 1E0XA 1KM3A 5LA2A 5DEZA 2OQYA 3QLLA 5HK4A 3L4ZA 4ICCX 2NQZA 4DLFA 4Y90A 3THCA 4CVWA 2BXVA 4XBKA 3DFNA 4YTQA 3EKLA 1ZP4A 1A53A 2ZWZA 4CQAA 2ANUA 5CEWA 3S1GA 3G5EA 2ZXDA 3VOHA 1Z42A 4H7CA 4INFA 3GRIA 3LU2A 4NNCA 2P0OA 4XZWA 2Y62A 3UR5A 2GJLA 4AVFA 2D73A 4AC1X 2ZVRA 4DAFA 1C8QA 2ZYFA 3PAJA 4JX5A 1QJWA 3V75A 2PWGA 1J8VA 4P61A 4MY8A 1L2UA 1JDEA 2V81A 1V8EA 4WJXA 1NOUA 2VX4A 2ZE3A 4IIBA 2IXUA 3BAXA 3FGCB 4B91A 5AC4A 3ARZA 3USZA 1HIZA 2UY4A 3HQNA 3M0KA 1CLXA 2H6RA 4DO6A 1V6XA 4K1GA 1K8ZA 4IX2A 1WKYA 4DB7A 4L6HA 3O6AA 1UCWA 1X1ZA 4AFYA 3OPSA 2YR1A 2RFGA 2VGBA 1IWAA 4YYFA 4G1NA 3WH6A 3PZQA 1RALA 2E1DA 3K4WA 4F4RA 4ZB0A 3G22A 1E6QM 4AXKA 1X8FA 1UA3A 5K4XA 3P5YA 4B5XA 4F0MA 5CSSA 1LT8A 3URNA 1UWIA 5LNWA 3MUCA 3FYPA 1NARA 4RDYA 1NEYA 5JH1A 3SN0A 5CLWA 2DUZA 4MOZA 3DCPA 3BSHA 2XU2A 3FXYA 3BAJA 3CIVA 3B8WA 2H9AB 3B8VA 1S1RA 3NAVA 3GQYA 1UPPA 5LIKX 1SJDA 4DJDA 3E02A 5EBAA 2D20A 1XHGA 2C79A 3KUMA 4O15A 4FNTA 4GXMA 4KERA 1V0KA 1I2QA 2HBXA 2HROA 1REQA 4GZIA 1LL7A 2A3AA 4EF9A 1J10A 1XDMA 1VJSA 1KTBA 1ICQA 3BSGA 3R5EA 6ALDA 2FVKA 3GK0A 1R7AA 2QCHA 4ICMA 4HOWA 3NEHA 4MLRA 2B0MA 3C0SA 4A35A 2TRSA 3QV9A 1MW0A 1WDPA 1UD4A 3NQBA 1Q5MA 1QR7A 1RA5A 1RCQA 1Q13A 5EFFA 4MFDA 4XIAA 4KPLA 7ODCA 3ZR5A 4HZ6A 1CWYA 5A6SA 1YPXA 3HIJA 1QPRA 5I3JA 1H11A 3M46A 4M82A 2GUYA 1HXJA 1I2PA 2B81A 4ZCWA 8TIMA 4EK7A 5BU6A 3R7MA 4O10A 4HJFA 1J96A 2PC4A 1FXQA 4CNPA 4B5NA 4UTWC 2PMQA 5ABTA 2WVSA 4R3UA 3ABSA 2C0HA 3R2GA 5M03A 3Q2DA 1WDQA 2A7PA 4G9PA 1EA0A 3E2VA 4WLCA 2QDEA 1R6WA 3EAUA 4IMDA 4WSJA 2VR4A 6A3HA 2J88A 4CQDA 4FR1A 3A23A 1TE6A 1RLCL 4D71A 1GKRA 2W92A 1LUCA 2OSYA 3CAVA 4MF4A 1LWJA 3ZR4A 1BD0A 1BKSA 1PKYA 2ZXAA 1ISXA 1PDZA 4BA0A 4O1DA 5IBXC 1P4CA 2V3DA 4DI8A 1DL3A 4MVAA 1YNQA 1GW1A 2VELA 1NDVA 1RXOB 1WA3A 4YHGA 4HMCA 2EKGA 1QPQA 4H7ZA 1C3FA 5A8PA 3GW3A 1KXVA 4GY1A 4JGDA 4DZHA 4HOZA 4EPKA 1TTIA 1XDLA 1VEOA 2WZHA 3DAQA 4XISA 4J3VA 3BAWA 3GIPA 2V5LA 4L4PA 1T99A 2C91A 4FSAA 4MNLA 1JDAA 3TSBA 4DQWA 3RAOA 5AYZA 1RJRA 2Z1BA 4ZXLA 1PTAA 4U4MA 3TJIA 3UJSA 4PUUA 3RILA 3MS8A 2WJDA 5E5CA 1JYWA 3UNDA 1FRBA 1DOSA 1SFLA 2ZDRA 1TKKA 3PZTA 2R8WA 2G3NA 2CZ5A 2VWTA 4WDUA 3L65A 4L9YA 1FFQA 4W8BA 4HMEA 1EBGA 4Z42C 2VEGA 2P3ZA 4GNJA 3WLPA 2GVJA 1F6YA 5BXRA 1YHTA 2QJIA 1DIEA 4UR8A 4NZ4A 1TZZA 4GX8A 3WIJA 1VFLA 3T55A 4W4QA 4WKFA 3MDWA 5AC7A 4O1BA 1AUSL 1CIUA 3S2NA 4ILSA 2G50A 1V79A 3UA3A 3AIBA 2FTYA 1PSCA 1VHNA 3D47A 3BO9A 2QT3A 4Q8WA 1WPCA 3CUZA 3R89A 5G4EA 2C1GA 1P48A 4JZ5A 5CC5A 5AN7A 5M3WA 1NELA 2FDSA 4MB1A 3HGSA 2ZZ4A 3MVTA 4LALA 5LYRA 3DU0A 4QJ4B 1I4NA 4MMWA 2VVSA 1QOQA 1YLVA 3CUJA 3M7SA 4ZEPA 3TYAA 1VB9A 2CLHA 3GIQA 3C2EA 5CJNA 3VM5A 3KVMA 4DBWA 1I1WA 1GVFA 5C9XA 5FOOA 3DFTA 4JDYA 3W7PA 1ADOA 3THDA 2XINA 3GSMA 3D0CA 1IWPA 2YSWA 2BG5A 3WF4A 3QGAC 2VDGA 1TPC1 2R1LA 4YTTA 3QSTA 3D3FA 3DFOA 1MMFA 3ZXWA 1O4UA 5I02A 1PUDA 1QPKA 3AICA 3GNOA 2CLLA 3MZ2A 5F2IA 1UR2A 3OLGA 1KRCC 2W3ZA 2QW5A 3FEQA 4J40A 3S1XA 3GC4A 1BLIA 1DJHA 1S5MA 1FCUA 1XSJA 3QC0A 2CBUA 1HJSA 1JVNA 3LHUA 4QJ3B 1DQWA 1ONRA 4AH7A 3QPYA 4KETA 2OGYA 2EPKX 3C0QA 3QC3A 4Q8NA 3KDOA 1HX0A 1N8IA 1YPIA 1NY1A 4NY2A 2FYMA 1HUVA 1K9DA 5FAJA 4ACYA 3PBWA 1V3JA 2W63A 3QY6A 5KINA 5HULA 3V16A 1EHNA 1GQNA 2VX7A 4WRHA 2VEMA 1YDYA 2QJNA 4FNRA 5DT5A 3HGOA 5EYWA 3BJTA 4V28A 2QCNA 2WV8A 3DFQA 1TYGA 1OC6A 1R5YA 4A2RA 3IGHX 4JYFA 4UXDA 2CPUA 3F4CA 5D9PA 3CYVA 4IP5A 3UXAA 1REQB 1KXHA 2DH3A 2RAGA 4ZA0A 3WO8A 3NDOA 4C90A 3ARTA 1OFAA 3HPZA 4NJIA 1V51A 3PR2A 1V7YA 3EXSA 4LRTA 2OLSA 4C7DA 3FNDA 3PZMA 2YIHA 4DYJA 3MUY1 2GWNA 3PZUA 1JQVA 2NUWA 2WMKA 1QOXA 3QPZA 1JZ5A 1LBFA 4XTDA 5D9MA 3GHTA 4EKJA 4Y9NA 5GJPA 2E4TA 5A8GA 3TQKA 5BW6A 3KBJA 4DNHA 5D04C 1H61A 1V6WA 1TREA 1W8SA 2G95A 2V2DA 3WH9A 2VUNA 3VOJA 4EPDC 5HJYA 3G2GA 3PUOA 3AC0A 1AW2A 3CQHA 4L1XA 4IIGA 3JU2A 3TE9A 4FLOA 3II1A 3GVVA 3RGTA 3NXLA 3RX4A 3S6TA 4RW3A 1B2YA 4AZHA 5MKGB 2G0WA 3WF3A 1A5MC 4RZ4A 2WHMA 4G7FA 2CW6A 5D8ZA 4M1RA 1DE6A 2BZNA 2J6VA 1W3JA 1YADA 2KX9A 3RLUA 1K03A 5CGMA 3SN1A 4MLJA 4EP8C 2QHAA 3O9NA 3N6HA 3CL6A 2FGLA 3PJWA 5HJXA 2HVMA 4PYSA 4I5RA 3T6CA 2XJ7A 3TCEA 4IF2A 2OU4A 4R34A 4H8HA 1YPFA 2OWXA 1M5WA 4GFIA 3S2LA 3TWBA 3W7NA 4CD6A 4FOJA 4K38A 4ERAA 1BKHA 2J8TA 4QROA 4I7VA 2A3LA 2PLCA 4LOCA 1KM4A 2P3EA 4PODA 3AYTA 2Y5SA 1RJQA 2OSWA 4PB4A 5BMXA 3G1HA 3RIKA 3ZQ9A 3D6NA 1M01A 2C14A 1XRFA 3JW7A 3M0HA 2OQHA 3D3AA 3V3WA 3UZWA 3VVGA 3H4XA 3BAIA 2QV4A 1P6BA 4Z1BA 3TNOA 1DJYA 5LHFA 3W1PA 4M6PA 4H1ZA 3G1SA 4Y6GA 4HU8A 3ZT7A 1ZU8A 3S5NA 3VFCA 2QEZA 4Q8QA 4PL2A 5F4WA 1SFJA 3HZ3A 4OGZA 4FNSA 1WZLA 3MANA 4N6EA 3SGZA 4GQ0A 2C1IA 4YMZA 2UWFA 4RV8A 4G7EB 5LA1A 4LUTB 3GG7A 1UQYA 1ITUA 3HG2A 1OT1A 2YW3A 4RE3A 3N11A 2POTA 1EJWC 3SRDA 4PCNA 4OUIA 3WQ5A 5LA0A 3ARQA 3RPMA 2J13A 1FA2A 4PB5A 2Z4GA 3NQGA 1POKA 4IG2B 2QCFA 3TWAA 1I2RA 1KRBC 1F2JA 4ZL1A 1R2RA 4HK6A 3ZOAA 5K4ZA 1UD6A 1AH3A 5F4SA 4Z17A 3WQWA 1W9BM 4LCQA 4GJJA 4HPJA 4RLIA 5LXXA 1UWAA 2CCRA 2PDPA 3CLWA 3AMKA 3EOLA 4DJED 4IFOA 5EMYA 2FLIA 2ZRXA 3JUGA 2OELA 4ZENA 1I2OA 3N4AA 2NXGA 3GC5A 3HPXA 3KCLA 3S9IA 1J2BA 3WQCA 5AYIA 4QBXA 3O0FA 3CHVA 3KZSA 1UUOA 4GKTA 4YPJA 4WVXA 2NQ9A 2ZKMX 3U5YA 2BP1A 3W1QA 3PWIA 2BWGA 4L9ZA 1FCBA 3CTLA 5I77A 1EX5A 6CGTA 5HOSA 3VCCA 1WUEA 4IP4A 1XPGA 3WJYA 1A5KC 2PDIA 4F0LA 1GQJA 3QKZA 3SUVA 1DJNA 5CPQA 4BEQA 1JDCA 4LV9A 4LAMA 1XUZA 4RNIA 4PCPA 1GOWA 4PTMA 5CJ5A 3RLGA 3J7HA 3HG3A 3W7KA 1H5YA 4XKYB 4HNOA 3LN3A 5KITA 4LX4A 2R1MA 1SZGA 2OEKA 4A3UA 2YBTA 4GZJA 1EWEA 3SRFA 4CGTA 3U5UA 3VNYA 3PFMA 3R25A 2O9PA 4L65A 4CN4A 2VC7A 3VDGA 4Q7NA 3UWQA 3FVDA 1ENUA 3IUIA 3WFLA 4ACZA 4UTWA 2X1SA 1IEXA 2XZ9A 5AHNA 3WDHA 2QYGA 3KL5A 2WNWA 3DYPA 4IIDA 1E4LA 2V5JA 4UOJA 5ENLA 3AMDA 2ALRA 4XUGA 1EP1A 1MXDA 2ACSA 1LQ2A 3H2NA 3W7MA 2F61A 3KOWA 4BZYA 1K9TA 2VQUA 2VX5A 4WXYA 4MNMA 4YTUA 1E55A 5AHEA 1S1PA 1AQHA 2GJXA 4GQRA 4H4IA 4WKHA 3KHDA 1X6UA 1LL6A 1S2AA 1XLCA 1J9YA 4IMAA 3FSUA 3TOYA 1D9EA 4AZBA 3F2CA 1JPKA 4D6IA 3GU2A 2DW7A 1XIDA 3BWWA 3L5LA 1A4LA 3GB6A 3ARSA 4HNNA 4UZUA 5HR7A 4G5DA 3BJFA 2XHYA 4ZQPA 1S2VA 1SZFA 1DXEA 5AY7A 3H8AA 2BASA 1H7PA 2F8QA 1WDWA 4OVXA 1JGMA 4UFIA 3W7JA 3O8AA 3U8GA 1Q6EA 4MSSA 4DXVA 4NSBA 3W53A 4HHLA 4D6JA 1POJA 1S3HA 4PZVA 3AQUA 4NASA 4AF0A 5A1AA 1PYFA 1RPXA 3N3MA 3WDIA 1ADSA 5EA9A 1UZ4A 2CZVA 4BQ4A 4R9XA 1UHVA 2NW0A 3R1ZA 1EA9C 4J27A 4Q4QA 3I10A 4AYSA 1E6SM 2ISDA 3V18A 3I65A 1W31A 4DPQA 3EB4A 1O95A 3CMGA 4LBSA 3EWXA 4P8VA 4ECLA 1OGSA 3W7EA 1YNYA 3A64A 1A49A 2E9LA 3BVJA 3L4WA 1XQKA 1W1TA 1R3VA 1VYSX 2TMDA 3CZEA 5J04A 2PUZA 4W85A 4JFSA 3W71A 1XYLA 2DQXA 2E8ZA 1CI1A 4XTIA 3RO6A 1IWBA 2VM8A 3MHFA 4NRSA 1N82A 2AMXA 5AKQA 1WXZA 3EDEA 3CXOA 2ZC1A 3B9AA 1XSKA 3PVFA 4ZMGA 1CW2A 3KOXA 4LUSA 2NSXA 1UPMB 2QCMA 2I17A 2HPIA 3TA9A 1HJXA 2QUTA 1KNWA 5G2WA 1D3HA 4BI5A 2XZ7A 1E6NA 2OZTA 4IJRA 1TA3B 4LRSA 4C7GA 3H2EA 3TW6A 2JBMA 2WNZA 3B05A 3LLFA 3W75A 1W5NA 3C2OA 3SUWA 1BQCA 4DHGA 4GGHA 4GE8A 2DFAA 2ESCA 4U3AA 3C0JA 5EL1A 3BQ5A 2WKLA 5A95A 1B3OA 1CXFA 3APYA 7REQB 3VM7A 3HA1A 4M51A 3CHEA 4KQNA 3P82A 3GE7A 2G4JA 4LANA 1LLOA 3ARVA 1VCFA 4QJ1A 2IS7A 1TQJA 4ORIA 1WOBA 4WY0A 1EKOA 1O5KA 3AHYA 4HBKA 3LM7A 5A94A 4CNSA 5HQEA 3UXIA 4OOUA 3UU0A 2VKZG 3TYDA 3VK5A 4D6DA 4LBUA 2VEFA 4WDTA 3RYSA 4K7VA 2DPEA 3GDTA 3H2FA 3OLIA 3EPMA 1TWSA 3C3NA 2Z1KA 3FYOA 1MW1A 2VRKA 3BUVA 1P1XA 1EJUC 2OVLA 5EY5A 4GFSA 3GG0A 1W9DM 1GYMA 3KS6A 3UY8A 1ZBCA 3M4HA 5AVHA 2HE8A 2DU2A 4DM1A 3ZT6A 3ITVA 5F4XA 1KWGA 4S3KA 1ZUAX 1W3NA 3ZSSA 5A6BD 1TRIA 1I1XA 3NGJA 3FW6A 4QAWA 3VNZA 3WMSA 2PTYA 2BOGX 3PB2A 4DO7A 4HJWA 1TWWA 2HVNA 4O17A 3GKAA 2Y85A 3TOPA 2PWVA 1OD0A 4XIMA 3K5XA 1TVLA 3R12A 3KM8A 4BEUA 4JKMA 4F9DA 2DJXA 2YL9A 1ZBVA 4MDPA 4GHRA 3SSZA 3LX9A 2UBPC 3LZ5A 1DYSA 1VYRA 3GW0A 5JUVA 1U1HA 1E6ZA 3MWAA 3LSCA 1JPHA 2JKPA 5EMMA 3MUIA 3OIHA 1B5TA 4C6NA 1YYAA 2VEIA 3ABXA 4JIQA 3WNPA 7ENLA 4UZSA 4K8HA 1N7KA 4AMAA 2E6FA 4YTRA 2ZRYA 5C9ZA 4NXSA 5IHRA 2AKZA 3T42A 1ECEA 3B0YA 3NG3A 3AXIA 3QHNA 2RH9A 2WW5A 2BHUA 3H2OA 2WNNA 3DC0A 1M1BA 1A5AA 4C60A 3B04A 3SFWA 4ZO6A 4E38A 4IOTA 4N6FA 4M29A 2D2OA 3C2RA 4MIMA 4L6OA 3W24A 3A4WA 4OU1A 3CAKA 3UESA 1OG6A 3CPGA 1V0NA 2X40A 4L4LA 2HWGA 4UIOA 4LVDA 1WZKA 5JBDA 1MZHA 4CUCA 4GI8A 4Z2IA 3CUXA 5IFTA 4GKLA 2A6LA 1OINA 1OYAA 2A3BA 1JAEA 1A4MA 1W3HA 3LCXA 5T91A 4LC6A 3PZNA 2NVCA 1JI2A 3TC3A 3B9OA 3TMLA 1ZS2A 3C6CA 1WDRA 2EAWA 3N18A 2XN1A 2CHOA 1OGGA 1EIXA 2HXUA 3B3DA 3NTYA 5G1TA 1VR6A 1SYTA 3FN9A 4AIOA 5JQ9A 4JAWA 4K39A 4ASTA 2I5IA 2E67A 1TRDA 3AHZA 5HBFA 4MAVA 3MP5A 4IPPA 4JTFA 3R11A 1G01A 2ASHA 3L7RA 3W02A 4FX7A 5F2MA 4IX0A 4QG8A 2HK1A 1IEQA 2NLIA 4IH3A 3HPFA 4N42A 2QPXA 2G8ZA 1ZCCA 4MPQA 4XD4A 5CCZA 5HPCA 1E51A 3AI0A 3GDLA 1HP5A 2FHFA 2YA2A 3I7QA 1UR9A 3TYZA 4KCUA 1PPIA 3UP8A 1XV8A 4FF7A 5JBFA 4BF5A 4QNEA 3W87A 2LLEA 4O1AA 2OR2A 4KIEA 4LYRA 1W1ZA 1M7OA 3VIJA 1QWKA 1F5ZA 3IK2A 1TIWA 3MUAA 3CUFA 4ZQMA 1PZ2A 2YOCA 2ZWYA 5I00A 3BW2A 3MV01 1BXBA 3DKLA 2HS6A 2OO0A 5FSEC 1V3LA 1FWGC 4QCFA 2Z0IA 1H49A 1G5AA 3SCUA 3MSYA 3KRBA 1KR1A 3ARRA 1GVOA 2PODA 2CBIA 1FQ0A 4JL2A 2DZTA 3VDCA 3IEBA 2PDBA 1XC4A 2UZ9A 1KGXA 2PDYA 4KGLA 1R86A 3IRSA 3RCNA 3VGGA 4NAFA 3PJUA 1E4MM 1OF6A 4P5UA 5AHFA 3U4FA 1AH4A 1FH9A 3PFRA 2Y61A 3AUOA 4W7UA 4JTGA 4LPCA 2C19A 2H8ZA 3PZGA 3UPMA 3IGUA 1ZL1A 3BW4A 2VCCA 2DDXA 2QVHA 1XBXA 2IPFA 1OFDA 2NUXA 5LXEA 2ACRA 4PCFA 4ES4A 3NZQA 4GVGA 4OE7A 4UFKA 3W2LA 5BXTA 2XIQA 3N73A 1XIHA 4DAIA 5E0FA 3E5PA 4A22A 3OP2A 4JICA 1E0UA 1KRMA 7TIMA 3A22A 2C71A 2YCKX 1ZNNA 3LBOA 3L21A 3CB8A 2REQB 1XICA 4NILA 1EYWA 1OM0A 1VHCA 2OX1A 1UOKA 4MDOA 4C1NA 4HTYA 4P7OA 4MADA 3W25A 2CLKA 3AXHA 5C9WA 3VAVA 4AIUA 3NA8A 4UNLA 1OZQA 3NM1A 1ITCA 1EUNA 4MY9A 5MHBA 1BYAA 3GXNA 3T0TA 3WLMA 3EXTA 3IVTA