3M1ZA

Crystal structure of the mutant v182a.v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIAGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 86
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m1zA00
3QQ1A 4E2DA 4JIPA 2P0OA 5DELA 3L0KA 2YFOA 1IF2A 2FLIA 3VNDA 4ZQOA 1D3HA 1O60A 4KFOA 4XKYB 1BKSA 1H7NA 1TPDA 3EKZA 5D2YA 1X6UA 1DQXA 4WY0A 3WK1A 4H6KA 3RK8A 4E38A 3MI2A 1ZAJA 3I7RA 3A9IA 1TCDA 3W1XA 2B4GA 4DO5A 3NL3A 2B7QA 3KRUA 5HWNA 3W23A 5KINA 3HF3A 3THQA 2ABAA 4K7VA 3SECA 5DBTA 3GK0A 1KM1A 3RLUA 3SJ3A 1TPVA 3PBVA 3SZ8A 2NX3A 4MY1A 4MIMA 4RZ5A 3DBPA 5BOOA 1C9DA 5BMXA 2VEPA 4MY9A 1VR6A 5F1UA 3S1WA 4QM1A 2I1OA 5C54A 4XTIA 3W07A 2NUXA 2Z0IA 4X9SA 3LERA 4GXMA 4IPJA 4KFNA 3E02A 3TIMA 3G1FA 5D2TA 2NUYA 4FIRA 2QCCA 1QMLA 4LU0A 3TV8A 2ZRWA 4UNLA 4Z08A 2ZRVA 2HTMA 1IGSA 5LNVA 3A22A 2A6LA 1LRQA 1A5BA 3EWWA 5D04C 1W3TA 1N8FA 2DZPA 5EY5A 3LM7A 4UTKA 3ABSA 3QFEA 3ZS4A 3W7OA 3OBKA 4X3ZA 3F03K 3W7NA 4Y6GA 1FX6A 4UFHA 1G4EA 4PL2A 3U2OA 1GG1A 2GVLA 4EVZA 3TA6A 2A5HA 3Q94A 3A24A 2A7NA 3YPIA 3NQ7A 4TU1A 1NFBA 4PFMA 3SGZA 4UCGA 4JEQA 1P5BA 3FLUA 3QF0A 2J24A 3HG3A 4GRSA 1H7RA 4DELA 3Q58A 5CPNA 3W87A 1R47A 3L67A 4O11A 4TMBA 4RZ6A 3P82A 2E5CA 4N6FA 1ZY9A 3FEMA 3IRDA 5L6UA 4BFAA 4IXHA 4AF0B 4CQ9A 4JTLA 3ATZA 3NQEA 2E1DA 4RR4A 1EUAA 2G96A 4NNAA 3EB2A 5D03A 3W74A 4AXKA 4GUHA 3EX2A 3TW6A 3NVTA 2LLEA 2ZZ4A 3UNDA 4UTTA 4AWSA 1F5ZA 4MFDA 3N73A 3NQ8A 2NV2A 1Q45A 5AC7A 3M47A 1DOSA 1W3NA 4Q4KA 1RVGA 4JTGA 4O1AA 1UJPA 2DZUA 3LRMA 4O4VA 1QOQA 4LVFA 2GQAA 3EKLA 3UZ5A 1W5MA 4FHAA 5AB3A 4XKYA 1P4CA 3G0SA 1TJPA 3JS3A 3PSVA 5AHNA 1Q3NA 3NQMA 1N55A 2ZRZA 5F2LA 5KMYA 1SZFA 3DENA 1B4EA 5DCEA 3GDLA 3OA3A 5KZDA 5EMUA 3R12A 1JJKA 1G7UA 1GVSA 1XBZA 4WY0F 2P1FA 1YPFA 3CIXA 2CLFA 3CWOX 2TYSA 3UWQA 5KSWA 1KFJA 1WYIA 3ZR4A 1H63A 3W85A 1KM6A 3S8HA 2X2GA 3FJ6A 2C16A 1TTJA 4S1FA 3BV4A 3P62A 3IGXA 2AAMA 4JXCA 2FPVA 5F4XA 3ABQA 1H1YA 3KX6A 4N2YA 3DFQA 1QOPA 1I2RA 3W7KA 1TPWA 1HO4A 2HS6A 3C2EA 3UXAA 4KKXA 1NSJA 4LNYA 1QPOA 4EF8A 1TPB1 3BG5A 3WK2A 4GFSA 1QO2A 1VCVA 3TJLA 3UXDA 5LHFA 3INPA 1NEYA 2OMAA 5IBXC 2ATMA 1HO1A 1JCXA 4XUGA 2ISVA 2FQIA 2EF9A 3QZEA 4JX6A 1W5QA 3LCHA 1KM4A 1F2JA 4E0CA 1H7XA 1H7PA 1KFBA 2TRSA 4JTJA 1GVRA 4WD0A 4ONVA 1KTNA 1PS9A 1SW0A 1YYAA 4MZ8A 4MUZA 4RX0A 4BWLA 3VCRA 4CQ8A 2DJLA 5DY3A 3W1PA 1GVFA 3B0VC 2E5BA 2QJHA 3P84A 1O95A 4UTHA 3USBA 2I9EA 1FCBA 3IIPA 4H4IA 5AHEA 4A3UA 2TSYA 1ML1A 3CC1A 3T7VA 2VEMA 4GUIA 3BLFA 3QPZA 5I3HA 4O0KA 3GYEA 3G18A 3BGGA 3G0XA 4HNTA 4YMZA 3M16A 1MEWA 3JRKA 3DKJA 3P74A 1JQXA 1BEUA 2G95A 4N6EA 3ABOA 1TQXA 1T96A 3UY7A 1EPXA 3PM6A 4M7TA 4UTUA 3B04A 4M19A 4Z0JA 3G1VA 3O63A 3LTSA 4A2RA 5L9FA 4UFIA 4UTJA 4MY8A 4JTUA 3ABRA 3NL6A 5LGZA 5EL1A 1TRIA 5D32A 2A6NA 4JYDA 6TIMA 4RXGA 2EKCA 3L66A 3W1TA 1WQ5A 1QFEA 4RK8A 4GC4A 1LLZA 2PC4A 1L2UA 3LCGA 4O10A 5K9CA 2NWRA 1JVNA 3RU6A 2DJXA 3TAOA 1AG1O 4OV9A 2YYTA 5AYZA 1RQHA 3NPUA 3UWYA 2XN0A 3LHUA 2A7RA 4M7SA 1JRBA 3B0UX 4DBEA 2FJKA 3HQ1A 3TK7A 1A5CA 1I45A 3NM3A 3NQVA 2NXIA 4NX0A 5I3GA 1OHLA 2ZBTA 1R30A 1SFLA 3G0UA 4LVDA 4UTWA 3HGSA 1KLYA 2CZ5A 1K8ZA 2YZRA 1SZEA 5D38A 2YGYA 2YX0A 1O4UA 1GWJA 5C6MA 1DBTA 2RHGA 3CB8A 3EX4A 3G22A 4LC6A 4UC5A 3W73A 3DHDA 3QYQA 1OX6A 4UFJA 3OG3A 1OFDA 1H61A 3NL5A 4GJ1A 3BW4A 3IV3A 4OBTA 4BF9A 3KFTA 4Z1DA 1YXYA 2J9XA 1UBSA 1OABA 3T55A 1SW3A 3SY5A 1EP3A 3HJZA 5AHFA 1QCWA 4G1KA 3LCLA 3I7QA 1W5OA 3LCWA 4MFEA 1TREA 1MEHA 2QUVA 5HJLA 3KVMA 3F1QA 1JUBA 3UPBA 4RJEA 1Y0EA 1JULA 5F2MA 1EP2A 3AJXA 5FEZA 1H51A 3CM4A 1HG3A 4UUIA 3UWWA 1R46A 3QSRA 2JKEA 1KM3A 1LDCA 3GB6A 5SWUA 2VOMA 2FFCA 2X1TA 2PRMA 1HFBA 4PTNA 3NQ6A 2RDWA 4HSOA 3O6CA 1S3HA 4O0ZA 3FKRA 1IIHA 3TROA 1C29A 2CZEA 5TQLA 2NZLA 1VQTA 3O05A 4AH7A 4WOQA 3STGA 1VHCA 1K8XA 1R2TA 3NPXA 4LS0A 2R14A 2Q3RA 1ZHAA 2ZA1A 3GDMA 1ONRA 3HIJA 4JTTA 4O1CA 1W31A 3KVLA 3W7DA 3GXNA 4LTSA 2H90A 2OCZA 3LI1A 1VS1A 3PAJA 2QCGA 4Q32A 1JQVA 3CQ0A 5F1VA 4HIBA 5FF2A 1EX5A 3OVPA 2YYUA 4JS3A 4TIMA 2ATSA 5DXXA 4Q33A 4WX2A 5HWMA 2NV1A 2Y70A 3CEUA 3LXAA 1GJPA 3DFPA 5D2VA 1T99A 1SUXA 5E93A 1P1XA 4O18A 3L65A 1KW1A 4UMCA 5AN7A 3QMRA 1X1OA 2GUUA 1GEQA 3IVUA 4GWEA 2ZA3A 3MMTA 1XBYA 3QW3A 3W7GA 5DBUA 1LROA 1MSSA 3MHUA 1YTKA 5HULA 3SFKA 2Q8LA 1WA3A 1W0MA 2G97A 3MI3A 3C56A 4X22A 5H2ZA 3B8DA 1IXQA 3Q2DA 3DH7A 5KZEA 1XI3A 1OYAA 4LT9A 3EX3A 1UUMA 4S2CA 1H60A 4JTKA 4LV9A 2X30A 2Y6ZA 4JX4A 1Q6OA 2Y88A 2WNQA 5DCBA 1K3UA 5FEPA 2YXGA 3EXRA 3HGJA 3QRHA 3O07A 1LCOA 1RQBA 3OVQA 3W71A 1TTPA 3NA8A 3IVTA 5CKSA 5AHIA 3P7YA 2NUWA 4A2SA 2WQPA 4QSHA 3K30A 4IMGA 1OFAA 4DQWA 7TIMA 4HNNA 3PR2A 3L9CA 4JTSA 4OE7A 3LBCA 4FNRA 5CSSA 3C2FA 2ZTKA 2JKAA 1IXOA 1EIXA 4XZ9A 2VFDA 4EOUA 4N9BA 1FWRA 1WOAA 4FB7A 2QAFA 1OFOA 5LNRA 1KM0A 4FEZA 1B9BA 3I6RA 4M5PA 2IQTA 3LCIA 4Y96A 5G2HA 1WBHA 3L21A 1K7XA 3G1DA 2ZZ1A 1V7YA 1FCVA 1GYLA 2C13A 2P10A 1RV8A 3LX9A 3NDOA 1KFLA 2VENA 4JR5A 2FDSA 4WOZA 2V5LA 4I9AA 1BWLA 1FXQA 5EYWA 4RLIA 3WJZA 4OGZA 4FX8A 5D33A 1M5WA 4XBKA 1R2RA 4FNPA 4NJGA 1EWEA 3W7CA 3E0IA 5BNKA 4NU7A 5IBXA 3U8GA 3L0NA 5H91A 2V82A 1TPFA 3TCEA 5A8GA 1B57A 1FDYA 1YTEA 4LVGA 4CNOA 1Q6RA 1X1ZA 2X1SA 3TH6A 2E6YA 3IVSA 3LCXA 1ZNNA 1U5JA 1U83A 3QW4B 2D73A 2JBMA 1LOSA 4A21A 1T0OA 3KAOA 3WFAA 5I3FA 3N34A 2A7PA 3LGEA 5DN1A 3DFSA 1OVDA 3W3OA 3FYPA 1I8JA 1L6YA 3TSBA 3W2UA 4AHQA 2ZRXA 1QR7A 4CNNA 1D3GA 4ZL1A 4AF0A 1ICQA 3TSMA 5HR7A 2QUUA 2XN1A 2VFIA 3LRKA 2GVJA 3LHVA 4Z1AA 3HG2A 3V75A 5FESA 3I68A 5AFDA 4UFLA 3SI9A 1F6KA 1WDWA 3OHIA 2ZYFA 3A23A 1GOXA 3L0GA 3VE9A 3W88A 4IX0A 1RD5A 1XM3A 2QAPA 2WSYA 1AW2A 4X2RA 1H5YA 1A50A 5GVJA 1LYXA 3EXTA 4IMFA 2GQ8A 3SW6A 3LI0A 8TIMA 2ZRYA 3EWXA 5D2WA 2WNZA 2ZQ0A 2EHHA 5HQEA 3S42A 1KV5A 2B0MA 2PRLA 3HGRA 3BG9A 3I65A 4YLWA 3W2MA 5G1TA 4IQLA 5AYYA 2B7PA 5FF0A 3H54A 3L2IA 1KA9F 1M6JA 1VYSX 4AVFA 3STCA 4PEKA 2X1RA 1BTMA 2Y7FA 1I2QA 2Y7GA 2V81A 2RDUA 3TC7A 1OJXA 3M9YA 4PC8A 3CWNA 4FNUA 1KV8A 4LS2A 5I3KA 3M41A 3W1AA 3IEBA 3G24A 3OIXA 4BI5A 3P8IA 1LBMA 4K37A 3EWBX 2Y62A 1G4PA 2O7QA 3BO9A 5F4SA 3W7EA 3WJYA 1UUOA 1JRCA 3GVGA 5FF4A 2VFEA 3O06A 1GVOA 1DORA 4ZQCA 2VEIA 3M7WA 4WQ6A 3HGOA 5DCDA 2Q8ZA 3T4CA 1FDJA 4MLJA 4BR1A 2DP3A 4UTMA 1IXPA 3P8JA 3GLCA 1PL9A 1R2SA 1C8VA 1XL9A 3DXIA 4JX5A 4LC8A 2CLEA 2ZZ2A 3NQDA 2QR6A 3HOJA 2VEKA 1SFJA 3H53A 3WJSA 1UB3A 5AHMA 3LXCA 1I2OA 1OX4B 1G7VA 2CZDA 3C6CA 1OK4A 2GOUA 1NF0A 3R13A 4PH6A 3PF3A 2E6FA 5I3JA 3BK0A 4O16A 3GAYA 4ALDA 3UD6A 1TJRA 3PB0A 2NX9A 1WX0A 4DPPA 3O1NA 3NPWA 3QH2A 3TAKA 4W9TA 2VC6A 2H8ZA 3HMJG 4M6PA 2GPTA 4LV4A 3VE7A 4ZMGA 3R8RA 3GNNA 1OF8A 1J5TA 2CU0A 4UFMA 5J5DA 2FIQA 4O17A 4JIQA 3IIXA 3FA5A 2WPBA 2A2IA 2AGKA 3TUUA 3L5MA 3TJXA 2WJZA 3MYPA 4LVBA 1FWSA 1IXNA 1GTHA 4O50A 3PULA 2VFHA 3P60A 4DEFA 1ME8A 1TIMA 2Y89A 4IMCA 2ZA2A 1VYPX 3AO0A 3OVRA 2NX1A 1XDLA 3H55A 3RLVA 3NQGA 4EIVA 3NM1A 5K2ZA 4CQAA 3C61A 1VCGA 4I7VA 4AHOA 2C19A 5FF3A 3PUOA 3GR7A 3PS7A 3VI2A 3LTYA 1ZAIA 3BLIA 3LCFA 4DPQA 4O4WA 3M5XA 5E0KA 1YTDA 4QITA 1I4NA 3LXBA 1XDMA 5G4EA 3C3NA 5C5YA 1LOQA 1VH7A 3TW7A 4JNMA 4CCCA 5AOUA 2YW4A 1K03A 1W5PA 5LKYA 4KFPA 4GUFA 5CG7A 4AMAA 3EWUA 4FNTA 1J4EA 3N2XA 5FF7A 1F74A 4IPIA 3ATYA 1N7KA 1AW1A 2QKFA 4MYAA 4FX6M 1I2NA 3LHTA 4WJEA 3DKLA 2CLLA 2TPSA 1L9WA 2DORA 4MJZA 4HPJA 4K39A 4WY0B 2R8WA 3GIYA 5EBUA 4FNQA 3L5LA 3LRLA 4QISA 3W7LA 3DFOA 3PVFA 1LLWA 4LUIA 2J9YA 4OQVA 1ICSA 1QPNA 3IGSA 1DJQA 5KZMA 4RCXA 3TKFA 2C18A 3O8AA 2H3BA 2Z6JA 3GKAA 1W37A 2VFGA 5D30A 1CI1A 1TMHA 3W75A 3SSJA 3O15A 3DHFA 4B5NA 1OG0A 3UWZA 4YXGA 2J6XA 4HT3A 5C55A 3W72A 4U4MA 2YDAA 1MEIA 4XWUA 5FEXA 1KBIA 4JY8A 3S5NA 2Z1BA 3CEPA 3BW2A 1W56A 2HMCA 3GXPA 2WNNA 2CFFA 4FXRA 4TX9A 5IM51 2R91A 1M7OA 1SZGA 1WV2A 2GQ9A 3G1SA 3NNTA 4NJJA 3GNDA 2QCHA 4L4LA 1DVJA 4LW7A 4UTIA 1LM1A 2RDTA 2WO5A 1VHNA 2QCDB 4GUJA 3QQ0A 1GTEA 3KHJA 4P2VA 4NJKA 4AAJA 1YLVA 4NNCA 1ME7A 4GUGA 3N2MA 1TPUA 1GT8A 5G1YA 1K7FA 4N4QA 1SO4A 2DU2A 3GDTA 4MYXA 1Z48A 3PUEA 2YW3A 5G2IA 3BPWA 4LRSA 4ADSA 3ANYA 4NZJA 2QDHA 2JGYA 3IIOA 4IX2A 3MP3A 4GBUA 3GAKA 3TQ0A 1VZWA 5KTLA 4HSNA 4LRTA 3HO8A 1CX9A 3EX6A 3MJYA 2V2CA 4KWVA 2QCEA 1Q6QA 1F6PA 3W7MA 4UFKA 2OJPA 3T44A 4ADUA 4CLMA 3LHWA 3L5AA 3LDVA 5CPMA 1SSDA 2NWSA 3LV5A 4WZHA 3E96A 1OF6A 3NGJA 3TSDA 2QJGA 4FIQA 1J2WA 2J9ZA 1PHQA 3T40A 3TU9A 5U7SA 5E1QA 1THFD 3W1LA 3QM3A 4CNPA 4XQ6A 4C1KA 1PIIA 4JICA 3M5VA 2UV8G 4R34A 3SGUA 4D2JA 3MP4A 5D09A 1FCUA 3FFSA 4O14A 3FOKA 1WAUA 2V5BA 3GKFA 1SO6A 2CZFA 4ICNA 4LY8A 1ZAHA 2ABBA 1DKWA 5TIMA 3RF9A 3VKJA 1SO5A 1VYRA 3C2OA 1PVNA 4HKPA 1TRDA 1JUEA 2CWNA 3S0CA 5EA9A 3W86A 2YR1A 2A0NA 3HPZA 3O6DA 3W7RA 4NXSA 3SR7A 1OYBA 3BARA 3NXFA 1OFRA 1LP6A 2ZFAA 1TV5A 1A53A 4O28A 1KM5A 2A85A 4I7WA 3MW7A 3BGJA 4FO4A 3HPXA 4UMAA 3W2LA 3G8EA 3IIVA 4K6AA 3I7SA 4KWWA 1OX4A 3KXQA 3QPYA 4WXYA 1DQWA 4YCOA 2H8XA 4E2BA 5K3VA 4HHPA 2OT1A 4IMEA 4A22A 3M0ZA 5K4XA 2BXVA 2WOQA 3W7PA 2QCFA 3DFTA 1MZHA 4K38A 4ZQMA 1OFEA 3UY8A 2ZRUA 2I14A 1ZJIA 3W1UA 4FX7A 3UYCA 1LTDA 2B7NA 4O54A 3CT7A 2BSLA 3VFLA 4BI6A 4QNWA 4YL2A 3PG9A 1FDZA 1XFBA 3UPWA 1I2PA 3N14A 5G4WA 1S5TA 1LBLA 2J88A 4OV4A 4OT7A 5DY2A 4OU1A 3IIZA 4LUJA 1SQ7A 4IJBA 3STFA 2V2DA 2CLOA 5J5RA 1VJIA 1JCJA 3P5YA 3TX9A 3DZ1A 4YWIA 3MWAA 1QNVA 3WK0A 1TYGA 3PBYA 3F4NA 1OFQA 3NQCA 1D9EA 3GX9A 2E68A 4ML9A 1SO3A 5F2GA 1M7PA 1JCYA 4NX5A 3C2VA 3QEZA 4O13A 1RZMA 3EX1A 2WV8A 4ORIA 4ORMA 5BMWA 5MHBA 3CPRA 1LBFA 3M6YA 2NXGA 1NF7A 4N9DA 4O57A 5D02A 3NQ2A 1WXJA 3C0JA 5CZ0A 3LBMA 1ZCOA 4HN4A 1PE1A 5K4ZA 4GE8A 3NOEA 1X7FA 2QCDA 2RKXA 3TQVA 1YXDA 4K8HA 1DHPA 1SU5A 1YDOA 3NQAA 1YADA 2BX7A 1TTQA 3MO7A 4R7JA 3M44A 2C6QA 2VELA 3UWUA 2TMDA 2WSQA 1O5KA 2HS8A 1PCKA 1KBJA 3WJXA 4OWGA 2G5WA 1FWTA 4PA8A 3FJLA 4K36A 1DV7A 5A5WA 4Y8FA 1AW5A 1YDVA 3NZ1A 4BWLC 1HTIA 1ZALA 2XFWA 4IGHA 3HBLA 3THAA 3TR2A 4YCPA 2ISWA 3NQFA 4EF9A 4MZ1A 3M1ZA 5HINA 5LZLA 4A29A 1Z41A 3PY2A 3V1PA 1GVQA 5HWJA 3ZWTA 5BW6A 2E6AA 1OYCA 2KZHA 2B7OA 2O7SA 4RXFA 5FI8A 4JYFA 4QAIA 3CLMA 3M43A 1L6SA 1MXSA 3PBWA 5DLCA 1XCFA 1CW2A 4RV8A 3GDKA 4HPXA 2JGQA 3EWYA 1F7BA 2QF7A 3W1RA 3NL2A 4BK9A 1QPQA 5C2XA 1L6WA 1G67A 1TB3A 4Y9AA 2Z6IA 3QMSA 5CGQA 2CLKA 3W2NA 1EWDA 3M5YA 1ADOA 3NAVA 4NT0A 4Z1BA 3CU2A 3P5ZA 3MBDA 4ZVJA 1TTIA 4PCFA 3NEVA 2JKPA 1TO3A 3C2RA 3WJWA 5FEWA 3G3MA 2YPIA 3ZWSA 1FXPA 4N4PA 1K7EA 4UR8A 5AC8A 3TC6A 3LTPA 3O6YX 5U4NA 4UTWC 3PSWA 4JD4A 2AQWA 1A5AA 3N19B 1S5WA 2ZZ3A 2E5DA 1B4KA 1HL2A 2YFNA 2BLEA 1FWNA 4O19A 3EEGA 3LHYA 5D2XA 1W3IA 3P81A 3S6DA 4O52A 4AWTA 4UMBA 3TMLA 2ZZ6A 1X8FA 3MI6A 3S1VA 2DZWA 4TMCA 4AB4A 1FY6A 3M5ZA 2Z2UA 4UXDA 2R94A 4LVAA 1G69A 2V2HA 1KTBA 1QDSA 1JCNA 4QJ1A 2QUTA 4GNJA 2Y85A 5CPLA 3NR0A 3UQNA 1WBJA 2V30A 2J27A 4R33A 3CTLA 4O53A 3QC3A 4JDBA 1OK6A 1FUYA 2ZTJA 3BG3A 3TDFA 1EA0A 4JDYA 3G1XA 5D05A 1QAPA 2FTPA 5CZJA 1TPC1 3W70A 5LGXA 1K02A 3DI1A 2HSAA 1YPIA 2Y61A 3FS2A 2QEZA 3MYOA 1FWWA 2VXNA 4O15A 2ALDA 3UWVA 5DXYA 4NNBA 2QDGA 4LS1A 4LOCA 1E51A 1W1ZA 4XBSA 3BLEA 3DU0A 3HB9A 4IWWA 2Y7DA 3GZ3A 3LB0A 1F76A 1ME9A 1UASA 4JN6A 1KFKA 1XUUA 3LLFA 1W54A 1PHWA 2A4AA 1LOLA 2CLHA 4IXXA 1LRTA 5LSMA 1TV8A 2C3ZA 3PUDA 2FB3A 4DBDA 4MZYA 2CLMA 2CLIA 5F2IA 1UCWA 4U28A 1G6CA 1DL3A 4TO8A 1K8YA 3W7JA 2ZDRA 4NQ1A 3DI0A 2W0UA 4AHPA 5D37A 3B4UA 3TE9A 2V9DA 3C4UA 3S1XA 4OHQA 5EKYA 3W2KA 4JYEA 4MOZA 3P67A 4LWWA 1VLIA 5HMSA 5CSRA 2FB2A 3MBFA 1QWGA 2C15A 2C1HA 2E6DA 4MLRA 1G4TA 1VLWA 3CIWA 3MP5A 1EUNA 1MO0A 5G5IA 1VRDA 5CZSA 1AL8A 1LZOA 5CPOA 3R5EA 1BWKA 3N9SA 3FKKA 3GR8A 3DAQA 2PE4A 2PCQA 1P0NA 2GJLA 1F73A 3DGRA 1ZFJA 1JCMP 1RQEA 1DJNA 1H7WA 4JTFA 4NVTA 3W84A 4MPQA 2GJNA 3HG5A 3G1YA 2RFGA 3W1NA 3A5VA 5K9XA 3GDRA 2C14A 1OFBA 3NO5A 3MHFA 1AK5A 3KOFA 3A5FA 3KVJA 4AWUA 4MVAA 3W7QA 5AC6A 4O12A 2F7FA 3G3DA 3S5YA 2DZTA 4K8EA 3DFNA 1RPXA 4WUIA 3LHZA 1EEPA 4ADTA 2OT0A 2ZZ7A 2EAWA 2W79A 4NXKA 3WK3A 3IGUA 1Z42A 5LNWA 4P61A 3NZRA 1YXCA 4JTEA 3TFCA 3A21A 3D0CA 4JTIA 5TBOA 4FXSA 3EWZA 1TPEA 3P61A 3B0PA 2DZSA 1IIGA 4UTTC 4C1LA 1P0KA 3B03A 4RKAA 1LRNA 4DF2A 3NG3A 4XTDA 5HUOA 4DF1A 4S2BA 3STEA 3ZFHA 1SPQA 5K9DA 1ALDA 3R2GA 2DZVA 3OEXA 4POCA 3FYOA 5F4WA 3N3MA 3E9AA 2VKZG 3QMTA 1SW7A 3UZJA 1H1ZA 3W1QA 4Z0SA 3LLDA 1S5VA 3P80A 3TFXA 4DF0A 3RNDA 1O94A 4IUOA 4M6QA 1VC4A 3PB2A 3CHVA 4MJMA 4DXVA 4M6VA 4K7YA 4H3DA 3LOTA 2W6RA 4PODA 3TNOA 3LV6A 1XBVA 2EPHA 3S9YA 1SR9A 4ZQNA 3W2JA 1WOBA 3TMQA 1VGAA 3R89A 2Q3OA 3W9ZA 3KRSA 3W7HA 4O1BA 3W6YA 3QJAA 1V5XA 4N9CA 3W7IA 1OX5A 1XBXA 3PG8A 4RZ4A 3U6WA 4CCEA 3JR2A 2YCEA 2DZXA 2PRHA 1H62A 4IMDA 5ABTA 1GYNA 1XKYA 5KITA 2BTMA 3S5ZA 1TPH1 3W1MA 4HNVA 1Q6LA 2Y63A 1ZENA 1H7OA 3W83A 2A1YA 3BVJA 5K7JA 4UNKA 3PC0A 3ELFA 1T8XA 1TSIA 4JTHA 3S1UA 3EXSA 2ZZ5A 2E77A 3HG4A 4AEOA 1XUZA 2OZ0A 2ISSA 3BW3A 2FPYA 1YDNA 1SSGA 1OFPA 2BZNA 3HPSA 4FNSA 1W8SA 2V8ZA 4N9EA 3PBUA 1VCFA 4MKNA 1EP1A 4WXZA 4HNUA 1AL7A 2QJIA 2EGZA 4UIOA 1A5SA 1KFEA 3N9RA 4ZQRA 1GG0A 3TQKA 2FPTA 4QQ3A 1KFCA 2C0AA 3W76A 5BRBA 2X1UA 1VPXA 3SIZA 2H3DA 3KVKA 3GXTA 2RH9A 3G1AA 1FCQA 1GQNA 1F05A 5I3IA 2F84A 4PL1A 5LHEA 4QIUA 5T26A 2XN2A 1EB3A 4DO4A 1TQJA 3G1HA 1PCWA 1QO5A 3B05A 3NPVA 2CW6A 2NXHA 3F4WA 2WSRA 3MHGA 2X16A 1JCLA 4J9JA 1NVMA 5HR6A 4ZQPA 1W5NA 3MUXA 4NZFA 2QCNA 1G4SA 2E09A 1GZGA 2A21A 2PURA 3C8FA 4QNEA 1QPRA 4NUWA 3L68A 1XXXA 1TV7A 2QCLA 2V0TA 4N02A 3RFAA 3B06A 3TXZA 2GVGA 4ZZ9A 4TR9A 1JUKA 1GPWA 3Q37A 3KRZA 4R53A 3TXVA 4CCDA 2YSWA 1O5XA 4I7UA 1RR2A 4Y90A 1SZNA 4UR7A 4BI7A 2OX1A 2Y7EA 5AHLA 1AMKA 5HUPA 2VFFA 5AYXA 1LORA 5CZTA 4NJIA 6ALDA 2ZCGA 1JR1A 1HUVA 2WKJA 1FQ0A 1B3OA 1NAL1 3S5OA 3C52A 3E49A 1KTCA 1Z44A 3FIGA 4NJHA 5LNSA 1KM2A 4JY9A 4UTLA 3T78A 5EPDA 3RMJA 4JGDA 3W22A 3O16A 4O8RA 1KLZA 4IOTA 3QSTA 1H50A 2BWGA 5HNRA 2JK2A 2NLIA 1XC4A 4L4MA 3PWAA 3NYZA 4Z1CA 2H6RA 3G8RA 4O1DA 4DO6A 2QCMA 1FBAA 4FF7A 5G2WA 3E12A 5LNUA 1PV8A 4EWND 1ICPA
chains in the Genus database with same CATH superfamily
4JIPA 3UA4A 3S6OA 1QWKA 2VX5A 3QV7A 2DT0A 2FLIA 2FYMA 3VNDA 4ZQOA 1D3HA 4XKYB 3MT1A 1FWGC 1H7NA 5JMUA 4DZIA 3EKZA 3VXGA 1X6UA 1DQXA 4QXIA 1ZAJA 3I7RA 3ITGA 2J7EA 3NIYA 2FJUB 3GDBA 2V5JA 1QI0A 3NL3A 3NFUA 4EX4A 1TZZA 2RUSA 3MJMA 1E56A 4J4KA 1HP5A 4GPNA 1HKKA 3L12A 5DBTA 3GK0A 4W84A 1TPVA 5FJIA 4EAYA 1I9CB 3SZ8A 2NX3A 4RZ5A 2CC0A 5BMXA 1KGUA 2HBXA 2VEPA 3R79A 4PCNA 3PFMA 1SVDA 3ZIZA 2HDJA 1PB0A 3W07A 2D2HA 4PMJA 4KFNA 1SR0A 4ZB0A 1FKWA 2YXOA 3CZKA 4GJIA 3VPLA 1QMLA 4I9MA 2C71A 5JQ9A 1CYGA 2YB4A 2HTMA 2F9RA 2FGBA 2VP8A 1EZ2A 1N8FA 2DZPA 3WBYA 5CCZA 5PTDA 3MQTA 5T9CE 4WKAA 5J8LA 3LD5A 1GG1A 1KKOA 2ZICA 3Q94A 3SUUA 3P6LA 3A24A 1PYMA 3NQ7A 2WHMA 1AMYA 3FLUA 3HG3A 4AEFA 4PUUA 3N6QA 3W87A 3CQIA 1OC5A 3WD3A 3AJ7A 4MF4A 1IZJA 4TMBA 5C0QA 3AIQA 4C60A 1XH1A 1ZY9A 1IE7C 4IL0A 3SQMA 1FKXA 5L6UA 3AHYA 1CIUA 3QR3A 3E2SA 4ZODA 1NJJA 5HQLA 1E40A 3F5LA 5AYIA 4DJEA 3MSGA 3PTMA 1E4LA 2G3JA 1R3TA 1V6WA 3E38A 5XIMA 3BDKA 1R9XA 3QY6A 1XLLA 3WEOA 3G2GA 4ZCWA 3SEPA 4H9UA 1Q5MA 4XVDA 4MNLA 4N7QA 5TD4A 4Q4PA 1YE4A 2BXZA 5AB3A 1W5MA 4FHAA 1BYBA 5DO8A 1P4CA 5TNVA 2XDFA 1KBLA 3JS3A 2NQHA 2XH4A 5AHNA 1K1DA 2HNEA 1QT1A 1R6WA 2ZRZA 4JBRA 3KP1A 5KZDA 1G7UA 1GVSA 1JDAA 2NQLA 1LUCA 5C7VA 2P1FA 1YPFA 3QKZA 3ME3A 3UWQA 3ZR4A 3B9OA 1KM6A 3TYBA 4Q22A 2Y8KA 3P62A 3IGXA 4L61A 4QBXA 3ABQA 1QOPA 2YA1A 1J18A 1HO4A 4KKXA 4PFHA 1KQYA 3EOLA 1MW3A 3F2CA 2XSXA 3BJFA 1BD0A 2J7CA 1TPB1 1UR9A 2C91A 7ODCA 1QO2A 3AXIA 3DECA 4GIRA 5LHFA 5DX7A 4R7OA 1WPCA 3WD2A 1HO1A 4XUGA 3UJRA 2FQIA 4K2SA 2BGNE 1JPKA 4BF5A 4FPSA 1HW6A 3LCHA 2X40A 3A12A 4F48A 5CPQA 4QCFA 1GVRA 2EPOA 2Z24A 4F66A 4W7VA 2WMFA 3UCCA 4E4UA 4MUZA 1VPYA 1K4GA 1RA0A 2HJPA 4XZMX 5DY3A 4LBUA 2CITA 1XIJA 3DYOA 1O7AA 3FY1A 3USBA 1MXDA 1YDYA 5AHEA 4H4IA 3T7VA 2WZEA 3GYEA 1K9FA 4YMZA 3M16A 1QK0A 3HPFA 4IPPA 1JQXA 1BEUA 2G95A 2BHZA 5G4HC 3APGA 3ABOA 3NDYA 3O7UA 2D69A 4CNSA 4P8UA 3B04A 2V69A 1MW2A 1VFOA 1ADSA 3LTSA 3B8UA 3EPOA 4KEVA 4A2RA 4UTJA 1JYNA 6TIMA 1TWZA 3N2BA 3W1TA 2D22A 1WQ5A 3VKKA 1QFEA 2FTWA 1HVXA 2JF7A 5BXSA 4P8WA 3VMPA 1RY8A 1W2PA 1S39A 1KB3A 2NWRA 3DIPA 1XDJA 2DJXA 4DJDC 1HVQA 1E1EA 1XLGA 3UWYA 1CENA 1L0PA 1A5OC 3LHUA 5IXEA 1FWFC 1T41A 3EDJA 4YNGA 1KRCC 1TMQA 4LUTA 1A5CA 1XPGA 5IDZA 1V3IA 3APTA 3POCA 1G94A 3WLSA 2J7HA 3GE7A 2YX0A 5C6MA 2RHGA 2FMOA 3VKCA 1Z7AA 3OW1A 3QYQA 4LUYA 3OG3A 2V68A 4L7ZA 4A35A 4NZ5A 3NL5A 4BF9A 1OT1A 3KL0A 5C2CA 2XUCA 2V67A 4JNYA 4LJ3A 1E0VA 3MKKA 1TREA 2VEGA 4I6KA 5HJLA 2PTYA 3UPBA 4B92A 3NZPA 1V02E 5FEZA 4MUPA 3GXFA 4PMXA 1KM3A 1UQZA 3HFYA 4C90A 1CGWA 4XK2A 4LGXA 1X98A 3XIMA 1JEZA 3FKRA 4XD5A 4J3WA 2E9MA 3TROA 1C29A 4KF1A 5TQLA 2NZLA 3O05A 4AH7A 3N12A 1RLCL 1VHCA 1BKHA 3NPXA 5I23A 4X2PA 5M3WA 5BRQA 3M0XA 2WVVB 3HIJA 3UPMA 4E2OA 2VD9A 2H90A 3VGDA 3PAJA 2QCGA 6REQB 2BGSA 3BE7A 3CQ0A 4IP4A 3O6AA 2W5FA 4LF1A 3ALGA 3BLKA 1NELA 4NYUA 1I0DA 5DFAA 3LXAA 4CD5A 1T99A 4WF7A 2P50A 1LG1A 3THUA 5IHRA 1CLXA 3L65A 5AN7A 3T6CA 1X1OA 3IVUA 4GYPA 1MDRA 1QATA 1IV8A 4ZXLA 3CZ8A 4KCWA 5HULA 1W3HA 2G97A 1OC6A 4X22A 3C56A 4GCAA 1VAHA 1LL4A 1IXQA 1Q85A 5KZEA 1I60A 1RP9A 1XI3A 1OYAA 4QLJA 3VKBA 3K5XA 4LV9A 3H2OA 3VCNA 2X30A 4BJHA 1CXIA 3NO3A 2YXGA 3EXRA 3QRHA 1D8CA 2W62A 3IVTA 5CKSA 4A2SA 3P7YA 2NUWA 4LX4A 1TWIA 3OZPA 4GZEA 1TIWA 3COTA 5HMEA 3PR2A 1REQB 5FAJA 4XZLX 3LBCA 2PBGA 4GKLA 3AYRA 4ZO8A 4FB7A 2IXVA 3PTQA 4HU8A 4YVXA 1OFOA 5LNRA 1GOMA 3W4RA 3LCIA 4Y96A 1WBHA 1NARA 2OX4A 3G1DA 2ZZ1A 3ANUA 1GYLA 4HYRA 1MUMA 4XKMA 2YBUA 4LUSA 2XVNA 1G9HA 5DANA 2PDJA 1FXQA 3E74A 3OGRA 2YL9A 3PZVA 1M5WA 1CGVA 3U57A 5EGRA 2W3ZA 2BP1A 1QW8A 1UZDA 1E55A 4S3BA 4AZ5A 3RX3A 3TCEA 1R3WA 2ZOXA 1FDYA 1YTEA 4C7DA 3RAOA 5D9NA 1EJWC 3IRSA 1U83A 2QNEA 2JBMA 2VRKA 3WH5A 3WFAA 3SURA 3LGEA 4S3KA 3FYPA 4AHQA 2CIPA 1D3GA 1MW0A 4ZL1A 3XINA 4AF0A 1UKOA 2XN1A 3WDHA 3WLPA 5XINA 3LRKA 2GVJA 1LQ0A 3M4HA 2AMGA 4DNMA 4CQCA 2OSYA 5C70A 5AFDA 3SY1A 4UFLA 1P7TB 1F6KA 2PTWA 3THDA 3S3GA 1BGGA 2GL5A 1UW9A 3A23A 3L0GA 4OVXA 1N2VA 1WXZA 2PCEA 1HXJA 3L4WA 1H5YA 3V16A 5CBIA 2OLHA 4AIEA 1FFQA 2GQ8A 2C8NA 9CGTA 1E4MM 2WNZA 4KRTA 2EHHA 3ORWA 4CEUC 2B0MA 5AECA 4QJ5B 1CDGA 3E0FA 4KGLA 4W86A 1YE6A 4N42A 3T0TA 2X7VA 5JIPA 1BG4A 2XFYA 3L2IA 1KA9F 1M6JA 3F4VA 3BZJA 4AVFA 2E67A 4ICCX 1BTMA 1KO0A 2WVSA 2D0HA 1IZKA 3ARQA 2V81A 3TC7A 3GO2A 1GVIA 4LS2A 2V6AA 3EZ4A 3Q65A 3GG8A 1KRMA 4XB3A 1EXPA 1QTWA 4W4QA 3CPUA 3MSYA 4AG0A 4NKCA 3BO9A 1FHDA 5F4SA 3V7PA 3SO7A 3W7EA 1O68A 4P7QA 2VFEA 4RDYA 2GUBA 1DORA 1GORA 4ZQCA 4EK7A 3M7WA 3T4CA 3VDHA 3QTGA 1Q4NX 3LPGA 1R2SA 1MRQA 4M6UA 4JX5A 4LC8A 1YNQA 1GZJA 4J3TA 3O0FA 4FXJA 3SGGA 5FSEC 1IR1A 3LXCA 1OX4B 3C6CA 1UD5A 4LANA 1DJZA 4LXFA 2WMHA 3BLPX 4DYJA 1CT5A 4OUEA 3REQB 1XIGA 3BK0A 3PB0A 2NX9A 2PLMA 3CS2A 3GZAA 1PZ1A 3QH2A 3AC0A 4W9TA 2I5QA 3TQPA 2VC6A 1OBAA 2GPTA 4ZMGA 2AOSA 3IIXA 2BNJA 3TUUA 4YPJA 3MYPA 1CXEA 3I4KA 3QV9A 1IXNA 3OLIA 4M0XA 3PULA 1XC6A 5I6SA 2YKKA 2E9BA 4IMCA 2ZA2A 1VYPX 4ZSTA 3NQGA 4EIVA 2JALA 8XIAA 2PLJA 2MNRA 4AHOA 5BYWA 3WG6A 4BQ4A 1AODA 4KWUA 3PUOA 3GR7A 2RJGA 4TQTA 3BLIA 3LCFA 3W25A 4DPQA 4FSAA 4E6MA 4QITA 1UH3A 1UR1A 1I4NA 3AFBA 1LOQA 2HCVA 5AOUA 3MMDA 4H7ZA 1PAMA 4AMAA 2Z26A 1RBAA 1J4EA 3HN3A 4XSMA 1F74A 4JNZA 4IPIA 1XLHA 1XKJA 2DFAA 4D9PA 4MYAA 2Q01A 1I2NA 4NYYA 3VMNA 2CLLA 1L9WA 1Q2SA 5I3DA 2DORA 3VAVA 5CC7A 4FA3A 3GTHA 1MNZA 1DWAM 3D46A 1KRBC 1XG4A 3LS9A 1PIFA 1LLWA 3WD1A 1W9XA 4Y9OA 3IGSA 2OG9A 4ERIA 4KQNA 4M81A 4RCXA 2C18A 3GKAA 2VFGA 4DUOA 3N1AA 3CLWA 3B8SA 3O15A 3VD7A 2VDIA 4B5NA 3V35A 4HT3A 3W72A 5HA7A 5FEXA 3S5NA 3OA5A 3SQSA 4WKHA 2OWCA 2V5DA 1B3ZA 1VFMA 4US6A 3C2YA 3GXPA 4K1WA 1M7OA 1SZGA 3NNTA 3LQLA 4NJJA 3N25A 4LCSA 4L4LA 4LW7A 3PNUA 1LM1A 2WO5A 1VHNA 1J96A 4RNHA 3QQ0A 4P2VA 1ME7A 1M68A 4GUGA 3N2MA 3HMCA 5G1YA 1XCWA 5MF5A 1DE6A 4GA8A 3V5FA 3MUIA 1QJWA 2P3EA 3A3HA 4LRSA 4FLQA 3ANYA 1MYRA 1RJQA 2QDEA 2JGYA 1XRVA 1VBUA 3MP3A 3KL3A 3WLLA 2P8CA 3GAKA 1VZWA 4M1BA 1CTNA 4MWAC 4JHZA 3MJYA 4KWVA 1F6PA 1OQFA 2BMBA 4ILSA 2QF8A 4MB3A 3IUHA 3LDVA 4PCTA 2A3BA 4FIQA 4AY1A 1J2WA 3T40A 4C6MA 3TU9A 4PCSA 1TA3B 5E1QA 3A4XA 3W1LA 3ZT6A 3M0MA 4DO7A 3SGUA 3PZTA 1OSEA 1BYAA 2Q09A 5ABEA 2ABBA 1DKWA 5D4YA 1PZ2A 3CQHA 1VYRA 3GSMA 4DX3A 2EG7A 1PVNA 1TRDA 1JUEA 4L9XA 2WXDM 3OGSA 3H2AA 2A0NA 1HKMA 1YW1A 4KIEA 2O9RA 4GI9A 3BARA 4IPLA 2PDYA 3T08A 2A85A 3ITOA 3WLTA 2IPWA 4I7WA 3KCJA 3R8GA 4ZEPA 1EA9C 4QE5A 4IZGA 5B7ZA 2YL8A 3IIVA 1ZZMA 2WMJA 2WC4A 3ZJKA 5DMYA 1EGVA 1T8QA 3I7SA 1JPHA 3SCNA 2R1LA 3QPYA 4P8VA 1CXKA 2PODA 3SRKA 2H8XA 3QQWA 4CNUA 5K3VA 4OBRA 2ZXBA 3M0ZA 3BLOA 4G7EA 4HU0A 4LALA 1MZHA 4AIOA 4K38A 4ZQMA 3JZEA 1OFEA 4M51A 3UY8A 2FH8A 2YBTA 4FX7A 3W27A 2VVSA 2OZ3A 2B7NA 4C7FA 3VFLA 3E5BA 4YL2A 1FDZA 5G1MA 1I2PA 2PWUA 5G4WA 3T1GA 1S5TA 1LBLA 7XIMA 5LA0A 3QPEA 4HNCA 4OT7A 5DY2A 3BQ5A 4XZHA 3IIZA 1GW1A 1YMYA 4TTGA 4IJBA 3STFA 2V2DA 3LENA 1LLOA 1W3KA 3P5YA 3MWAA 1QNVA 3WK0A 3PBYA 3F4NA 3OLEA 1DTNA 4WGHA 2UY5A 3PZOA 1SO3A 4NX5A 2XM1A 3QEZA 4O13A 4ORIA 5BMWA 1JZ5A 3CPRA 1LBFA 3J7HA 1EBGA 1XRTA 1NF7A 3U0HA 4N9DA 1HX0A 2XTKA 4O57A 3RPMA 5A6TC 1PBGA 4NRRA 1HL8A 3T42A 5K4ZA 3NOEA 1X7FA 3KS6A 3ZSSA 3EMQA 3WH9A 1YXDA 2XH2A 2OOGA 3TJIA 1REQA 2QLYA 4YWSA 4HCDA 4IUGA 3BICA 1PX8A 3M44A 2C6QA 2HS8A 1X96A 1ESWA 4OWGA 3AZSA 4DAFA 1FWTA 4PA8A 3FJLA 4K36A 1DV7A 4FOUA 3WFZA 1YDVA 1HTIA 2XFWA 3TR2A 1BVNP 2ISWA 3NQFA 5LZLA 3ONBA 1E1CA 4U2YA 1OYCA 2B7OA 1GQJA 5FL0A 1TKKA 4QAIA 3CLMA 3M43A 4MDPA 1WCGA 4U5IA 4QLKA 1MXSA 5DT7A 3PBWA 1PWMA 1CW2A 4RV8A 3GDKA 4NZCA 3NL2A 1QPQA 4JCMA 1ISZA 1G67A 1TB3A 2Z6IA 5CGQA 2ZUTA 2BS9A 1KR1A 3OP2A 3B9EA 4GYKA 4HN8A 3NDZA 2F6KA 3B8WA 3NEVA 1UKQA 5GQBA 4IM4A 3C2RA 3AYVA 2WJEA 2QJJA 4N4PA 1K7EA 5AC8A 3O6YX 3QR1A 4FOKA 3PSWA 1IEIA 1A5AA 2UY2A 1NP2A 2C0HA 4CD6A 1Q6FA 1W3IA 3MI6A 3UBPC 3C0QA 4D1JA 1CNVA 3PZIA 2REQB 2VGGA 3M5ZA 2W66A 1YQ2A 3VIGA 4IIGA 5I78A 5GJNA 3H24A 4UXDA 2J75A 1G69A 1IYXA 2WCGA 3EBVA 1JCNA 1HP4A 5A1AA 2QUTA 4GNJA 2IS7A 2Y85A 2YXXA 3ZQ9A 2WM0A 3UQNA 1GJWA 1HNYA 1WBJA 2VR2A 1C8QA 1FH7A 1XIHA 3QC3A 4JDBA 2ZTJA 3BAKA 3VK5A 3XISA 2FZDA 1EGZA 4L1GA 1R5YA 1XX1A 3KTCA 1IT7A 4CN1A 1IT8A 4AMCA 1FWWA 2ZUSA 4IHCA 5I7GA 3EGJA 1OWQA 4LOCA 1E51A 2VM8A 4EANA 3TW9A 1RA5A 4YTSA 1XLBA 2YCLB 4IWWA 3NEHA 3IK2A 4QJ3B 3VIKA 1UASA 2EQDA 2AGTA 4PTVA 4Y9PA 1L6FA 2R82A 3CMJA 1F9CA 1LOLA 4AISA 1RCQA 4IXXA 4WDTA 5LSMA 4I3GA 1Q2RA 1JPDX 1M3UA 2ONEA 3S9ZA 4DBDA 4MZYA 5JBDA 4UOJA 4LUTB 1O12A 3VABA 1K8YA 3IJQA 1Z9AA 1EJRC 3W7JA 3OBEA 5CGMA 1AQ0A 3PWIA 2W0UA 2WVTA 4PN2A 5D37A 1J0KA 3B9NA 4MOZA 3RUBL 2XGIA 1E1FA 5CJNA 5HMSA 4JL2A 3PPGA 3LYEA 2E6DA 1EUNA 5HOSA 5G5IA 1XSJA 4I9TA 1LZOA 5CPOA 3GXMA 4WR3A 3VIOA 4CGTA 1VFLA 2PU0A 2A79A 4DI9A 1K9EA 3GR8A 4H8NA 3P3BA 3SFWA 1K6AA 4LAOA 5CAKA 1UWQA 1P0NA 1T40A 1F73A 1P6WA 3FSTA 1QNSA 2R1MA 4QP0A 1ITXA 4XD6A 1DJNA 1UYQA 3W84A 3UR2A 3R11A 3G1YA 3W1NA 3A5VA 4MWAE 4HMNA 1XCXA 4A3YA 2C14A 2PC8A 3MHFA 5FKYA 4H9XA 1C8XA 3A5FA 4MVAA 5AC6A 3B97A 1E0WA 2DZTA 4K8EA 4BCEA 5TF0A 4AZHA 4WUIA 3IWPA 4YVVA 4QEEA 1E3ZA 4Z2JA 3KHDA 1EEPA 4AXNA 3WL0A 2ZZ7A 1E70M 3WUBA 3WK3A 3LU2A 2Z25A 1Z42A 4P61A 2OSWA 1NOFA 4GLEA 3MY9A 4JTEA 4C6BA 3A21A 5TBOA 4DNHA 3EWZA 3V5CA 2X8RA 5IFPA 5A8OA 1CLVA 1RLDA 2UBPC 4GZ7A 2ZKMX 1P0KA 2ZDSA 3B03A 6XIMA 3RDKA 4DF2A 4D6IA 2GDQA 1W9DM 2OGJA 5HUOA 3W01A 2ACRA 4W87A 3MUCA 4B4FA 5K9DA 3UWEA 3R2GA 2DZVA 3OEXA 4KWOA 4JAWA 3E9AA 3UZJA 2GUYA 1H1ZA 3F7JA 4C6KA 4J35A 3LLDA 1U30A 3TFXA 3CV6A 4M6QA 1XIDA 5CQ1A 3CHVA 3MU7A 2W6RA 3LV6A 1XBVA 2EPHA 2X2YA 2XIIA 4DWSC 3TMQA 4W8AA 4UOQA 4XAPA 3NGFA 3W7HA 1EF3A 1HKWA 1M04A 2WYSA 1OX5A 3PG8A 3U6WA 2WQDA 4CCEA 2DZXA 4C6IA 3QHOA 3I3BA 1QNQA 4L56A 2DQXA 3GH4A 4TTUA 1JDEA 2J62A 1H7OA 3W83A 2Z1SA 4A8IA 3FSUA 1UA7A 4G9PA 3HV9A 2XH0A 3R6IA 1DJIA 2AMXA 3S1UA 4LEFA 5ABFA 2HZGA 4H9ZA 2OZ0A 2ISSA 3W26A 2FPYA 1SSGA 4GBDA 3UF9A 1BTCA 2BZNA 3CAQA 4IMAA 1A5UA 3HM7A 1AL7A 1GQLA 1A5SA 1YKWA 4BQ3A 2BVTA 2CKRA 1AH0A 4ZQRA 3RCMA 2FPTA 5B80A 3GBEA 4HSHA 4KS0A 5A6KA 1VPXA 1YBQA 1L6GA 5ABFB 4LFYA 1AH3A 2H3DA 3KVKA 3N4EA 2RH9A 1KFWA 1OG6A 3LEPA 1FCQA 3UJ2A 4A6GA 4DUWA 5BU9A 2RGMA 5A6BD 5LHEA 3M0IA 4DO4A 1OCNA 3LUTA 3IJ7A 3AWOA 3BZGA 1NDVA 2WSRA 2X16A 1JCLA 5HR6A 4FI4A 4NZFA 4HNLA 4JZ5A 1G4SA 1GZGA 3GG0A 3UZYA 1QPRA 4O8AA 4UBPC 2DQWA 3PPHA 2VOTA 1VB9A 3B06A 1ECEA 2VZSA 4KCVA 3A64A 4XAZA 4ZTXA 3IARA 2JEQA 3Q37A 3KRZA 5T9BG 1ZS2A 2VZOA 3MS8A 1SZNA 3VZXA 5AHLA 2Q8XA 4PYSA 4PSRA 5AYXA 3NJ3A 2X05A 1X38A 2PA6A 3EEZA 4NJIA 2E25A 6ALDA 2WNWA 3OU8A 3BV7A 1JR1A 2EJAA 2WKJA 3BSHA 1FQ0A 3W6LA 1NAL1 3E49A 2WBGA 2CHRA 3SUWA 4D8ZA 3SSZA 5LNSA 4J1OA 4Q4QA 5EPDA 1QI4A 5A6LA 3N29A 3W22A 3WF1A 2PP3A 1KXHA 3SJNA 4IOTA 1A0CA 2BWGA 2JK2A 3NYZA 1FRBA 2OZTA 2WWDA 1BRLB 2F6XA 7ENLA 2EXOA 3G8RA 2BY0A 2QCMA 2R1PA 4NZ3A 1E72M 2WVUA 1J11A 4B16A 3QQ1A 1D3CA 2DEPA 1VFTA 3L0KA 3R4IA 4KFOA 3H4XA 5J04A 1TPDA 3H22A 2NT1A 1UD4A 3MI2A 4PTDA 1PX3A 3K13A 3NUKA 4S3FA 3S2CA 4R27A 3EDDA 2HVMA 3KRUA 3UXKA 1WDRA 2Z1XA 3V0UA 3KBVA 3K46A 4DIAA 4K7VA 1M7XA 3RLUA 1HGWA 3TVAA 3VO0A 3NZQA 1FP8A 2F2HA 4MHBA 3ITXA 5BOOA 1LT7A 4QDMA 2A3CA 4H9MA 3RHGA 3FXYA 1VR6A 5F1UA 2I1OA 9RUBA 5C54A 4A3HA 3FJ4A 3LERA 4GXMA 3MWCA 3OZMA 1E6PA 3G1FA 3RILA 4C6EA 4NSBA 4FIRA 4LU0A 4AIBA 4MB4A 4OIFA 3OYXA 2ZRWA 4UNLA 1PPIA 2ANUA 1TUFA 4Z08A 1E3XA 2A6LA 3WQ6A 1BSLA 3H23A 1W3TA 4C6DA 4ZR8A 1JG9A 3QFEA 1K8CA 3BLDA 3F03K 1BHGA 3WO8A 1W9VA 2J4GA 1FX6A 4UFHA 1KKRA 1G4EA 4KT2A 3TLLA 2QJNA 4PL2A 3U2OA 4Z2IA 2V3FA 5GJMA 3SDOA 3TA6A 3WUFA 3YPIA 2VRJA 1NWSA 2XSBA 5CC5A 3AAMA 1P5BA 1KC7A 2ZVIA 3VX0A 3QF0A 6REQA 1H7RA 3Q58A 5C71A 2PTXA 2WZTA 4XZWA 2GK1B 1UD2A 4BEQA 3FEMA 4W7WA 4BFAA 1JDCA 1FWEC 4CQ9A 4OOZA 5CH9A 1O6IA 3NQEA 3O2LA 4RR4A 1E9ZB 4JFTA 2CBJA 4X9YA 2DT2A 5D03A 4AXKA 3EX2A 3WDIA 3TW6A 3U7VA 2ZZ4A 1J0IA 1EX1A 4UTTA 1W9PA 1HJSA 5EFFA 3QTPA 2NV2A 5AC7A 4QTGA 1W3NA 1BYDA 1OGBA 4O1AA 1WP6A 2DZUA 3LRMA 4O4VA 3MC5A 3EKLA 4XKYA 3TOPA 3G0SA 9XIAA 1N55A 5F2LA 2WC7A 3UGVA 3BSMA 3N4AA 1SZFA 3DENA 1B4EA 2EG6A 1JJKA 1XBZA 1MFUA 1B31A 2C1IA 2Y0FA 2SFPA 3S8HA 2WAGA 4J7RA 2VNCA 1VFSA 1BGAA 2FHBA 4TUFA 4JXCA 5F4XA 1H1YA 3KX6A 1VBJA 4RDVA 1I2RA 3W7KA 1GK8A 1PX4A 1EJSC 1PZ0A 3SRFA 1NSJA 1GVEA 1WO2A 1UKSA 3MV01 3RRAA 4EF8A 3BG5A 2FZMA 5CLTA 4Z2GA 3B9DA 3TJLA 3INPA 1XG3A 1NEYA 2I16A 2ATMA 1BPLB 2QXWA 4ICMA 3NSNA 1UR8A 3CNYA 2X0HA 3MZ2A 4NZ1A 3W6MA 3TYZA 2YIHA 1H7PA 1KFBA 1LWJA 2TRSA 2I5GA 1E6NA 1NIUA 4ONVA 1JDDA 1KTNA 4GIYA 4AC1X 4Q8VA 1YYAA 4RX0A 4JFWA 1Q6EA 3T8LA 4CQ8A 3U2EA 2GGEA 4XX6A 3B0VC 2HXUA 3HJEA 3P84A 4LYKA 1O95A 4UTHA 3AHTA 2ACSA 1V6TA 3CC1A 4GC3A 3E3HA 1UR3M 1U5HA 3AHZA 3G0XA 3ZJ6A 4KERA 2DUAA 4I8YA 3ZT5A 1MEWA 2B31A 4KMQA 4IG2B 2HBVA 1TQXA 1T96A 2WMIA 2DZBA 4DI8A 4M7TA 4UTUA 4M19A 2PD9A 3G1VA 3O63A 3E2VA 4MY8A 1R38A 4JTUA 3ABRA 1SFSA 1IWAA 2D3LA 1C90A 2EKCA 3L66A 3T0BA 1EQCA 4XUYA 4RK8A 3W02A 1LLZA 4M8UA 1XD0A 4O10A 1JVNA 3MZNA 1R3QA 1ZCCA 1AG1O 5I24A 1VKFA 2YYTA 2UY4A 5AYZA 1RQHA 1AH4A 3OIHA 4R9OA 2OSXA 2XN0A 5E5CA 5A8PA 3CQJA 3B0UX 2FJKA 4Q7BA 3TK7A 3NM3A 3NQVA 2NXIA 5I3GA 3LPPA 3BJSA 3BWWA 4GXWA 3CUXA 4S3DA 2ZBTA 4LVDA 1SFLA 3KUMA 2PMQA 7A3HA 3IV8A 7TAAA 2CZ5A 1JF5A 2YZRA 5D38A 1EH9A 2W61A 2YGYA 1O4UA 4X0VA 3G22A 3WLQA 3DHDA 3FYYA 1HZYA 1YPXA 4Q7NA 3UNTA 3BW4A 3IV3A 4OBTA 3KFTA 2VWTA 1RY0A 3WDRA 1AFSA 1E6RA 2E4TA 2OB3A 1OABA 2CYGA 3CV2A 3TN3A 3WNPA 2YA0A 2OEKA 3ZLGA 1SW3A 4INFA 3HQPA 4BZYA 4G1KA 3MPGA 1RP8A 1OCBA 2QUVA 3KVMA 3IAQA 1TWWA 1T5AA 1VBRA 3E6EA 4RJEA 1EKOA 4LEQA 1EP2A 3N6JA 1H51A 3CM4A 1HG3A 3SAZA 4DJFD 1LDCA 3MUAA 3GIPA 1UP3A 1VJSA 1HFBA 4FALA 3SIMA 2PDNA 1GCYA 1IR2A 4O0ZA 3HTWA 1JCTA 1J12A 2WSPA 1IIHA 1SJDA 4P7NA 1S38A 4DWSD 1PDZA 1BXNA 1QI5A 1VQTA 2YCLA 5D9OA 2YLLA 2HV5A 4LS0A 2P88A 3EA1A 2R14A 2Q3RA 3CHCA 2POTA 4JTTA 3KVLA 3GXNA 4LTSA 4Q32A 1E9LA 3TEVA 1TUXA 4HIBA 1Q4WA 3H12A 1VBHA 1Y7VA 2YYUA 1TV4A 5EU9A 1XIEA 4Q33A 4WX2A 1NDWA 3RM4A 1EJXC 2PGFA 3KLKA 4NY2A 4ERAA 5HWMA 2PI6A 4JIRA 1GJPA 5D2VA 4NL1A 1SUXA 1P1XA 1KW1A 3BCJA 3VU2A 4NIRA 4GCXA 2ZA3A 2OKTA 1R3RA 2KX9A 2Z1KA 1I6NA 1TJ2A 1LROA 3UU0A 3MHUA 2Q8LA 3MI3A 1WA3A 3C5QA 3B8DA 1TX0A 2E3ZA 4DWSB 2CESA 2X41A 3GVVA 4S2CA 1H60A 1VBGA 1V93A 2OWWA 4KRUA 2WNQA 5DCBA 2WKGA 3OVQA 2G4FA 2J13A 4IFRA 3NA8A 1F4AA 1RCXB 3MUY1 4XG1A 2Z2AA 3K30A 4IMGA 7TIMA 1CB2A 3ZO9A 3RM8A 4JTSA 4HNOA 1UC4A 4XZ9A 2VFDA 1EC8A 1EDQA 4EOUA 1FWRA 1NWUA 1QK2A 2QAFA 1KM0A 5G2HA 3L21A 1K7XA 1RV8A 4JKLA 1I1WA 2VENA 2FDSA 2BXYA 2WW5A 2V5LA 4I9AA 1P1MA 1BWLA 1PXGA 3JW7A 1EBHA 4XZIA 5BWFA 4OGZA 4G1NA 5H1WA 2Q02A 4FX8A 1PEZA 1A4MA 4HZ7A 4IQDA 4PB5A 1GPFA 3W7CA 1ONXA 4NU7A 5IBXA 3L0NA 2PP0A 2V82A 3LMYA 2UY3A 4D8LA 4FMVA 1Q6RA 2FVKA 3DGBA 2E6YA 3IVSA 4ZFMA 3RR1A 2D73A 4H8UA 1J79A 3GU1A 3AS0A 1HKJA 2WMGA 3N34A 5DN1A 1OVDA 2VVNA 1I8JA 1L6YA 3TSBA 4CNNA 1J9YA 1ICQA 3RLGA 1BXCA 3KS5A 3TYCA 2VFIA 1Q65A 5BXPA 3VNLA 4F79A 3TTEA 3LHVA 3HG2A 3DFHA 1OADA 4M80A 5FESA 1KXVA 2XFRA 3SI9A 1AD1A 1DWGM 3OHIA 1TG7A 1GOXA 1BF6A 4WSKA 2OWXA 3W88A 1UC5A 4UB9A 1RD5A 1XM3A 3W29A 3WENA 1AW2A 1XLJA 8XIMA 4JFSA 1LYXA 3EXTA 4IMFA 2PDXA 3QBUA 3LI0A 3FN9A 8TIMA 1W3JA 2FTYA 3HGRA 1E5JA 3EMCA 1PO9A 2Y8UA 4Q8QA 3KBSA 4DJEC 1A80A 1PDYA 1ZGDA 3F4DA 2J77A 2B7PA 5FF0A 2BASA 2WM1A 4DB7A 2W63A 5EFDA 4B90A 1XLKA 2X1RA 2Y7FA 3URBA 2Y7GA 4PUNA 1ISXA 4UR9A 4PRTA 1OJXA 2NQ9A 3R58A 4FNUA 2VJXA 1KV8A 3HU7A 1EC7A 4WLCA 3EKGA 3IEBA 1LBMA 2OYLA 4K37A 3EWBX 2JF6A 3T2QA 1Q6GA 3Q4DA 2D23A 2Y62A 5I03A 4GABA 1QOXA 1BF2A 4HD5A 5JUVA 3O06A 1GVOA 4HU4A 2IXUA 4F2TA 3VNZA 5DCDA 1W1PA 1FDJA 4MLJA 1V3JA 2VCAA 4BR1A 4H00A 3DYMA 2EPMX 5C2GA 1MQQA 2YDSA 1C8VA 3DXIA 1RUSA 1ZSXA 2CLEA 3PJTA 3HOJA 2Q6ZA 3H53A 1A47A 5AHMA 3KBJA 1G7VA 4W8LA 2I9UA 3CZGA 3GNRA 3R13A 4PH6A 3PF3A 5LYRA 3UD6A 3VOFA 1UP2A 3CUGA 4J5NA 3CYJA 3HMJG 2H8ZA 4D6GA 3AIVA 4LV4A 3VE7A 2IUZA 1IT0A 5J5DA 4JIQA 3KLLA 4PMDA 3TJXA 4GGHA 3G6LA 4LVBA 3WMSA 4B5VA 3R8HA 4DEFA 1TIMA 3CHDA 4JHMA 8A3HA 3AUJA 1A0EA 1JZ2A 4F2UA 5IOBA 2GSHA 4LUSB 2NX1A 3H55A 1UUQA 4ZOCA 3NM1A 2DVXA 5K2ZA 3C61A 4PTMA 2C19A 4F0SA 2QMKA 4AD1A 3PS7A 3PPCA 3LTYA 2XINA 3N3TA 1G01A 2PB1A 2VMFA 1XWYA 4TVUA 5G4EA 3C3NA 5C5YA 5HMFA 3CMGA 2WB5A 3PTDA 4F40A 5ABHA 3TW7A 4JNMA 3VNJA 2YW4A 1W5PA 3RM9A 3T81A 2OYMA 4FNTA 5M17A 1S1PA 2G3IA 3N2XA 4GI8A 4DUXA 5FF7A 3GM8A 2PTZA 3ATYA 1U5VA 2X7WA 4GFIA 4WJEA 4YYCA 3WF0A 3PZUA 2FHCA 2R8WA 4PUKA 4WY0B 1TE6A 3VDBA 3GIYA 5EBUA 5BCAA 4FNQA 3L5LA 4DZ5A 4QISA 2DT3A 3PVFA 4IGSA 1JPMA 4OQVA 1QPNA 5AZ1A 3MCMA 3AIBA 1DJQA 3TKFA 4LSBA 7PTDA 3LNMA 3RO8A 3AWNA 5D30A 3FHAA 1TVNA 2H9AB 1UWRA 2AQVA 3TN4A 4U4MA 5T8GA 1MUWA 4JY8A 2VYOA 2Z1BA 2WANA 1W56A 2X1IA 5IM51 4FXRA 2PDIA 3PP7A 3UR5A 5CEWA 5BU6A 1DJHA 2OQLA 1B2YA 2QCHA 3CHEA 1RSCA 2GWGA 3VA8A 2RDTA 2BY2A 1WNOA 3E2QA 3OQ8A 3THCA 3KHJA 1YLVA 3S4TA 1F3WA 4KW2A 2IKJA 4MYXA 1Z48A 1D2KA 2YW3A 4HYVA 4AD3A 4E8DA 3LA4A 3IIOA 2PU1A 1E4IA 4ZO6A 4PMRA 4GBUA 1E0XA 2DSKA 1MMFA 4IPNB 4E4PA 1HGYA 2PGEA 1R7OA 3P14A 2QCEA 4CU7A 2XGBA 4W8BA 4UFKA 2OJPA 4PRRA 4ZOAA 2YCKX 4ADUA 3DC0A 3L5AA 1SSDA 3ZR6A 3LV5A 4WZHA 3QV8A 5AZ0A 1OF6A 3DDMA 5HNTA 3WLHA 3VIFA 1EO7A 2Y8VA 4ZA0A 3UG4A 1THFD 4CNPA 4XQ6A 4JICA 3M5VA 4H7VA 4GACA 2C7FA 4J3ZA 3MP4A 5D09A 1XS2A 2POZA 4O14A 4KEZA 3FOKA 4PUDA 1WAUA 3GKFA 3WD4A 4ICNA 5FJOA 4LY8A 1ZAHA 1DXFA 4GQ0A 4CVUA 4L9ZA 4HJWA 3VKJA 2OVLA 2DSUA 4YHEA 1SO5A 5DQPA 4CKQA 4R9XA 2CWNA 3S0CA 3GH5A 3FEQA 5C9WA 1HL9A 3MCNA 4ZE4A 2G3FA 4NXSA 1OYBA 4L6HA 2BV9A 1OZMA 1XYCA 2PWFA 2ZFAA 3VD9A 1CECA 1MXGA 3Q67A 4H41A 3HPXA 2VO5A 1M01A 5DMLA 2PDFA 5HNNA 4HK6A 3ARPA 4K6AA 3RG6A 4G2DA 1R3YA 3FHQA 1DQWA 2VEFA 4I6VA 3C3UA 3QC0A 4FF5A 4A22A 3OLGA 5K4XA 3LSBA 4KCTA 3EDEA 1JAEA 3W7PA 3DFTA 4ATWA 3VOJA 4J40A 2I14A 4OECA 1FWHC 2GJPA 3CT7A 2BSLA 1NQ6A 1TR9A 3UPWA 2O92A 1GKQA 3AXMA 5I09A 1ITUA 3UERA 1KD0A 1W17A 1J0ZA 1EYEA 5FOOA 4OU1A 1SQ7A 4AVOA 3DZ1A 1TZ7A 3ARUA 2XG9A 3KEHA 4OJYA 4ML9A 4JFVA 4KRZA 5F2GA 4GO8A 4ZO9A 1XF0A 5FL1A 3WNLA 1F8MA 1XYAA 5D02A 5A8NA 5CZ0A 4JQ1A 4HN4A 1LWIA 3CT2A 1EYWA 1GKRA 1XLFA 4GNKB 1UR2A 4JOMA 4PMQA 4HGXA 1YDOA 2V5KA 1BRLA 3U5YA 4YU1A 1YADA 4R7JA 2BX7A 3AISA 3UWUA 2WSQA 1O5KA 2D20A 1KBJA 1QUMA 4IQEA 3WJXA 4PRWA 2JFEX 1UQYA 3MKVA 4L9YA 1NP0A 4Y8FA 1AW5A 2JEPA 3NZ1A 2BY1A 1ZALA 2BOGX 1PSCA 4IGHA 2GDVA 4YCPA 5KETA 3GW0A 4EF9A 4MZ1A 3PY2A 5HWJA 4LBRA 5BW6A 2E6AA 4HCHA 1K4HA 1JPIA 3S47A 3FDGA 2O55A 3EA2A 4JYFA 3S5SA 3B40A 4HOWA 3UVIA 3WL1A 4HPXA 1UPPA 4F0KA 4JPGA 1IEQA 4KETA 3MVTA 2MUCA 1EWDA 1DP0A 4TV5A 4Z1BA 1E6SM 3S1GA 5A69A 4JQ4A 3KE0A 3T9PA 3WLOA 1XLAA 2JKPA 5FEWA 4IIEA 3G3MA 2P76A 2YPIA 3UGRA 1FXPA 4UR8A 1LUCB 5U4NA 3I3DA 1LJYA 1K9DA 4JD4A 2AQWA 3N19B 1S5WA 2ZZ3A 2E5DA 5HK4A 3SCVA 4K3ZA 2BLEA 3N13A 1J0JA 4B9YA 1C92A 1FWNA 5REQA 4O19A 3SCPA 3LHYA 3P81A 4PUWA 4L6DA 1VPQA 2PWHA 2DUZA 2DZWA 3ITVA 4AB4A 1FY6A 2WZHA 4QX4A 1WDDA 2Z2UA 4ACZB 3LNPA 3CTTA 5REQB 2ZX9A 3NR0A 2ODOA 1WZKA 1JZ6A 5JBEA 3CTLA 4DM2A 5AC5A 2PGWA 1FUYA 3W0KA 4JDYA 3G1XA 4A8NA 1MWOA 2QW5A 1QAPA 3NCOA 3F2DA 1XH2A 5LGXA 3V36A 4A8RA 2XIQA 2X09A 3MYOA 1NU5A 2VXNA 4O15A 1CGTA 3BLLA 2ALDA 3AXXA 3GQYA 4JN8A 4LS1A 3WBWA 1XV8A 3M0HA 1W1ZA 4XBSA 1XIBA 2YDQA 1EHNA 2Y7DA 1Z32X 3UCQA 3U9IA 4XAGA 4EXQA 1UIOA 1J10A 3RU8X 3L23A 3LLFA 1Y5XA 5LA1A 5FJRA 1LRTA 5C9ZA 1TV8A 3PUDA 4PSPA 2PPGA 4LAZA 2CLMA 1UCWA 5M5DA 4U28A 4JKMA 1G6CA 3ARXA 1IEVA 5I5RA 4TO8A 3GVRA 1XYFA 1DIDA 3UT0A 3VD4A 3DI0A 4AHPA 1R8LA 1B3XA 2V9DA 3S1XA 2DW6A 3WLIA 4CQDA 3P67A 4HBKA 4CCZA 4IIHA 2C15A 1G4TA 1VLWA 3CIWA 4NG3A 3MP5A 5CZSA 4ZGYA 3FAXA 1POKA 3VM7A 3R5EA 1B0IA 1BWKA 1JI1A 2V3DA 2VL4A 3N9SA 2J7FA 3AMGA 2PE4A 2W27A 4C65A 1T7LA 3WX7A 1NOUA 3WMCA 3I3EA 3WN6A 3DGRA 3RN6A 1JCMP 3HZ3A 1MW1A 4MWAA 1S1RA 2GJNA 2QVHA 2RFGA 2NVCA 5K9XA 3CWHA 5AKQA 3GUGA 1OFBA 1XIFA 3KVJA 3W7QA 4O12A 2F7FA 3DFNA 1EDGA 1QXLA 1TVPA 3GTFA 2CBIA 2CKSA 4QJ4B 2F8QA 1PKMA 4NXKA 5FCZA 1V7AA 5LNWA 9XIMA 3NZRA 1YXCA 3TFCA 3D0CA 4JTIA 4FXSA 5KZ6A 2Z27A 2GZXA 3BOXA 1TPEA 3QHNA 4QEHA 3P61A 1AJ0A 4GH1A 3A4JA 4PBGA 4C1LA 4RKAA 1B54A 1WKEA 3PFRA 4CN6A 5HJXA 3UETA 3STEA 3ZFHA 3P2VA 1DJGA 3KP0A 4QFUA 1ALDA 5F4WA 3N3MA 2VKZG 3DG7A 5RUBA 1SW7A 1V6VA 3CUFA 2G0WA 5E6YA 1S5VA 4DF0A 1O94A 3KBMA 2WLYA 4MJMA 2J47A 4IJRA 4H6QA 4H3DA 3LOTA 1CWYA 3CL8A 3RRXA 3FK4A 1SR9A 2GSJA 1PKNA 4LF2A 1M9HA 4LB3A 3VDAA 5GNYA 3NWRA 4TXEA 4O1BA 7REQA 1AJ2A 1GQKA 2OKOA 1PZ3A 4BA0A 1MDLA 3JR2A 3AROA 2ZUVA 3PZMA 4HPGA 4HP5A 3ICJA 3HV8A 1U33A 5ABTA 1XKYA 1L8NA 3S5ZA 3W1MA 2D2GA 1Q6LA 2Y63A 1OM0A 1P6BA 2G50A 1SJAA 2A1YA 4GMEA 1Q66A 2FKPA 3BVJA 4U3AA 2VQUA 2QYGA 3ZLHA 1AJZA 4JTHA 5DMMA 4PMOA 3N2TA 2P5NA 3VVGA 2WZIA 3GFZA 4LPCA 5AY7A 4K68A 1OFPA 3M0JA 4C6CA 3HPSA 4FNSA 1W8SA 4N9EA 3QGKC 3AZRA 3C86A 1EP1A 4HNUA 2QJIA 3UESA 2PS2A 2J25A 1KFEA 1P0BA 1XH0A 1IZCA 5BXRA 4AWEA 3CUHA 2EJ1A 2C0AA 3CHFA 3WDQA 1RH9A 3L4VA 2VI0A 3G1AA 1GQNA 4A05A 1PJ9A 1F3TA 2CEQA 4REQA 4F0RA 3Q45A 3GHRA 1V6UA 1K70A 5D8WA 3G1HA 1PCWA 3B05A 3AYSA 4BS0A 1VFFA 2NXHA 3MHGA 4J9JA 1NVMA 1R7AA 1W5NA 4FLOA 3T4WA 4W7UA 3WQWA 1FOBA 1LL6A 1KBKA 2J79A 2PURA 3C8FA 3VIJA 4NUWA 3VIHA 1XXXA 3DOPA 1TV7A 4H6RA 2V0TA 4N02A 3RFAA 4OUIA 4M1RA 2O4MA 3W81A 1QHPA 4KBXA 4AQLA 3NQBA 4DZHA 3UVAA 1UD3A 1LQ2A 3TXVA 2H9AA 4JTDA 2YSWA 4I7UA 1RR2A 4BI7A 2OX1A 4LAUA 3SN1A 2WMKA 1B3WA 5EBAA 4H01A 1AQFA 2ZCGA 4IP5A 2DPEA 4US5A 1FHUA 2L5HA 3K8LA 1KTCA 3EDFA 1KM2A 4UTLA 4GISA 4AD0A 1V3LA 3OODA 3RGTA 3O16A 1JXKA 5LIUX 4O8RA 1MRAA 1US0A 1H50A 4B3ZA 2GVEA 2OU4A 2ZX6A 2PLCA 3WQEA 4L4MA 3PWAA 4MAZA 3DCPA 6ENLA 5IRPA 3LG3A 4O1DA 1FBAA 4RNJA 5LNUA 1PV8A 4NZJA 1ICPA 3PBMA 1J6OA 2PF8A 3AOFA 3N2OA 5EMLA 2P0OA 4JL1A 2YFOA 2BFGA 1QI2A 2YCIX 1GNXA 1IF2A 1NDZA 3LSCA 3FW6A 4OTKA 1O60A 4F4RA 5C9UA 2GQ3A 3PJXA 5A3HA 4WY0A 1JZ4A 3WK1A 4E38A 4Y9NA 2CHNA 3V0SA 4H04A 2B4GA 2WHJA 3ZZ1A 4EAMA 2E8ZA 2DV0A 3W23A 3HF3A 4J2PA 1M03A 5A8MA 1F4HA 3THQA 3SECA 4QS5A 1KM1A 3WNOA 3PBVA 3R43A 4MY1A 3IJ6A 3L4XA 4MIMA 2VTFA 3DBPA 2XIBA 1L2QA 4MY9A 3S1WA 1RBLA 5C7HA 1OY0A 4X9SA 4YN5A 3TIMA 1EEXA 5D2TA 2NUYA 4LB4A 1UBPC 3VGGA 2FZBA 3TV8A 4QG8A 3WQPA 3LPFA 1R9ZA 2ZRVA 5LNVA 3EWWA 5D04C 3ABSA 2GLKA 3OBKA 4LYQA 3W7OA 3VOIA 4IT1A 3W7NA 4Y6GA 4LCQA 5CC6A 3BANA 4DYEA 3ARWA 3WF4A 3VGFA 4EKJA 4EVZA 4TU1A 4PFMA 1MQPA 3SGZA 4UCGA 2J24A 3WEZA 4DELA 1PYFA 5CPNA 1GOQA 2EEXA 1R47A 2OXNA 2FGLA 3OO2A 3P82A 2E5CA 4N6FA 1XQLA 4D6JA 4KPLA 2GGIA 1JF6A 3DUGA 2O9TA 2FHFA 3CZEA 4XAFA 4D6DA 1EUAA 3PPFA 4EPBC 1SGJA 2IKGA 2G96A 4NNAA 3EB2A 2AKMA 2W92A 4GUHA 4UCFA 4LCRA 3NVTA 1WDSA 3UNDA 1F5ZA 2J78A 4MFDA 3N73A 3NQ8A 3AIWA 1Q45A 1DOSA 5I07A 3MANA 4Q4KA 1RVGA 4Y7EA 2DSVA 2WHKA 3B9AA 2GQAA 3UZ5A 5JU6A 4MB5A 4XZBA 1DIEA 2WLZA 5IFTA 2NQZA 3O0KA 2QGYA 4TOQA 5DCEA 2IQDA 1W32A 3R12A 3S6TA 1US2A 4WCJA 3L2LA 3SB0A 3TTOA 4EPKA 4DUVA 3TTYA 2TYSA 4F0LA 5KSWA 1KFJA 1OD0A 2X2GA 4IJCA 2WZMA 4XIMA 4S1FA 3BV4A 2AAMA 2FPVA 4HZMA 3DFQA 1TPWA 1V0MA 3C2EA 2HS6A 4IG2A 2UWFA 4AC7C 1XYZA 1HJWA 1NFPA 1QPOA 4Q8NA 1Z89A 2G3NA 3N11A 3FVDA 4JTQA 1VCVA 2BDQA 2YB1A 3CJPA 1LG2A 2OMAA 3UEQA 2TAAA 4L4OA 2J8FA 1YBQB 1NQKA 4PUEA 2PDHA 1ODZA 2EF9A 1MZRA 3QZEA 3K4WA 4HPNA 1KM4A 1F2JA 1YEYA 1I1XA 3WQVA 4WD0A 5E0CA 5MKGA 2XU2A 3IACA 3W00A 1SW0A 4HOXA 2CZVA 4MZ8A 2ZE0A 4BWLA 3U3HA 2DJLA 3W1PA 5I00A 5E09A 2I9EA 1JD9A 3IIPA 1XLEA 1ML1A 2VEMA 4GUIA 2VX7A 4UZSA 5I3HA 4A8LA 2TODA 4O0KA 1KQZA 3G18A 3BGGA 5FA5A 4HNTA 3TWBA 4H9TA 5A6BA 3WMLA 3JRKA 2GDUA 3DKJA 1NM9A 5E70A 3BSGA 4N6EA 3DFYA 4GQRA 2CCRA 4MWAD 1QNOA 1V79A 3PM6A 2PFHA 3VUSA 3A3WA 3NL6A 1VFUA 3F5KA 4PBEA 2BODX 1JGMA 4RXGA 4CQBA 3SCSA 4I9JA 3ARRA 4JIHA 4IQJA 3RJYA 2PC4A 3N9KA 1L2UA 4XBJA 3ZOAA 3WLKX 4HA1A 4PUMA 4OV9A 3PNZA 1KCKA 3GVWA 3NPUA 4GYPC 3BH4A 4J3UA 3CO8A 2A7RA 1JRBA 1WXYA 3REQA 2GSEA 1OHLA 3G0UA 1R30A 4UTWA 3MV11 2ZUNA 1I75A 3RITA 1K8ZA 4GD0A 2QVNA 1SZEA 4MWAB 1V8EA 4GYFA 1CGUA 1GWJA 1DBTA 3EX4A 4DAIA 4LC6A 4UC5A 3W73A 4JQAA 4H6EA 1OX6A 3BURA 5EB8A 3QHMA 1M1BA 4GIAA 1GONA 2BB0A 4QDPA 4A3QA 1S46A 2R6OA 4GJ1A 2XHYA 5IDIA 4QQUA 2MANA 1SMAA 3T55A 1VD6A 1P43A 3DN5A 1EP3A 3HJZA 5AHFA 2GGJA 3APYA 3TNBA 4H2HA 3LCLA 2Y2WA 3LCWA 3HFTA 4EWJA 1MEHA 1VIWA 3F1QA 1JUBA 2O56A 4W85A 2J7BA 1Y0EA 1M7JA 1JULA 5A2CA 1S2AA 1U1HA 3AJXA 2AL1A 4UUIA 3UWWA 3IANA 3QSRA 2JKEA 1UHVA 3BAJA 5SWUA 2ON3A 2X1TA 2PRMA 1I0BA 3NQ6A 2RDWA 3ZVHA 4HSOA 3O6CA 4G7EB 4UZUA 4QS6A 3UZWA 1B1YA 1EZWA 1MUCA 4DRSA 2J6VA 2CZEA 3WQGA 3L4ZA 4WOQA 1MNSA 4R88A 4CN4A 3W82A 1K8XA 1Q63A 1R2TA 3FGCA 4BEUA 1QW7A 4NI3A 1KWKA 4Y8EA 2E40A 1LT8A 2ZA1A 3GDMA 1LQAA 1ONRA 4O1CA 4YVPA 2UZ9A 3W7DA 4PMVA 1CB7B 2O9OA 3LI1A 1VS1A 3A3XA 1XLMA 3GFYA 5FF2A 1H2JA 1EX5A 3OVPA 4W93A 1ZL1A 2ATSA 3MVIA 3T09A 4KH2A 1XW8A 2HNHA 1XHGA 2I7GA 1A3XA 4HB7A 1GGOA 2F38A 2Z2BA 3BMVA 4GWEA 4DBSA 3MMTA 3VKAA 1ITQA 3T07A 3QW3A 3ZSTA 3QOKA 3W7GA 1T6MA 5DBUA 1YTKA 4CU6A 1W0MA 3ABZA 5H2ZA 4F9JA 5BOFA 3WQFA 1GOWA 2CHOA 4B2DA 3CB3A 2Y6ZA 3PJWA 1Q6OA 2HXTA 2Y88A 1K3UA 3HPAA 3HGJA 1LCOA 1RQBA 3SN4A 1TTPA 3NZGA 4KESA 4Q8PA 1JFXA 2VGFA 2WQPA 3FXGA 3CH0A 4QSHA 5AVHA 2P8BA 3AIRA 3KWXA 4DQWA 4HNNA 4OBSA 3C2FA 2ZTKA 2JKAA 5H8MA 1EIXA 4PEEA 1RJPA 1VJZA 1WOAA 3GW3A 3D3FA 3KBNA 3TONA 5FSDC 1B9BA 3I6RA 4M5PA 2IQTA 3MSDA 3A6OA 3LN3A 4P8XA 2V3GA 4QAWA 4ZENA 4PE8A 4B91A 4PZVA 3V0TA 3NDOA 2DSWA 1KFLA 4JR5A 3P0WA 3QR0A 4HMEA 4WOZA 3L4YA 2BHUA 1NFGA 3IJLA 4RLIA 3WJZA 3RX4A 5D33A 2VX6A 3WD0A 4XBKA 2ZADA 1R2RA 1WE5A 4FNPA 4NRSA 1WZMA 5BNKA 3SQLA 1DQUA 1EO5A 4JCLA 5A8GA 1B57A 1LF1A 4LVGA 4CNOA 3FA4A 4L4PA 5B7YA 2X1SA 3TH6A 3M0VA 1GHRA 1N82A 3U2CA 3LCXA 3NURA 2E28A 1BG9A 1U5JA 4S3EA 1EFZA 1IEWA 3QW4B 1WDQA 1QRQA 3H4WA 1V77A 5I3FA 4IFKA 3SUTA 3DFSA 1G1YA 3W2UA 4J3XA 1QR7A 1F8IA 3KWSA 4X60A 2RJHA 1OIMA 3OQEA 5HR7A 3VIPA 2BY3A 2QUUA 3ARZA 1WUFA 3N2CA 3H2MA 4Z1AA 4IIDA 4YIWA 3WNKA 4AD5A 2QMJA 1WDWA 2DVUA 3ZM8A 3WH8A 2ZYFA 3VE9A 4YJ5A 1Q6DA 2QAPA 1CGXA 2WSYA 4RZBA 1HJXA 2J7DA 4X2RA 1CXLA 5GVJA 2HROA 1ISVA 4S39A 1WDPA 1EOKA 1G5AA 1Z69A 5CLWA 3N17A 3GR4A 4REQB 3AUOA 3WDJA 3S42A 2PRLA 3BG9A 3I65A 4YLWA 1UWAA 5DMNA 5G1TA 2I57A 5AYYA 3MTWA 1DIOA 3TTSA 3UP8A 4QGCA 4GX8A 3ZVHB 3H54A 1ITCA 4HA0A 3EWDA 1VYSX 4FZIA 3STCA 1Y8BA 3EB4A 4PEKA 1EJVC 1FWJC 1I2QA 1L8PA 3EOSA 4AZBA 2ZC1A 1GOOA 2QIIA 3CWNA 1C8YA 7CGTA 3URAA 5I3KA 2Z4GA 3G24A 4BI5A 2E8YA 1W1A1 3DC8A 2JQXA 3MMWA 1P7TA 4FS9A 1G4PA 2IMRA 3R1ZA 1UUOA 1JRCA 3GVGA 4MB1A 5FF4A 1C7TA 4WK9A 4DBWA 4CU8A 2FZ9A 3QY7A 4ZB2A 3WNNA 2VC7A 3BGAA 3DHUA 3MB9A 2Q8ZA 4PMYA 3P8JA 3GLCA 4Z42C 2HE5A 2ZZ2A 2VEKA 1UB3A 1I2OA 4QSFA 3LBOA 4AZGA 4ASTA 1OK4A 2GOUA 4NAEB 1NF0A 4E5TA 2PF0A 1ZUAX 5FJUA 4ALDA 4C1NA 1TA3A 4QDWA 4DPPA 3KCLA 3RO6A 3NPWA 2HVNA 3V18A 3TAKA 2VZUA 3MMUA 3UXLA 1OGGA 3R8RA 1J5TA 2FIQA 3WEMA 1AQMA 2VGBA 4ATDA 2A2IA 1X6LA 1V3KA 3GC2A 5GJPA 2XGZA 2OZ8A 1GTHA 1KGWA 4JTAA 3P60A 2DH3A 3WQCA 1KCXA 4JIEA 1V3MA 1XSIA 3AO0A 1XDLA 3RLVA 3F2BA 1RXOB 1DJYA 5FF3A 2G41A 4AZ6A 3H8AA 2GGHA 1ZAIA