3M33A

The crystal structure of a functionally unknown protein from deinococcus radiodurans r1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
RESYDRLARELGGYRHPWARVLSGPDPELTFDLWLSRLLTPQTRVLEAGCGHGPDAARFGPQAARWAAYDFSPELLKLARANAPHADVYEWNGKGELPAGLGAPFGLIVSRRGPTSVILRLPELAAPDAHFLYVGPRLNVPEVPERLAAVGWDIVAEDHVSVLAHAPTWEDWQMRGEFMGKLARRADWDAEATVRGMPYREERHLVLARQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The crystal structure of a functionally unknown protein from Deinococcus radiodurans R1
rcsb
source organism Deinococcus radiodurans
molecule tags Structural genomics, unknown function
total genus 59
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m33A00
5K09A 3EPPA 2B2CA 5EGSA 1EIZA 3QV2A 2GLUA 4BY9E 4ER3A 4IV8A 5E2AA 2JJQA 3G2MA 2P7HA 1JQ3A 1JG2A 3A26A 2V74B 3LKDA 3BWMA 4OX9Y 2AOXA 1IXKA 2KW5A 5DTQA 3RODA 2WA2A 1UIRA 5DSXA 5EKXA 1XJ5A 3R24A 3DMHA 3ER9A 2IDJA 3TFWA 3UJCA 3THSA 3VSEA 4U7PB 3EVDA 5DXJA 3GXOA 2ZLBA 4C4AA 2O06A 1JG1A 1KXZA 2BR3A 3DH0A 3FPJA 1JR4A 2CL5A 2HMYB 4QTUB 4XUCA 2G71A 2ZFUA 3GRZA 3HA5A 4RTRA 2B78A 1PRYA 2XVAA 5C1IA 5BP7A 3MHTA 1JSZA 3A25A 3P9KA 3PTAA 1VP9A 3ELDA 1UFKA 5HZMA 3OU7A 1RI5A 1DL5A 3C6KA 3ME5A 5DM2A 3HA3A 5E8JA 1SVUA 3OFKA 2OXTA 4K6MA 3UBTA 5LQRA 4DA4A 4KDRA 5HIKA 1Y8CA 3HTXA 2G1PA 3KKZA 3ELYA 5GM1A 3IV6A 3DOUA 2FRXA 3KPWA 3A27A 4PYIA 5KQRA 3G7UA 3GIWA 5FHRA 2ZZMA 1G8SA 1VIDA 3OE4A 3UJ9A 2FK7A 2YVLA 3MAGA 4F84A 1SQGA 4Y2HA 2ZIGA 3BWCA 3FYCA 4AUKA 5LQCA 1PJZA 3M6VA 4RTOA 3G5LA 3P2EA 2HV9A 2P8JA 4XCXA 3HCBA 4DQ0A 4EVIA 3ID6C 3TRKA 4GEKA 5K0BA 2PXCA 4RTLA 4PYLA 5CCXA 4FZVA 3LDUA 3TM4A 5CVUA 3TKYA 2IGTA 5DRTA 2AN5A 4KDCA 4QQNA 2ADMA 2C7RA 1R8XA 2JHPA 5ICFA 1YB2A 1YFJA 5K0NA 5EQJB 3BWYA 5HEKA 4FP9A 5HIIA 3TMAA 1XDZA 3KQVA 3DXXA 4DKJA 1VL5A 2PJDA 2JH9A 2DULA 3B89A 2BM8A 1KIAA 5ICEA 3FUUA 3OFJA 5GWXA 3KQYA 3HCDA 4CTKA 4YUVA 3BGVA 4KW7A 4PCAA 4C06A 1P1BA 1AQIA 3HA7A 2NYUA 4FT4A 2PWYA 4PYQA 4R05A 5EPEA 4RTQA 2P7IA 5FA8A 1N7JA 5K05A 1Q0SA 3PT9A 1ZQ9A 1FP2A 3JWGA 2A14A 1XDUA 3HCAA 2Z6UA 2ZSUA 3NJRA 4WXHA 5DX8A 3MTEA 1B42A 1TW3A 2AOTB 5EMKA 4YV0A 3NVKI 5F2NA 3DMGA 3EGIA 3CJQA 5C0OE 3C3PA 5E2BA 5EC8A 5EMJA 3HEMA 5BW4A 5LQAA 4RTKA 5K0GA 1ORIA 5FQNA 2Y1WA 3NW9A 3KR0A 4V0QA 2OB2A 5EG5A 2NXEA 4MQ4A 1RJDA 2PBFA 3KPUA 4M38A 5F2KA 4QPNA 2ZZKA 1WS6A 5T67A 2OYRA 3UJDA 4C03A 2YXDA 4DMGA 3DR5A 3LCUA 3AWIA 3KR1A 4POOA 1BHJA 1G55A 1JTEA 5FCDA 3REOA 5LR6A 1VP3A 3B5IA 1KPIA 4LG1A 5T64A 1F3LA 2QYOA 2ZBQA 3TKAA 2WA1A 3FRIA 5E1MA 2C7PA 4E2XA 1SUSA 2O07A 5EMMA 2P1DA 1KP9A 4E2WA 3PB3A 3KQSA 2PX2A 4ZTBA 1SUIA 1UWVA 4MTLA 1O9HA 3AXSA 4HGZA 1QANA 2QY6A 5IKMA 1NW7A 3HVKA 1N2XA 3NWBA 4GC9A 5LSAA 4X1OA 4A6EA 1FJXA 3R9XB 4GBED 3X0DA 3B3JA 3EEYA 3SM3A 5DTRA 3LGAA 3GRRA 3PS9A 2DPMA 2UYOA 2HR1A 1L3CA 3HVHA 2K4MA 1YZHA 3NDIA 4FT2A 4JXJA 2FCAA 3ORHA 3OPNA 3R6TA 5DRYA 5IH3A 1NBHA 2O05A 3FUTA 3LKZA 3Q87B 3QOWA 5GIPE 3PX3A 4QVGA 3NVMB 3NWEA 3G2QA 5HIMA 4YUYA 2ZULA 3H2BA 5LQJA 3OU2A 2NXNA 5EEGA 4DCMA 1VLMA 2PX5A 1EJ6A 2GA9A 3BGIA 1T43A 4CKCA 4XUEA 3EVGA 4LWOA 2OO3A 3KPVA 4E70A 3LDFA 1RJFA 2EJUA 3I58A 3MCTA 4YUZA 1G38A 2QM3A 4GC5A 4AX8A 2OKCA 5FWAA 3MERA 2ZW9A 1M6YA 2PGXA 3A4TA 3RW9A 3C6MA 4HSGA 2ZTHA 2BZGA 5HIJA 2JHAA 2IBTA 3GRUA 4NECA 9MHTA 2NP7A 3EVFA 3BUSA 1X1CA 1JG3A 2AVNA 2VDVE 2YQZA 3HVJA 3JWJA 3LCCA 3TM5A 3V97A 2P35A 4C05A 4CWAA 5KYGA 2YTZA 2C7QA 3SXJA 1SG9A 2OZVA 3CCFA 1L9KA 1VQ1A 4E30A 2ZCJA 4Y30A 1BKYA 2ZWVA 4M36A 2EX4A 4FS8A 1MJFA 3BKXA 4P7JA 4AZSA 3DLCA 3MCZA 1SQFA 3FUXA 2Y1XA 4KRGA 3P71T 3AXTA 4CXMA 1Q0TA 3KQOA 2Z6AA 3P9CA 3LBYA 4YV2A 1JG4A 1KPHA 3DUWA 3KPYA 5E8RA 2JH8A 4P7KA 3IEIA 1NV8A 2YR0A 2R3SA 2B25A 1D2HA 2FPOA 4O29A 3M6UA 4GOND 5LQUA 3MGGA 3KR2A 4M37A 3FPEA 3FPGA 4OBWA 1XTPA 3GU3A 2P40A 1KYZA 3BZBA 4LECA 4E32A 3FZGA 4E2ZA 1EAMA 2QRVB 3GGDA 1RI4A 2GPYA 3Q7EA 3V8VA 3SGLA 4C04A 1XCLA 2Q41A 2P3LA 3GWZA 1AQJA 3ERCA 1G8AA 1R18A 2E5WA 3M6XA 5K0LA 4PNEA 1QZZA 2YXEA 2FK8A 2AOTA 3TR6A 1AF7A 5FWDA 1O9GA 3GRYA 4E33A 2FHPA 4HTFB 3IHTA 3MQ2A 5ICCA 4PIPA 1X1DA 5CVDA 2GB4A 2BR5A 4BLWA 3GDHA 3LSTA 4P58A 4MHTA 3R3HA 5LQNA 5HOQA 2LD4A 5CCBA 3AJDA 3C0KA 3DP7A 3VC1A 3HCCA 1NW3A 1H1DA 4UOEA 4ER7A 1JQDA 3RIEA 2ERCA 5E1OA 5EZQA 4AZVA 2EG5A 1L3BA 4G56A 5DTMA 3ELUA 2UZ4A 5E9JA 2XBMA 4YMHA 1I9GA 4QPPA 3KQPA 3S68A 5GIOE 5JR3A 5KQSA 2GH1A 3FRHA 3K0BA 4PINA 5ERGB 2IP2A 1D2CA 4BLVA 1AV6A 1WY7A 3DULA 1JTFA 4CKEA 2UYQA 1P91A 4YUXA 4GOLD 5E9WA 4RWZA 5GOZA 2NXJA 4C08A 5F2OA 3SVZA 2V7EA 3OU6A 5GP1A 4BP1A 3UJAA 3I53A 2VP3A 3M33A 3I64A 2BH2A 5FULA 2ZVJA 5M5BA 2H00A 1KHHA 3G89A 2P3QA 2R6ZA 4PWYA 3CC8A 4OQEA 3LL7A 1NBIA 5CM2Z 1I1NA 3HCFA 3VYWA 3BT7A 5KVAA 1XCJA 3FYDA 3E7PA 2H11A 5DSTA 4IWNA 1RJGA 2CWWA 2ESRA 1VE3A 2AN3A 2I6GA 4PYOA 1TW2A 5D1NA 4QDJA 5EIWA 5D1HA 4YMGA 3R0QA 3EGVA 3O31A 4GQBA 4PYNA 2IH2A 2HTEA 2PX8A 4OA5A 3EVAA 4IV0A 1R00A 5K0EA 2IDKA 1U2ZA 4YUWA 1VPTA 2XYRA 4LWPA 5LQKA 2N47A 2GAFA 5MHTA 4AZWA 4DM3A 4EK9A 1KPGA 3GRVA 3SMQA 2ZZNA 5BXYA 2JG3A 5EOVA 4OBXA 3T7SA 4MWZA 4OA8A 2HWKA 2IH5A 3A7DA 2O0LA 4U7TB 2FYTA 2I7CA 3FPHA 2VZ9A 5EKUA 3G5TA 4EQZA 5EVJA 1ZGAA 2GS9A 3QOXA 3ER8A 2P3OA 3OZTA 3CJTA 1R74A 1YUBA 2IPXA 4OQDA 3T7TA 3G2OA 5ICGA 3HM2A 2PSSA 1BC5A 1Z3CA 3ANXA 3OE5A 4X60A 3I5UA 2CMGA 3KU1A 3BGDA 3OCJA 5EZSA 5EHIA 1D2GA 4FSDA 4EMSA 3EVCA 1XDSA 4CTJA 5K01A 2PV0A 2G70A 4MIKA 4R8SA 3CGGA 1DUSA 1NW8A 1X1BA 2BM9A 5DM0A 1BOOA 3EVEA 1P39A 4R8RA 3KQWA 5FA5A 2CMHA 3E8SA 1M0EA 2BR4A 3MB5A 3FPFA 4RVHA 4ER5A 3HP7A 3BXOA 4KWCA 3CJRA 3OZRA 5DXAA 4YV1A 1NT2A 2G72A 3KPJA 5T6BA 4PGHA 4F86A 1HMYA 3KQTA 3A7EA 3KQQA 1RI2A 4GF5A 3PLAE 5FADA 2QRVA 1INLA 3FTCA 2ZBPA 10MHA 5CUQA 3UA3A 2H1RA 3LHDA 2Z6QA 3E23A 2PVCA 2AOUB 1I4WA 3P2IA 5FUBA 1RJEA 1XVAA 3KR9A 4PCLA 4X41A 3EVZA 4WVLA 4EKIA 4PYJA 1R8YA 3M4XA 2AVDA 1NE2A 3T0IA 1ZKDA 2IFTA 3B7PA 2PT6A 3GJYA 4P7GA 4RTJA 2PT9A 1QAOA 4HTFA 2ORED 3CBGA 1V39A 2WK1A 3KHKA 4FGZA 5E1BA 5GINE 1YFLA 1MHTA 1KR5A 3BWBA 5JUWA 2PLWA 3BKWA 3UZUA 2PKWA 5EMLA 4BLUA 5K0CA 3B3GA 5DLYA 3WSTA 2JHCA 3LECA 3P8ZA 4EKGA 4V0RA 5KS2A 2PY6A 3EMBA 3MTIA 3OZSA 3M6WA 1JSXA 3KQMA 1ORHA 3P9IA 3PX2A 3UJBA 3EVBA 2VDUE 1ZHFA 2VS1A 1JQEA 3LCVB 1WZNA 2OB1A 2PX4A 3HVIA 3PFGA 4Z2YA 5DM1A 4HC4A 4R6XA 3AY0A 3PVCA 3SSMA 3UWPA 4ATNA 1NV9A 5CIYA 3NDJA 1SKMA 3LDGA 5G02A 5DX1A 3DMFA 2EFJA 5CVVA 4RTNA 2B3TA 4M7RA 3UJ8A 2F8LA 3HNRA 5DWQA 4HRAA 1OR8A 1G6Q1 1WXWA 3P9NA 4ER0A 1DCTA 3UA4A 1KYWA 1TPYA 4KIGA 4X61A 4PONA 1VBFA 4IKPA 3LPMA 3GO4A 2I9KA 2QE6A 5HILA 4RTSA 5DM4A 4KIFA 2XYVA 1L1EA 5DPMA 4ER6A 1EG2A 8MHTA 4RSRA 4PGGA 3G88A 5CVJA 4FSXA 4DCGA 3B3FA 2AOVA 4DZRA 2NP6A 1NW5A 4P7FA 4RYLA 3FTFA 1L3IA 5HFJA 1ZG3A 3SR4A 2ONYA 3LBFA 3EGEA 2HNKA 2YXLA 4H0NA 1RI3A 4RVFA 1QAMA 1YZ3A 5U4XA 2AZTA 2B9EA 3U81A 4PIMA 3K6RA 2P41A 1WG8A 2AS0A 4ISCA 5EHGA 3TQSA 5FHQA 2IBSA 5K03A 3E05A 4E31A 1WXXA 3FUWA 1EQAA 3DLIA 5EIFA 5FTWA 3FUVA 2NXCA 4RVDA 2O57A 3UJ6A 5E9QA 3VC2A 1EJ0A 2XVMA 3T7RA 1FP1D 2ZIEA 2ZBRA 5B1SA 2CKDA 5CD1A 2AN4A 3EEOA 3O4FA 1X19A 3I9FA 4HGYA 4X63A 5CVEA 4PYKA 1N7IA 1X1AA 2OPBA 3CKKA 3SSNA 3TPZA 4QVKA 2IIPA 3HCEA 4F85A 2UYHA 4XUDA 4HH4A 2VDWA 3EMDA 2ZWAA 1R6AA 3TLJA 1QYRA 4RTPA 3JWIA 1F38A 4A6DA 2PWPA 2XYQA 5FQOA 2YUIA 3FTEA 4RVGA 3IYLW 4RX1A 3L8DA 3G8AA 4GOOD 3O7WA 3DXYA 2G8NA 2ZIFA 1QAQA 3D2LA 1G60A 1M6EX 3GNLA 4RV9A 2AOUA 5E1DA 5P8WA 3THRA 3UJ7A 1IM8A 3LX6A 2PXAA 2OY0A 1NKVA 3FTDA 3P97A 5DX0A 3UFBA 1YF3A 4CKBA 4DF3A 1RI1A 4GUAA 3DTNA 4C07A 5BW5A 3JWHA 1FBNA 1ZGJA 2I62A 3DXZA 2C7OA 3M70A 3SX0A 4AZTA 2OBFA 4RTMA 2IH4A 4L7VA 5K8VA 4BP3A 1HNNA 3G8BA 3NTVA 1P1CA 2NNWB 4E2YA 1IY9A 1NW6A 3NMUF 7MHTA 5EEHA 2AR0A 3F4KA 4QTTB 2YX1A 3C3YA 5H02A 3TOSA 1FPQA 2PXXA 5K0JA 3GCZA 2UYCA 3SSOA 3ELWA 4HG2A 4PYMA 5GM2A 3PFHA 4B17A 1XXLA 1O54A 5C9ZA 5DT2A 4QQKA 4FR0A 4QDKA 2AOWA 5K0FA 2EJTA 2ONZA 4KVZA 3P2KA 3G2PA 4GOMD 4R6WA 3CVOA
chains in the Genus database with same CATH superfamily
4TMYA 1J8VA 1L7VC 1N2HA 2B2CA 1EIZA 2HL6A 3BBPA 3NHBA 3AETB 1JBKA 5B7GA 4BNTA 1YE5A 1LK5A 4P98A 2Q2NA 3DW3X 1TZKA 1XZDA 1Q57A 3AKYA 2Y2UA 3ZZUA 4KR3A 1YJXA 2H4WA 1J9EA 2HK8A 4DNOA 1I32A 1QQBA 5HR5A 5KO2A 1CF4A 2PUCA 3H19A 3C6QA 3IEPA 3A9TA 1RD4A 1HQKA 2XAUA 4MW2A 5LB2A 1LW6E 3TZHA 3WDMA 5CEJA 2PUBA 3WK7A 2ZANA 4KMSA 5JCXA 1GSAA 4YRFA 4XA8A 4ABYA 3TNYA 2OUIA 4BP8A 1J1UA 1CJMA 4C4AA 4JBXA 2BR3A 3F3KA 4I9GA 3H7IA 1ZCBA 4I4IA 2H29A 4WWHA 4ZVTA 3OZFA 2PTGA 2WD8A 2O2GA 1USGA 2I80A 4MB6A 4CGYA 5CEFA 1IHUA 4GVPA 1RCFA 4KQEA 3HA5A 2NUTB 4BQPA 1L1QA 1YL5A 1QS0A 1MNQA 1F2DA 2HRZA 2XT6A 3H83A 4RENA 3RC2A 4BC1A 4DIFA 4PRZA 2VWPA 5IXYA 2YVKA 4XVQA 4CQMA 4AI6A 1EI9A 5TPWA 4DFDA 4YJDA 2AMFA 3TZCA 3KVYA 3GRAA 1E3DA 4RJLA 3E3NA 1C8BA 4DA4A 2NQ8A 2X4LA 4A8PA 4IH1A 2F1JA 1MEOA 3B9BA 1RIFA 3R7FA 3RABA 3VUEA 4FQ8A 1KQ3A 2OXEA 5IAJA 3TL2A 4R0MA 5D3ZA 4GE0A 1ZP6A 1TUBA 1R16A 3DNFA 3T4EA 1E4EA 3G7UA 5AVWA 1QYVA 2FG6C 2G40A 4P7BA 1T4BA 5KX5F 1BN6A 1JVBA 3SE7A 4IRUB 3RHSA 1AA6A 2Q6VA 1JG6A 1EUZA 2YWRA 3V34A 3KKKA 2IUEA 3DJFA 4Z4FA 4NMLA 4K9LA 3S81A 4LMPA 2VJKA 4W5TA 5JSUA 2AFHE 4A2CA 4KUHA 2R6DA 2IBMA 4JASB 3JY6A 4EG3A 4DIOA 3A9CA 1Q0ZA 2FB9A 4BZPA 5TVKA 2DU8A 4ZCMA 1QRRA 3EZ2A 5AVXA 2HM7A 2IRWA 1UBGA 3CZCA 1PV2A 1S7GA 4YAIA 3OWOA 1FL9A 3P2MA 4QYSA 3OFJA 1EB8A 3ORFA 1RQGA 4UEQA 2CXNA 4AY4A 4YUVA 3PUHA 4QELA 3TKLA 4EKYA 1BU5A 3N2LA 4ZOQI 1Q0SA 1SVLA 4FBLA 2HPHA 4PSUA 5B1HA 1CY7A 4ND4A 5A05A 3EEBA 3A0UA 3S2SA 2PAFA 1R4MB 1TW3A 3OHSX 2LV8A 2IW1A 3NFRA 1LQTA 3DMGA 4R8MA 4XQGA 2CXSA 2YWEA 2ZSEA 3N8KA 1FXUA 2XOKD 5C0OE 3OCYA 2XUGA 4KSYA 1EDZA 3Q8KA 1U6IA 2Y1WA 3F6EX 3L1JA 3KAKA 3QVTA 1MCZA 2CLEB 4HDRA 2PBFA 2E9SA 2R1ZA 3V42A 2C03A 4FD3A 4J0JA 1H0SA 4KWTA 2J3DA 2QNIA 2ZBDA 3BH6A 3DZBA 4L7QA 2KSQA 1DKLA 3QX9A 3UC5A 3CKYA 4D3YA 4XVCA 3OQ1A 4JUCA 5BSRA 4J7UA 3RS9A 2BJVA 1NR5A 5IMBA 3A8TA 3PP8A 4HPWA 4L5BA 1H3FA 4M55A 2RHRA 3ZDXB 5LA6B 2RH4A 5AM5A 3SYRA 1YR6A 1SUSA 4JBLA 4HZUA 4TTTS 4ROSA 2HHHB 1SUIA 3DMDA 4MTLA 4JYZA 2J3LA 2Z57A 3ZE6A 2NTJA 1UJ4A 4KYIB 1CUAA 1DT3A 1NIPA 3B3JA 3K4QA 4JUFA 2N1MA 4HQRA 3D8BA 1F48A 1J2JA 2CCGA 2X9LA 3A70A 3O8LA 2F2TA 2H9YA 1MLDA 2HR1A 3COYA 4JK3A 2DCUA 1ESCA 1WU8A 1YZHA 2OD2A 2FKAA 2VBFA 3INRA 4XDYA 2EZ4A 2R0QC 4I3HA 2GXAA 3PJDA 3R6TA 5T3YA 4ENTA 1KH3A 1Z2DA 3N1UA 4G4IA 4J03A 4ZGGA 5KJ6A 1COWD 1UXHA 2SNIE 4FOOA 4UD6A 3NEYA 5JXJA 3OKAA 5EEGA 4DCMA 4OIFA 3KJQA 3ZX4A 2AWOA 3UGKA 1D2MA 2XADA 1OTHA 1CWUA 1KMQA 2B0CA 3NYRA 4KN5A 4LNUA 3MFYA 1CY1A 1EQ2A 1RM0A 1VJ1A 1DGQA 3NXKA 1V5FA 3EBOA 4MINA 1N2IA 1T36A 1Z74A 3AI2A 3IJ5A 3TQQA 2WJHA 4FYKA 3O3MB 1VRVA 2DPGA 3EAFA 3FMGA 1WZCA 3E70C 3LF2A 4FYJA 4NECA 1OPRA 3PC3A 4BCBA 2YQZA 1OJLA 1UBKS 3H8WA 5KNBA 3TM5A 4D41A 5DEIA 4ZAFA 2C7QA 1UADA 2EHJA 3D1VA 2ECQA 1GPNA 4F4IA 1UK8A 3MOGA 3OZVA 5BN5B 4BFXA 3PNVA 1IJEA 3HK2A 1J42A 1N5MA 1CR4A 2AT1A 2EGHA 2EX4A 3AUTA 2BKXA 3PTLA 1ZJZA 4F3CA 3DQQA 5H5JA 1GA1A 1V3VA 3H11B 4G0ZA 3W3ZB 4GKJB 1BWPA 4GOXA 4BO6A 4HXEB 2PU7A 5TMEA 5ALRA 1HDZA 4KRGA 4HVCA 1WV1A 3AR4A 1WQ3A 4LJ8A 2PAAA 3M3PA 1F8GA 1SZJG 1QZ3A 4R0NA 1N2CA 4M1KA 3M8KA 2MTBA 4RXTA 1B41A 1HYGA 3HB7A 2AUNA 2IZ5A 2O7NA 3AT1A 1GG2A 2B25A 3HN7A 3DBLB 2PWAA 1XA3A 1RAHA 2P9QA 3EZ6A 1OF1A 1ECLA 3JZDA 3NO4A 5G4LA 4M0FA 5B53A 3TAUA 3H2HA 1NN5A 2O2SA 2Q28A 1ZU4A 2R68A 5FOSA 4AY5A 1A2BA 3N5KA 3ERCA 1SUBA 4JVNA 2PWBA 3FDZB 1QO9A 5EP2A 2Q46A 1E1KA 5KDLA 4QL3A 1BMTA 5TRTA 3B8EA 3VR6H 1C2YA 1G8PA 2ZB2A 5CK5A 3WWDA 4WECA 5CFMA 3QNWA 4BVJA 2QXUA 4LQ4A 2C98A 3BQMB 4L3WA 5JE8A 4AF6A 4LBZA 2R6AA 5AK3A 2HSEA 4G1VA 4B4OA 3OQNA 2M2IA 3G5MA 3W5HA 4MDYA 3EGCA 4BUZA 1KETA 1EFLA 1RAIA 3EEFA 3SZGA 2PZGA 4DANA 3OBBA 1N0UA 2JAXA 2JIZA 2I67A 5B58C 1UFQA 2O8BA 1Z0JA 3ICEA 1JQDA 1JHUA 2I4TA 1ESDA 2ERCA 2O23A 3ZCSA 3ZIAA 4EG8A 5JD4A 2OWEA 1LDYA 4Q4CA 4KXXA 3RT9A 4JITA 3NOVA 4KIUA 4ZYYA 1JH9A 1O58A 4C0HA 4I1VA 4OX9Y 4RHXA 3SYLA 3T9CA 5JR3A 1D4AA 2BP7A 2IP2A 5FWXB 2A94A 4GPBA 4GP6A 1RHJA 4PVCA 1P91A 5F23A 3VDQA 1KSHA 1HT1E 2CBGA 2D2FA 5IKPA 1WKCA 2RSLA 2XXJA 3EXFA 3JQBA 4WZAE 3OQIB 2BUCA 2BH2A 3ND6A 3JQGA 2X86A 3HKCA 3V9AA 5AVUA 5JNWA 2W6ID 5JW6A 3OZGA 1C3XA 3N8HA 4X6UA 2WTMA 2DLDA 4TKUB 3O1IC 1M34A 2BMJA 2RG1A 2BEUB 4F2WA 5LNK1 5AM0A 2YASA 3ZD8A 3GCGA 3Q0TA 1VMEA 3E2PA 4NEQA 4Q00A 4X24A 4RABA 1WPQA 1QBGA 4QU0A 1FMFA 2BRUC 4QDJA 4GQBA 3KT0A 5LIRA 1ECFA 2XSZA 1YQ9A 5CT5A 1WETA 1L5VA 1T29A 3BYZA 5EXTA 1ZOLA 1VHJA 3HKBB 3JZAA 3PC4A 4NICA 3REFA 2XF8A 3FWYA 5EJ8A 1C1XB 1Q7BA 2A1UB 2J0UB 3H5WA 5HFAA 4IEIA 5HIAA 3S0JA 2QP9X 2P2DA 3U62A 2RGDA 1HDYA 3WYEA 4MWZA 4L27A 2NO0A 4EQZA 3SOZA 3SS9X 1LBIA 1JLKA 3E53A 4WUTA 5CXQA 1A4RA 3T3IA 1AX9A 1YKFA 3EIEA 2F1OA 3H18A 4PPGA 3AYZB 3HH8A 4P32A 3ZZMA 3AF1A 1WMEA 1Z3CA 4PN3A 2RGGA 3MWLA 3OFSA 3E81A 4XB1A 4FK8A 3JRWA 1LNZA 2Q6IA 1K4MA 2Y1CA 3K30A 3WL3A 3EYAA 2PUHA 2R25B 5KNCH 3T9FA 1UXKA 3TQRA 4P36A 1X1BA 2WP0A 2DR3A 4DCUA 3BHMA 3IPCA 3TSYA 4EB3A 2XMBA 4G01B 5AHKA 1BDIA 2CWDA 5TQ0A 3ZK7A 4ARSA 5MGNA 3VKVA 3C7AA 4UBNA 3U49A 4KWCA 5B58T 4PZUA 3QMMA 5HQJA 3SQDA 3KZCA 3W8FA 4F4HA 4YJFA 3T9DA 1Z73A 5KMGB 1ISMA 4HFNA 4M3NA 5T6BA 3FFAA 4FPXA 2ATCA 1DJLA 4RXUA 2ONKA 1INLA 1E6UA 1IZZA 3AZQA 4MWTA 5C7LO 1HDRA 2P4QA 1G5RA 1U5BB 1MOPA 2H16A 4DM4A 5HP4A 1K2VN 2Z6QA 4G0VA 1SCJA 3WRWA 2J87A 2JL1A 2R87A 5CFQA 3RUAA 1Y6FA 2QQ5A 5IW8A 1VGRA 1XVAA 2VTBB 1VI5A 4NATA 3KQUA 1NUQA 3IUNA 1PT8A 5K2OA 3D02A 2KBEA 1KEKA 1M5RA 3KWMA 4RF5A 4H59A 4NFSA 3R76A 1TUGA 1N6KA 1K3FA 1APBA 3S1SA 3F2IA 3BJZA 5KTRA 4YO8A 3KV3O 3INTA 4A0GA 2HF8A 3IFSA 3RLIA 4KQJA 1Z18A 1H6BA 3A1WA 4EKGA 4V0RA 5KS2A 4WXYB 5IN4A 1GPMA 3F5FA 3M6WA 1G21B 1CQXA 3B9QA 4R8KA 4OK3A 3ZDFA 4PC1A 2L18A 3T0FA 2Z6VA 1LUAA 1KSJA 4BO2A 4Z2YA 4DMRA 1T2FA 1BE8A 3INYA 2DPHA 4HH3C 3RGWS 3WMEA 2WWYA 2FGKA 4Q39A 2ZR9A 3G8DA 4Q1CA 3TSCA 1NBWB 2GCEA 4F7WA 4WFKA 1EX1A 5LDGA 1P0IA 1OC4A 1QRUA 2G8LA 2OE2A 3P9NA 4HAUA 2C9CA 3QRWA 4PBRA 1KNQA 4PZYA 1OT3A 1G7RA 1QC5B 3KOZA 2QTAA 4KIGA 3TNLA 4ZI2A 4MQFA 4IKPA 4F92B 1A8UA 3KVOA 4K05A 3WGHA 5A5EA 1E6WA 2HQOA 1M8FA 4D3FA 1Q3HA 3FKSD 2FRDA 3EAGA 4RY9A 1NX9A 3QIVA 5D5QA 1IOVA 4GOKA 3I0MA 1BSVA 5GZ3A 4UEOA 1PG0A 4ND3A 1B8NA 3AP2A 3I6QA 1XSEA 3R44A 4J4BA 5FUMA 1J07A 4FDLA 1QHYA 5BN1A 5HF5A 5ALMA 3JVEA 4LI0A 4E7PA 2QUIA 3LBFA 1F4VA 4AS2A 4D6PA 2HNKA 3S99A 5K3CA 1N9GB 1XMPA 4PZPA 5JSKA 1Z4OA 3VAZA 2D5IA 4NJMB 1RHUA 1NL3A 2CLLB 4QFCA 3U81A 4CCYA 5CIWA 2DSTA 1J1ZA 2QORA 3CLRC 4C4SA 1W0KA 4OL0A 4KFUA 3LKVA 4W99A 5FLXA 1YIAA 3CLVA 3G68A 3WHLA 2ON6A 3X1JA 4DDWA 4YLEA 1CY4A 1DPGA 2B4TO 2XD4A 3VU1A 1UMDB 1PU2A 1XO1A 2I29A 2IXAA 2WVGA 3GMSA 4DQDA 1WBDA 4R16A 1JL3A 4ETWA 1E4OA 2H4YA 1RMTA 2X8AA 3DFIA 4MVJP 1ICEA 1QE3A 4Z4IA 1UDCA 2QE7D 3B6IA 1T9BA 5LQSA 3B1KA 2RMKA 3OC0A 2J3IA 1THMA 5LUBA 4OB8A 1EG7A 2QJWA 3SDZA 3CKKA 1CFJA 3MJSA 4TYPA 2P90A 3P7MA 3DE7X 4G6ZA 3V48A 2O8CB 3L1IA 3L7MA 1VSQA 2B8EA 2PRIA 1EEHA 4DV3B 4QU8A 3HKEA 1N32B 1F38A 5B4UA 5IK2D 4XX0B 2ATVA 3TTYA 3DMYA 5CJPA 1A50B 4AJPA 5KYWB 1NTOA 1F60A 2AC4A 2PH5A 3NHJA 3VYVA 2L69A 1H2FA 1ID1A 2XVYA 3GLSA 5JYDA 1GEGA 1ULAA 2VC2B 3RSLA 4RM2A 4C7OB 3BZUA 2O8EA 1BOFA 4Z3OA 5BN5A 1YQWA 1YXMA 3T7CA 4ZVOA 4IMJB 3TNFA 1I4OA 3DHNA 3K20A 3SXUB 2C78A 3S2UA 4Z7QB 1Z6PA 3HDYA 1CEYA 1F9EA 1TI7A 5HGXA 2X1LA 2RGWA 4FZ5A 3BAFA 3GLHE 4KXQA 1ZLXA 3IVGA 3OEED 3PYXA 4O4LA 4A82A 1UDAA 2C4NA 3WHKA 4MKRA 2O2ZA 5A0TA 4HQ0A 4JL5A 2A84A 4FEYA 2EJWA 4MW5A 4RL4A 4RZSA 3WLPA 4DCOA 3MMXA 2OO7A 4JWTA 3SYMA 2MT9A 3ILYA 3DBLA 2Q4EA 4PLTA 3SSOA 4DQVA 4HRXA 3GGGA 1UJ6A 5HUHA 2AB0A 5HF9A 4L4RA 5A9SB 3H3JA 2WKPA 3GJTA 5C9ZA 4HH0A 3DYBA 1K27A 1SD2A 4LFCB 2B94A 1JAYA 1LKZA 4LYEA 3JXEA 5H70A 4B2IA 1L0BA 2P3SA 3A3KA 1JZSA 4HEQA 5EGSA 3UAXA 1VL8A 3VR1A 5AM1A 4C1BA 1P5JA 4EI7A 1Z7GA 3WGOA 3EZFA 1HE5A 1FRFS 3EIHA 4QEZA 5IANA 3TSZA 4F2HA 2PJUA 5DTQA 2ENUA 1E5LA 4YI3A 5B2FA 5CURA 2XUIA 2Q4TA 5JMPA 1M2FA 3S4YA 2A33A 3C1UA 3UIEA 1JI3A 3FOFC 1D09A 2ZBUA 1LLQA 1NVFA 3FPLA 4FW9A 3FF1A 1GAXA 1WXGA 1FSPA 1RJ9B 2FP3A 3AM5A 2CDNA 2CFRA 2O0HA 2O2HA 3KSZO 5FTJA 3T7EA 4RBNA 1CSEE 5JATA 1TF2A 4YRTA 3IMEA 3L7YA 1DWOA 3DONA 3K15A 1I3LA 3PJFA 2SKEA 4Q66C 1JFLA 1Z56C 1Z5OA 4FHEA 5FWXA 3ZQ4A 1RKUA 2O8DA 2G71A 2ZG6A 4OHBA 1DBSA 2AXNA 4ARBA 2B78A 4ZMSA 4H4EA 2I99A 5A62A 2WDZA 3FCYA 2JIOA 4DWOA 4GKBA 2ASEA 2J0EA 3GV0A 4KV7A 3O90A 1JQLB 2W2PA 3FH0A 4Q02A 1Z4NA 2CVZA 2HA4A 1QGAA 2QDXA 1ZIOA 1FIUA 3RF6A 3QE2A 2BEUA 2AFIA 1AQ6A 1SB8A 4M46A 1WP9A 1BW9B 2C2HA 2VN8A 3KOMA 1GCAA 1KFBB 3GAMA 1VYUA 1K5HA 1UXOA 1R2QA 2G76A 3IV6A 3QLUA 4XJXA 1XRSB 5KQRA 3CLUD 2I87A 3N6XA 3IP9A 1PJLA 3HL0A 2OENG 3FYCA 3ER6A 5M7EA 1ZCAA 1VSVA 3IAHA 2FMIA 1RWVA 2GI4A 2Q27A 2QPLA 3KB8A 3WBBA 4ALMA 3KT8A 1KJWA 2A1TS 3RANA 2H4HA 2O2JA 4JGGA 3T94A 4EA7A 2A1UA 4Z7OB 1R4AA 5JSFA 1TTHA 3HJGA 1S01A 5CXSA 1G18A 2WD7A 1BS9A 1GFWA 2ZYSA 1YKSA 3H1TA 3I2HA 1SHUX 4JR1A 4CMCA 2WM8A 3C8MA 3EF0A 3JQDA 3GDGA 1LX7A 4KAFA 1YFJA 1KAHA 2KI5A 2NZ8A 3ESQA 5K0NA 1UINA 2J0VA 4NHOA 3WOVA 3KQVA 1L9XA 4UCWA 1GNTA 5T3UA 1ZMXA 4ZYZA 3BFKA 2PZFA 3C8DA 1E1QD 1E62A 4Q4HB 3EGWA 5CA1B 1H9AA 1DRWA 3BK2A 3G85A 1IWBB 4UULA 3KQYA 3D6UA 3HCDA 5DEOA 4RZ2A 2IV7A 1P19A 4R69A 3D3NA 2W83A 4EENA 2WZBA 4RTQA 1OXSC 4KVGA 1GTVA 3IAM1 5TEWA 2ZREA 3TQTA 4MVJM 2VPYA 4P5EA 1P8JA 1RYMA 1FFHA 1WXFA 2PH1A 2X6TA 2NN3C 2FGJA 1LWNA 4KG7A 2V9ZA 2V97A 4H77A 4Z8YA 2JFVA 4Q3EA 5GQSA 2BFWA 4UPDA 4E5YA 5TB5A 1HZZC 1AS2A 4C30A 5HS6A 2OB2A 4EHKA 3KPUA 3H0KA 4IIXA 4M38A 3KLPX 2ZOSA 2I5PO 4IYJA 4X0EA 3JQ9A 5ITVA 1PR0A 1VYTA 3FLAA 1J20A 2ZRHA 5K51A 1GUAA 4BMZA 3TBFA 1VP3A 3IUJA 2JPDA 4W8GA 1IL0A 4FIDA 4KRFA 5FFFA 2BEVB 1KGSA 1RAEA 1L4UA 3CR8A 3OLVA 3IBCA 4NBRA 2RI1A 5TQ2B 2JH3A 2YNMC 4WNAA 3WBJA 4CBVA 4GBJA 1PGJA 3ZCXA 4LXUA 4BKOA 4QYIA 1NMEA 3CG4A 1TM4E 4GC9A 1C1HA 3HFSA 1TEHA 1SXJB 3H6GA 1MTZA 3SM3A 1FTNA 4JMPA 2ZBFA 4RPKA 4I6EA 4YJ2A 3BL6A 1F9AA 1G21A 2YIDA 1NI4A 1O77A 1USIA 2W0MA 4QHTA 3TYXA 5KQLA 3NDIA 4FT2A 3GVCA 4AMZA 2R4QA 3D0OA 5LMUB 1ZMBA 1OREA 2Q07A 1TQ2A 2G9VA 3NHWA 4JT2A 4KPFC 3TB4A 3UAVA 4G1FA 4KQMA 1SZCA 5L3RA 1SQ0A 3S70A 2ZRFA 2A3RA 2VCYA 3W05A 1WNFA 3NTQA 4KXMA 3DYIA 4EOGA 2VAPA 1VSUA 5HJEA 3EVGA 3A1SA 3VH1A 2Y6UA 3ABOB 3QJGA 1QC5A 4HY3A 1AGRA 5CLHA 5BRNA 1IIBA 4CHTA 2WU8A 5IBPA 1SKBA 2A30A 4HV4A 1R12A 2JGRA 3CNOA 2ZTUA 1DC6A 1E2LA 1HDIA 5ALOA 1OH5A 1RAAA 3RDPA 3GA7A 3RS3A 2AUMA 3L6DA 1ZOOA 2B9VA 3O8QA 3A9SA 2HMVA 5TEVA 1WW3A 1H6AA 1QF9A 2WHXA 1X7ZB 5F35A 3FCOA 1K3UB 2IZZA 3K9FC 1I3KA 2QGZA 4AF7A 3MJDA 1MW8X 2H18A 5J2TF 5D51S 2V03A 1BEZA 4KO1S 2OR3A 4JJ4A 4ZV4A 4X7PA 2FUG6 1QPBA 1F0YA 1SQFA 2FTKE 5JYCA 1XNQB 2BLNA 3P71T 3E9YA 4OXXA 4CXMA 1QP7A 2HRRA 2UUCB 1FNNA 3JASB 4P81A 3IVRA 3CXUA 3I34X 621PA 6NULA 4YV2A 4GIBA 1FCJA 4IEFB 2FZGA 1QF7A 3EC2A 4MQBA 1PV4A 1BEUB 3T1TA 1NV8A 3PC7A 1G66A 4EATA 1UMDA 3I45A 3TW6A 1MZPA 3OA2A 2YQ4A 3M6UA 4U7JA 5JY1A 1Q1QA 3GLGA 2JS7A 2Z3WA 3B1ZA 3CGWA 3PUWA 3QEOA 5IJ9B 3QBTA 3MWJA 4LJ9A 5IABA 2QL7A 3AUJB 2G1KA 3SGLA 4GL4A 1UT5A 5K0LA 1X1TA 2CN1A 4R5MA 1ZICA 1M2EA 3S1LA 4AWAA 3WAJA 2AOTA 4QBHA 4AFNA 2KM1A 4XRGA 1MD9A 1KJQA 2QT9A 4ZYUA 3NAZA 4E33A 2V6FA 4XX0A 2NTNA 2FMUA 3CB4A 2XZPA 1O6FA 4NV3A 2BKVA 2P4SA 3WRYA 4D8XA 5BNIA 3SFVA 2CK3D 4TV9B 3TZBA 4CIDA 3KSDO 2HIGA 4C7OA 4N12A 3L0ZA 3DZKA 3LLSA 2LD4A 5CCBA 4NYMR 1KU6A 3DOEA 1E2NA 2BTQB 1OTYA 2F43B 1GLVA 4MWGA 3ZEAA 1KH1A 2BFDB 2AJCA 2GOYA 2VQ6A 1CDZA 1KRXA 2B5WA 2PRYA 3M5PA 5E9JA 1T6NA 3B2QA 3HGTA 3ZW7A 2QN7A 1TJ5A 3RS7A 5J4LA 3ZCTA 1TVMA 1Z06A 2VYVD 3OH8A 3M81A 4BLVA 4QSHA 2A8YA 1COZA 4UHHA 4CQJA 2XJ4A 5TPZD 2A9OA 2WJZB 3R3XA 1U3DA 1WB4A 4G5HA 4OTZA 1S89A 3DC7A 3SVZA 3RRNA 4DMUB 5EE0A 2FRDC 2IYEA 4U8GA 4BP1A 1YACA 1YR1A 4HLNA 1F1JA 2Y9PB 4NOKA 2GDJA 3KJHA 3K5HA 5BQPA 4U2BA 3E8MA 3HC7A 2HFJA 3M49A 5DWDA 3FY4A 4EAAA 2DBZA 4MV6A 1EXDA 1X0VA 1CS4C 2IZOA 4HSEA 3E5RA 2IHTA 1Z0FA 4QYTA 3DDHA 3FYDA 2J1LA 2V6BA 4MTCA 2QMQA 1LSUA 4NDAA 1QHNA 2ZE8A 3G0BA 2HDOA 3HY6A 4HUQA 4OFZA 4RHFA 1Z4LA 2OG1A 2H0QA 4H7KA 1K5PA 4L85A 3UK6A 3KWFA 1I13A 2I78A 4KQ2A 2NPOA 3R0QA 3EW7A 3O31A 3T3NA 1OXVA 3AP3A 4B44A 3C4QA 1CJBA 2IIVA 4ODIA 4D9IA 4JVLA 3CZQA 2XKAA 4LXIA 1V25A 1V1MB 1E7RA 2QM0A 4UCFA 4CJXA 3CH4B 2FN3A 4LXGA 4E5MA 4AJNA 4AZWA 4ZOCA 4GMHA 1YTLA 1B8VA 1L8OA 2ZSBA 2OA0A 1Z88A 1AZTA 1JJVA 2DFLA 4F56A 4FWBA 1RJ9A 1K97A 3AEUB 2FYTA 1ESEA 3KKOA 4DRXB 3GT0A 1JU4A 4FYHA 3QFHA 5A3QA 3K31A 3VR0A 4KB5A 5JAIA 2DBYA 3ER8A 4B6FA 3CUTA 1XCMA 2NPFA 2MDTA 1P1IA 2ZRQA 3HMQA 2QUHA 3JS5A 1KMNA 4LDAA 1N5LA 5LXTF 1QV7A 3KU1A 4WMLA 2VF7A 3ZOKA 1FYEA 2ZSIA 5K01A 2VHJA 1HL3A 1FNBA 3MNFA 4ETNA 1YWGO 5TSDA 3RSHA 4X45A 4RKFA 2VNHA 4LPSA 5A2GA 1MF7A 4ER5A 2JGIA 2ZBEA 2IU4A 3IH5A 3IO3A 4KKVA 4DQUA 4Z5XA 2JFXA 1UQRA 5F1KA 5TGDA 1BW9A 5L4NA 5C1PA 3K8YA 1XKQA 3LGXA 4OXKA 3WJ1A 3UYLA 1QH8B 2BC9A 4KACA 2XR1A 5KWIA 4POAA 4ZYVA 5LMZA 2IHBA 5JG7A 4ZI3A 4ESEA 1X92A 1P2GA 4PCLA 2JDIA 5HDQA 3AM1A 2I03A 4YR7A 4I5GA 4D8YA 3T0IA 1L8XA 1ZKDA 2Q6KA 4RWEA 3MOSA 3V1TC 1ZNQO 5LWQA 4MI1A 5AI0A 1QRTA 3LBIA 4RSGA 1O95C 3QVLA 3ZE8A 1KR5A 4ENVA 2F7SA 4TZTA 3SZMA 4NBWA 3X1MA 1Q0PA 4JI0B 4LOIA 1Y8QB 1Z5PA 2WUFA 4PHCA 2EWWA 1PI3A 3BE8A 3FOCA 1Q1NA 2JHCA 4LZNA 4Q7QA 4LJ4A 4LJ7A 5DCYA 1MVOA 2NVUB 2QX8A 1ORHA 3PJEA 3PX2A 1LRLA 2XWBF 2QX4A 1LXCA 3GCWA 2IY7A 2WWFA 4WNCA 3UHPA 1SIWA 1EM6A 2WU1A 1C7RA 4MW0A 2BFCB 1N0IA 3ZWPA 2HDNB 4WLFA 3ZE9A 1KVRA 1WHSB 1PUIA 2B2NA 4QDXA 4RC9A 4UASA 1N77A 2QY9A 3DL2A 5JTTA 1L5QA 4V0KA 2JANA 2IWRA 1SXIA 4LYJA 4PONA 4B6SA 5A6SA 3QU9A 4F1WA 1C0EA 1ZVKA 3F78A 4WA7A 3GA5A 5GJVC 3V7WA 1T25A 3WLJA 2YWBA 2O0KA 2Z1NA 3HWWA 4PGGA 2VSFA 3BA1A 2JNWA 1YVDA 1U0FA 2TMKA 4HWSA 1S2IA 4Y1RA 4YAKA 2JVKA 3ZTTA 3WNZA 1XDWA 3KP1A 3QI7A 1O94D 4IRXA 1GGEA 3RC7A 1PS8A 1HRKA 2OAQ1 5T4FA 5AQ1A 1IUOA 2HQBA 4B5KA 5U4XA 1PVDA 4NV1A 4MZXA 3DFFA 3FWZA 1NIJA 2B61A 2FNAA 3BEOA 1YIDA 2FR8A 3AKCA 1SXJA 3KXPA 2YWHA 5JQGF 4HN4B 3OLYA 5FHQA 5T7BA 2FPIA 2J5BA 5I4BA 4CLHA 3FAZA 5AM4A 3A6DA 1FBTA 2P9HA 1M66A 4U7WA 2BUAA 1VBMA 2Q5FA 1Z0IA 3QLUC 1DDGA 3HCWA 4MUFA 3NUQA 4RFLA 5FTWA 4NNOA 4I9UA 3EODA 3LS2A 3QP9A 4KFRA 4LX8A 4RVDA 4AP6A 3D7SA 4MCHA 2ZIEA 4DEYA 4QDUA 1NDUA 4Y2VA 4HDCA 1RYDA 2XECA 1L5KA 3O2JA 3WBKA 3ZGLA 2K7FA 2VH5R 3WSVA 1ZVQA 2I7TA 2ZRBA 4M0CA 4C7MA 2PL3A 2Z30A 3I23A 4CEHA 1KEEA 2Q1UA 3E7FA 2P6MA 2C7BA 3HB1A 1K06A 2DGDA 1UBCA 2BFAA 1N2OA 2V54A 2XUQA 4NJEA 1DG9A 3SS7X 1H23A 2EFGA 2OZPA 4BVHA 1I10A 1U0RA 3HJFA 3W4JA 3GJ5A 1NFFA 4EQ6B 2QAIA 5BR4A 4RD6A 1B0PA 3H5VA 5K45A 4GMXA 1XE3A 3PIIA 4AQDA 3JR3A 3ECAA 5BO5A 4IJ6A 5CX4A 5JH7A 1MUUA 2RGEA 2FSVC 3B5JA 4BVGA 2VT2A 3A32A 2BCGY 4CT5A 3D2LA 1O3YA 3G13A 2QR3A 2VDKB 1C9YA 3T5CA 4JNKA 2YW2A 4ENQA 1EJ2A 2NNLD 2PZLA 4M54A 1MGPA 4RE5A 3VJLA 3E0QA 4QGSA 1W6UA 5FBKA 1PVVA 4URFA 4EO9A 1W0JD 4R5HA 1GQOA 4M0UA 4UUOA 3UB3A 4JX9A 2CB9A 3I6ZA 3QX8A 3ZD7A 1XQVA 4MP6A 1XLTA 1YVEI 2PBLA 1BE6A 4JELA 3SU8A 5FPKA 4EL0A 3EZYA 1JB1A 1JF8A 1JGTA 1NVDA 1T2DA 3ZTWA 2AR0A 3QMVA 4MPTA 5L7WA 1H2AS 1S9DA 3LGSA 1WP4A 3L8FA 5FX2A 2QD5A 5CM9C 2N46A 2IOHA 4BMVA 3NOQA 4H3SA 2E3JA 2XDQB 4DC1A 1T5IA 4EHLA 4BMXA 5BQ3A 4KR2A 5E4JA 4N3GA 3UXHA 4UVEA 3H8VA 3Q3HA 2QD3A 3WQBA 4E14A 4ZHQF 4D9EA 2G4LA 2W2TA 3P32A 3EPPA 2R7MA 4LC9A 3QLVC 5T4EA 4DA6A 3VA7A 1YHZA 1MO5A 1GTRA 4B73A 4W5QA 2XUZA 4U7HA 2P7HA 1P0MA 4UCQA 1UZLA 3EXAA 3LHSA 3T95A 4EG7A 2V74B 4L22A 3ZCVA 2MR5A 4BNDB 3ZKAA 3KYJB 4LX0A 2CFTA 4BFZA 4UZFA 3UMRA 1B93A 1KZHA 2VWGA 3ETHA 3AW9A 4UNIA 1J0DA 1OGJA 1P9WA 2TECE 3DDWA 3V33A 2BTQA 1KZ9A 2D74A 2WVAA 2GNAA 2HDWA 1YR2A 5LLSA 3U7IA 1I0IA 1DI0A 1FRZA 4FN5A 4J4TA 3UK0A 2DLNA 4AS3A 4D42A 3EDQA 1KDRA 5IULC 1QIKA 4DIDA 1ZDMA 4B84A 1ZH0A 2D00A 5BWBA 3WISA 1UAYA 3HJBA 4IGKA 3TK1A 2R4TA 3A1UA 3PNBA 4RETA 1MQAA 4IZHA 3VKHA 3QU2A 3AVQA 1KOGA 1JYFA 2J85A 4E03A 2NUBA 5KC8A 3W5VA 3CTMA 3MHTA 2AV6A 5ILOA 1UFKA 3WIEA 2QAGA 4UJ5A 4E2FA 2OTCA 3ME5A 3HA3A 4M0PA 1JFRA 4ID9A 4RF4A 4UM5A 5HCUA 4TKLA 4CKXA 2DYKA 4GU5A 1QKIA 1WQ4A 1QVAA 5IT9A 8GPBA 2HMWA 1H0KA 2IA5A 1LI5A 3R09A 4GQAA 4QFDA 2FFQA 1YKGA 3TW4A 4P4UA 5CFNA 4LYDA 4PYIA 3A27A 2JIRA 2V98A 2ZWPA 3DBOB 3LC0A 3U19A 1QYCA 3OE4A 1ZN8A 1UP6A 3MTAA 2ZIGA 3BWCA 1OB2A 1J2YA 2F4VB 1E7QA 1TD1A 1HH4A 1NF2A 2OCDA 3HCBA 2A1TR 1CV2A 1ZA2A 2NO5A 1GYRA 4GEKA 6YASA 4UUQA 2PXCA 4D6YA 5AKIA 4TLCA 4S04A 3TLBA 4PO3X 3PFNA 2QL5A 2QJRA 1FXWF 5CVUA 2OHFA 5KOJB 4HDMA 3PGLA 3V8MA 1XKTA 4QQNA 1GRCA 1TJ3A 2COEA 2O3TA 4YT5A 5EL0A 3RSGA 3U4QB 2VJLA 4NPCA 1OFGA 1XZJA 1US8B 3K9QO 3EA5A 2WW8A 1YQGA 1M74A 2RH8A 1RLJA 4O4JB 5D8DA 1QNFA 3AR2A 3GW8A 3IR7A 5G3ZA 3VR5D 3FUUA 4XYEA 4BB0A 4DQXA 1KS2A 3BB4A 2EDCA 2QD1A 3KUXA 4ZOBA 4FOLA 3N8DA 1KYTA 3QPUA 5GJBA 4OO3A 2AF4C 4R05A 4WN9A 3VISA 1CPYA 2B6NA 3OZBA 4IP0A 3QKSB 1JWAB 4M98A 1XDUA 4DXHA 3IE1A 1UKAA 2HWXA 3HCAA 2ZSUA 2BFEA 3HZZA 4G1UC 4AXXA 1B42A 2FEKA 3ESRA 5KNLA 3O4RA 1QIJA 1QOPB 2DOKA 3CU5A 3ZN2A 4IO0A 1EZ1A 3JRXA 3H8SA 5EWLB 4EDFA 2N75A 2RGBA 2CW5A 5ITZB 5JYBA 2O5RA 3GJSA 4NEHB 1JU9A 3HEBA 4C4PA 1TJ4A 5DNYB 4DMGA 3L0OA 4WXPA 3U3MA 1E6EA 1LK0A 3WGZA 4S05A 4TYNA 3EFBA 4WERA 5FLEX 3PEVA 5A02A 2W6JA 4ZYWA 4DNFA 2CFOA 4RL6A 4TN5A 5BVGA 4OBBA 1LDMA 4N8EA 1Y81A 4CT0A 1STOA 1N2EA 1Z45A 3ZHQA 2PSHA 1TTPB 4GRDA 5JEDA 5CDSA 5JJ5A 4EGQA 2OLKA 2AEFA 3NHKA 1WLYA 2DWUA 5GOTA 1M67A 2V7UA 3NWBA 3AR5A 1E5VA 4IDCA 3R9XB 3QEKA 4PBSA 4AMYA 1G6KA 3AF5A 3FDXA 3U56A 4ESHA 3SBXA 2E85A 3ZH9B 4RD0A 3OPMA 3AVVA 2WU4A 4Q6BA 1F0NA 3NHAA 1CVLA 3PQ8A 2PMDA 3CSDA 2GX6A 1NTRA 3HHPA 4NESA 2R6HA 1U0SY 1ZBDA 2RGUA 1WB9A 1BS2A 1ZIYA 5ESDA 4YDQA 2C5FA 5JSZB 1ZMRA 4A92A 4TMFA 1EJ6A 2GA9A 2ZVPX 3F3SA 2AJ8A 1PTKA 2DWQA 1TUIA 2ZUCA 1JHZA 1HKUA 4Y2SA 3DTYA 2AD1A 2EJUA 4JQOA 2WSLA 3O03A 1TC1A 2J46A 5ED4A 1WEHA 1N8NA 3N0WA 4C0KA 7REQB 5HUQA 3T3PB 4C0XA 2FW0A 2ZROA 1NWCA 2QQEA 3COSA 1Y89A 3KEMA 1WSAA 2L17A 4LJYA 4UUMA 5SYMA 4B85A 3JSAA 1LJUA 4HWTA 4ZV7A 1OFIA 4N65A 1D8TA 1E2GA 2ZUSA 1KL7A 3LCCA 3VYUB 1TT5B 4BRZA 2WB4A 3BS4A 5BOSB 1U8AA 3CF2A 3KD3A 4JUAA 5K0ZA 1L9KA 2PMBA 2ZCJA 3TX2A 1XF9A 3EGXA 4F9EA 3GGCA 5ECGC 2F3QA 1QZUA 3OPYB 2OZLB 2X5NA 4YBRA 2AWNA 4G8DA 2DUJA 3SHFA 3HLYA 3WK6A 3Q8LA 1FFWA 2RFLA 1FFSA 3AXTA 2EV9A 4M8LA 1S1CA 4OQ4A 4YP6A 4L1KA 4KJZA 4Q48A 3UH0A 4DV5B 2HJHA 2PRZA 1H2WA 2JH8A 5KX5A 5FO1A 3BE4A 3G0CA 3FOWA 5AI8A 3CRZA 3WLHA 1M34E 1W36D 2ECKA 2HRBA 3WKCA 2WM2A 2AFRA 3BM5A 1A9YA 1YZVA 2IYUA 3KR2A 4YRMA 3MRVA 3TCNA 5BYJA 4B3XA 4MYTA 1CQJB 3TF5A 4C04A 2W42A 3F7TA 1MABA 1XTQA 2GESA 2P3LA 2W4MA 4EJ0A 1UZMA 2PT5A 2UUPA 3M6XA 3V1LA 4EZBA 2XZLA 2VHUA 3QFCA 4LKOA 4EQ6A 3UUWA 1MB3A 1VLZA 3V7FA 4G5QA 1T6XA 1U8CB 4EUKA 2WJ3A 1KY2A 1GG9A 2X7JA 4BMPB 1HYEA 1VRCA 2JVJA 3EDOA 3G17A 3S7TA 4FOTA 3UJ3X 3V8RA 1OX4A 5LQNA 1M7GA 4QEKA 3WWZA 3H9JA 2WJYA 2H07A 2DE0X 4MLPA 4P4SA 1E1CB 3BDAA 5IJAA 5JAZA 2EG5A 3HMKA 3VPFA 2O8BB 1QIFA 1C9JA 3JQQA 4LYFA 1M75A 4YAOA 3C7CB 2IZ6A 4I50F 1CJTC 2WICA 1RRMA 3FR7A 2PIAA 3FRHA 4DDUA 2QD4A 4NRDA 1E0AA 1Y8AA 1IWPB 2P2LA 1P61B 3B1YA 3P94A 2FEOA 4C87A 1UT6A 1HETA 1DAGA 1O7JA 4JLWA 4QPJC 5E9WA 3SIXA 4CKEA 2GAJA 3NUZA 5BSGA 5LD2C 4L73A 4DABA 5AVVA 1TKRA 2Z9BA 3D1JA 3N05A 3OU6A 4OCZA 2CBZA 1J9GA 4CEIA 1P4AA 2CLHB 2VJCA 3MN1A 3P9ZA 3H05A 4BLTA 3C1TA 3DM9B 1B0UA 2P3QA 4AMVA 1U9YA 4EHBA 4TXJA 5K99A 1TQ8A 2G25A 4QARA 4IHQA 4ZI5A 3PUVA 4NZOA 4UHFA 4G25A 5LMCA 1DAFA 2IS6A 4J8PA 1T6BY 1M0TA 4DT1A 3OHPA 4XWYA 5JJBA 2ZXEA 2XDWA 2O0JA 4RFSB 4OOFA 3QA9A 2WVHA 5DHSA 1J8YF 2FR8C 1P1FA 1UDRA 3AV3A 4BNDA 1OE0A 1UBOS 2XNJA 3RFVA 3U1VA 3MGBA 1R00A 1R0XA 2A5YB 2VAXA 4EJFA 3UQYS 2IDKA 1GRNA 2JCGA 1PUJA 4NENB 4C6TB 4ZCQA 3DTVB 1U2DC 2J6IA 2QMEA 1RW4A 3MMPA 4KXUA 1DFGA 4R01A 3B1XA 1QTIA 1WABA 4NZ9A 2XYPA 3K0CA 4OHCA 4MUEA 3RT7A 1EFVB 3IIEA 3ECCA 1YRBA 4PSAA 3SIPA 2E55A 5DI3A 4ZT3A 5JCJD 3ZDBA 3G1WA 5FTNA 1DLJA 1LJ8A 5T5QA 1DJOA 4TYMA 2G5GX 3WKEA 4D0GA 1VSBA 1XTSA 2A0FA 4QHSA 4X60A 3GOQA 3WLIA 4OYLA 3A1TA 4RADA 3VKUA 1XFAA 3PRYA 4FMBB 2M6LA 1THTA 1Z25A 4FCWA 4OM8A 4QDZA 4BGIA 4MIKA 1NJ8A 4J1TC 1PFWA 4LDPA 4RSMA 5TJ9A 2CSUA 1RE0A 4R8RA 1ES9A 4KK4A 1M0EA 2B2XA 2UVDA 2H2DA 3DB1A 3CW9A 1ZKMA 4KOAA 2BEJA 1U9IA 2VAWA 3OTGA 4PC2A 4ZFNA 2I4LA 1G7CA 1CY8A 3SI7A 4NARA 1G59A 5EKTA 2M1ZA 2MSNA 3EGDB 3HYTA 1BE1A 5G0VA 3RIGA 2WF6A 4C7VA 1Q16A 3C24A 3LCRA 4B79A 4H1WA 3JV7A 1IZ7A 3HBNA 4WY5A 1WMAA 1VHLA 2HADA 1ODCA 4B47A 2X7HA 1Z37A 1CDDA 1B4DA 1T8RA 2HU2A 3F97A 3RODA 2J9ZB 2V6MA 5C34B 4RSHA 2VXBA 4KGZA 2GDZA 1I2CA 2OC4A 3X44A 1FTQA 1P2BA 4CCAA 4CM9A 3GP5A 1V39A 4N9QA 4QUKA 1YFLA 1MHTA 1WA5A 3BWBA 3QMWA 4MARA 1T4GA 4XFKA 2PLWA 1VIYA 2PKXA 1CUYA 1T5SA 6CHYA 4ASUA 3B38A 4DLZA 4DOMA 1BMDA 1QF6A 3P8ZA 1IWOA 4MH0R 1KQOA 4P4GA 1JSXA 1R0YA 1E2DA 1TRKA 5JJCA 1U4NA 3FAKA 3I37X 1WDKA 1Y3IA 1Z4KA 5DM1A 3U4CA 4UC0A 5CIYA 4M2LA 2NX2A 1T1SA 1W6RA 1X39A 1A8HA 3ANNA 3LUAA 3O5AA 2C9BA 4MV0A 1B00A 3UJ8A 3A6HA 4UJ3A 1IY1A 3CRW1 3I4CA 2WE7A 1PNRA 4A36A 3C8UA 4ACAA 1Q5PA 2C58A 2OCBA 4JYCA 1CRWG 1PR1A 4CYMA 1NF9A 2KLHA 4AT1A 1JFSA 5DYTA 2VNJA 5IF9A 4IF6A 1KAGA 2FPGB 1CNFA 1L8AA 3AI1A 1E3MA 4P3PA 3CE6A 1JI0A 2ETVA 4YPVA 1V16A 3FFWA 3H13A 4LXHA 3JU3A 3WLLA 3DCYA 3T4PA 3AZPA 2HNBA 4IGIA 3WGLA 5JALA 4F46A 1L1RA 5ALIA 5AUPB 4K2HA 2PL1A 2HEIA 2XHEA 4KQ9A 3IAFA 2I54A 1HT2E 2J0QA 4NG5A 3KTDA 1VE5A 4LF4B 2YH2A 3L1HA 4JZYA 4DGQA 4LGMA 1SVIA 1FVXA 3KELA 1RYNA 5B3JA 1NVGA 1CY2A 4CL3A 3R9XA 1YVUA 4L76A 3R8CA 4ISCA 4JB0A 1PP4A 2CDRA 4IVQA 5K3FB 1LZKA 1POXA 3ESCA 3LXMA 3PI6A 2UAGA 2QIPA 1YB5A 1CR2A 4MULA 1G2QA 3GLVA 2BEKA 1W29A 3MYRA 4Q4AB 1D0VA 4H7DA 2JGDB 3RJZA 1CTQA 3VC2A 4Y6PA 2O19A 2JZCA 1JIXA 1HDEA 1TVKB 3V3TA 4TWJA 3LC1O 3S2YA 1Y48E 3L0SA 4GGOA 4LYGA 5H9WA 4FFSA 2NVBA 2H51A 4X63A 3LK7A 3REQA 1N7IA 1X1AA 2RGAA 3N28A 4QVKA 4F85A 1E77A 2EWMA 3D7KA 4YWJA 3IAS1 1LLDA 5EXDA 4N47A 3WFIA 2GEJA 3ZWQA 1GV0A 2HSWA 1UOPA 1VZ2A 2EZTA 4EX6A 4MX8A 2G28A 3CNQS 2GRAA 2DBQA 2VHZA 3H2GA 1KY5A 3MFQA 4H7PA 1E3WB 4K6GA 2DFTA 4NQRA 4BVFA 2GYVA 2IITA 4UD2A 1A5ZA 5F7XA 4HXYA 5GONB 4CDMA 4AMBA 3A3OA 5CBPB 4DKXA 2AFVA 1P4JA 5G0WA 3E4CA 2Q4BA 2CXQA 1LY1A 4KLCA 3ABRB 2XRMA 2AOUA 1T8WA 1YZNA 4QJ5A 3IOYA 1AGPA 2CV0A 3A4VA 3DWIA 2OZLA 3OY7A 2X40A 1X7GA 3P97A 4YJHB 4DF3A 4MYCA 3OKFA 3EYWA 2C2YA 2W6QA 2X14A 5DXFA 1XDGA 2INGX 1OSNA 1T2CA 3MHPA 3SMVA 4I46A 2QG6A 1Z8HA 5JFTA 2XB2A 3UOWA 3L4SO 2JI9A 2Q8PA 4YA6A 1R0CA 2CNKA 7MHTA 2DJIA 4E88A 1Z5NA 2O59A 3NBAA 4M49A 3DLBA 2XGOA 2AFIE 1HSZA 1GVNB 4M1OA 5AI6A 4BEBA 3WLOA 3O0DA 5GY7A 2Z4SA 3WOHA 1P2DA 2EBHX 4AJEA 4MHSA 3ODPA 3ZXSA 2QRJA 4KE6A 8ADHA 2VJBA 5SZHB 3ICWA 4XTCS 1SCUA 3C48A 3I2YX 1TLTA 1U80A 3HM9A 1UJNA 1O6CA 1JR6A 1OASA 4NDNE 5FPYA 3ZY3A 3IB3A 3ODGA 2IIQA 3H4TA 4N5NA 1GAEO 2QTBA 4CN8A 4DEXA 4NZMA 3I9MA 5LP6F 4DV2B 2EP7A 3R40A 1Y3AA 2FP4B 3BWXA 3LI2A 5ALHA 2RARA 4CG3A 2KE5A 5JEEA 1XJ5A 2JVIA 1LK7A 1C81A 4FZRA 1NVUQ 1RXVA 5HZGA 3DMHA 3OEHD 3IBGA 5A4AA 1YK1A 3JVIA 4G0YA 3EVDA 5IC5A 4R3UC 3D0QA 1ZJWA 3KQLA 4PM4A 1EB9A 2ZRDA 1C7FA 2R79A 4BKUA 3K0AA 1A96A 3OQPA 5BOVA 3ANLA 1J4AA 2H1OA 3O95A 2NAFA 2ALJA 3AFMA 4JC4A 4QE3A 4Z6KA 5DNEA 3RUDA 4DY4A 5BP7A 3H6KA 1AS3A 2J5KA 2V7QD 4GLJA 4HNSA 4I1OA 1KKLA 1P4SA 2J9YB 1RI5A 2BBTA 4AO7A 5AOVA 3ZU2A 4W9MC 4C2BA 2XWPA 3ZLBA 1KK2A 2Z5FA 3SZUA 4ES6A 1Z2EA 3ELYA 3PSHA 5JSYA 2JEOA 1P5FA 1CZUA 2H3HA 1G5HA 2GR9A 2RK4A 1U7DA 3W04A 2O8NA 3HYNA 3N70A 421PA 1E32A 3PGKA 4HBZA 2QJTA 5JRJA 3S8EA 5J58A 4WIAA 4O1IA 1PJZA 3PXDA 5LM3A 4E13A 1C7ZA 1JJIA 1JVSA 1Q0UA 2PNJA 2NO1A 4MVYA 5TNXA 4F4CA 3TRKA 4D9MA 2D06A 3Q6MA 4A03A 4A4DA 2FEAA 3FM9A 4MRMA 4NENA 1SVMA 3KALA 4W6QA 3HJCA 3DTVA 3NR2A 4KHZA 3QUTA 2J7PD 3MCUA 3M1YA 5DRTA 3VV2A 1SC4A 3GDFA 1W1IA 2IYLD 5LMNB 3WQQA 4H7JA 4P9NA 4K9OA 1T10A 4GZ3A 4ZCLA 4EECA 1J23A 1E1NA 4K6CA 3PSAA 1DIHA 1JMVA 4HWPA 1JDPA 4HMPA 2WWHA 4OHKA 3V32A 2PJDA 3LUCA 3SR0A 1JIJA 5JNLA 3KO8A 2CC2A 2P2CA 3N0TA 4Y30A 5GWXA 4WXEA 4OD0A 4PYQA 5EHNA 2C95A 2GMWA 1C9DB 5K3BA 1DXQA 1KARA 4LZPA 5ICSA 1UOQA 2AK3A 4XEHA 4IO1A 1C0LA 2OBMA 4IDGA 3NJRA 4WXHA 2Z6UA 1KO4A 1ZW6A 1LGYA 3W2EA 2YZ2A 2YKGA 1Q2XA 4YV0A 4ZOEA 4KRXA 3KU4A 3PA8A 1V26A 3QPWA 4PQGA 4KSCA 3R7LA 3PWZA 5KI6A 3WMFA 4ZO4A 1GDDA 1SXHA 3JD1A 4QUEA 1JTVA 4RTOA 1VKOA 2OO5A 2YJNA 2A5DA 3L18A 4JAVC 3C6ZA 2CUKA 3HI6A 4JBNA 4IIFA 5BUQA 4OLBA 1RE1A 4HVLA 4BO5A 1XTIA 3HUTA 2W70A 4F45A 4CZ2A 4EZEA 1SVWA 2MIIA 2AX4A 4HLCA 4D8VA 2FH5B 5DN6A 4G5SA 3EOAI 2Q6LA 1FFBA 3QQ5A 2W0SA 4EO7A 3FRIA 4RNCA 2C7PA 4M0DA 1BXKA 4UTXA 1PVOA 1JPNA 1HSOA 4DJAA 3PB3A 5LZ5A 2PX2A 2AHRA 1UWVA 4RPJA 1VPDA 1ZGHA 2CHVA 1QANA 3ONEA 5LSAA 2PL9A 3HVRA 3CVXA 2JJ1D 3H17A 1I0ZA 2GAOA 2JAOA 3OIDA 1C9NA 2XNHA 4EW1A 2DPMA 4GMGA 4YT8A 1ZNYA 1A9QA 1DG1G 1SK8A 3SHVA 1WDTA 5JWHA 3ZDAA 4WFQA 3GLGE 1E2BA 4U63A 1VHQA 3DZGA 4IQ4A 2FWNA 3SOPA 3EBLA 3VNAA 3ZGXA 2I8AA 3ORHA 2IODA 2FJPA 3L7CA 2PRJA 3WIDA 2QI9F 5DSZA 1KNXA 2QSJA 3LUKA 1R6BX 3NVMB 4OQYA 1G291 2KQUA 4H6PA 2OHVA 2W8ZA 1M33A 2BF7A 3TBHA 3ROGA 3IX7A 2OO3A 4ZO8A 1S02A 3DZIA 3ZHUA 5B3KA 3BSWA 3FA2A 4ZT5A 3OOWA 5ECDA 3CO5A 2VDWB 3E1GA 2ZW9A 1GLGA 4CT4B 4MV7A 5L3QA 3C39A 1B8UA 3L92A 3ESDA 4JMLA 1YRWA 5A7FA 2FV8A 3TXYA 4HFMA 3Q7IA 2QZPA 4ACBA 2Q2WA 4H3VA 3W34A 3G49A 5FWYB 2FFRA 2ZRAA 3R5XA 5JXWA 1HE3A 4UQPA 3ZHVA 1D5WA 1JZTA 3KXIA 4B71A 2WSMA 4DRZA 3MCAA 1K4KA 1QLHA 4X3PA 4EHFA 2X41A 1L1FA 1TAHA 3CX4A 4I0WB 1WEKA 1TYCA 5LBTA 1GUYA 2X2FA 4JXKA 2V4ZA 4NYJR 4CQMD 1LBTA 4IM7A 5FKJA 2WD9A 5HRCA 1D07A 3RRXA 3FUXA 3GLTA 1E5DA 3UOGA 1Y5MA 1Z5UA 4G4SP 5F4ZA 2AA3A 1J2RA 3CLRD 1C8KA 4F4DA 1KPHA 3E9ZA 1WSBA 5SYAA 2Z1MA 4Q4AA 5IFLA 1YCGA 2KBFA 3Q98A 4MRSA 2JI4A 2V7TA 1C9EA 1MEEA 3PUXA 2FPOA 2OSBA 4JR2A 3AH8A 2XVZA 5DN9A 3VPAA 4BJ3A 3WY9A 1ZXLA 1NUHA 3RBZA 2IS2A 3EWSA 3Q9NA 721PA 5JMOA 3VKGA 1JLRA 3OJWA 1TMOA 2Q41A 3QX7A 2JLWA 2W43A 2D6FA 4KITB 4Q12A 3KOXA 4S1VA 5AW6A 2Q1SA 2SICE 3D5QA 2YRWA 2FLKA 3D3EA 4LY3A 2H1LA 2XKJE 3CKMA 4F5ZA 3L7KA 2Z5LA 4JLOA 4RJTA 1AUOA 1SKYE 2Q3DA 2YN4A 4HLUC 4MVJH 5KSPA 1JWLA 1DSSG 2BONA 3HR4A 2AK2A 3EIQA 5GONA 2JAWA 3ZLUA 1I0LA 4D99A 1YB4A 3DEFA 1MP0A 1H2RS 2BR5A 5CVDA 4UU0A 3E3AA 1SZPA 5ELXA 3ZDQA 4OI0A 1DELA 2PZMA 2Q50A 5DCUA 1ZIDA 5K4GA 1AT1A 3E4DA 1VGVA 3HCCA 3CO0S 3FCXA 1VCIA 4GG1A 4IRMA 3RIEA 2H8GA 5E1OA 3ZWWA 4P93A 4AUEA 4YJHA 1L3BA 1QTRA 1C9KA 3OIWA 5FFNA 2C2KA 4JR0A 4PF1A 3Q2OA 2NQ2C 4MR7B 2FPMA 2RCYA 3K0BA 3EG9B 3JATA 2WIJA 1AV6A 3DULA 1PQUA 4H6WA 1OYVA 2RKWA 2XT0A 1JQBA 1K7FB 4K0RA 1UC4B 1UAAA 3LFTA 1VKJA 1DRJA 3CWCA 5DHAA 3UQZA 2YYYA 1XQYA 5I9LA 1LA2A 3I64A 1YE8A 3FG9A 3QUBA 4P53A 1OI3A 3N76A 2WZQA 4GVLA 5JARA 4OQEA 1Y5NA 3U6BA 1WCYA 3DOJA 3A3NA 3RASA 1NM5A 1I1NA 2G04A 5G40A 1V5EA 4JZKA 1RTKA 3EXIB 3NRCA 1CKEA 1XJCA 2COKA 3PCXA 3GBPA 2WMOB 1X9HA 4ZVLA 4GKKB 3TNDA 3C3DA 5FI3A 1BVUA 4UHCA 3RYFB 1J24A 3SIRA 4AJIA 5B3JC 1V9LA 4RJKA 2K2QB 3GRCA 5C5IA 2R11A 5HCNA 3KAQA 4E1BA 3LTEA 3KOUA 4JQSA 2NTYC 3Q2KA 1EK5A 3QV1A 2BN4A 4NABA 3WB2A 5FYQA 5L6LB 4G0MA 1PL7A 1DEHA 2RDMA 1P4HA 3P26A 1BS1A 2I1VB 4D5EA 3QM1A 2OILA 4IYRA 5LB4A 4INZA 5CNJA 4HS9A 4F5EA 3C3CA 1KI7A 2QVLA 1DC4A 4NS1A 1JAZA 1YIOA 4DHWA 4ZTZB 5AMXA 4I1YA 2LTAA 1KI6B 1KYQA 1RRKA 1JNXX 2O8VA 4U2DA 4IINA 4BFVA 2GYUA 4M1MA 2I4NA 5K9ZA 3GHHA 5AW0A 1H69A 3I5UA 4BVEA 3WLAA 3BGDA 1CX9B 1WL8A 1Y1TA 2A4MA 1D2GA 3BIJA 3HI4A 3ZQKA 1XDSA 2FN4A 3JZFA 2PV0A 3PYLA 3GEHA 5BYAA 4DIUA 3M4ZA 4Z9XA 1Y3CE 1KWGA 4B0OA 3K6KA 4C0JA 1RZRD 3H99A 4JGBA 3NIFB 4TRRA 4CMEA 4DMLA 2BKLA 2EYUA 3MD0A 4GHWA 5PGMA 5AW7A 5KNBD 3RKUA 2R6FA 3BGSA 1FXSA 2G72A 5J2TA 3TOZA 5IWCA 1NKSA 3QKIA 3NCTA 3KQTA 1ONNA 4EBFA 2QSUA 3WGNA 4J2TA 5A7GA 10MHA 2GVNA 5I8ZA 5B57C 5BR8B 1OZGA 4ZJPA 1DKQA 3K94A 3F73A 3ABIA 3R6WA 1SHTX 3B52X 3DBHA 1RJEA 2QPTA 2P8SA 4X41A 2HQ1A 2JGFA 1NURA 1P1KA 3I01M 1IRIA 4KK3A 2HBYA 5I5GA 4RTJA 2A5GA 3DEJA 2JFBA 2WK1A 3DMTA 2ZJ8A 3BFXA 3R77A 1KDYA 3UWDA 1NT4A 4WZBA 1E1MA 2G5TA 4KE7A 2B30A 2D4AA 1TFRA 3ZJVA 3P96A 2L19A 1T1GA 1N0VC 4WUVA 4ZDWA 2GTPA 3EQ2A 4D4HA 4BVKA 1PT9A 1VL0A 3BXFA 4UMFA 3UMVA 4KLNA 3TQCA 1AZLA 1T0BA 3LCVB 2ZR0A 5E6SA 1VKNA 1L4EA 4L8GA 1BX3A 1D03A 1XQWA 2ZIVB 4TMZA 2DWOA 5KKAA 3OKPA 5BSTA 1YQTA 3DMFA 3FRJA 4JENA 4O0MA 3W6UA 3WDSA 4EKEA 1JXAA 2WKWA 4ZCTA 3RVKA 2JD2A 1GUDA 1W36C 3HNRA 1DLIA 2V8BA 2IHYA 3QXCA 4AF8A 3ONNA 4BC0A 2CMKA 2IJGX 1KYWA 3KE8A 3D43A 4G1CA 4WRRA 4JROA 3ZV5A 3QEBZ 3PIRA 5DULA 1FRNA 2Q3HA 1CUIA 3LPMA 3PFBA 3FMIA 4QUIA 3LQRA 1XZ8A 2AJBA 2V8OA 2GWHA 2YRXA 4ZI7F 1EUYA 3ES9A 1QX3A 2GXQA 1W1UA 1YAJA 4NE7A 4F96A 3ENZA 3MINB 1OYOA 4EG4A 2Q5LA 2NP6A 3D5EA 5BVHA 5I9NA 4UE6A 3PJRA 5EPOA 4HNUA 3C70A 1S2GA 3FTFA 3OQBA 2VLIA 4DJ5X 3PL1A 1AO0A 4GM0A 1P44A 3RC1A 4L72A 3V1YA 3VU8A 4FNGA 1ECPA 1B3BA 1TC2A 1CZOA 4FFVA 4YQFA 5TXGA 3GJ3A 5AI5A 5JVDB 2YNMD 2HUNA 3IR5A 1KQFA 3UO8B 2Y1OA 1VI2A 1YHNA 3CZ5A 2XITA 2AS0A 1C3OB 2GXSA 1DO2A 4D1YA 3HDTA 3N86A 5C8YF 1D2AA 4LBYA 4B6GA 4UVDA 2HJRA 4E5DA 2YDYA 4FR2A 5HXAA 2FR0A 4EYGA 5JRDS 1FEZA 5K03A 4DC9A 3V8EA 4DLRA 1GAWA 1NHGA 1PKXA 3HRIA 2EFEB 1R1DA 4F6CA 3OCUA 2XSZD 1XAGA 1K66A 1K8XB 1HTBA 2DQYA 4RHYA 1R7RA 3WMXA 1DRKA 4B2YA 1PK8A 1HURA 1VLJA 4UEKA 5JD6A 2CNWA 3G02A 4GLLA 4HATA 4L9AA 2XNCA 3G9UA 1PTJA 1KK1A 1U90A 2Y67A 2NSYA 2VDWA 4IEEA 3GQVA 2PQ2A 2WMDA 3AILA 1MX3A 4WOKA 4EAQA 5BNWA 2BYTA 2MOKA 4HR7A 1QKJA 1UBHS 1OXBB 3LK6A 3RBVA 3QUCA 4WK0B 5IASA 4Q21A 2DZDA 1X7YB 3C6YA 3EJWA 3QF7A 3JALB 3IYLW 2Q8QA 3GVXA 4J9UE 4RLQA 3PGXA 5EQDA 5LXTA 4URYR 2O14A 5C31A 2FN7A 4DUPA 2CXTA 5C8DA 4MSUA 1QAQA 3V5NA 1G60A 4L9SA 5CLQA 1E9FA 3CH5A 1Z5GA 3HJHA 4EA8A 2I7VA 2PXAA 3NNNA 3RUCA 3R8FA 4RKRA 5KIAA 1K98A 2O2DA 4JY7A 1ZBQA 1K6JA 4Y6RA 3Q3CA 1FBNA 4ZARA 3QPBA 3DAHA 2JJ2A 4XDGA 1I6KA 3OC6A 3NBMA 1AKVA 5J4YA 3EWNA 1F2VA 1UXGA 2EP5A 4WBNF 4V2UA 3EXHA 3G8BA 1DKUA 2Q5HA 2ZT8A 3NTVA 1I33A 4LHXA 2JK1A 3BB1A 2I1LA 2JLYA 3NMUF 1F8XA 5K2MA 4CQNA 5LYYA 3P9YA 4PR3A 1NI5A 1HDXA 1PX2A 1D0IA 2P78A 3H97A 1GL7A 4L4SA 3GCZA 3J7TA 3U0VA 3DD5A 3M6LA 1CT9A 4DXDA 4PQFA 4PW0A 3PX7A 3DHEA 4FHFA 3EOBI 4JJ6A 2Q1WA 1L7EA 3ETNA 3NHYA 1Z28A 2ONZA 1T5OA 1GIAA 2YN2A 1TL7C 1QGUB 5D3QA 1IK4A 1A8PA 2QN2A 2JGLA 3RRZA 3DLTA 1TO6A 2ZYAA 3NEJA 5JCOC 4TZ6A 3D3KA 1K7SN 3GLIB 4ENSA 5EWJA 4MQLA 4AYXA 3ZY2A 4M9XA 5L3SB 1QPGA 3QBVA 1VLLA 2BSAA 1AUVA 4NFYA 1PFUA 2WRZA 3PUKA 5ERYA 3CEPB 4A6XA 3IQWA 2YXNA 5FV7A 3TFWA 2QDKA 3AJAA 2V7PA 2JCXA 4IBOA 1ZITA 1CP2A 3INGA 4G1EB 4ZCPA 2WYIA 4EFLA 1OD6A 3UAWA 4C4ZA 5ADHA 4H3KB 3V1MA 5ENZA 2VJMB 4JI7B 2H2IA 3U26A 1MZVA 3SQLA 1ICIA 5F64A 2VNKA 2H1WA 4EG5A 3T8YA 1PQ4A 3L04A 5BORA 4P4NA 5C1IA 3MQ4A 1CRLA 4FFBA 2GEKA 3BSSA 3R3JA 1VP9A 3ELDA 4YECA 4D9NA 5IFKA 1NZJA 3M6FA 2CLIB 4Y1FA 3TTXA 3U3ZA 3D81A 2OXTA 1SU8A 1GD1O 1DAMA 1PEDA 3IL2A 4TLMB 3KXDA 3NVAA 3G1TA 4KDRA 2I4IA 3QHPA 3EIWA 3ITEA 5HIKA 4AIRA 1GNRA 2C3PA 3IQXA 3UPTA 2VHYA 3DCIA 4CN9A 4PPFA 3W8DA 3MRXA 3LQKA 3JYPA 3WMWA 1K8QA 2JGEA 4TKMA 1JHAA 3CSSA 1LVHA 2XXBA 1EWKA 1SCDA 3G5LA 3M9LA 5G1PA 1IG0A 1DHTA 1V7QA 3NIBA 5HGJA 3MWYW 3GRFA 2CVOA 1ABFA 4CKYA 5K0BA 1ULTA 4M8KA 2X15A 4XW2A 2OXCA 4G09A 1EYZA 1R0WA 5EWMB 3RSSA 4D9BA 4DCPA 2Y68A 4OP2A 1GTG1 1XXHA 4U6QA 4OI1A 1EK2A 4IMPA 4KDCA 5HFNA 2JK0A 2M98A 4B35A 3ISJA 1GN9A 5JO9A 3SLGA 2AG5A 4XQ9A 2WP8J 1E18A 3MM4A 2JIQA 3SKYA 3N39C 2FEMA 3DXXA 3ZGNA 2X8LA 4LS3A 4MICA 3CCCA 3E9CA 4AAYA 2A4KA 5I51A 2QBYA 4B8ZA 3JARB 4MS3A 5IHXA 5LP1A 4KW7A 5BUZA 1JR3A 4CV3A 5AVOA 1J21A 4UUBA 3ZVLA 4QEDA 4YJKA 5TT0A 3CTPA 3Q10A 3RIXA 2VOJA 1U8ZA 2A14A 5DVZA 3TG8A 3E3LA 1WW8A 2H7XA 2OOKA 3P9SA 1ZLYA 3BMOB 2FJUA 3NZEA 4JOBA 2XW6A 5DZSA 4DCNA 4C20A 1JLLB 1FP7A 1FDIA 4PC3A 5B12A 5J3JA 3SKVA 3ASYA 3EC7A 3ZW9A 4TV8F 3MPOA 5AO9A 4US1R 4Q6WA 1HQYE 3HHEA 3GFTA 4CQLB 3CZAA 2H5LA 2VEOA 1JDZA 3NW9A 1XCPA 3QJYA 4F72A 1WS6A 4KLRA 4H16A 2HNAA 5BN3B 1HDGO 4J6EA 3D9QX 1JVNA 2IV3A 2O7QA 1UQTA 3KZNA 2ZS9A 3TB6A 3LC2O 4X1YA 3NETA 3SC2A 3KKLA 2WUVA 2ZYUX 4S2EA 2P2ZA 4RVNA 4AO6A 5IJ0B 1JAHA 4JYBA 3WZMA 2X58A 1K5DA 1U7TA 4K3VA 5FL7A 1HRDA 3ZHXA 5IDWA 5K3EA 3R75A 3A3PA 3BD7A 5IZ4A 2DPXA 4NCHA 4PEVA 1CVRA 1ANKA 2QRQA 2VF5X 4LBVA 1O5TA 5F52A 5ARDA 4E4YA 5K6AC 1NM5C 2XT9A 3PQ4A 2Q9AA 1D1TA 3IUEA 4ZHQA 1ZSNA 2Z3ZA 4D74A 1QFXA 3E9DA 5BQ5A 3RTEA 3P4UA 3S5UA 3WNBA 4AG6A 2Y4OA 1ZMTA 5L8VA 5CA0F 1IAQA 1MH9A 4YHBA 5AD1A 3WMGA 3C3KA 4P2GA 5UKDA 1EK1A 3L6CA 3AJEA 3R5KA 2O05A 3DBRB 3QOWA 1CJKC 4Q4JB 1JV2B 3UVEA 1OI2A 1Q0LA 4G5FA 4YUYA 5KYNA 4HNVA 4TWZA 4X7RA 2X2PA 1EXMA 3D4LA 2B99A 3GJ8A 4E21A 4MKFA 2IPMA 4AULA 2P5UA 4R1OA 5ELLA 1UIMA 2C00A 2QUJA 4FMDF 4PGAA 1HKHA 1RJFA 3I58A 1G38A 2QM3A 5EHZA 4FFMA 4ZXFA 2XEXA 3A4TA 1W59A 3FSEA 1RADA 1DIAA 1U4SA 1UKZA 1O8BA 3IS3A 3U7HB 4IHJB 3RIYA 3MINA 1TJNA 3EQ9A 4WESA 1DBPA 2BDTA 4RY0A 4PWZA 1XZHA 2PYDA 2NUPA 2YWFA 4I1RA 5IYZB 5KHOC 3HFRA 1GFIA 3TOVA 2F64A 1WHTA 3CZ9A 4YAFA 1KFJB 2CLFB 3WK4A 1EFTA 1K75A 5JVDA 3B1FA 2JKYA 3ITNA 1JHVA 1MC1A 2GAAA 4YV7A 1IIRA 3BX1A 3QBEA 1KIMA 1PEYA 4CMEC 4WX2B 5SZJA 1YS2X 4QIHA 3LT0A 4ZJYA 1QONA 3GPLA 1FJHA 4JEUA 4DUGD 1JG4A 1E60A 5DNAA 1FUYB 1YZLA 3VO8A 3C74A 3IV7A 3T1QA 1ZRSA 2GBGA 3CZ4A 2R3SA 2R84A 3JYOA 3WK8A 1ZD5A 1HT0A 1YTUA 2K5UA 2O4CA 1WQ1R 4KWIA 1EMDA 2VDNB 3BZBA 1TMGE 5CIQA 1L7OA 3ZS9A 1UDWA 2OCXA 4RQAA 3KSAC 2PCLA 1L5HB 2IUFA 2JFHA 3KL2A 4ZEWA 4WPGA 2R1VB 5CM8B 1NONA 5IPFA 1IBKB 1Q50A 4KYTA 4BPBA 1JIQA 1G20E 1JXQA 2YXEA 2Y0PA 1Z16A 2FK8A 3PD1A 2HF7A 2AHOA 2HH9A 1QCZA 1BH2A 4BNGA 2UXBB 3GRYA 4AW9A 4HWKA 5E6RB