3M33A

The crystal structure of a functionally unknown protein from deinococcus radiodurans r1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
RESYDRLARELGGYRHPWARVLSGPDPELTFDLWLSRLLTPQTRVLEAGCGHGPDAARFGPQAARWAAYDFSPELLKLARANAPHADVYEWNGKGELPAGLGAPFGLIVSRRGPTSVILRLPELAAPDAHFLYVGPRLNVPEVPERLAAVGWDIVAEDHVSVLAHAPTWEDWQMRGEFMGKLARRADWDAEATVRGMPYREERHLVLARQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The crystal structure of a functionally unknown protein from Deinococcus radiodurans R1
rcsb
source organism Deinococcus radiodurans
molecule tags Structural genomics, unknown function
total genus 59
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m33A00
3FUVA 2VDVE 3NMUF 3K6RA 3PX2A 4Y2HA 5EHIA 3M4XA 4RVHA 3ELDA 1OR8A 3G89A 4Y30A 2BM9A 4EKGA 5F2KA 5JR3A 1I1NA 2OYRA 5K0JA 5ICEA 2FYTA 3FPHA 3KR0A 5E2AA 3MTIA 3DULA 3NJRA 5EKXA 1XCLA 2ZIFA 5DX8A 1L3IA 1ORIA 4WXHA 3TM5A 3GDHA 1B42A 4PGHA 1JTFA 1ZG3A 5HIMA 1MJFA 2UYCA 4ISCA 5EGSA 1BOOA 4R8RA 5DX1A 3TPZA 2AOWA 2B9EA 2YR0A 3T0IA 2P41A 2OPBA 1JG4A 3BWCA 3T7RA 2YXEA 5DPMA 4ATNA 5LSAA 4RTMA 4PYIA 3D2LA 5EKUA 4ER0A 2NXCA 3HCCA 4YUWA 2A14A 1Z3CA 1ZQ9A 5JUWA 1Q0TA 4DCGA 3HCBA 3P9NA 2Y1XA 4P7JA 4DZRA 5DM1A 2ZFUA 3GCZA 3IEIA 2NXJA 2O07A 4KDCA 4ER6A 1SQFA 2P8JA 3MGGA 1L3CA 4CKBA 3E23A 1YZ3A 4K6MA 1FJXA 3GIWA 3R6TA 5FWAA 2AN4A 2BM8A 1NW7A 3M6UA 1KIAA 2AVDA 3LKDA 1RI2A 2XYVA 3KQWA 3LECA 3UJCA 2ZTHA 3UWPA 1WG8A 5C0OE 2EJTA 4CTKA 2HTEA 5F2NA 5K05A 2ORED 3FUXA 3EVCA 3P71T 2DULA 3JWJA 4FSXA 1FBNA 2IDJA 3CVOA 5E9QA 5GOZA 3TR6A 4F86A 3BWYA 1NT2A 3HCFA 2Y1WA 1VIDA 1VP3A 2NP6A 3HCAA 5BW5A 4IV0A 4E2ZA 2PGXA 3P9CA 4U7TB 4R6WA 4BLVA 1SQGA 4X61A 3P9KA 5LQRA 1WXXA 3BGVA 5LQJA 2PX8A 1IXKA 4BLUA 5CCBA 3UJ6A 4RTOA 2VP3A 3B89A 2FCAA 4ER7A 1I9GA 3UA4A 5KQRA 1G60A 4NECA 3DH0A 5EZQA 4B17A 3TM4A 2O0LA 4C08A 4GF5A 1VLMA 4YV2A 2PXAA 5HZMA 4KIGA 1R00A 5GM2A 3DUWA 3G2OA 2UZ4A 4RWZA 2G1PA 3P9IA 1VQ1A 4PIPA 3B5IA 4QQKA 3KKZA 1EIZA 5DWQA 5T64A 3UJDA 4ER5A 1P1CA 2ZULA 3ME5A 3EVFA 2B2CA 3MCTA 3O7WA 4X63A 5IKMA 5CIYA 2JHCA 4HRAA 2LD4A 5E8JA 4PYJA 2ZIEA 3PT9A 1XDUA 2OO3A 1YFLA 2ONYA 2OY0A 5CVDA 5EIFA 5K0BA 5HILA 3OCJA 3THRA 1NBIA 3H2BA 2JHPA 2ZVJA 1D2GA 2AN3A 3BWBA 3G88A 3IV6A 2DPMA 2CWWA 2PXXA 1G55A 3OU7A 4OBWA 3OFJA 4WVLA 2GAFA 5K0EA 2FK7A 2ZZNA 2HV9A 4R6XA 2FK8A 2WK1A 2FPOA 4RTSA 3CCFA 5E1DA 2IH2A 1I4WA 4XUCA 1P91A 3JWHA 3EVBA 3MHTA 3LCVB 2NP7A 2PWYA 2VDWA 3LSTA 1HMYA 4PYLA 5KQSA 2OXTA 1WZNA 5EG5A 3LHDA 5BW4A 2OB1A 2IBTA 4M36A 4QTTB 1O9HA 4EKIA 5FA8A 1WY7A 2EFJA 4RYLA 5KYGA 1AQJA 4C06A 5DRYA 2ZIGA 2V7EA 1JQDA 3KQSA 4E2YA 3LDGA 3ERCA 2PSSA 4MHTA 2B3TA 3G8BA 4IWNA 4E33A 2JH9A 2CMHA 5EOVA 1TPYA 3AXTA 5E9JA 3NVMB 4HGZA 2BR5A 3QOXA 4CKEA 4FT4A 3RODA 2ZBQA 2JH8A 4GOOD 4YUZA 1G8SA 2N47A 3TFWA 4LWOA 4V0QA 2VDUE 5HFJA 3X0DA 4M7RA 2C7PA 4QQNA 4QDJA 1JSZA 3KR9A 1YFJA 3E05A 1M6EX 3E7PA 1XVAA 3JWIA 4P7FA 5E1MA 3U81A 2E5WA 3A26A 4RTPA 1JTEA 3ELWA 5ICGA 1KPIA 3GU3A 3C3YA 5DSTA 2HNKA 5EEHA 2O05A 2QRVA 3G2MA 4DM3A 3A7EA 5ICCA 3EGIA 3ANXA 3P2KA 4OQEA 1R74A 2P3QA 3B7PA 2XBMA 3DMFA 4EK9A 4HGYA 1XXLA 4DKJA 3M33A 1R6AA 2P3OA 3REOA 2IPXA 4E31A 4AZTA 1DL5A 3F4KA 4QPNA 1Y8CA 1INLA 2Q41A 4RVFA 2OZVA 3FRIA 1F3LA 3B3JA 3LGAA 3P2EA 2NXEA 4OA5A 3GRRA 5BXYA 3C6MA 5K0GA 2ESRA 2P7HA 4BLWA 1MHTA 1ZKDA 3EPPA 3TOSA 2H00A 5C1IA 2ZWAA 3BGDA 3Q7EA 2B78A 2HWKA 2AOXA 4PNEA 1TW2A 5K0LA 4GQBA 5M5BA 3FUWA 2GPYA 4YMGA 1NV9A 4POOA 1ZGJA 2PJDA 2C7RA 4R05A 4L7VA 4RTLA 2PX4A 4RTJA 5ERGB 3RIEA 3HVIA 2P7IA 5DSXA 3HEMA 3BT7A 3GRZA 4PINA 4BP1A 2GA9A 3EEOA 3CJTA 1U2ZA 2WA1A 4DA4A 1NW8A 4LECA 3GJYA 5FWDA 5C9ZA 2HMYB 3AWIA 7MHTA 2AN5A 3DLIA 2YVLA 1P39A 3HTXA 4ZTBA 2AOTB 3G5LA 2EG5A 1R18A 3BKXA 3ELUA 4QVGA 5E2BA 4CXMA 1L1EA 1IM8A 5EC8A 3C6KA 2ZSUA 1KR5A 2BZGA 2AVNA 3KPWA 3TQSA 5DTQA 3WSTA 1VBFA 1BKYA 4PYOA 5EHGA 2G70A 2OB2A 2K4MA 2P35A 3KPYA 5E9WA 2O57A 3BWMA 1IY9A 4OA8A 2G71A 4X41A 4GBED 1BHJA 2XYRA 3DMGA 3HVJA 2YTZA 2FRXA 3O31A 4PGGA 4X60A 4LWPA 3DTNA 5DXJA 5FCDA 4E70A 5K09A 4PCAA 3HCEA 3HVKA 4AX8A 4E2WA 5CVUA 2IIPA 1VE3A 3KPVA 3G5TA 5P8WA 3NWEA 4F85A 5GINE 2PKWA 2PWPA 4FS8A 3HM2A 1VPTA 2YUIA 5FHRA 1X1CA 3CJQA 5HOQA 4V0RA 5K01A 5EMJA 3FPEA 9MHTA 5H02A 3G7UA 1JG3A 3BZBA 3OU6A 2P40A 3UJ9A 2PV0A 1XDSA 1SUSA 3UA3A 3I5UA 4PONA 3VSEA 3TKAA 4DMGA 3NW9A 4PWYA 5CUQA 5HIIA 4P58A 5DX0A 5E1OA 2PT6A 5HIKA 2JHAA 3A27A 3DMHA 3DXYA 2ZZKA 1N2XA 2I9KA 3EVEA 3HA5A 3ID6C 1RI4A 3B3GA 1VL5A 3SSOA 2ZWVA 2IH4A 3A25A 3GXOA 4FGZA 3AXSA 4C07A 2PLWA 1JQ3A 3KQYA 1L9KA 3V8VA 1NW6A 3HA7A 2YXDA 4PYQA 4HG2A 1X1AA 3DOUA 3IYLW 2KW5A 3FPFA 3I64A 2C7QA 3TMAA 2BR4A 3P97A 1EQAA 3TLJA 4CTJA 3FTFA 5CCXA 2PX5A 5DTRA 3PX3A 5FHQA 4XCXA 4HC4A 4YUVA 1KHHA 1YB2A 3CKKA 3OZSA 3SX0A 4A6EA 2AOVA 8MHTA 5FTWA 3UJAA 2R6ZA 5CVEA 5EMKA 2QYOA 3R0QA 3UBTA 4KDRA 1JQEA 1AV6A 2P3LA 5DTMA 1SUIA 5EPEA 1SG9A 5DM4A 5EVJA 3UJBA 5FULA 4OQDA 2IBSA 1FP1D 5EMMA 4PYMA 5U4XA 5LQAA 3SVZA 1EJ6A 5CM2Z 2GB4A 2NNWB 3FTEA 3OU2A 3UFBA 5ICFA 3NDJA 2R3SA 5GWXA 3JWGA 3HCDA 10MHA 2YXLA 3TKYA 2YQZA 3GRYA 3MCZA 1JR4A 4QTUB 5DM2A 3BGIA 1SKMA 4AZWA 1KPGA 1AQIA 1XJ5A 1PJZA 5LR6A 2CMGA 3ER9A 4HTFB 2PX2A 4QVKA 5T67A 1L3BA 2ADMA 4H0NA 2XVMA 3OPNA 2ERCA 3ELYA 4YUXA 3EVZA 3VYWA 2GLUA 3PFGA 3NTVA 3R3HA 1NV8A 3E8SA 3KQTA 2BH2A 1QAOA 2ZW9A 2Z6AA 2O06A 1XTPA 4KW7A 5F2OA 4E30A 3KHKA 5DM0A 3AY0A 4CWAA 4MIKA 3GWZA 3LCCA 3FUTA 1G8AA 2PXCA 3CGGA 3HVHA 3GRVA 1Q0SA 1JG2A 4U7PB 1WS6A 4FP9A 3RW9A 3CBGA 4C05A 2Z6UA 3P2IA 4FZVA 2AOUB 3HNRA 4CKCA 3A4TA 3M6XA 1ZHFA 3OE5A 3FPGA 2IP2A 2UYOA 3OZTA 3T7SA 3DP7A 3VC1A 2QM3A 5FUBA 3EVGA 1P1BA 4YMHA 3TRKA 4RTNA 3PS9A 4YV0A 4MQ4A 1V39A 2AOTA 1QANA 3GO4A 3LDFA 3MTEA 5EIWA 5EQJB 5K0CA 1BC5A 2UYQA 4P7KA 4BP3A 4PYKA 5CD1A 2ZLBA 2OKCA 2H11A 1NKVA 3EGEA 3M6VA 2I6GA 4HH4A 3M6WA 3S68A 3FYCA 4EVIA 3KQQA 5LQUA 4PYNA 3T7TA 1X1BA 1NW3A 3SSNA 3OE4A 5KS2A 5GIOE 4M37A 2C7OA 4AZVA 3FUUA 4R8SA 2V74B 2CL5A 3G2PA 3BXOA 5BP7A 3PVCA 3P8ZA 3B3FA 2IGTA 3FYDA 1KYZA 3AJDA 3NDIA 2HR1A 1UIRA 5G02A 2VS1A 3FZGA 5DXAA 4AZSA 2OBFA 1KP9A 3EMDA 3DR5A 1RJDA 3I53A 4GUAA 3SSMA 5HEKA 3CJRA 3ER8A 5EMLA 3EGVA 3GNLA 4MWZA 4GOLD 3UJ7A 4BY9E 3LBFA 1RI1A 2GH1A 3DLCA 4FT2A 4GC5A 4FR0A 1JSXA 4RSRA 1X1DA 5LQNA 2EX4A 3NWBA 4GC9A 3R24A 4HSGA 4M38A 4YUYA 5FQNA 4E2XA 1AF7A 5CVVA 1NE2A 4KVZA 4RTRA 2QE6A 4Z2YA 2YX1A 5FADA 3UJ8A 1RJGA 3EEYA 5B1SA 1FP2A 3PTAA 3LKZA 4IV8A 2F8LA 1ORHA 1N7JA 1O54A 1UFKA 4P7GA 3LCUA 3FTDA 3MAGA 3EVAA 2BR3A 5GM1A 4EQZA 1DUSA 1YUBA 3V97A 5IH3A 3FRHA 4OX9Y 1EAMA 1VP9A 3OZRA 3KR2A 4MTLA 5K0FA 4RTKA 3DXXA 3GRUA 4RVGA 3NVKI 4O29A 4QDKA 4C04A 5T6BA 4C4AA 2NYUA 5DT2A 1DCTA 3BUSA 3LX6A 3THSA 2ZBRA 4LG1A 3QOWA 1XDZA 5EEGA 5LQCA 4KRGA 5EZSA 1KXZA 5D1NA 3CC8A 3ORHA 4RTQA 2XYQA 3R9XB 2PT9A 1QAQA 3KU1A 1EG2A 1EJ0A 1R8YA 3DXZA 3LPMA 1N7IA 3G8AA 4PCLA 1YZHA 5FA5A 2AR0A 1KYWA 1X19A 2XVAA 5GP1A 4YV1A 5K8VA 1RI3A 4PIMA 1T43A 2JG3A 1TW3A 4GOND 4DCMA 2ZZMA 3OFKA 4E32A 4DQ0A 3BKWA 2ZCJA 3LL7A 4RVDA 1M6YA 3FTCA 2Z6QA 5E8RA 4IKPA 3EVDA 1KPHA 3SMQA 3Q87B 4AUKA 5D1HA 3KR1A 4X1OA 4HTFA 5LQKA 2ZBPA 3EMBA 1RJEA 3L8DA 2FHPA 1NBHA 1QZZA 1WXWA 4G56A 1UWVA 3LBYA 5HIJA 3VC2A 2G8NA 2G72A 1D2HA 2QY6A 3FPJA 4RV9A 4XUDA 1F38A 4XUEA 1FPQA 2AS0A 3SM3A 3C3PA 2B25A 3SXJA 5MHTA 3KPJA 2NXNA 2VZ9A 3MQ2A 3I9FA 2P1DA 4UOEA 2PBFA 2H1RA 2IH5A 3I58A 3HP7A 4QPPA 1SVUA 3O4FA 5K03A 3SR4A 4C03A 5CVJA 3LDUA 4RX1A 4GOMD 2UYHA 1D2CA 3A7DA 2WA2A 3KQVA 2AOUA 4GEKA 1O9GA 3PFHA 1YF3A 5E1BA 1R8XA 1M0EA 1RJFA 3C0KA 3KQPA 2EJUA 5GIPE 3MERA 1PRYA 3M70A 3PB3A 1RI5A 2I62A 3SGLA 5K0NA 2I7CA 3IHTA 3K0BA 4FSDA 2IFTA 1H1DA 3HA3A 3MB5A 1G38A 2PY6A 2GS9A 4KWCA 4JXJA 5FQOA 5DRTA 2IDKA 2ONZA 3G2QA 3KQMA 4ER3A 4DF3A 3GGDA 2AZTA 4KIFA 2PVCA 3QV2A 3PLAE 1G6Q1 2CKDA 1ZGAA 4F84A 3KPUA 5KVAA 1XCJA 3UZUA 1NW5A 2JJQA 2QRVB 4A6DA 1JG1A 4OBXA 5DLYA 3KQOA 1QAMA 1HNNA 4EMSA 1QYRA
chains in the Genus database with same CATH superfamily
2Q8NA 3PFCA 4O2BF 3FDXA 3F6BX 1L5HA 1YWGO 2P4HX 1QTQA 1R6XA 5TR9A 1MC4A 2ADOA 3IDZA 1DQNA 1Y1TA 3EC2A 1Y5RA 2OAQ1 3FUCA 4INZA 1PWZA 2XSZA 3SJBA 3VR3A 4K2AA 2IQIA 1GNRA 3FPBA 2ZRNA 3N75A 2WI8A 4R7ZA 2CCKA 2V59A 4MR9B 5TPWB 1M0SA 1RBMA 2VAWA 3QVTA 4OSEA 1N77A 2BKEA 2WD7B 1TM3E 2G9UA 1A5SB 1M0TA 5HIMA 3VPSA 4MITA 4RELA 4IUBS 2X23A 2BUCA 2QJFA 5KWJA 3LIPA 4D9FA 1U99A 5HS4A 3DO6A 4RTMA 4NV3A 2DH5A 4BTLA 2FR1A 2A14A 2C9DA 1RAEA 2P1RA 3OE1A 2JRLA 2OAEA 4UD2A 1HFEL 3HDJA 1D2MA 3L41A 1J09A 2Z58A 5DE3A 4IH9A 5DM1A 4DZRA 1UOPA 2ZSAA 4RZXA 1XRRA 4IOLA 5BV0A 5HYVA 3PR2B 1KYXA 4R9SA 5HM8A 1T5SA 5KNCD 5JPCA 4ND1A 2O5EA 4R69A 4E94A 3A9TA 4FGKA 2FKNA 2ZTHA 4OSOA 4CTKA 2GEBA 1ZMBA 1DPGA 5DBHX 5F2NA 4FYIA 2IEAA 3EVNA 1FBNA 1ZD5A 3CVOA 3FDIA 4RPLA 4F3YA 3R3WA 1PKEA 1NT2A 3LV8A 4RH3A 4I4TF 4KPFC 4LOIA 2YXBA 4BX0A 2CXSA 3CX7A 2IW3A 2PGXA 1W1WA 1ZMOA 2P9ZA 3Q3HA 4U7TB 3NXKA 2AC2A 3DBOB 3ZHOA 1FFDA 3P9KA 1E7WA 4JP2A 3WDLA 1VLVA 3DV9A 3JQGA 4OI4A 5GGYA 1HBJA 3UPTA 4ER7A 3UFXA 3UA4A 2C07A 3QX9A 1U2QA 4JI1B 2EDCA 4ANFA 3DLBA 1ADGA 5JHGB 1ZCFA 3DAOA 3LMKA 4IMPA 5JMOA 2QYTA 2BFBB 2Q3LA 4BMSA 2R2AA 2YY5A 4PEVA 1H1LA 1WB9A 2AKYA 3CH7A 2J4FA 4YRAA 3B5EA 1X8LA 3VFDA 2UV8A 1W4BA 2C7VA 3IEUA 4X63A 1I7DA 2ZDQA 1FOEB 3NWJA 3NBQA 4S1PA 2A0YA 5ARCA 5AM0A 2ZUWA 5F1KA 2IH5A 3H1EA 1R1DA 3KSUA 1M5UA 1NBIA 1T3HA 2C7GA 3PNKA 5BWCA 5PNTA 3E82A 2XNDD 3EWIA 3WGJA 4CEHA 4PFQA 3ADDA 1EK6A 3L05A 4DBLC 4FFLA 1EBUA 5BXQC 5D2CA 5ALYA 5AJYA 5E1DA 2ZUTA 2IH2A 5DU2A 1X3SA 1W29A 3LCVB 4ARZB 5C5IA 4BLSA 2JLAA 3BS4A 1T5IA 4EENA 1WEKA 3OQ1A 2H2WA 3TKLA 2MDTA 5ESXA 4FYXA 2A9PA 3D4OA 1O2DA 2VYCA 1T6BY 1WY7A 3AZOA 5FA8A 3TLXA 2X7XA 2EX1A 3NFRA 4Q01A 3FPKA 1BXZA 2H57A 4UDXX 3ZKWA 3H4MA 1GTJ1 1VJDA 2R4QA 4G1VA 3RHSA 5L3QB 3NTUA 1FYVA 4MHTA 1JR6A 4ISBA 3T95A 3FTQA 5JXHA 1U04A 1TEXA 4FNMA 2VNHA 3QOXA 3RODA 5D5PA 5IS2A 5A3RA 1G8SA 1R2QA 5IWAB 2LDBA 1ZAYA 4Z54A 5AM2A 5J4YA 1YFJA 1RAGA 4MQ5A 4UEJA 4GDMA 2YIMA 3PTLA 3ON5A 4P7FA 3L1HA 4RJIA 3I73A 3OY2A 2FSVC 1F20A 2C2WA 3KE8A 4NABA 4UU7A 1U94A 1VI5A 3WADA 4CGZA 1F6BA 4AWBA 4YRMA 4YR9A 2B5OA 1JEOA 3DMYA 4QOGA 4EL5A 2PQMA 2RGNA 3I1IA 1CK4A 3FGPA 1YTUA 5CNJA 1JLHA 1UWCA 1ELOA 4CKWA 2G5CA 4TLDA 1TZCA 3KJGA 1Y4DE 1HT1E 3NKVA 4C78A 1XZNA 1GG9A 2OECA 1L4FA 1C9DB 1GQSA 2SECE 1GY8A 3CVJA 2ZB7A 2G7ZA 1PYDA 3IEVA 5SICE 1VLQA 4LZPA 2QLBA 1D2NA 2C5HA 1SHKA 3VGPA 2AOXA 1L7VC 1YDWA 1Y3HA 2JFUA 4ZODA 5CFQA 5BSMA 5IDQA 4PC6A 4N82A 1DJNA 2IS4A 1D8AA 1I0LA 2RHRA 4PPGA 2C5SA 4Z4HA 3MJEA 4FKZA 1Z62A 2P7IA 1IHXA 2VBFA 2CHGA 1NVUQ 1TMYA 1KGDA 1LFDB 1QGDA 3Q5GA 5E0KB 3TLAA 4B73A 2PTGA 2ADFA 1YDFA 3GJYA 5JFGA 2A5FA 4ZCQA 4C7OA 3FJOA 1CY2A 4PHHA 5A7GA 1DCFA 3G2KA 1V9CA 2WE7A 2EG5A 3BFXA 3LBAA 4JL6A 1UP6A 1MO3A 4KWHA 4Y8VA 1L1EA 1Z22A 1W4ZA 4BFYA 4BUZA 2GJAA 3UUEA 5AW6A 4C7XA 4YT5A 4GM1A 4RJJA 5CJPA 3WNVA 1USKA 3A6JA 2PHZA 4J7XA 2R6AA 3LUAA 4ND2A 2CNLA 4Y2QA 1JKJA 4Z49A 3A3YA 4UE6A 3T5TA 4BBJA 4XWKA 1QE5A 2NG1A 1A4RA 2Z9BA 3M0EA 3D6JA 3ROKA 5IG2A 2KM1A 5J2UB 5KYKA 4BC1A 3QVKA 2YTZA 2FRXA 3O8BA 1DS6A 5FL7D 4R1OA 2Q62A 2C9BA 2JJYA 3CW9A 5C4GB 3KDAA 4J1TA 1IY2A 4E2WA 1NMQA 4AJOA 1TRHA 3E2IA 5FRDA 1PGOA 2WC1A 5U4QA 4WBNF 1LVHA 6NULA 3I83A 4L3WA 2YV3A 3HYLA 1VJGA 2CZQA 2Y99A 1JJVA 4YJHB 2VPQA 5F7JA 5K01A 3DXFA 1V8BA 2ILVA 3VYTB 4YRKA 2AKEA 4TKLA 2XTZA 3G7UA 2PX6A 4QD3A 5FPYA 3THXA 1JEAA 5HKBA 1F2UB 3IHWA 2A3NA 3HXTA 1SUSA 1XIVA 3EUFA 4XWGA 1NU8A 4E4YA 4EKNB 2Z2YA 4WVFA 2CDAA 2CNOA 1Z5NA 4TT8A 5LNK1 3ICEA 4YHHB 3O7MA 5E1OA 3T38A 2XF2A 2P9JA 3WGLA 4LRSB 4UZSA 3EVEA 2ZRIA 2QHXA 1YUNA 2A9VA 1CZLA 4WE3A 3SSOA 2IH4A 1TC2A 3TEJA 3R3JA 4MUAA 4C07A 1TTHA 2PH5A 3TSCA 3V8VA 5FBVB 3NC4A 4AKIA 2YXDA 1HLFA 1T2FA 2RAUA 3DMRA 2WKPA 4KMOA 5JDCC 3STXA 5CM9C 3UQYS 5B58C 1TEZA 3AOGA 5K7SA 1OTXA 2M1ZA 3HBLA 4KGXA 3TLBA 5G53C 4ND3A 1TDJA 3GJ7A 3OOHA 5DZSA 5C8YA 1CEXA 1Y9AA 2DWPA 2Z2XA 4NK5A 4KPEC 4JLVA 4QUDA 3K31A 5HJ7A 3BOSA 1CE8A 4PNPA 3FYHA 4R9NA 5L3SA 1UZLA 2BT4A 3PHIA 3A10A 3LRXA 1KK2A 1WMAA 5EPEA 3OTOB 5L3VA 2IBSA 2J3LA 1FRNA 3EQ8A 1E2DA 3WAJA 1YRAA 4Q24A 1XD8A 5LQSA 3AVWA 3SG0A 2RD2A 4KACA 2GK4A 4JEMA 4LSGA 3GZNB 3T9CA 1J2JA 2AG1A 4H1VA 4YNBA 3JVEA 4EHIA 1Y7IA 2VNKA 1JR4A 4H2DA 1P2FA 4QTUB 5HGJA 4YJ3B 4AN1A 4W9NC 3C2QA 2PA0A 4OQXA 2QTTA 1U1IA 2PFKA 5TB5A 4I1IA 2Q4EA 4E46A 5A5EA 1M1YE 3T1YB 2ZUVA 5FBKA 2AWOA 2XR1A 4FWTA 3JVIA 2FWNA 3ROGA 4BO5A 1L3BA 3AUFA 3ZHSA 2UUAB 3N8GA 3R7AA 1XAGA 2ZSJA 1ECPA 5B1DA 4YJFB 4JENA 4Q9KA 4Q18A 2Q07A 4EUEA 2VN8A 4CN9A 1CVIA 2A7XA 4O0LA 5AH0A 1KYIA 2Y0PA 5CIQA 1RYYA 4OM8A 5ELLA 4BMDA 4CMIA 4KFCA 4I1VA 2GTIA 2XW6A 5E38A 2Z6AA 4OJNA 4E30A 4HDRB 1X1TA 2P2YA 2XXBA 5E7MA 3NYRA 1UPTA 4Z1MA 1Y6GA 3GWZA 5K8LA 5TXGA 2B0JA 1KY2A 3WGVA 3B2NA 2FEOA 4MQLA 4ZIRB 1X38A 4ZXPA 3RKUA 1JX6A 1DIGA 2KWIA 4F3CA 1WUYA 4NMWA 3ZH2A 1PQUA 4C05A 4B35A 2QY9A 4CEIB 3K8ZA 2W90A 3RK1A 3ENZA 3ROQA 4CKCA 2C1ZA 5KX5F 1OXUA 2ZRMA 3BAZA 3LUPA 4FYKA 1SIOA 4KBYA 4MVXA 4QJBA 2B1GA 1HYBA 4PLWA 5HA5A 4EPTA 3RAFC 2O8BA 1P1BA 5BUCA 4MVYA 2EW8A 4WL0A 2OHVA 1TJNA 3AKEA 3GOQA 4DDUA 4RTNA 4RC9A 2CXUA 5DLEA 4WLOA 1JAIA 3LDFA 2PSHA 1AK9A 2Q5CA 4Y2YA 3PFBA 4BP9A 2JPDA 2WMYA 2PAFA 3T0FA 1CS0B 3ZE8A 2QLJA 1DI0A 4HXFB 4HRYA 5D87A 4PYKA 5TSDA 2OGSA 4L8YA 4X1IB 4C4XA 4YIHA 1XVVA 4DCVA 1Z28A 3B1YA 3ESBA 4YMTA 5LQUA 5KS2A 1TU3A 3BK1A 1Q12A 4KXNA 3UJNA 5BQ3A 1XD2A 4K1LA 5JZ9A 2ZRCA 1KY3A 1N5MA 3G2PA 3Q9NA 2WIKA 4LDAA 4LJAA 2BFFA 4FBGA 3L7LA 1XEWX 4V1CB 1H0RA 4XASA 2ZRBA 3ZXUB 1XPRA 1UANA 2IGTA 3CLTD 2OP0A 5FLXA 2IITA 3IEKA 3T41A 4Z9FA 4CGYA 3CUWA 6LDHA 1KQNA 5KZMB 3B9QA 3LDHA 1G8KA 1PNTA 1PJ2A 3FZGA 4HEA6 4FMDF 4XLLA 1I24A 2YZ7A 3A06A 4P0TA 3UMBA 3QEMB 4HB2A 1PUJA 3HBFA 2H48A 4E07A 2HA0A 1FYDA 3B78A 2IYAA 2WF6A 3ZVNA 2PQ2A 4Q0MA 3HJCA 2R6FA 4OUDA 4RHTA 3UK6A 2HHHB 4GXTA 3U31A 4QDOA 4B3DA 2VP9A 1ZGZA 2VNJA 4GZLA 4HDKB 4KIWA 5F5NA 1DIOB 2Q2WA 2HPAA 5G0UA 1UDWA 3LSYA 3PNQA 4S24A 4HSGA 1HOTA 3DGEC 4XGQA 2Q1TA 4XWWA 4RD4A 3ONNA 2BTQB 3KVVA 1VDZA 3IQHX 3VU0A 4ZPJA 1NZFA 3B7WA 5BOSB 5B1SA 4HPXB 2O0HA 4D9KA 2DFLA 3PVZA 1ZXBA 3O0DA 4UUNA 3P45A 1UFKA 3GEBA 1GTMA 4RLQA 5FOWA 3T5CA 3THWA 4J3JA 3FNBA 4JNCA 5F3WB 1O1YA 1GSAA 3MVEA 4OX9Y 1L1QA 3DAFA 1X80A 2HRZA 1W34A 2RK6A 4TVKA 4XM2A 3L07A 2M1XA 1H94A 3WA7A 1ZVKA 3ETEA 1CHNA 2PJZA 3IS3A 1XK7A 2F2TA 2UAGA 1F1JA 2AFRA 3BXEA 3DEFA 3PC4A 3QOWA 1XDZA 2Q9CA 3AKYA 4BMPB 5LQCA 1MBZA 2G6BA 2YFYA 3QU4A 1WXQA 2JASA 2P9EA 1P75A 2AXEA 1NLYA 2ZYDA 1UC4B 3DF7A 4JVMA 1Y34E 1RZRD 1E7QA 4JL5A 4X44A 1SEPA 3I9MA 4GOXA 2I4OA 2C5GA 5B3KA 1KAQA 2JFYA 4HAXA 3KTAB 4M2LA 3RTEA 3OFKA 2CXQA 1THGA 3ONVA 2A88A 2Y71A 2W58A 5IAJA 4LF6B 4HZGA 1W9MA 2Y8EA 3BE6A 3H7IA 1FSGA 1GFSA 5K0CA 5JY6A 3HM9A 2ODPA 3ZDDA 2B7LA 2RHWA 1YE3A 3FBWA 1MQAA 1KAHA 1JGTA 2ZANA 3UW1A 3KR1A 1EP1B 2R5FA 3MWGA 5LQKA 1T8RA 4HB4A 5ED4A 3LX5A 5I3CA 2XNHA 4G56A 3SKXA 3LUDA 2BBTA 1RXSA 3VPGA 1LK0A 3Q3EA 4EDHA 5B64A 2FMHA 3OEHA 3H2JA 1M8KA 4AY6A 3RVPA 2YHSA 1K68A 1VE9A 4ALNA 5LXTA 3W7AA 1USVA 4JLWA 3WIOA 3A3PA 3L0BA 3LW8A 3SEZA 4DDHA 5DOVA 1N5JA 3BIFA 4TGLA 3T4EA 1PW5A 4G4SO 1HT2E 5EZYB 1SKYB 5HR5A 1LVGA 1GKYA 4IHJB 4D8UA 2H85A 4KE8A 4K81B 2Z5VA 5HUQA 4QVIA 3OA0A 4GGPA 3PA8A 3W77A 3SE0A 4ZU1X 3G7SA 2I71A 4HFJA 5EJ7A 2REOA 1NE7A 1YULA 2A33A 4NJEA 3ZDRA 5BV7A 2HOQA 1PRYA 3OJWA 3PB3A 4QOSA 1OCEA 3FNEA 3O4JA 4FDTA 4JV5B 2D2FA 2BKVA 5GJBA 3BSFA 5DP2A 1K0FA 3CLRD 1V9LA 5KNDD 2M98A 2ORYA 3D1VA 2QD5A 3O4IA 4R2MA 4X3OA 2C4NA 3PPVA 1N33B 2JFPA 2ZBDA 4NNPA 3Q98A 3U7RA 3ZZMA 2HBYA 1U0OC 4WCFA 4NCIA 1I1HA 2JJQA 3ZV7A 1QLWA 2FOLA 2HCBA 3L06A 4LNUA 1KBQA 5DLYA 1T6XA 3DDOA 3WYEA 1J8MF 3WGKA 1IB6A 2CVHA 1ZDMA 1FQOA 1OW3B 1Z56C 4OAOA 3RIXA 2A2ZA 4P80A 5BURA 1B0PA 3WDKA 4WGGA 4B6GA 4FN5A 5E3JA 1HEIA 2XQVA 5LBIA 5JR3A 3O3CA 4Z4QA 5F2KA 3UMRA 1VJ1A 3ABIA 2WU3A 5KTPA 4U6NA 2PMWB 3SF8A 3NHJA 1WIWA 2WT9A 3EXHC 4R16A 5FORA 1GYQA 5JS8A 2RKWA 1YAJA 3LQQA 3BXXA 4JI6B 1QQBA 3DF9A 2OQIA 1U0JA 4P5PA 3W04A 4IH1A 4R8RA 5DK4A 3ED1A 3GFFA 3RK4A 3IR6A 1Z2NX 2R86A 2P41A 3LBHA 5AI8A 5BVHB 2XGMA 1R9JA 4MYRA 3TRFA 2ZRFA 1NMYA 2ZRJA 1UMDB 4HTAA 1YB6A 1XDDA 1OLSB 1NLMA 2NUTB 2WE8A 3EIOA 5AUOB 4I1PA 1U80A 1K08A 3HCBA 3THYB 2Y1XA 2YS7A 2ZJ2A 2AX4A 4P6VF 1X13A 4WSOA 4NCHA 2X19A 5J5VA 3S1LA 3SKVA 2BSXA 2C92A 1G7TA 3V1NA 4AECA 3SQMA 4K6MA 3ND7A 3TMYA 1G3UA 3WL7A 4ND8B 4M49A 1IJEA 3WKBA 1PZFA 2C8JA 3KUUA 1L7XA 1Q17A 2OEPA 2QM8A 2ZE8A 3D6FA 1WG8A 3UWPA 2E2WA 2YDXA 2DULA 4Q3KA 1OFVA 4OMFG 5H1YA 5EQTA 3T3MB 3HSKA 1DBWA 1XNRB 4B3TB 2BHLA 3ZK9A 3L7OA 4E2ZA 3DQQA 4TTRA 1YH3A 2FJUA 3IODA 4R6WA 1QYDA 1WMFA 2VH2A 2GZDA 3PK0A 1NNUA 4F1KA 4BLUA 4D4HA 1A7UA 2HMVA 3NC0C 4BB6A 3A31A 2F67A 5EZQA 1J20A 2ZIXB 2PE5A 2ZQYA 1GQYA 1YB1A 4D2IA 1A96A 4TKVA 3FKSA 1ZEJA 2BEWA 3ETNA 4D42A 2OO5C 3GCWA 4UZFA 3V8NA 2WICA 3P9IA 4QQKA 3R9KA 1N2CB 4K28A 4QA9A 4Y2UA 3M83A 2ZSBA 3OX3A 5JMPA 3WLKX 5FWNA 3JSAA 3S81A 5K20A 2DB3A 2OOKA 3SJCA 2IHBA 5KQGA 3H2BA 4KR3A 1D2GA 1OFHA 1QCYA 1Y33E 2Z3VA 2FOIA 2IYNA 4ARSA 2FSIA 2JGAA 2VG8A 2GPWA 4G01B 4PZEA 4E1BA 2B30A 1ZSNA 1C2TA 1FNSA 2IPAB 1NI4A 1T10A 1YA4A 2R65A 2WK1A 3BJRA 4M0EA 3TDNA 3TOZA 4ASUD 5IM4F 1OLUA 4AF6A 4DJEC 1QIKA 1IQRA 2XD9A 1VSBA 1ZMXA 1EM8A 4BL5A 2WNSA 1PK9A 5KQSA 5ALEA 5F4ZA 3N8DA 4RY8A 3QSYA 3FHCB 1JJIA 1DINA 1ZVJA 4EUHA 4EYOA 3ZS9A 3BD8A 3S6JA 4B32A 2N0SA 1FZQA 4RYLA 4RJTA 4KKXB 5A62A 3ZJTA 2WSSA 1JQDA 5CTJA 3DUFB 2PNJA 1DUIA 1KJYA 3MELA 1YQWA 4KRXA 4MZDA 1W52X 3EUEA 4JVSB 1LV7A 1GDHA 2FX5A 1I3CA 4RA9B 2D13A 3H5NA 1PR9A 5KQPA 4Z5XA 2J59A 4MKIA 4V0QA 2E9SA 2GPSA 5KYXB 1Y6RA 5B4UA 2VBGA 1JSZA 1E4OA 3AR2A 3KR9A 4LPSA 3JQBC 1SCNE 2EBWA 4RTPA 3WIUA 4KWIA 5KWIA 4Q9HA 1JWBB 4YAIA 5REQB 5EEHA 1GN9A 2HNKA 3OF3A 2C31A 3IOMA 4DM3A 1BWRA 4EVRA 3VUFA 1Y3AA 2D3WA 2R96A 1SKAA 3EGIA 4I5GA 4RZ3A 2OGUA 4TRJA 4XTRA 1FLVA 2HO4A 3K2QA 1BGWA 5DI3A 4CM7A 1GG2A 3V8QA 1RKBA 4JJEA 4BYMA 3REOA 1OD6A 3R5XA 4ZOQI 3T15A 1U2PA 4WDRA 1RRMA 1EFAA 1JJAA 2COKA 1QP4A 1BQEA 3OCCA 2XWPA 3KYJB 1QLHA 2HLNA 5EAIA 1RE0A 1VLJA 4MW4A 3TOSA 5JADA 4GR4A 3AB3A 1BJRE 2PO5A 4GVXA 4R1TA 2B1QA 3HE3A 1CERA 4ZCLA 2FPPA 4UHDA 1KMCA 5BN3B 2FSGA 1E9AA 2AQKA 3FFAA 3RUAA 3P4YA 5C81A 5FX2A 2OYCA 1FSFA 3QHQA 1F0YA 3UC9A 5IKXA 4MPPA 4WADA 3I92A 4MV8A 4GRIA 3PXGA 2VK4A 3IJEB 1U2ZA 2RKBA 3LG2A 5F1YA 1Y82A 3RV3A 4CIBA 1HDRA 3ORRA 3QE2A 1P5RA 3HJRA 4AXXA 3AG5A 521PA 5KVCA 1RC0A 4OHUA 2FF7A 5CLIA 4R2KA 3D6AA 4X6XA 1ZIPA 3S70A 2C2GA 3LE8A 1U2DC 1PS8A 1CQZA 2IODA 2IHUA 2IGBA 3B1FA 3VMFA 1WHTA 1UM9B 1GZ6A 3RC8A 1BMTA 4OFBA 3RIHA 1FIUA 1FFAA 3DBHB 4NCXA 1POWA 4E22A 1IY9A 2QAGB 4MJ7A 4B84A 4XJXA 4J16A 4JBYA 2VJQA 3CLKA 1SZPA 2POQX 3OQPA 3GDOA 3DZCA 1NXXA 1X7DA 3GT0A 2IUUA 3MJSA 4JT4A 5CVUA 3WDSA 2BDTA 1QZXA 3KXLA 3OD1A 4FNAA 4G24A 4MUIA 1D6MA 4TV8F 3RSGA 5ANRB 1SU6A 1ZD8A 2JJ8A 1BE1A 3CEJA 4O2BB 4ZVTA 1VPTA 2GGSA 1WXFA 5HOQA 4X5OA 2XLBA 2C2KA 3NVDA 3KM0A 2YJTD 3TGWA 2HK7A 1JG3A 3RUFA 4BNZA 3HLKA 1EG7A 1GZ7A 2GM3A 2VT7A 4LF8B 3JZDA 4TMXA 1HA3A 4DN6A 1DAKA 1QVWA 2P90A 3DR3A 2R8RA 1VA5A 1CBUA 5B3JC 4Z4IA 2X4IA 4QG3A 1RCUA 4QL3A 3FF4A 5DCUA 4A91A 2ATCA 2FR8C 1KOFA 2RIRA 2D06A 2PSFA 2Q0HA 3HDGA 3N0XA 4NVRA 1QVAA 1U63A 6ADHA 4PAQA 3FGOA 3NBKA 4ED9A 2O19A 2ZP1A 3F49S 1MABB 1UMCA 2QR5A 3EA0A 4XFDA 2BGTA 5IABA 1LDMA 1QJ4A 1KSFX 3ZXXA 4EKYA 3K0SA 2ECPA 4Q05A 1X1AA 3BDAA 2ONCA 2O7QA 1P62B 2MYTA 2VPWA 2E37A 2ZETA 4FDVA 4P84A 5JQGA 1T91A 3PQ6A 4HDQB 4MVJE 1DBPA 1JHXA 2BFCB 2V5UA 3FTFA 5IVPA 3PX3A 3R20A 1BX1A 4B71A 3TZEA 2D0DA 1SK9A 4PSAA 5IAGA 2R1ZA 5H7XA 1JEYA 3EXEB 3H2IA 1JQEA 5DYGA 4MWBA 3FZEA 1SUIA 2HT6A 4I4TB 1UPAA 1UZUA 1DKMA 2ZYIA 1M5TA 4MVWA 4QTXA 1QYXA 4JBNA 2G9NA 4LMAA 3FTEA 4AY5A 1T9GS 3PBKA 3QJYA 4N8SA 4X84A 3NBZC 5ICFA 4BO9A 4XAQA 3ZDYB 3HDTA 4IQGA 1MIHA 2H08A 2VTVA 3RVDA 4UJ3A 1Y5NA 3HDYA 4NBRA 3NOXA 3ABSB 1YJ8A 4LJ4A 5FP0A 4D9CA 5JNRA 4XVQA 3G23A 1I4EB 1OBHA 3C14C 2VJKA 3FI0A 3HACA 5FBRB 4XDHA 3FOZA 1QG0A 3B1JA 1CUDA 3KL4A 1C9YA 3MFQA 2SKCA 1WVIA 1ZJZA 4MYHA 3NV9A 2Q49A 1BXGA 5EESA 2J45A 4IDQA 1TM5E 4OJYA 5CGZA 2OG2A 5HW0A 4QPJC 3VYWA 2O1SA 2DHDA 3ZWBA 5KKAA 1Y4UA 1RQXA 1QFXA 1XPUA 1NV8A 4MUKA 3ZWPA 2BEUA 2QRUA 3QE0A 2WUWE 1J22A 4KXLA 1KI6B 2ZDGA 4TT3A 2G17A 4NBKA 3EEBA 1FS5A 3CE9A 4UTXA 4G84A 4PICA 3RSSA 3KLNA 1P5HA 3UGTA 2XNCA 1IN1A 4HRXA 3O2SB 4KXWA 3S2YA 1JG2A 1L5MA 1T2DA 1B6SA 4OP3A 1YRLA 2NTYC 3R8FA 2P4QA 4DRXA 2AG0A 3A9CA 2PUBA 2QW1A 1Z35A 3ADKA 2BGJA 2BDUA 2PRSA 3EFHA 2UYOA 4FUTA 4PAWA 2BDEA 3R41A 1MRNA 1HO3A 1G5IA 4QBIA 3QLVA 4FNGA 4LS3A 4E4RA 4P0QB 3K70B 2RFLA 1QFJA 3B5JA 3IAEA 4OQNA 2WHEA 4QBFA 2WIDA 3WL6A 3I4FA 1ZJ5A 4Z86A 3A2LA 3B6MA 3HHPA 3QH4A 1ULHA 3SEAA 3CRRA 1OXSC 1TTPB 2HPVA 2OBLA 3JZAA 2BYTA 2HU2A 2DR2A 1RBZA 1Z6GA 4S1NA 2I6GA 1RXUA 4ID3A 2C7OA 4HHEA 4RGBA 1MF7A 1GV1A 2JGKA 3F6PA 3T0GA 3TNFA 4BATA 3WJ2A 3KOOA 3I1YA 3RAGA 3RH0A 1JF8A 1OXMA 1WMBA 2F1JA 3BXOA 4KREA 4LA4A 3Q41A 4PVDA 4GD3Q 4BU0A 3P8ZA 2GQ0A 5HXAA 4LVCA 5BYJA 1DSSG 3KZOA 3FLMA 4YBZA 2A5JA 3ABOB 1N0HA 2G06A 3KLMX 1N9KA 3Q0EA 3H97A 2VS1A 3L40A 4LJ7A 3WK7A 1OVGA 3WOHA 3ZWMA 1BCRB 3INNA 3VX4A 2JBWA 3L02A 3I53A 4HLNA 4B4WA 1F2TA 1L0BA 3K0AA 2GKSA 3N2IA 3NDRA 4TN5A 3ZK8A 2Q1WA 4ETNA 4CKYA 2XE8A 3GELA 4MCAA 4MEBA 3ED5A 4ZYXA 3CUEF 3VOAA 1X1DA 2I1VB 1KI9A 3A6LA 4S0ZA 4DQLA 1Q1QA 2P5YA 4BAGA 3IALA 5KTMA 4CMKA 1NJFA 3CE6A 1G20B 2IIVA 1CF2O 1NQTA 2G1KA 3U56A 1AB5A 5D7NA 1XTQA 4ICIA 5A0TA 4DE5A 1FS6A 2AF3C 2QTGA 4OQLA 1ZC3A 1SBZA 2YX1A 4FC7A 4LE2A 1GRRA 3QLJA 3Q7QA 1KY5A 1YASA 1C30A 3MK31 5GMOA 3R7BA 1DE0A 1GYRA 1KFCB 1MJGA 5H9WA 1ZH0A 2AJCA 4C5BA 3K1ZA 5IKEA 4P7GA 5IUJC 1AURA 2PYIA 4WNIA 4WOJA 4DQKA 1QIJA 1KRXA 2R8BA 1G1AA 1FJ2A 1XMSA 5EXTA 2H31A 3KSRA 1EAMA 2HYDA 2JGFA 4JNKA 4L8WB 4LRTB 4ZOBA 5H82A 3C7AA 1C3VA 4OU5A 4V0SA 4AKSA 2FZCA 1V8PA 3DMNA 2FVXA 2I3ZA 5WRFA 1S2LA 2ZOSA 1JPVA 2QM0A 4EW6A 2H4FA 4JYPA 1NN3A 3OZIA 2QVYX 3N8IA 2PGNA 2R62A 3IUPA 1HSOA 2OORC 4O63O 4OHCA 4AK9A 5AVVA 3KTOA 4DLPA 2OAP1 1OXXK 1KXZA 2ZJAA 4FWIB 4KXFB 5BSRA 4LMPA 4MDEA 3ICVA 4HYYA 1EG2A 3DEIA 3TW8A 1N7IA 1O57A 1Q44A 1RMTA 3BWXA 3NHRA 4G67A 5BN5A 1C0LA 2ETVA 2DQZA 5FAKA 1GSIA 5L95A 2L17A 1NYRA 3NAQA 2ID9A 1USUA 3OA2A 2QMEA 4O3MA 1I80A 4JUDX 1V47A 2IYPA 5A3JA 4OXYA 1QJCA 1DMSA 1I2AA 2JNWA 4FD3A 1S2DA 4LWQA 1EB9A 2QUKA 1ZJ6A 3MMPA 4IIJF 2QMQA 3B51X 4DYHA 1V16A 1MXFA 1R3DA 1DDOA 3GUYA 5D1HA 1ZSYA 5IJAA 4PGAA 4MS4B 3IBTA 3OPMA 2BPOA 1M1YB 4K1XA 1BE0A 4EJ0A 1WF6A 3C3XA 4MS3A 5F7OA 1L9XA 2E4VA 2FN3A 3AIIA 3LVFO 4NE7A 3O84A 4HMPA 2GNPA 4ZAGA 3DAPA 4CFSA 4DCSA 3O3OB 3QHPA 2B25A 4K5QA 4ZKDA 2GCEA 4QZVA 1VKRA 2VQ6A 1QKKA 3I9FA 4UOZA 4UCWA 2CZCA 2H1RA 2OFXA 5E2IA 2AXQA 2VO1A 3F2IA 5EMHA 2ZQZA 2X5OA 4KQGA 1AN9A 4TS9A 1QZ3A 4F45A 5K03A 1GNTA 1PF7E 3BRSA 3A6KA 4HAYA 5BMVA 1TZMA 4F04A 3HJNA 1J99A 3OOEA 1T5LA 1E6KA 2W22A 1R16A 3T34A 4U2GA 3EAFA 1E9VA 1NY6A 2OV6A 1M8FA 1J9ZA 3N76A 3GFVA 4D3SA 1AIPA 4F56A 3KEGA 1M2WA 1ZCBA 1C4XA 1O4VA 3QMWA 1D6NA 3R6DA 2ZBFA 3SN6A 3H2GA 4UBOA 3K0BA 3LLCA 2IFTA 3QVSA 1KIMA 3NRCA 4A0SA 4CR8A 2RAVA 2C9OA 1FXWF 2ONKA 4KWCA 1ZHHA 4O2RA 5DBIA 1RM3A 4JEHA 5ALZA 2WIGA 3EQZA 4H3VA 3LKVA 1CEYA 2YHUA 1TQ8A 2R4TA 5CBPA 4HNQA 3OFSA 5H4GA 2A6PA 5AXBA 1VSVA 5BSKA 2JAUA 2E4WA 2JD0A 2FPGA 5ES3A 4BCDA 5D3QA 2F4VB 3A28A 1UJ4A 2I6UA 4PZZA 2X5XA 2QD2A 3MA0A 3WFIA 1NXWA 4I5IA 1KMQA 4DZTA 1B16A 3MTIA 4CG3A 3IUSA 4ZI7F 3TUZC 3L0SA 1FUEA 2WWTA 5DX8A 1FDRA 4M7OA 5DWDA 1FK8A 3GDHA 1MJGM 1NSFA 1PX0A 2O2JA 4BV3A 3TS1A 4CUKA 2WILA 2X5KO 2IXTA 4EZBA 2ZVQX 5JEEA 3I8SA 3TTWA 1ZH4A 4FGLA 4J4HA 1CQPA 2DY0A 2V45A 2N1MA 4ILKA 1MAWA 4EYQA 1WW8A 2AJ8A 1LEHA 2F1KA 3ZWAA 2ZU0C 4YRFA 3C7TA 3T3GA 3PEFA 5CFOA 5IX8A 3FFBA 2CXNA 1G4HA 1U6KA 2E4XA 4KDCA 5D3KA 3RS2A 5KX5B 2P8JA 2XWSA 2YFHA 4M0DA 3T3DA 4FCCA 3GIWA 4QUKA 1TIPA 2AN4A 2BM8A 4B87A 5IANA 2IE8A 2ZKIA 5FB3A 1Y8RB 1EPUA 3H11A 5EY5B 3QQ5A 1Q7EA 2VWPA 5DIFA 5C0OE 3QE9Y 4CU2A 4N5MA 3G0HA 3H5IA 1KKUA 5HMMA 2C59A 4HOYA 1W2GA 1WZ2A 2Y1WA 1KEVA 1VL0A 3DBLA 2JI7A 3B2EA 3GFBA 4A6XA 5JT1A 2GEDA 1YS7A 2ATIA 3TL2A 4Z7OB 1J24A 2BMAA 4M22A 1I13A 3ZKAA 2YWJA 5ALJA 3TZHA 2DE0X 2JD2A 3K4PA 2VP3A 4Q4LA 8AT1A 1TB4A 2AR9A 1U9YA 3JAWA 4K9LA 5CIWA 3E22A 3RHFA 3ZIAD 4EB8A 2EKPA 3GEEA 3GVIA 4I55F 4H1WA 3H7AA 2H2HA 3E1KA 3F71A 1B3RA 3IX7A 1QE3A 4FMDB 1N5LA 1WDLA 2PXAA 5FTLA 5IYZA 1J90A 1VJ5A 3HRHA 3VXKA 5B3AA 3ZCUA 3WB9A 4CG0A 1JBKA 4OMCA 4IF4A 4YK7A 4BO6A 4CLOA 2V7WA 1RRPA 1N0UA 1R4AA 3MCTA 2BTOA 4WZBE 3SY8A 5MGNA 1J9EA 4GPIB 1QHHA 1DJOA 2JJMA 4MJ3A 1IG0A 4W1RA 4O3FA 5IZ4A 5LWQA 5K0ZA 3NHUA 4G5FA 1XTRA 4H9GA 4D8TA 1JG6A 1XAHA 5AM5A 3DCIA 3DHVA 2FG6C 3JQ6A 3ZZTA 1V11A 1Q21A 4XIYA 4OBWA 2CWWA 3FNQA 2WJYA 4G5RA 3ZPXA 3QZUA 2GHQA 2QLTA 2GOYA 3K20A 3KZVA 3PPIA 1ZZGA 2BF4A 1CRZA 4R9UC 5JE8A 4JC8A 4YJGB 1P29A 1E20A 2JGIA 3LCRA 4XUCA 3VAAA 1M1XB 4M1WA 1A8IA 3QF4A 4O5OA 1JNYA 3UWDA 3T5DA 2JLWA 3ZIDA 1NQWA 3ERCA 5H3HA 1B2RA 1KEUA 4UCQA 1Z0KA 3RVKA 2OQRA 4YP0A 4M36A 1XLVA 1N1GA 2B8EA 3WRYC 1DC6A 3Q9LA 1RTTA 5BSUA 1PUIA 4Y6LA 3BMCA 5D6NA 4ZK6A 2V4MA 3KQSA 2HXSA 1Y6ZA 1I2ZA 3MS7A 4MLCA 3VMMA 3I5XA 1L8XA 4H3KB 4E33A 5EOVA 5ALNA 1ZOLA 2B8NA 3HMKA 3NVMB 2DSNA 1JAXA 2DP4E 3A1UA 4D9NA 4Q12A 4W4TA 2N47A 4ZALA 1V7QA 2LGJA 2UUOA 1STOA 1X94A 1XTVA 2EARA 2Q8QA 1VL8A 3EZLA 2Y77A 2O2CA 2DPHA 3BQMB 1YC5A 1RYDA 3FRJA 1ODCA 3JQAA 3N3BC 3QMPA 2QN8A 4MNTA 2GASA 3VHLB 4EYSA 1M6HA 3NHLA 2XVYA 1E94E 1VL2A 1YR3A 3KLPX 4NYMQ 3G2MA 4YB8A 4FHFA 4XCQA 3R7LA 4LQ4A 2HQSA 4V0KA 2PZEA 3DBIA 1NJ2A 4BMYA 3I09A 4RPCA 3ZX5A 2IHVA 1XU7A 3UMCA 4JLDA 2V3VA 3NUQA 1QDLB 1PZHA 2Q41A 4RVFA 4I2NA 4U39A 3T4UA 4BKUA 1A7JA 1NFQA 2QEQA 2PU5A 1RM0A 2XADA 2CLSA 4GBMA 4NH0A 5K0GA 1YV9A 3B1VA 3O4GA 3TTXA 4D8YA 4R83A 4LZNA 1B26A 1OX5A 4JLJA 3Q7EA 4FJ1A 2B78A 1LLUA 4LMBA 3G3EA 3T5PA 1WHSA 2F1IA 4PNEA 2J0VA 1CJVC 1XC7A 4B45A 3FIUA 2HJSA 5GY7A 4UM9B 2IPMA 2I54A 4M83A 3PD0A 3JQ9A 1XKTA 4F21A 1SG6A 4M8KA 5AHWA 2AZXA 1IOZA 4G3XA 3BT7A 3GRZA 1R5NA 1TU4A 3KSBC 1H6DA 4MQBA 4MWGA 1XWIA 3CKMA 3CUKA 4WZAB 4LXIA 1KI3A 4ETWA 3T3PB 2YVLA 4F9EA 2H16A 2G0AA 2GBCA 4R9RA 3E70C 3GLGE 3QKRA 3NBAA 4QVGA 2VXCA 3DZDA 4O4HF 1IM8A 4LKOA 2AEFA 1T9CA 1X7WA 2BUBA 2H7XA 2ZE7A 3WIBA 2NU9A 1M6WA 2IQ5A 1U81A 1JHDA 2C8LA 3OIVA 3OZUA 4GGOA 3PDUA 4HQKA 1BH2A 2IVFA 1A5TA 5C2JB 5K3EA 1XOIA 1ORVA 4HDCA 1GAXA 1RYNA 4XDYA 4YT4A 4UM9D 1GQFA 2OGTA 4J6EA 3R44A 2LPMA 4HFNA 3RU9A 2G71A 1IB0A 1I3LA 2C5FA 3O75A 1KI7A 1V5WA 3PHGA 3FTNA 3DMGA 3DVAB 3HVJA 3K9NA 3QBJA 4HWRA 2BGRA 5AJUA 4DPMA 1N9GB 1UWKA 2BFEA 1Z38A 1YDEA 4PCAA 1U8EA 3GR6A 2HMUA 3VPCA 3QTBA 2IIPA 4I46A 4KWTA 4DIFA 2VI5A 5T4EA 3VISA 3HM2A 2QT9A 4W1PA 3QXCA 4TYPA 3QYFA 2GRJA 5I3ZA 1XZPA 3F3KA 4Q00A 1NC1A 4H1HA 3B6KA 4DWVA 1EFRA 1URPA 1ZNQO 3E84A 3FIJA 3B82A 3N39C 4ZU3A 4MARA 4Q4DA 3VTZA 4BLOA 9MHTA 1VTKA 1ZICA 3BZBA 4RQUA 1C1XA 2QT0A 4RCVA 1AG9A 1XDSA 2PFGA 4PX5A 4WKGA 5JS7A 4MB6A 2WYUA 1OUMA 2DY1A 3RYHA 3OP4A 1J6UA 1N6KA 3FROA 1JJFA 1K5PA 1D9ZA 1T0IA 2XEXA 2GKOA 1Q83A 4LJ6A 4UHKA 5BWNA 9LDTA 5KSZA 3DXYA 5JI2E 1V96A 2Z43A 3LPAA 2VSXA 1DU4A 1TTTA 3O38A 1JHPA 4BUCA 4CV2A 1TMOA 2VJDA 4QNMA 1M1NA 1GL7A 2XZDA 6PFKA 4QUHA 2W6JD 1ZEMA 3HZHA 1VLZA 1WR8A 1BU8A 1JEEA 3TG2A 2VT3A 3ZD7A 1Q0HA 2EP8A 2PZBA 4H7JA 1DJLA 4F71A 4XM1A 4YUVA 5I45A 2XHEA 1RTKA 1KHHA 3LGXA 4A6EA 4CF5A 1ZGGA 4PQRA 4YPOA 2JHFA 2Y2UA 2R6ZA 1KZ1A 2PNFA 4NZNA 4KDRA 1JHOA 1AD2A 1BXRB 2HRRA 4A0HA 3QM1A 1YC2A 5KWSA 1JQ5A 3I37X 1YCHA 2HN9A 3U39A 5LC1A 1WV1A 1IPEA 1FP4B 1TVKB 2NNWB 5HCIA 4KPGA 4D79A 4I50F 4DRZA 4QLBA 2XE7A 4QYWA 4O4LA 4U9IS 1NLZA 3TIXB 3R9WA 4HYEA 3R8XA 4JU9A 1FTYA 3EZNA 1B0UA 1KP3A 1Y3CE 2VRBA 3RNLA 2NSDA 4LF7B 2RGNC 1WUKS 3GVCA 1XEAA 2V1XA 3QPCA 1BHSA 3CT4A 3I9JA 4QVKA 1J33A 4XX1A 3KOMA 4RK7A 1ZR4A 3H99A 1KOGA 5C5CA 2RBKA 4CDGA 1CDZA 5AKJA 2WWWA 1OI3A 2O5VA 1FJHA 4KAAA 4LCBA 5FA6A 2O8DB 5A0VA 4M9QA 1WL8A 1PP4A 1I51A 3H8SA 4MR8A 2GILA 1YGYA 3LFUA 1FDWA 1E6UA 4QGGA 3DAHA 5EXDA 4D0NA 1CVRA 1LBIA 3C70A 4G0NA 2PSJA 4LTDA 4DT1B 4BKMA 4FSHA 2J0UB 4UEOA 1L5ZA 3WYBA 4WW0A 3AF1A 4UMEA 1OX6A 5KKNB 3PL1A 4X6UA 3NG1A 3ZQJA 5HBGA 2V7PA 3OOSA 3R6WA 4MW7A 4XYBA 4AKTA 2LKCA 1ZHFA 2YH2A 2F59A 4LI0A 3OLVA 4CM9A 2C5EA 1UKYA 2WM3A 3PQCA 5FUBA 3K9CA 4NZ9A 3HO1A 3AVTA 1R8SA 4L07A 1A69A 3MYRA 3AM3A 2PLRA 3BPSA 3C15C 4TL8A 3KLBA 5TF0A 2V7GA 5AW4A 4GUDA 3PU6A 3CZ4A 1O6FA 7GPBA 1GM5A 1P4RA 4Q4HB 1V8ZA 2FCRA 3CLUD 2CUTA 2CEKA 2OM2A 2RONA 3FA2A 4IGKA 5K2OA 2KB0A 5L6LB 4J6FA 4O1HA 1IUKA 5AVRA 4HN2A 5GIOE 1S8FA 2PRIA 4J1TC 1XJCA 4EA7A 3EHEA 5A4KA 821PA 4A7PA 3WFZA 2YW2A 5EP4A 1UJ2A 4G2TA 2WW8A 4CM4B 1ZN2A 3KU4A 4CQJA 1G64A 3RM3A 5B7GA 4CL2A 2Q9BA 4XB2A 1J2RA 3IAM6 3O8DA 2EKLA 3EDCA 3FYDA 4PBTA 1TQ6A 2FFQA 3E9EA 4YMVA 3TIGA 3RB8A 2L2QA 3H5OA 4L4RA 5DHRA 5DLQC 2BP7A 2N9UA 3GJZA 3HJFA 3UT6A 1V48A 2C2MA 4JP3A 5DXAA 1O87A 1QGUB 4FFOA 3SS9X 1EU1A 2IUEA 1NQ5A 1D4FA 5DHPA 3ROMA 4Y3UA 5E7JA 4TXHA 1XTUA 3KEFA 1SVLA 4QFBA 5IJ0B 4GOLD 4WOPA 4D25A 421PA 5JS6A 5DB4A 2FW1A 3DLCA 3HB9A 3Q88A 4RSHA 4EFNA 3ZHZA 4OGFA 1F4VA 3KJEA 5LQNA 1Z13A 2WFAA 3D7SA 1PEKE 1AZWA 2EX4A 2NTVA 5FTKA 1MX9A 5LP1A 3R24A 3FPCA 1N8KA 4G0ZA 1PT6A 3U3KA 4LPKA 1P9WA 3L0OA 1RPAA 1UT5A 1VKHA 4YUAA 1II8A 2H4WA 2ODAA 4G0XA 5KYWA 3FOAA 3KBBA 3PTAA 3GGPA 5JYCA 4HV4A 4HQRA 3JAMA 5AFSA 2ONJA 2B21A 2OMEA 3LCUA 1DT5A 1EQUA 1TPZA 3KZXA 1DUSA 1ONOA 3K9QO 4I14A 4U7FA 5JZOA 4NLLA 4Y9RA 1K75A 3H9QA 4D4JA 4RTKA 2ZXUA 3TK1A 1T29A 3FSGA 1FFBA 3HKCB 5AIAA 4DTIA 3ETJA 5IHPA 4Q3EA 1RQ2A 2NYUA 1MG5A 4TKUA 2VEOA 4MUBA 2ZRGA 3QRWA 3S2SA 1K6XA 4A92A 4HN4B 3WNCA 1JIKA 2X1VA 4JP5A 4EW3A 4KFSA 1PT9A 1T1JA 3QVUA 1SWVA 2A9KA 4GR9A 1F4PA 1PLLA 4Q5IA 1AQYA 2WWIA 4KGDA 1R8YA 2LVBA 4FFPA 3TUJC 3TG8A 4RY9A 3G68A 4CM8B 1AKYA 2VYVA 3MM4A 1LV8A 4ZCMA 3IP1A 4P35A 3SU8A 4K0KB 3C8HA 4H7EA 4CKZA 4CT5A 4DCMA 5HPYB 1AZLA 3WK6A 1S3SA 2KSQA 1BN7A 1RCFA 2GN4A 4WASA 4GT1A 2ZM6B 3W1WA 3JASB 3FTCA 3GD7A 3OICA 1JL3A 2ECKA 4JT8A 1M6VB 2FSUA 4GKVA 4KXMA 4LN1A 5FO0A 4ZCPA 4E5UA 4ZJZA 1LDNA 3EHDA 4M9CA 5IH7A 5AVUA 1DRKA 4YT8A 3WC4A 3DZIA 3R0XA 3WRVA 1KZ7B 2Q28A 4RO0A 3ZXYA 1FUIA 2FX2A 3NIGB 3QKWA 4H7FA 2WU1A 1LI5A 3LBYA 1KH3A 3FJ1A 1Y7LA 3FVQA 4MKZA 2J0QA 1KE2A 1GADO 4I9FA 4YVFA 4YCDA 1OH6A 3RSOA 5CK4A 2YNMA 3QVWA 1I3MA 1H3EA 3V2UA 3DLTA 1MAVA 3I1JA 3Q3JB 3H4IA 1HURA 5B55A 1SN7A 4ZZ0A 3QE4A 4EA6A 121PA 1A8SA 2NYAA 1GGEA 1JXMA 4MKGA 5J4VA 3IE1A 4MGEA 4ZAZA 1R5BA 1SURA 1DEAA 5KVVA 3HL0A 1FVHA 4KAJA 4XYMA 3HGMA 2AHOA 3L8YA 3P0RA 5DNWA 3WB1A 4WX2B 2FJPA 1R8XA 5HZKA 1BG6A 5KDOA 1G0OA 2JIDA 2OCGA 2UUPA 3C1OA 2WHRA 4J0FA 3S7ZA 3SDBA 4US1R 3ZWQA 1YMQA 4I5DA 3HSYA 1EFLA 2PY6A 1XU4A 2HH9A 4RULA 5CX1A 5DTIA 2QW8A 2Y92A 3QPUA 5CYGA 4FCWA 1XJ0A 1QIMA 1LUAA 5JLAA 2XDQB 3O2QB 3UZUA 4E0BA 1JAYA 4C0XA 3RSFA 1NSTA 4J94A 1JECA 5IT5A 1DKLA 1VB3A 2OK7A 2IIQA 3DAGA 3KCQA 4II3A 3GV0A 2BEKA 1EZ4A 4RKYA 4X7RA 3NZEA 4EMSA 5FPKA 4TZ6A 3O8QB 4RGVA 3UXMA 4AJ9A 5I9NA 1AKUA 4L6IA 1U11A 2WJPA 3PHBE 4NICA 1X9IA 4RVHA 3A1FA 3G89A 2ZPTX 3RVSA 3JD1A 4LYHA 4YFVA 5JBNA 1II0A 1I14A 4II2A 2I4IA 2WPNA 3CZRA 4YCCA 1FU4A 5CX4A 3RU2A 3FPAA 3H17A 5IFKA 1GQRA 5CDHA 3NNDA 3WJ7A 3D02A 3GP5A 2ZI3A 1C4KA 4R81A 4DQXA 1O8CA 1XBTA 3C3MA 3OLWA 4OEHA 4D6PA 2QG4A 1N2SA 1ZLYA 3VKHA 3TQTA 3OJEA 4WKNA 1JG4A 5AK5A 3MWJA 5I7EA 3P0HA 1DC5A 4RH0A 4PYIA 4RK6A 1YJCA 1PBNA 5L3ZA 4CUZA 2J87A 3E35A 4ZA2A 3UCEA 2VHVA 4QBHA 2WQ6A 4EHAA 4QTZA 1DRVA 3MWEA 3NH6A 3LIIA 4ZT6A 3DLHA 2WWXA 1SVKA 1FP7A 1RWQA 1SIBE 2B37A 2N75A 3URKA 3VZDA 3GVXA 4AO6A 2Q6VA 1MLDA 3IMFA 2W2LA 4MIYA 2NO4A 3ZHCA 2HCTA 1HL3A 3PXDA 1YS6A 1VGRA 5J2TF 1XRQA 2GT1A 2IZ1A 3BD9A 3R6TA 4EMUA 3IUMA 2HQOA 3IT3A 2ENUA 2REBA 5JTUA 3QU9A 1SXPA 2BMFA 2P6OA 3GT7A 4MW5A 4JC5A 1UBTS 1VECA 2TYSB 2ORED 3HK2A 3IC5A 4D9BA 4RGQA 4WKBA 1IBCA 5MGBA 4L74A 4CIXA 5HHTA 4MW6A 2PVPA 3AJRA 1VP3A 5IASA 3HCAA 2BGKA 3M34A 3MC1A 3L5OA 2BD0A 3P9CA 4JI8B 4X24A 1BHO1 1ZI8A 3PDIA 1HDEA 5F78A 1C1DA 3HR7A 1CUYA 5C8XA 1ZI6A 4IJMA 2J67A 3R7WA 3COVA 4IJKA 4D43A 1H23A 1P33A 4L2IB 2YJ6A 4GMFA 4TSRA 3CEMA 4BQIA 2V5VA 1OT3A 1YE5A 2O0LA 5DJ5A 3MMNA 1XROA 2X8JB 1VLMA 3JQ8B 3RARA 5HKKD 4JUIA 1SOVA 9ABPA 4DNPA 3AP2A 1GCUA 2XB9A 1XV5A 4MWSA 1JBQA 1UBCA 1Z68A 3CS3A 3D7RA 1A4UA 1T36B 1V35A 4G8CA 5IZCA 4P93A 4X8OA 5K8JB 3IBCA 2WHXA 4BLQA 1NFRA 3UC5A 1Z8HA 1GLGA 2O8NA 4F93B 4DLAA 1E64A 4UOQA 2MSWA 3DW3X 2JZNA 3GN1A 2LR0A 1KMMA 1P0IA 2PXXA 3AR4A 4WY2A 1EJBA 3SQNA 2VSOA 4DTCA 1G4AE 2XVZA 3SBOA 2FFHA 2VRCA 1LNZA 1CUXA 1IFXA 1M2OA 1RYEA 3H18A 3ITEA 3M5PA 4OGKA 1W0JD 4QARA 5FFMA 3HP4A 3WFJA 4AKHA 2Q5EA 3OE7D 1DQZA 3EWAA 1ESCA 2OCYC 2WTXA 4PYLA 1TLLA 1WXEA 5KWEA 4MB0A 1WABA 3TBKA 1U1DA 4UBKA 2IBTA 2DH6A 1FQKA 3VO1A 3ZZ0A 1ZONA 4K6HA 1Q74A 4XX0A 3EG5A 1XRLA 1B4DA 2XT6A 4Y6RA 3K1AB 1C41A 4HS4A 1G5PA 4WD3A 1BTOA 4ZO4A 1BZYA 1TPYA 2F90A 4GBGA 4B7ZA 4Z7NB 2G1UA 1C3XA 3PJEA 2FOXA 1UDAA 4FT4A 1UBLS 4LRXA 2JH8A 2RE8A 3U9SA 1LXCA 3ZE6A 2V7QD 1FF9A 4PN3A 1SPXA 3SC6A 1ISRA 1GZDA 1Z2DA 1XZJA 1B8VA 1RWBA 5DK6A 4Y1RB 5TX7A 5A3QA 3VA7A 2QUJA 5C31A 3FDJA 2HCJB 1XMOB 7ADHA 3WGUA 2O05A 5I5EA 2Z9DA 2HZ7A 5ICCA 2QRKA 1FRFS 3R3VA 1YBMA 1KAMA 4XD7D 2O2SA 4FLMA 3A2MA 5C35A 4IIJB 4DKJA 4Y2SA 2P3OA 2NQTA 1JFFA 2R87A 1CYDA 3DT6A 3Q3GE 5SY9A 4ZCTA 4KXQA 3PQEA 5HJ2A 4RPGA 3P2EA 1ZOIA 4RQAA 5FPHA 3SWWA 3ISTA 4MI9A 2P7HA 2DF8A 2I8AA 5C1IA 3NAZA 1NBMD 1DTSA 2QQFA 2R8EA 4B09A 4C2AA 4ESOA 1EDOA 5M5BA 4ALLA 2MMCA 4TTJA 2GPYA 1PQWA 1JRLA 1B93A 3KV3O 4B8ZA 1IZ8A 2IV3A 2QL9A 3C7CB 3D64A 4C0JA 1E79A 1GT91 1OQAA 2CBZA 2XCSB 2PS9A 3OCZA 4IYJA 3IIIA 2I9PA 2QQGA 1Z4PX 2NU6B 2OC4A 3Q11A 4EGCB 1S2GA 2WNHA 3EEOA 1VM6A 1CV2A 2H4ZA 4Q3NA 2WVGA 2I4MA 1YHZA 2QTZA 2WUDA 3LUGA 2G67A 1ES9A 2HBQA 1UJNA 4TSFD 4WINA 3Q12A 2H6EA 1KC3A 1P4JA 3HYCA 3L0CA 2ZIVB 2ZWPA 5HK8A 1AUVA 2CCGA 2AVNA 3IVCA 3KPWA 3WLFA 4WA7A 5CP8A 1VBFA 2BMWA 4EQ6B 3GLIE 2AFVA 3T6KA 5AUPB 2AJTA 4H3SA 4HNRA 4HVTA 2GCNA 4L0DA 3OLXA 1IOWA 1R3UA 3RFVA 1FPMA 4GE0A 4RD3A 3HHEA 2PGOA 4QDTA 4MGYR 1PFQA 2CVZA 1UBMS 2GRUA 2QUAA 3JQFC 2HSGA 2CLMB 4I1UA 1E3IA 1PGNA 2RMKA 1JI3A 3A05A 1EP9A 3AERA 3PYLA 4FTWA 3GDGA 1UFQA 4G0QA 3KUCA 4PC1A 5K09A 4EPXA 4JCOA 3WLMA 3A0UA 4OU4A 1Q11A 3DL7A 1N92A 4QEZA 1NR7A 1RYZA 4LYEA 1U9JA 2J5XA 2FEAA 4KLRA 1V4VA 4ALMA 2Q0XA 3LC7O 4FXOA 2XZOA 1AGPA 3W2IA 3A58B 4HQOA 5JSZB 1BS1A 5ITZB 1EWTA 1GNVA 3VDQA 4ZI7B 1M2VB 3WK5A 5IK2D 1BCSA 1M10A 1CPYA 3VZSA 1IBMB 3GK3A 2YWEA 2QTMA 3MILA 4WK0B 4Q7LA 4B2LA 1D6SA 4UKDA 3NBMA 1NFFA 2FP4A 5CAEB 2O2IA 1K4KA 2CNKA 5CUQA 4BP8A 3GNQA 2I3GA 3A27A 2O0KA 4MZXA 2VSYA 2NAPA 3E9RA 3VR5H 3A25A 4NJOA 4HSEA 3MTGA 4CNQA 2C29D 1PV1A 1OI2A 1WM1A 4LY9A 1K8QA 4KSYA 2RGDA 2IEBA 1I32A 3C6BA 3PFWO 1SY7A 3Q7PA 3PYXA 4BEVA 5DN6D 4TOIA 1QE0A 2PX3A 2D1QA 3Q72A 2E49A 4K9MA 4ZPXA 3FNHA 4NG4A 1XXHA 3FH0A 3HFJA 3BERA 3IBSA 4QUEA 5DTRA 4TQ9A 3VJKA 1XEFA 4BE9A 3A6PC 4QU9A 4GRDA 3WMGA 1RIFA 2JGJA 1LDGA 3PNMA 4R31A 3ZWWA 5HUJA 2D2VA 3C43A 2VZLA 3ZZNA 1M8GA 1KI1A 2KLHA 2NV6A 2OMKA 2W4MA 3K2IA 2IYRA 2MSNA 5DM4A 3SI7A 4MKXA 1U1FA 5SY6A 3SVZA 1ZH6A 1H6BA 2IYLD 1E6EA 2B8WA 1KYTA 3F5MA 1VMEA 1JTVA 2H3HA 3OC6A 5GV7A 5J63A 3WIDA 1ZD1A 4CMHA 2FWPA 2PXHA 3W8EA 1G2IA 3ZGLA 4B80A 4EG1A 5BR4A 4W5NA 4I55B 4RH1A 3QGMA 2X0DA 5KO2A 2GK3A 2ERXA 4U5XA 4KQ6A 1E0JA 3VI4B 3L7YA 4QOJA 1WB6A 4PZ9A 4ROTA 1K86A 2QTLA 2XVMA 3ESRA 3ABZA 1X92A 4HQ0A 2IC5A 2C3OA 4RENA 3RI3A 3VKVA 4UTZA 3R7NA 4L15A 1I9CA 3IUNA 3VHXA 1W5BA 4LY3A 3ZY2A 1KQGA 1J9GA 4RA6A 1M5RA 1RP1A 4N1AA 4WV3A 2GXAA 4DSAA 4J0HA 2OILA 1MA0A 2AE2A 1LJUA 4N7JA 4D3ZA 4REQB 1CY7A 4MIKA 1P2UA 2OBYA 4HBZA 3CLSC 3VR0A 1PFGA 3AP3A 1E4EB 4BQRA 4HWSA 1UXOA 5KNCA 4U0JA 1WAMA 4HVLA 4B6RA 4DLTA 4Z4FA 1CQIB 3I6ZA 5TPWA 5G0TA 3N0VA 2VBIA 2GF0A 3RYFB 5K6AA 2WKQA 2P9YA 1HY3A 4B85A 1EDZA 1P7WA 4WESB 3KXDA 4YMHA 3AEYA 2KBFA 4MWCA 2ARKA 1Z6XA 2PIDA 1DDIA 2WWGA 3EIEA 3D7LA 4JJAA 4MI3A 4AZ0A 2PT7A 3K6SB 1L8OA 1IOVA 5LVAA 1UDCA 4X8HA 3OZXA 3ZV4A 3ZI0A 4B6EA 3GLHB 4HKTA 3DEHA 2XCIA 3DVSX 4KO1S 3LVQE 4AG3A 1IUOA 3VV3A 4UMDA 2SCUB 1BMFA 2H63A 3RT7A 3WNDA 3FKJA 3JVDA 1P80A 4Q03A 2E6KA 3DZKA 2FUNB 3PF9A 2AFIA 1U0BB 4BIIA 5KQMA 2Y1OA 4GPAA 4RIFA 4HDSB 3VOTA 5J5CA 4DDWA 1Y1LA 4IEEA 4XYGA 1TA0A 2WT4A 3DDHA 4FOOA 2Z3ZA 1IXYA 3UENA 3USCS 4HDNB 2ZS8A 3H1AA 2VKQA 4AZSA 2KYRA 4AG6A 1FVXA 3KYDB 5AYVA 2IY8A 3WGHA 4NH4A 4KDFA 3JX9A 3ANTA 3F7TA 3V00A 3CMCO 3QWFA 3NDPA 2UZ1A 4M89A 5JSQA 4PFJA 4B3GA 3W2TA 1L7OA 3BXPA 1J56A 1IE3A 3TPCA 5JD5A 2C2OA 3NTRA 3A9WA 4YCBA 5CH8A 1EFPB 3NGMA 3R3ZA 2C00A 1E1KA 2D00A 1NXPA 1QONA 2MSCB 3LDAA 3N6XA 2IL1A 4UHBA 5KYYB 4M38A 3QLEA 1Q15A 3T9BA 4DPLA 1PK7A 1XZ8A 3MWKA 3LUCA 3MCWA 1XVIA 3UUGA 1FLAA 4PRZA 4PLVA 4QUIA 3DPIA 5GVRA 3SC4A 3VJMA 4A9AA 2C7BA 3WHKA 4H6VA 2BGUA 3AI7A 4HGRA 4U7JA 3CIFA 1P3Y1 4FUQA 3WX0A 3KELA 5TQ2B 3ONDA 3VKFA 2IUYA 1T9GR 3VVMA 3CU5A 1B1CA 1F51E 1FNDA 4QECA 2PRZA 3QVOA 3TN7A 4CL8A 3LBIA 3NB0A 4MTLA 2ZRKA 1REQA 1OHHA 2O2HA 4O4HB 4K87A 4YO7A 5FLYA 4DADA 5C7YA 4HXGA 1E1CA 1UM8A 4YMSA 2J3HA 1Z2CA 3H5TA 1KEEA 4NCAA 1UAGA 2RH5A 5FI5A 3Q4GA 5JCZA 4EGJA 1Z2PX 1OLOA 2ZBRA 3PEVA 5DYTA 4DREA 4ENUA 4MDHA 1XYYA 4Q1FA 4OD0A 3EUAA 4TMFA 3S5JA 5KNBH 2JCSA 3ECCA 2IP1A 2YRXA 2A86A 3R9XB 3R2JA 3LPMA 1CLEA 1U8XX 2H51A 1ENZA 2YBEA 1T4BA 1Z4JA 1NZDA 2NPIA 3INYA 4WKOA 3I12A 4MWOA 4ZQCB 8LDHA 4OJMX 2N3ZA 3CF4A 3QQPA 3U4QA 3KWFA 5AUNB 3V4FA 1V7ZA 3SHVA 1Y81A 1Z5VA 5HQJA 1HRDA 2Z6QA 1TUBB 5FI0B 4IYRA 2CV0A 5EHXA 5JWHA 3QEOA 3CNLA 1PGQA 2J3JA 3IQWA 3LQRA 4W82A 2ZBPA 4JB8A 5CT5A 4NF2A 5AESA 1V3VA 3CLVA 2M6LA 1ABBA 3OPQA 2HFKA 1K7SN 4M8SA 2J5BA 4UE3S 5FO1A 3VC2A 1D2HA 2RK3A 1AH2A 1XVUA 4D9HA 4F4DA 4KLZA 1RYMA 1FPQA 3OOYA 3A6ZA 3ZU5A 2BJWA 1Z7BA 4R51A 2Q4OA 3KSDO 3UK2A 1AQ6A 3DFKA 3G2LA 3MIZA 3ILYA 3SIPA 4KV7A 4QPPA 2EZTA 3VYVA 2VF5X 4GAEA 4U8GA 1E3LA 2J3IA 2G4LA 2M6SA 4LHWA 1SH7A 4PCUA 2WRZA 4O33A 3SBEA 3A7DA 2IUFA 3QLVC 4Y2VA 1ZUNB 2FRVA 1W8IA 1DOHA 2O9JA 3CZ5A 4MWEA 3STVA 1P6UA 2YMMA 3RAPR 1K5HA 4EOGA 1EA7A 4Q39A 1J7JA 1RJFA 2QLNA 4BNVA 3A6EA 3E9YA 1RI5A 3E7XA 3KKMA 3IP3A 4WN9A 4Y6PA 3G59A 3V4ZA 1S8AA 4JLOA 4DJDC 1BXKA 1KO4A 5HNKA 5HRUA 3MJDA 1AGXA 4RNDB 1H9AA 4BNKA 5KTOA 2O8CA 4IXMA 2GS9A 4TS1A 5I7FA 1U3GA 5FL7A 2GPTA 5FOXA 3PNOA 4H77A 5FQOA 5EI5A 1JDJA 3Q7RA 5BVGA 1A7AA 2FG7C 5JZSA 2HF7A 1GHTA 3WP0A 2CYCA 2A5DA 1NVGA 1ZFNA 2E85A 1SA0B 3LYAA 3OZGA 4I50B 2TS1A 3N59A 1HEUA 3T7CA 1NYTA 2ZYGA 1GXSB 3S8EA 4RLSA 3TNJA 2SKEA 5A2QA 5SV2A 4NWIA 3KV1A 1HNNA 1UZAA 5JCOA 3SLRA 3KHSA 3V4SA 1LA2A 4KVAA 4KOEC 2FNAA 3AUUA 1RPNA 2JJ1D 1AMNA 3ET4A 3V2HA 3F98A 4Y30A 1O94A 4U63A 5E3IA 5FI3A 4ZMRA 3K9HA 3WVNA 3HNPA 2R6GA 1W75A 2I0FA 4GHWA 5EERA 2HEIA 4P4TA 1MOZA 1QLJA 2PBLA 3A9VA 4OHXA 2O7RA 4BZQA 3CPJB 3LGSA 2O1WA 5EIAA 4D9JA 2JLZA 3C3AA 2XUOA 1I6WA 4RNCA 1JTFA 3AU8A 2AFHE 4X8LA 4EFDA 1OTHA 3BJEA 4ISCA 5EGSA 1EGVB 3BMQA 4UNRA 4M1SA 4EI9A 2YWXA 2G82A 2B9EA 2JI9A 1EFVA 1TUGA 3BMNA 4YJHA 3ROPA 4N49A 1Z4MA 3FPSA 3L49A 1M6NA 4OQFA 5DNEA 5EKUA 4BMNA 2BBWA 3R74A 1MH1A 1S02A 1YZLA 2PZAA 1UR5A 3NXSA 8ADHA 3S4YA 4AMVA 3NBYC 1FVOA 4L08A 3EG9B 2VT6A 4MRAA 4HH3C 5JYDA 3GCZA 4IDOA 1QNLA 2B4QA 3AM5A 4D8XA 2E4YA 4A73A 1ZQ1A 1E9BA 1L3CA 3I32A 3QJGA 1RWVA 4MV7A 3RD5A 1FU7A 5F73A 4WNAB 1G18A 2CDNA 4DXAA 1KIAA 5FIUA 1J0CA 1KFEB 3BORA 2CNWD 1WSBA 2W2OA 1ZA1A 4FSXA 1FB5A 1HFKA 2IDJA 5IC6A 1E3SA 2JJ2D 2QU7A 4RXMA 5EKTA 2OHJA 2XZPA 4BTEA 2VUIB 1T2UA 4I5EA 3IDAA 3MCUA 3MINB 2YICA 1APBA 3BZWA 2YV4A 4AO7A 1E1NA 5F51A 1KDYA 1Q7BA 1E2IA 4IJ5A 4JQZA 4HZUB 4AS1A 1BQ3A 1EFTA 3CVUA 4ECEA 1GU7A 3B89A 3C16C 1DCKA 2X8LA 4NYJQ 1XMXA 1TYDE 5A5FA 5AW1A 4YCAA 4PXYA 4ZMSA 3VC7A 1RHJA 3TM4A 1RM5A 4WI1A 2OD7A 2DQYA 3AFHA 3KB2A 5EIHA 4M1QA 1N2BA 2GYYA 2XE6A 1K89A 3NI2A 4OMDA 1U4NA 4GPZA 4CFZA 3GZNA 3KKZA 2FW8A 1Z5OA 3UXYA 3VR6D 2R66A 3EVFA 4EPWA 1KS9A 4MP8A 4K6OA 3N2KA 5LDHA 1PZGA 3DHEA 4IDFA 3E7WA 4EGAA 2CJFA 3BSSA 4NEHB 3UOAB 1C3LA 5HILA 4EECA 4ZO6A 5MFZA 1RWNA 1BSVA 3AHGA 3ZGZA 5CT4A 2ZZNA 1L4NA 2JFHA 2PS3A 3UO8B 5JFTA 4WWHA 2F1OA 4R84A 4DCNA 4R6XA 4FB5A 4LZAA 5L8VA 1FU8A 2QLFA 3I0NA 4GU5A 1YK1A 3CCFA 3T1QA 4ZHSA 3AY6A 1J0DA 2ZVDA 4ARBA 5BR1A 1W47A 2PWYA 1PR6A 1SHUX 3TVTA 4BQFA 1WPRA 5BRNA 2BGIA 4FFWA 5EG5A 3A4LA 5F7ZA 2OB1A 4ETIA 1MHPA 2GETA 1E5VA 4RK0A 5F98A 4QTTB 3EZYA 2F6RA 5K3CA 4KU4A 2UXCB 3FCEA 2HD4A 4C06A 4CQMA 2DBVO 2XLCA 3PICA 1GUZA 4RDIA 3MGAA 3OETA 3QBEA 1H93A 1X7ZA 5M04A 1GTL1 2B5VA 1A9ZA 3A6HA 3ISJA 3I2FA 1JLSA 4GOOD 1Z9BA 4KAFA 4CQLB 2Y67A 1YFZA 4YUZA 1N36B 5HFJA 2DHCA 1U0GA 4R2HA 4C0LA 3EK2A 4U7HA 3RJ9A 3O5AA 3HL4A 2BL4A 2YXPX 3E05A 5CLHA 5H3CA 5JO9A 3O1LA 1LBQA 5CNMA 3UIEA 2E5WA 1V2GA 5LCXA 3UPDA 1U0TA 1Y3IA 1ZCJA 1IBSA 2HIHA 3U44B 1YRBA 1GR1A 5THQA 1F0PA 5AI6A 3OFVA 3IQIX 4OGWA 1G17A 1JE1A 2ON6A 2XBMA 2X22A 4JC4A 1AS3A 1M75A 4L5JA 5DHSA 2HC9A 4LDZA 2HDNB 2H1CA 3PFNA 3ZDZB 4DVJA 1OILA 4M88A 5D8DA 1Y1SA 1Y8CA 4I9UA 1X77A 4LQLA 4WLNA 4JEUA 3QVMA 1YI8A 1U8FO 2P3SA 3C6MA 3PD1A 3PKJA 4G0WA 1SXJC 1Z7EA 3EPPA 4XWYA 3W3AD 1BS9A 1JIQA 5JS2A 3VPAA 4O4IA 1KL7A 2IWHA 3ADCA 2AD5A 4PM4A 2WVJA 2RGGA 4J0DA 4MV6A 4GQBA 4MV1A 5K45A 1CIJA 4GECA 1XHFA 1Y42X 4D97A 2X8AA 3U48A 3NOVA 4L4ZA 2OT3B 3U37A 2QDXA 1BFKA 4KN9S 1RKVA 3O93A 1UK9A 5KPDA 4UTOA 4KXVA 3CN7A 4OK5A 1NW8A 2CT8A 4ZGGA 5FWDA 4W5HA 5KSWB 2QXUA 1C3OA 1CYEA 2BCJQ 2BFWA 2K87A 4HDKA 3WLOA 1YVDA 2BISA 1CVLA 4RQBA 5FV7A 3HTXA