3M3CA

Crystal structure of agrocybe aegerita lectin aal complexed with p-nitrophenyl tf disaccharide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
159
structure length
159
Chain Sequence
b'MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-tumor lectin
publication title Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
pubmed doi rcsb
source organism Agrocybe aegerita
molecule tags Hydrolase
total genus 38
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m3cA00
1LOEA 3NV2A 1LGNA 3R4UA 1MS9A 2WT0A 5T50A 2JKBA 1JXNA 1FNYA 4ZXKA 2R0HA 4Q1PA 1JBCA 3Q9OA 1W0PA 2I2SA 1S0FA 3FLPA 4FOVA 3AZZA 5T5LA 3T1LA 3FBYA 2PHUA 2ZHKA 3AJYA 1QKQA 1FATA 3D5OA 1LHOA 3QLQA 1S0GA 3APBA 2W68A 1VAMA 2EXKA 4BQ1A 3BOPA 1BZWA 3USUA 1LOCA 4PQ9A 1WD3A 1KDKA 2EALA 1Q8PA 2V5YA 3CNAA 2TEPA 4F83A 1IS6A 1Z78A 3AXDA 3POYA 4FPFA 4LBMA 2ZGUA 3UJOA 5IT6A 5EWSA 1RITA 5T52A 1MVEA 1QOTA 4M01A 2SLIA 4ZKTB 1APNA 4PBPA 4ATFA 2JECA 4Q27A 1I1EA 1MS0A 3RRDA 1AVBA 4Q1RA 3RQ0A 4GA9A 1Q8QA 1CPNA 5FREA 3UK9A 5JLVA 3ZYRA 3V0AB 4DRRA 2SBAA 3AFKA 2NP0A 1VALA 3B3QE 1UZYA 5EXOA 2DVAA 1YIFA 2W39A 1F5FA 4ATEA 2B7YA 2C9AA 3B9CA 2NZ9A 1C1LA 2Z42A 3AXEA 3W59A 3ZYPA 1B09A 4UW4A 1KQRA 1V6KA 5JMCA 1AZDA 1GSLA 1UPSA 3AP9A 2JE7A 4NOTA 2D43A 4OZXA 1YO8A 4M3CA 4MYEA 5HCBA 2NMNA 3UJQA 1MS5A 1D0HA 4IQPA 1LOBA 1MS4A 4XOGA 2A6VA 2ZBJA 4Y22B 3BODA 2WKKA 4U36A 1DYKA 3VUOA 2LTNA 4M00A 3WDXA 1G9CA 1FV3A 3I4IA 4YM0A 5BYNA 1BXHA 1AX0A 1UX6A 2EXHA 1DQ0A 1DYPA 2D6OX 3PMEA 4WZFA 1N1SA 2PHRA 3O0XA 4TYSA 1LU2A 1AXYA 3MEPA 4YW1A 4AVTA 2A75A 3B69A 4YFWA 1LOFC 3N7LA 4ITCA 1V6NA 3SNMA 5DZFA 2A3WA 1QMJA 3A0NA 2DU1A 4Y1ZA 4GXLA 3USUB 1V6IA 1JHNA 3AX4A 2KM2A 4U2AA 3PVOA 4GWNA 1ULEA 1V00A 2W52A 2ZZJA 4AVSA 2YROA 2A6WA 1JW6A 3R05A 1DQ2A 5T5OA 1AXZA 3ILRA 1LECA 3V64A 1DQ1A 1XQNA 3AJZA 3D6EA 3NV1A 1PZ7A 1IS4A 2P3JA 5GZEA 3I8TA 2CWSA 4XJUA 1OFSA 1ULGA 5DG1A 1MZ6A 4DQAA 3ZXEA 4FPOB 4JCKA 2ZMLA 4PBOA 5HCAA 1GZ9A 4YZ1A 2ARXA 1UAIA 3GNEA 1GICA 3SISA 2Q5TA 4WVVA 5CBLA 4BM8A 1JN2P 1UKGA 4XJWA 2ZHLA 3A0KA 1DZQA 2R0FA 3IPVA 4P9XA 4XHBA 5E88A 4M3CB 1WLDA 1C1FA 5CA6A 3AZWA 4FPCA 4W65A 2WSUA 3DUIA 2AENA 1LENA 2E53A 2WQZC 3T2TA 2OUHA 3VKOA 1ULFA 1G9DA 1LOFA 3JU9A 1ENQA 2PHFA 2NN8A 3BIWE 4Y24A 1W6NA 3OBRA 1GYKA 1FX5A 2YV8A 3M2MA 1GNZA 1UL9A 5DUWA 1CN1A 1GKBA 1QF3A 2DUOA 3PVEA 4XXPA 1YI7A 4YGCA 1N1VA 3TAYA 5JDBA 1WLCA 2WLQA 1LULA 2P2KA 1CESA 4YW2A 3ILFA 5T5PA 2A71A 2A7AA 2EXJA 4K21A 4LBNA 1WBFA 3PJQA 4JRAA 2GN7A 2D6PA 1NXD1 2ZGLA 2H0BA 1A3KA 3M3OA 2DYCA 1F9KA 5GZDA 4Q8KA 3W58A 4Y20A 5SV8A 2D6NA 4M3CE 4YZ4A 2YZ4A 3OY8A 2D3PA 2VY0A 3WHUA 5JOXA 2W08A 4Y26A 4BLJA 5DUXA 3WUCA 1A8DA 3N35A 4XDQA 1SBFA 4FOQA 4YM2A 3FFZA 3OJBA 4FPGA 1LGBA 1VIWB 2AYHA 4Y1XA 5H9RA 1KITA 1LOGA 2GALA 4TZDA 3WG4A 1EPWA 4FPHA 5GLUA 1HLCA 2CNAA 5GZGA 1R1ZA 1G9AA 3NV3A 3B00A 1IKPA 1Q8VA 3QCWA 1FAYA 3V65A 1WW4A 4C1WA 1N3OA 5KXEA 1GBGA 1LESA 1PZ8A 3FLTA 4FPKA 1KJRA 5DZGA 3UL2A 1N1TA 3AZYA 3ZXFA 2FMDA 4XJ9A 3TB0A 4XMAA 1MVQA 3OYWB 4HANA 1AX1A 4FPEA 4LBQA 4RL7A 4XBNA 5FRAA 5H9PA 3OGGA 5GJ6A 2ZGRA 1JOJA 5F5QA 3ZXKA 1WW6A 2ZGOA 4GKYA 3WDWA 2C5DA 1GZWA 2ZABA 3AK0A 4Q26A 4XJZA 4YGBA 3VKFC 1LOAA 4BPZA 3IPVB 2GMEA 3AYCA 3WDVA 5GZFA 2UWCA 1DQ5A 1ENSA 1X50A 2PHXA 1MR5A 1LGCA 4BLIA 1JYIA 5GZCA 4H55A 3FLRA 2DV9A 2DVDA 2A3YA 3MW4A 2EAKA 4C1XA 1AJOA 1G8WA 1LTEA 4FP3A 3HMYA 1SFYA 1DBNA 1W6NB 4DFSA 3R4SA 3WNXA 5CB7A 1V6OA 1ULCA 1Q8SA 1SLCA 1WW7A 1S0BA 4DS0A 1ONAA 4BMEA 1SLLA 4YG0A 4ISQA 4Y20B 1H9WA 3RMYA 3O5SA 5IUQA 3OY8B 1S1AA 4YZ2A 2ARBA 3D4KA 3IN9A 4FQ4A 1SLIA 4YW3A 2UURA 3WDTA 4BMBA 3N3HA 3MW2A 3WZ1A 2XB6C 2ES3A 3ASIA 3KQRA 1URXA 3NV4A 4P14A 4Y1VA 2AR6A 1AX2A 1C4RA 4YW5A 1LEDA 1Z0HA 2WT2A 4YLZA 1GNHA 5IK7A 1BKZA 1N3PA 1RIRA 3AZVA 5EYYA 1SBEA 3M3EA 4Y1YA 1UMZA 3O12A 3KM5A 5H9QA 3WLUA 5GLWA 3AYEA 2ZGNA 1H9PA 3ZSMA 1V6JA 1I3HA 3AP5A 5KXDA 2A6XA 4Q2FA 3OPZA 2D7FA 1GANA 3WUDA 4PF5A 5GM0A 1IOAA 2NMOA 1DIWA 1V6LA 1WCSA 5GLTA 1FNZA 1MS1A 4YM3A 3RG0A 3O0WA 1LODA 1N47A 2DU0A 3OYWA 4LBQB 2GMPA 1W6MA 3AYDA 4FOYA 2GMMA 1G9FA 2D6KA 4YG3A 4ASMB 1HQLA 3V0BA 1WLWA 3ZSKA 2JE9A 4XILA 2AH2A 5KXCA 4YW4A 1GZWB 5L73A 5GALA 4AYUA 1LHUA 1GV9A 3VKLA 1QOSA 5EYXA 3SITA 2A5ZA 3FUQA 1TEIA 1Q56A 4Q8LA 4XE9A 5F9TA 3SH4A 2DVBA 2HYKA 2WSVA 3SH3A 4BOWA 5DXDA 2R1DA 4FQZA 3AP7A 3NWKA 2G4IA 2GNBA 3HN1A 3LSDA 3O0VA 2D3SA 1CJPA 1RINA 2UU8A 3RSJA 1S0IA 4R9DA 3SH5A 2D44A 2GNDA 5T5JA 4AGRA 3DGTA 2D6MA 1DQ4A 3ZXJA 1C57A 2E7QA 2OUJA 3PVNA 4R9CA 3ATGA 1WBLA 2A70A 2CWMA 3M1HA 1F31A 4XZPA 5T55A 3WG3A 3ZPYA 1QGLA 4XJAA 2ZGPA 2GN3A 4YGEA 1BJQA 4PCRA 3AYAA 1DQ6A 1CVNA 1W6QA 5AVAA 1LJ7A 1VAVA 4DRVA 3WG1A 1AXKA 3AP4A 1Y7BA 2DUPA 1G7YA 1KDMA 2ERFA 2GDFA 4YM1A 1W6PA 1ENRA 2DUQA 2ZA9A 2ZGTA 4FPYA 5DG2A 4Z8BA 2E6VA 2AREA 2A6ZA 1MS8A 1PZ9A 2VW1A 4XXAA 2ZGKA 3AZXA 2WT1A 4GKXA 5DZEA 1MZ5A 4CRQA 3OBTA 3VKMA 3N7JA 2ENRA 4GWMA 3WOGA 5JOZA 5CNAA 1OQ1A 2ZAAA 4LBKA 4UW6A 3SLIA 4KBBA 1YXWA 1KJLA 1SLBA 1W6MB 5IK8A 1BQPA 2PELA 3V0BB 4XYXA 2VU9A 1W6OA 2NM1A 3WG2A 2EIGA 1IKQA 1G86A 1DHKB 3VKNA 4XIKA 1MACA 4CTEA 2P3KA 2R16A 2P34A 4FPLA 4XJ8A 1CIWA 3FUOA 1DFQA 5T54A 1S0JA 2CY6A 2JJ6A 4LBQD 5JVVA 1ZA4A 2DWRA 2LALA 1A78A 3ZXLA 1S0EA 3WCRA 1QNWA 3GALA 2UWAA 5KXBA 2JD4A 2RHPA 4XBQA 1SLAA 2WNEA 3A4UA 1J1TA 3ENRA 1SBDA 2VH9A 2E51A 2DTYA 2VUAA 1V6MA 1Q8OA 4P9WA 3ZSJA 4K1YA 3MW3A 4UW5A 3HR9A 5GLVA 1NLSA 4HL0A 1LHVA 4UW3A 2VW2A 4LBLA 1D2SA 2V73A 1UN1A 1CPMA 1W0OA 4L8QA 1MS3A 1N3QA 1H30A 4D69A 1QU0A 2VW0A 5HCFA 3ZSLA 4NO4A 2DVGA 1YYNA 4DPNA 1SLTA 1ZM1A 2DURA 2GNTA 2DVFA 1S0DA 1KRIA 4WVWA 1LU1A 2P3IA 3IKWA 4K1ZA 1W6QB 1JYCA 5E8AA 4LBOA 2YY1A 1SCSA 1LCLA 4FOWA 1IS5A 2AUYA 2AGSA 2ZHNA 5DUUA 1W6PB 2ZGMA 4JC1A 1BYHA 2VXRA 3INAA 5E89A 2R49A 3WVJA 4AVVA 4YZ5A 2YMZA 3IM0A 1U0AA 2CTVA 4K20A 3WCSA 1FYUA 1LEMA 3B01A 3M3CA 3IMNA 4I30A 1IS3A 1YRZA 2NYYA 2A3XA 1OKQA 3MPPG 3POWA 2YXSA 3VV1A 2E7TA 3LCPA 4YFZA 2ZHMA 3L2YA 1VLNA 2ZMNA 4R9BA 4CZSA 2EXIA 4XIOA 1S0CA 5CAZA 5JOWA 1CR7A 2P37A 1GLHA 1O4ZA 1O4YA 1QDCA 1W6OB 1WUVA 3JUUA 4ISRA 4R9AA 5IK5A 4Y1UA 3T1MA 4XTMA 1DGLA 1QDOA 5LK5A 1LHNA 1SACA 2BQPA 4GALA 3RS6A 2OVUA 2CL2A 2PHWA 2ZACA 4XBLA 4AGVA 4AGGA 1HQWA 3H0OA 3WDUA 2FHRA 4WV8A 1AJKA 2ZGSA 4FVVA 4YZ3A 1QNYA 3BTAA 1SCRA 4YG6A 5IK4A 5H9SA 5JOYA 3V0AA 2JDZA 4M3CF 1AF9A 1DLLA 1QOOA 1WD4A 2OW4A 2A6YA 1N1YA 1CQ9A 4P9YA 1UZZA 3ILNA 3N7KA 4FP2A 1HKDA 2ZGQA 2DTWA 4XMIA 2CYFA 2UWBA 5DUVA 2D3RA 2WJSA 2ZMKA 4LBJA 4XHXA 1GZCA 4RA0A 2XG3A 3WDYA 1HDKA 4AWDA 1G9BA 2EF6A 4YGDA 3WHTA 3RMXA 2PHTA 3N36A 3WV6A 3ZVXA 3U4XA 3M3QA 4SLIA 5GLZA 1FV2A 1WW5A 1LHWA 1ULDA 4FPJA 4XTPA 2R1BA 3AP6A 3C2UA 4Y22A 3POSA 1CONA 3N7MA 1JUIA 2ZKNA 2GNMA 3LSEA 2D6LX
chains in the Genus database with same CATH superfamily
3SKVA 4OUEA 1Q43A 1A6CA 2XVKA 4CU6A 5C9AC 2RS33 3GJBA 4GWIA 1JXNA 1FNYA 2VMHA 2J7MA 4E8CA 5AFBA 1RJ7A 1RUF3 3JD71 3Q9OA 1OLME 1W0PA 4FOVA 1S0FA 3T1LA 5JPNB 5T5LA 4F7ZA 1EV13 2FD8A 3AJYA 3VD5A 3D5OA 1LHOA 4LKSA 1S0GA 4AFMA 4LO6B 1P8JA 2DBIA 1VAMA 2EXKA 4RR3B 4RQPA 2C1FA 2JDHA 3GZAA 3USUA 3GZUC 3OUHA 2ADDA 3VHNA 2OQ7A 3AKSA 4PHZA 4FXGB 1RMU1 2EALA 1XU1A 5JSOA 4FPFA 2XOMA 5FBZA 1RITA 5T52A 4EWDA 4Q0QA 1M4WA 5C4WA 4M01A 3VBFB 1PGW1 5A32A 3IB3A 3ZYFA 2JECA 3R0RA 1F15A 4Q27A 1I1EA 2VZQA 1AR93 4Y4YA 3TNQA 1W8OA 1ULPA 3KV9A 1DCSA 1Q8QA 5FREA 1JYTA 3URFA 5FO9B 3V0AB 4ZU7A 2WO7A 4DRRA 1U5ZA 1NE6A 3B3QE 1O8PA 1RGSA 1YIFA 2HWB3 1W99A 2VQTA 5EXOA 5LA0A 2C9AA 2WNUA 1K3IA 2VCAA 1IG0A 3LSEA 1ND2A 4QPGA 1K12A 4FT8A 3AXEA 3W59A 1B09A 4Q4W2 5FWEA 1O3RA 3UGGA 3VBRC 4P00B 1Z7S1 4AEJA 3ITQA 1S2BA 1YO8A 4QXKA 4KU8A 3ZKYA 3UJQA 4KL1A 1QJEA 3THTA 1SMVA 2BGPA 2WN3A 3T2OA 4K8FA 3ACGA 3SCHA 1HB3A 2WKKA 4XFCA 3THCA 1YIPA 3HD8B 4M00A 1G9CA 4YM0A 3RPQA 1AYM1 1BXHA 4ZONA 3OUIA 1MEC2 3HQXA 3O1RA 2QCSB 3NO8A 5IVCA 5JAXA 3T2PA 1NQJA 2XJPA 5FK7A 5C8CB 2BFUS 4TN7A 1K42A 3H8XA 5AC91 1SPPA 2FDIA 3SXWA 4J1XA 2P1BA 4YW1A 1AXYA 3H8OA 4LLOA 2HWE2 2OXBA 4GH4A 3MF6A 1PO22 2B39A 3N7LA 1V6NA 2RS52 3SNMA 3LDKA 4CU7A 2A3WA 3A0NA 1JYVA 5LATA 5HCHA 4BXFA 2YC4A 2OYZA 2KM2A 3PVOA 3ZFGC 5A3UA 2WAOA 2WWSA 4MGZE 1V00A 1NCQC 5FXWA 5A7SA 4QU2A 4QB2A 2XBO1 1EY2A 1JW6A 3R05A 4JX0A 1DQ2A 2GC0A 2WWJA 1XQNA 1QJX2 4R4ZA 1Y43B 4WM8B 5BNNA 3D6EA 3NV1A 1ACCA 3LWCA 3WW4A 2RMU3 1C8M3 2W91A 4HXCA 2JDUA 3ZFEC 1JI6A 5A6QA 4XJUA 2JIGA 1OFSA 5SV5A 3TEWA 3PJYA 2WINB 1ULGA 3GHMA 4Q4Y3 4QX1A 3H42B 3ECQA 4FPOB 2ZMLA 2Y6LA 2XJUA 4XQ4A 1O5LA 5FLHA 3WY6A 4YZ1A 1A34A 2HH9A 2Q5TA 4KWLA 4BM8A 1FMD2 5CBLA 1UKGA 3LF7A 4XJWA 3X29B 2FCUA 3WEZA 4EV0A 2RM21 5C71A 3A0KA 5A6XA 1ZA7A 3HT2A 1MPXA 1W9WA 3ROUA 2OKXA 1WLDA 1C1FA 1PGL2 2XLGA 1UU4A 4W65A 1REDA 5IVBA 2WSUA 2F4LA 1DP0A 1W8FA 3J9SA 3USSA 3BPZA 2QQMA 1HB1A 1MZFA 1G9DA 1EV12 4INDA 4Y24A 5FZ4A 4CDWA 1FX5A 3M2MA 4AI0A 3B93A 1T6GC 1QF3A 2DUOA 1YI7A 1L3JA 1OFNA 3ZIWA 4M4RA 1LULA 2P2KA 4DB5A 1EYBA 1RUG1 2R6QA 3PJQA 4K7JA 1VB2A 1NXD1 2ZGLA 4QPIC 1OF4A 4CUGA 3HIFA 4H7MA 3IDAA 1AHSA 2VTXA 5LBBA 1BEV3 3VD3A 3UGFA 3K3NA 2D3PA 1SHWB 2W08A 2Z79A 4BLJA 1Q5OA 5FZ8A 1AR92 5LA2A 5BNPA 4YM2A 1MEC1 3OJBA 4FPGA 3LA7A 2ZEXA 4BXSV 2GALA 2VOXA 4EN8B 4FPHA 3T3YA 1LRHA 5FYSA 1HLCA 5GZGA 1WZXA 1R1ZA 2Q30A 4HETA 4A45A 4QXBA 5FY0A 5I0TA 1Q8VA 1FAYA 4YSFA 5KXEA 3K75B 1DGRA 1PZ8A 1EPZA 2BP6A 4FPKA 5FYTA 3WW3A 3VZJA 4A42A 2JDNA 1TMF3 2D40A 4RGGA 1WCDJ 4RL7A 4IV1A 4MXVA 1EP0A 1AR61 2E63A 2QTWB 4XFAA 3CKHA 3LFMA 5H9PA 5FO7B 3OGGA 4D6SA 3BTZA 4QQ2A 2JE8A 3ZXKA 4FFIA 2I45A 3VBUB 3WDWA 5LASA 1HRV3 5ANNA 5I0SA 2AACA 3NQHA 2ARAA 1PM7A 5D8AA 1MR5A 4BLIA 4H55A 3FLRA 1DDLA 2DVDA 3HQUA 3MW4A 1PIV2 2QQIA 2WZR3 4GWJA 4C1XA 4D6QA 1LTEA 3I3MA 3HMYA 4IV3A 3QH7A 4QKNA 1CZVA 4KMQA 3VBSA 1NT0A 3D82A 5CB7A 3IDBB 1ULCA 1UPIA 4HLTA 3CU7A 4MOAA 4NIAA 3GYDA 4AQ6A 4D0QA 3VDDB 5I0RA 4OYUA 4IGPA 4HMZA 2YBSA 1NCQB 4DS0A 4E4HA 1ONAA 1W9FA 1AL23 4BMEA 4CE8A 1ND3A 2OA2A 5C70A 1L7QA 1WCQA 4N9HA 3O1OA 3TEZA 2WL1A 4UI9L 4Y20B 3VB9A 1S2KA 2YGMA 4CP9B 3RZHA 1UY0A 5DABA 3Q8CA 3OY8B 5F5AA 1PO11 2RMU2 3U4SA 5L9VA 3N3HA 1TVGA 2ES3A 3ASIA 5K8SA 2BV4A 2J1AA 1MZEA 1VBE1 3OGVA 4Y1VA 1AX2A 4Q4Y2 1C4RA 2VNRA 4QAWA 3TEXA 2WT2A 5C5UA 5TSWA 1BKZA 4C0HA 4TSVA 4PQQA 3LAGA 1RIRA 3NRUA 2O0OA 1PNGA 2WO3A 2Z4FA 4Y1YA 1UMZA 2ORXA 4QGNA 4AFDA 2YGLA 5A33B 2WS93 3AP5A 3KHCA 5KXDA 4OI0A 5E1RA 3FE5A 4IE6A 1O3SA 3C3VA 1PVC1 4PF5A 5GM0A 3W5NA 3K48A 1IOAA 2NMOA 2OIIA 4IEVA 1WCSA 1V70A 5K0UA 5FZKA 3WQ0A 2ET1A 1OUSA 4RFRB 5FV3A 4KWUA 2X53S 4O65A 3JXSA 1RVF3 2OPKA 4FTSA 2Q8DA 3RFRA 1JUHA 4XILA 2AH2A 4YW4A 2R7EB 4OHXA 4AYUA 2PLV2 1LHUA 3B7MA 4LE4A 4LULA 3DYPA 1D4M3 4EWAA 2VOTA 3KCYA 2BUKA 1Q56A 2XXZA 4TLFA 3SH4A 2YB7A 3NW4A 1REFA 3E5UA 4RGAA 3KLSA 1IPSA 1E5IA 2HYKA 2WSVA 1YJLA 1UOBA 2W3JA 1BEV2 3CJIA 3UETA 1AR71 4BIFA 2G4IA 2VM9A 3RWNA 4CEWA 5FQ0A 1CJPA 1RINA 2YFZA 3RSJA 2BVVA 2QUOA 4R9DA 2D44A 3FFQA 4WM7A 2XDVA 3ZN6B 2DBNA 3AKQA 1I5PA 1TME1 2OUJA 3UKVA 1U5YA 1JS9A 2BYVE 3ZXJA 1ZRFA 3ZPYA 1F31A 2CHHA 5T55A 3WG3A 4JKKA 1QGLA 5A1FA 4ZZ8A 5FMCA 1JYNA 4YGEA 3GHNA 3KF5A 3AYAA 4XACA 3ZFFA 1W6QA 5AVAA 1JOPA 4E8DA 1O5UA 4JTOA 1JH5A 3WG1A 1NLRA 1AXKA 4QXCA 4W6WA 4AVCA 2HJIA 4ET7A 4YVWA 2QKDA 1W6PA 3QBQA 3KGZA 1QH7A 2FCTA 2E6VA 1ZBE2 2P6HA 2AREA 5D1IA 3VN4A 1W2UA 3AZXA 4GKXA 2OZJA 4AFAA 2ZX4A 2PA7A 4DUWA 5J3UA 4RHV1 3ZN5A 1ZRCA 3DF0A 3GCWA 1K5MB 3O14A 3Q8BA 1HRV2 3WOGA 5JOZA 1TZOA 2ZAAA 4LBKA 2CGNA 2XKOA 3AKPA 1KD7A 4BB3A 2X09A 1ASJ1 1AR81 2HEVF 2IXKA 5LB6A 3V0BB 3RZKA 4OVEA 2C0ZA 3FBMA 4OQ8A 2ZX3A 3DPRA 2EIGA 4AEDB 4Y5TA 4HKWA 4XIKA 4NMIA 1DGWA 1MACA 1OD5A 2P3KA 4CTEA 2RJLA 4NIGA 1NCRC 3AFGA 4NE9A 3RDIA 2WN2A 4LKFA 1HXS2 4UFKA 4A6OA 1S0JA 2WC2A 2JJ6A 2EIBA 1O7FA 2IC1A 1QJU1 5CU1A 3WD5A 3UNPA 3ZXLA 2VZUA 3SCGA 2UWAA 4IE0A 1L7RA 4CCOA 4XBQA 2FDJA 4KWJA 5LK5A 2E33A 3ENRA 1VPHA 3HNMA 4UW5A 5C8WA 3O1PA 5FZ0A 2H6CA 3N9LA 4HL0A 1PVXA 4CDUA 4E9KA 1CPMA 3EXUA 3FL7A 2Q0AA 1W2AX 4NHXA 1OSGA 1QU0A 2BERA 2W1SA 4XURA 4LK7A 3VD9A 2DVGA 1YYNA 2HWC1 1I5ZA 1BLZA 1OF3A 3IKWA 2CAUA 2WS92 4K6BA 5E8AA 3WNOA 4CP2A 3D3AA 5LY1A 2XJQA 2K2SA 3NVCA 4IEOA 3RGBA 1BHGA 1RUD1 1XOYA 4PF1A 5F7UA 4YVSA 5KBFA 4CU9A 2AGSA 2ZHNA 3WVJA 1ZZBA 1BYHA 3INAA 4RN5A 2JG8C 4C0BA 4YZ5A 2YMZA 3DXUA 3GCXA 1HX6A 1RUE1 3C7FA 1FYUA 3B01A 4BWOA 1RVF2 3M3CA 4I30A 3MUZ1 4XZUG 4DY3A 2B5HA 4OULA 3IWZA 4NPRA 3VZNA 4NRQA 4L0PA 3MIHA 5FPXA 2E9QA 1NG0A 4XUOA 4CZSA 3HVDA 1D4M2 3I49A 5EQUA 5JR7B 4RR3A 5JOWA 3DKWA 1BBT2 1O4ZA 1VRH2 3JUUA 3EQEA 1EUTA 1R091 4XTMA 3U0ZA 5CG8A 1JZ8A 1UY2A 4OHWA 1SACA 2BQPA 4UOJA 2QZ2A 3PUIA 1Y9QA 4GALA 4LITA 3HNYM 1K45A 1W03A 4LR4A 4JRLA 3WNMA 1PK6A 2CL2A 1DG6A 2PHWA 2P5BA 3CBNA 3IDCB 5C3QA 2VPVA 5FZ1A 1HQWA 3VD4A 2C4XA 2JDMA 5C3OA 4N43C 3S5AA 1AJKA 4A7ZA 5JR2A 2OX0A 3C7EA 4Q4X1 1W2OA 4GULA 3KS7A 5H9SA 4EYUA 3V0AA 4M3CF 1AF9A 3UV9A 4P02B 2A6YA 1N1YA 4P9YA 3K77A 5F2WA 1UZZA 1ZBA3 4FP2A 1COV3 1WCKA 3WNNA 2ZGQA 3PNAA 4XC9A 4GMP3 4AEMA 3J26N 4QM9A 2R063 2UWBA 3KV6A 1RC6A 2ZMKA 4LBJA 5F2SA 1PM4A 3R6SA 3WDYA 4ASLA 1RTVA 3BU7A 4YGDA 5IHRA 4OFGA 3MIGA 1CAXB 3F95A 1F4HA 4KI5M 5GLZA 1WW5A 1UIJA 5KR7A 2BZDA 4Z2WA 1LHWA 1ULDA 1J3QA 3JB8A 4QMAA 3C7OA 2GAUA 5A70A 2VZTA 1HV1A 4DMIA 1F4AA 2H0VA 1HRI1 1S55A 1LOEA 4MV2A 4CCCA 3NV2A 1LGNA 3R4UA 1MS9A 5C8CA 1AUYA 1RUC1 3M70A 5F32A 1CX4A 2JKBA 3THPA 3HPNA 1NCRB 4R4XA 1ZRIA 3SEEA 2ZEWA 2IZWA 3AZZA 4UAPA 2XL7A 3FBYA 2PHUA 1YWKA 2ZHKA 3J7MA 1YUDA 3PURA 4JGZC 4E2QA 4EJRA 1QH6A 4UBGA 4MZUA 3KV4A 2HWF1 2ID4A 1LOCA 4MXWB 5JXJA 2JG9C 2YU1A 3VDBA 3KMHA 2PMWB 3VBOC 3J8F3 1XYOA 1KDKA 1R1A1 2X5IC 5EHDA 4HN1A 5BNQA 3JBG2 1DGWX 4MG2A 3POYA 4LBMA 3UJOA 4AG4A 1C8NA 1MVEA 1W04A 3RYRA 2VAUA 4QB1A 1POV1 2KXLA 2SLIA 1APNA 4IE4A 4PBPA 2XHNA 1VAKA 3K4DA 4WM8A 2LS6A 2YC2A 3S30A 4ATFA 5IVJA 4IERA 4BE3A 1WA4A 2EAAA 3I2KA 3POGA 2PFWA 3ZYRA 5JLVA 1UWWA 1RB8G 1BBT1 1BMV2 4FTBA 2IFRA 1VB4A 4HT1T 2VVEA 4KBZA 2VJXA 1UZYA 3NNJA 2HWD3 3K3OA 4TWTA 4XF0A 3SC7X 4ATEA 2B7YA 3BOWA 5J48A 2W1UA 4BYYA 3K4AA 3GZEA 2VR4A 3CEWA 3LGRA 3NJXA 4UW4A 5JMCA 1W3VA 5BXXA 2VUCA 4LO4B 2CU5A 1XB9A 2D43A 3WXPA 1JZ5A 3JB4C 4PJYA 3ZR6A 1VBD1 1QQP3 2F17A 3EO6A 3PTYA 2NMNA 3PMSA 3NNMA 3PUQA 2RR11 1UMIA 4JTNA 1MS5A 4C90A 2YBPA 4IQPA 1LOBA 4Q4V1 3TWIA 3EB7A 2GH8A 4MGYE 5GKAC 2ZBJA 4Y22B 3BODA 5HPOA 4L92A 3LEIA 2K9ZA 3KB5A 5I0UA 1FV3A 3I4IA 4IW3A 2DDUA 1UX6A 3E5XA 2JDPA 3QH6A 3RVHA 2F4PA 4QHZA 4UF0B 4E4ZA 4XAAA 5B2GB 3CDZB 1PX4A 2QQLA 4AVTA 3PHMA 4Y3OA 1XRUA 3M3IA 4QKBA 2P6CA 4ITCA 3U07A 4HZFA 5DZFA 1QMJA 2TUNA 1CAWB 4Q0VA 4DZGA 4GXLA 1V6IA 3HEIA 4GWNA 3KWVA 4RGKA 1ULEA 5IW0A 3THDA 2W52A 5HXVA 1HB2A 2YROA 1UQXA 4B3NA 1RUG3 4NRPA 5FZ9A 3WW1A 5FIXA 2J1UA 1BVP1 1ST8A 4QPWA 4IE5A 3ILRA 1LECA 1NUKA 3V64A 1ZBA2 4MHRA 3AJZA 4CUAA 2WYFA 1XNAA 1PZ7A 2R062 5D2AA 1E5RA 2LW8A 4LO7A 5GZEA 3I8TA 3ACHA 4MGTA 1NA1C 3POJA 1MZ6A 3ZKUA 1VR3A 4DQAA 1W2NA 3EHKA 3N9MA 4JCKA 4CXWA 3GF6A 2O8QA 4PBOA 3JBG1 2ARXA 5J98B 1UAIA 1JYXA 3SISA 2RJ2A 3MLJA 3VBUA 1NQDA 2BGCA 2ZHLA 4J1WA 1OPOA 3RYPA 4BU2A 2MEV3 4P9JA 1H8TC 3MFCA 4XHBA 4BH9A 3HT1A 5E88A 4M3CB 3I59B 4V2WA 5F6KA 5KHJA 4BA6A 3DUIA 2G9FA 1DLCA 1HV0A 4A2UA 3ABZA 2OUHA 3M8LA 2IFWA 3JU9A 1ENQA 2PHFA 2NN8A 3BIWE 3VD7A 3MIDA 5L19A 4XDOA 5G04L 1GYKA 2YV8A 3RZMA 1BVVA 1UL9A 1GKBA 1US3A 4EN9B 3TBDA 2JG9B 5C5TA 1GZTA 5A7NA 3VBOB 3FHIB 3VDDA 1FOD1 4NHLA 4BZ4A 4K40A 1NCQA 3PTRB 3U14A 1WBFA 2YU2A 3NJYA 3J8F2 4GAZA 4D7TA 4DXZA 2GN7A 4P5HA 5LRRA 5CKNA 3PL0A 1QY4A 4Y20A 3B9IA 4CP9A 4R8HA 3OY8A 5C3SA 4CEYC 2VY0A 3W20A 5F5CA 3VBHC 1XU2A 1GR3A 5DUXA 3WUCA 5HV4A 3N35A 4XDQA 1SBFA 3BCWA 1RUH3 5FPZA 1D2QA 3JZVA 4LMFA 2Z5WA 3AL6A 4Y1XA 4HVOA 5H9RA 4JKLA 4LOTA 3K2OA 4EZ4A 3ETQA 2I07B 4UFIA 5I8YA 4BQYA 2HWD2 1BCXA 5AFEA 2NPIA 3C7GA 4CP0A 4C1WA 1IKPA 3QCWA 3V65A 4K9SA 4S2HA 4AW7A 3AMNA 1GBGA 4OMDA 2GH2A 3FLTA 4ZS3A 1N1TA 4JGYB 5L9RA 4XJ9A 4FO9A 1R082 3T4HB 1QQP2 5IAXA 3OYWB 1AX1A 4FPEA 1JU4A 4W6YA 1IQAA 4XBNA 2VUJA 4D6RA 2R071 2ZGRA 1JOJA 3LIGA 4JQTA 1RUI2 4GKYA 5ABJA 2C5DA 2ZABA 4YGBA 5FPVA 5FDBA 1J3PA 4LLFA 1FPN1 3WQ7A 2JB8A 4ES9A 4NUBA 1NY71 4AQ2A 2GMEA 3WDVA 3ZYHA 3IT8A 5J36A 3O1VA 3O1TA 2UWCA 3S7IA 1ENSA 2PHXA 4QHOA 2OZ6A 5FPBA 1JYIA 1W8WA 2DV9A 4PLOA 4PDWB 3HNBM 2EAKA 1AJOA 4FP3A 1H0BA 1X36A 2PHLA 4AOCA 2XHKA 2UYAA 3R4SA 3WNXA 1V6OA 5D21A 5F3CA 5LRSA 1Q8SA 1WW7A 1MQTC 4Q0SA 1CWPA 1S0BA 4FAGA 1XE8A 1DYOA 2VCBA 4RS5B 1NOVA 2XUMA 4XFHA 1J84A 1SLLA 2Z2SB 4YG0A 3WNKA 1E5SA 3ZN6A 5JZGC 2FDFA 4ISQA 5JXGA 5DAQA 2QNKA 1UXZA 4LXLA 1EAH3 1IZ3A 3AMMA 1UZ0A 3POBA 5L9BA 3JCIA 3O5SA 3DCQA 3P5BA 3Q8EA 1O6UA 5IUQA 2YUEA 2QQVA 2ZPXA 1VBB3 5F5IA 4YZ2A 5BNOB 4FQ4A 4YW3A 2UURA 4H7LA 3WDTA 1BMV1 1AR73 4E2SA 4AVAA 2VOVA 2WNVC 1F8VA 1URXA 4P14A 3N9PA 1LEDA 2WRAA 1GU3A 1Y9MA 4HG6B 4HBNA 3POEA 1EUUA 1SBEA 1PNFA 5EP9A 3O12A 3KM5A 2RE9A 4QM8A 3WLUA 5GLWA 1UYXA 4JDOA 4JV4A 1V6JA 1I3HA 3H3UA 4C91A 5FZAA 4DOUA 3KV5A 5FP7A 1H8TB 5JWPA 1GANA 1K5MA 3OBZA 2ZKLA 4CU8A 1D0GA 2MEV2 5FY8A 5CVRA 1DIWA 1QJY3 2RG4A 3N9OA 4YWAA 1LODA 1N47A 2DCTA 1ZX5A 2DU0A 4LBQB 3AYDA 3P1IA 4FOYA 2GMMA 2D6KA 5I8TA 3V0BA 4ASMB 1HQLA 1KS4A 1WLWA 2BFUL 4Q29A 3I2FA 3NAPA 2GZWA 2WFPA 4JZRA 3UGHA 2XJRA 2J1TA 2WZ8A 4ONUA 4AEDA 4AI2A 5CFCA 5HI0A 4PLNA 4QQHA 4NRMA 5JXHA 4IGOA 4W50A 5C9AB 3OSDA 1RUJ3 2C26A 2B9UA 2Y34A 4LORA 1GNYA 4XF9A 2RS32 1CAUB 1R081 1XXNA 2FMYA 4XE9A 5F9TA 1RHI3 1FT9A 1RUF2 4RQPC 1NX9A 2DVBA 1ASJ3 2QZ3A 3E6BA 5HV0A 1AR83 3SH3A 1QJFA 3KT7A 3ZM8A 5DAWA 2PYTA 4H14A 3WQ1A 1VJ2A 2VMDA 3LSDA 5FYYA 1S0IA 4Q4W1 4AL9A 5FYHA 3H1MA 5EJ3A 1RUH2 2D5FA 2W47A 2D6MA 2E26A 2BPA2 2ZX0A 4Y5SA 5I0DA 1WBLA 2A70A 2CWMA 2ZEZA 3M1HA 4GQ7A 1QJU3 1LB2A 1OMIA 3FHQA 3M7AA 4XJAA 3GJAA 4CDQC 4PCRA 3B5LB 1DQ6A 3WP6A 1LJ7A 1VAVA 3L2HA 4YW6A 4DRVA 1V9U3 2DUPA 1G7YA 3H8UA 2BTVC 3KD4A 1ALYA 4HK8A 5FZOB 1VBC3 1ND2C 1W8NA 1ENRA 1OPMA 2ZA9A 3T4VA 4Z8BA 1XJAA 5JIUA 3T30A 2HWB2 2A6ZA 4O9EA 4XXAA 5DZEA 2HWE1 3H7JA 1UYYA 3N7JA 2ENRA 1CZTA 1PO21 3VBRB 2RS51 2I74A 5AVPA 2GU9A 2G1MA 3I2DA 3BI3A 5CNAA 2W95A 1W39A 2IXHA 2HEYF 2J1RA 4ARYA 1KFXL 4UW6A 4UT5A 1RUD3 2ORZA 1BK1A 4COZA 2NLRA 1KJLA 1W6MB 2IXIA 1H2KA 3RZZA 2PELA 3LQCA 2Q4SA 2CV6A 4AI1A 4WBBA 1RUE3 1W3XA 1G86A 1QJX1 1MQTB 2PTMA 1GQPA 2KD7A 2P34A 2JDYA 1OLQA 5IFTA 4LIVA 2W0XA 1DFQA 2XJSA 4GH4C 2EVXA 3WP3A 4NIHA 4Q0UA 5JZGB 4LBQD 1WWYA 4CDXC 1W05A 1A78A 3I2IA 3N9QA 1VE0A 4EN0A 1EAH2 3IDEA 1OURA 2VBPA 1SLAA 2WNEA 3A4UA 1J1TA 3PVEA 2J1EA 1PX3A 1VBB2 3I3DA 5A3LA 1FMD1 4LT5A 2WNVB 4MGIE 1NLSA 1UMHA 3ZFGB 3PUSA 1LHVA 4M0HA 4UW3A 3TNPB 1F5JA 1UN1A 1UIKA 2X8KA 2VGDA 1IG3A 2JEMA 3LEMA 4O9GA 4XW3A 4AF9A 4QQLA 4QWNA 1ZREA 3OEBA 2XGXA 2VW0A 2A73B 1PGL1 4NO4A 4BQ5A 1RUF1 2QQOA 2DURA 2V4VA 1CAXA 3AL5A 5FZMA 4AI9A 4OLLA 4Q4X3 1S0DA 4WVWA 1LU1A 1EV11 2P3IA 2QQWA 3M4FA 3WF2A 5LK7B 3ZFEB 3S0MA 5F3IA 5L7OC 1C8M2 5KC5A 4BDVB 2X10A 4FOWA 3H1WA 1IS5A 3ZDVA 2K46A 4UFJA 2Q1MA 1QJY2 1OVPA 5A3NA 2VXRA 3LEKA 3LZZA 4RYDA 3BTXA 2F6BA 4LHKA 3PIGA 3IM0A 3J4UH 1LEMA 3AKTA 3TRSB 4I0WB 3C8XA 4IEXA 2LM3A 1IS3A 1ZVFA 2YYOA 2NYYA 2A3XA 1HQNA 2UYBA 3MIEA 3MPPG 3BGAA 1QEXA 5FAXA 3POWA 5KHHA 3SQOA 2E7TA 2LROA 2RS13 2ATFA 3LCPA 2YPDA 1RUJ2 1AR91 2B45X 2CDPA 2BVBA 1S0CA 4CDWC 4L99A 5IVEA 1OA2A 2VULA 1ZZ9A 5FYZA 4MXWA 1GLHA 1HRI3 1RHI2 4URTA 1O4YA 3HBKA 1W6OB 1WUVA 4ISRA 4LPLA 2Q8EA 4KH9A 1YFUA 1O91A 4LJHA 2WFF3 3ACLA 1DGLA 2VCCA 4JHTA 2PN5A 4N9IA 1CX1A 1QDOA 2VC9A 3DECA 3BPSA 4B4QA 2OVUA 2XVLA 5CISA 1OOPA 2VMIA 3MHZA 4QPIB 3GZTB 4X8NA 4AGGA 3H0OA 4HVQA 5FOBB 3OEAA 2ZGSA 2Y6FA 2E7AA 5FY1A 4CSWA 4WVZA 1DGRN 1SCRA 4QQPA 4CDQB 5BNPC 3I7DA 3TOJA 4GB33 2VNGA 2K0GA 1WA6X 4YW7A 1DLLA 5FPUA 1AL0G 1WD4A 3KQ4B 1R1A3 2AEZA 4B4PA 2CGOA 3ILNA 3N7KA 1ND2B 2N7GA 1V9U2 3ST7A 5ACA3 1AYN3 5K9YA 2W1WA 4QX7A 2JXAA 1VBC2 2WLPA 5DUVA 1POV3 3ZYGA 2D3RA 4DNYA 4IE7A 2QFEA 1GZCA 2VE1A 3AVRA 4RA0A 5A3WA 4MHUA 3MICA 4AWDA 2EF6A 5FUNA 3MLLA 4COVA 3RMXA 1NZCA 3BB6A 5EPAA 1LAJA 4QX0A 4P5YA 3K51A 5FYUA 3PVBB 1PIV1 4BQWA 5LW9A 1WMFA 2WNOA 3F2ZA 4XUNA 4XTPA 1JZ2A 2R1BA 4B8EA 4Y22A 5IFPA 1CONA 1UX7A 3WW2A 2ZKNA 2EIEA 1TMF2 5FY7A 3MV11 3HQRA 3MBWA 5A7PA 3FX3A 4I3PA 3EBRA 5T50A 1SPPB 4UF0A 5FY9A 4ZXKA 4UXAA 5D8AC 1XNBA 3JQXA 2R0HA 4NWWA 2I2SA 4ZPIA 4JHZA 4GH4B 1NKGA 2RMU1 3QLQA 1CAVB 4IV3C 4CDXB 1CAWA 1XYNA 1V0AA 3BOPA 4MADA 4Q4Y1 3ALQA 1W9YA 1WD3A 2WZR2 3KGLA 3CNAA 2V5YA 1Q8PA 1ND3C 5DDJ3 1IS6A 1E5HA 2GP5A 2ZGUA 3OOXA 5EWSA 1VBA3 3H3ZA 4XUQA 4XPVA 1UCXA 1XNCA 3ZR5A 3H9AA 1HW5A 4XVHA 1AL22 4DIQA 4Q1RA 4GA9A 4LKEA 1CPNA 4Y5Z0 2VBBA 2FZ1A 4CCJA 3KT1A 4IETA 1VALA 5L7OB 4NAOA 2DVAA 2ZEYA 1F5FA 1XE0A 2P3YA 2PLV1 1ZZCA 3B9CA 3ES4A 5LEJA 1TNFA 3AB0A 3NMBA 1KQRA 1QXRA 1V6KA 2XJVA 4OMCA 4ZKTB 4NOTA 1NAEA 2JE7A 3E6CC 5A1LA 1XPWA 4ES8A 1SQ4A 4M3CA 3VHRA 3MIFA 4O61A 3ELNA 1UY3A 5K0UC 5FMOL 1JU3A 3E5QA 1BEV1 3EMRA 4NPMA 4ASKA 1MS4A 3V56A 4XF3A 2A6VA 4XOGA 3DEMA 2NQYA 2RS12 2VOWA 4IEPA 4U36A 1GQGA 2LTNA 3OPWA 3WDXA 2R043 4GZ9A 4FI9A 1ZZ8A 2ETEA 2JENA 3VBOA 1DQ0A 2VZPA 4QKDA 1DYPA 4BK4A 4NVPA 3PMEA 2VL4A 3TN93 4WZFA 1T2XA 2PHRA 5B4NA 2BNMA 5KC6A 1OT5A 1CZSA 3IAQA 4H2AA 2WO1A 1LOFC 1H2NA 1SDDB 2WYSA 5F1RA 1C5IA 3CJIC 4XFBA 1NZIA 2DU1A 3H8RA 1UZWA 4QT6A 1UYZA 4CEWC 1TMF1 3AX4A 4U2AA 5CFDC 1ZBE1 2Y0OA 4LOSA 4WM7C 1OA4A 1RL3A 2J1SA 2ZZJA 4GB32 1SG3A 4XCAA 1T6BX 1NXMA 4Y4RA 1HN1A 2XKPA 5T5OA 3JD73 1QWRA 1DQ1A 2ILMA 4FBFA 2W1QA 3VBFA 4OHZA 4AXOA 4FFGA 2J42A 3H50A 1HRV1 5FZ3A 2Y60A 2Y6GA 2B9VA 4N53C 1AYN2 1GWMA 3H7YA 4HSLA 3UT0A 2OT7A 1YC61 5ACA2 5FWJA 1IS4A 3ZFFC 2P3JA 4L11A 4JGYA 1GQHA 2P4EA 3ZXEA 3OB8A 1W8HA 4YVWC 2XR4A 5FZCA 1RJ8A 1RMU3 2XUEA 1GZ9A 3T0AA 3VLBB 3HBZA 3GNEA 5LEKA 4ZZ5A 4M4PA 1JN2P 3FMGA 1HXS1 1DZQA 2VBDA 4JDMA 4KG8A 1ZRRA 2R0FA 2QDNA 4BQXA 4COWA 2AEYA 2B8MA 3LOIA 1ODNA 1PMJX 5CA6A 3AZWA 1JHJA 2QQNA 5J96B 4V1PA 5KWRA 2AENA 2E53A 2OS2A 5JUVA 4PDWA 1IPJA 2WQZC 4MUVA 4YRDA 1ULFA 3T2TA 3UESA 4AR2A 3CHXA 3OBRA 3JQWA 3DPRC 5DUWA 1CN1A 2RDQA 1N1VA 4DY5A 3U11A 2J1VA 3QOPA 3VZKA 4YW2A 1FPN3 1GP5A 3ILFA 2A71A 5T5PA 4B29A 4GD4A 1ND3B 4K21A 4RS5A 4AE2A 3KVAA 2JWPA 4JRAA 4OZOA 1Z7S3 3BKZA 1J58A 1OH4A 3I3QA 3M3OA 5DDJ2 5GZDA 1F9KA 3RYKA 3KF3A 3U10A 3W58A 2WS91 1ZYBA 4IESA 4ARXA 4A4AA 1GOHA 1WLTA 1YHFA 2YZ4A 3MUY1 4QX2A 5FZDA 5BNOA 4EN7B 2KR2A 4ZXEA 3WHUA 5JOXA 4Y26A 4NROA 1A8DA 1X82A 3D8CA 5FJHA 3VHOA 2DFCA 3OBAA 1AYM3 4UWDA 4I02A 2AYHA 4Q0PA 4CP1A 2YPJA 4CDUC 1RVF1 1F2NA 4QD2A 4P9IA 4OI1A 1KITA 1LOGA 1BK0A 4TZDA 4XFIA 5FMBA 1EPWA 5AC93 5GLUA 2CNAA 3WR0A 1G9AA 2PAMA 1PGSA 1QJZA 3NV3A 2YFUA 4AQTA 5DMYA 3RZGA 2RJKA 1WW4A 3CZUA 1D4M1 2QBXA 3ZYBA 1H8TA 1N3OA 1RUOA 1XE7A 1LESA 2VMEA 1KJRA 5DZGA 3AZYA 2FMDA 2Y26A 3KZ4C 1MVQA 1XC6A 1VRH1 3FWEA 4QX3A 4YVSC 4CCKA 4HANA 5FY5A 3UKNA 1YFXA 4LBQA 5L36A 4X6RB 1D4VB 1IGOA 2E31A 2XBO3 3NJZA 2ZZQA 4AI8A 5CADA 4PIXA 2O8OA 4DUVA 4DXTA 1UXXX 2ZGOA 2JG8B 3AK0A 4MYEA 2RV9A 2VZVA 4Y33A 4LHNA 2R042 1LOAA 1I6XA 5C9AA 3IPVB 3LPFA 5FPLA 3VDCA 3ME2A 1W2TA 4LQRA 1DQ5A 3ORJA 1Q3EA 1CAUA 4QU1A 3TN92 5GZCA 4AHYA 5CKQA 5F8PA 3SCFA 1M06G 3B94A 1B35C 3WQBA 2EA7A 1SFYA 1W6NB 4NWVA 3SKJE 2JDAA 5A80A 2TBVA 1OI6A 3J7HA 5CFDB 1SLCA 1CD3G 3ZX7A 2Q1FA 4KG0A 2RM23 2EICA 3U78A 3WP5A 1PK6C 1HIXA 2V4AA 4L97A 2BU9A 4QDSA 4YYOA 1Y3TA 1OA3A 3A22A 3O1UA 3RMYA 1Y9GA 3JD72 4LIUA 4N53B 5M0TA 3GBFA 4B4RA 3LIHA 4KQ7A 4N90A 3LKJA 3D4KA 3IN9A 3PUAA 4N43B 5FKBA 1SLIA 3MZHA 4XQWA 5LWBA 4X6QB 3WSOA 4D7YA 1D7PM 1RXFA 5FZOA 4YVWB 2AR6A 4QXHA 5CEHA 4DUXA 1H2MA 2JDKA 1GNHA 3I2JA 3LDBA 5FZ6A 5IK7A 5F37A 3AZVA 5FMDA 5IVVA 1RMU2 4BJ0A 3M3EA 5H9QA 5LBFA 3ZLIA 1COV2 5FP4A 3AYEA 1H9PA 4W8JA 2D7FA 2AC1A 1UD1A 3VBRA 3WUDA 3S57A 5FKCA 4OHYA 4LO8A 5FK8A 3I2OA 3VL8A 5FBJA 1V6LA 4HOOA 5GLTA 3IIIA 1DZRA 3KSCA 1WMXA 1MEC3 2IXCA 3RG0A 1OQDA 3O0WA 4YM3A 5F6LB 5BY5A 2GMPA 1W6MA 1H4GA 3HJRA 3ZSKA 5C8CC 2FBEA 2JE9A 3WNLA 4HKOA 2GSYA 4XFFA 1SEFA 2FQPA 1GZWB 2GC2A 4ZHNA 3I2GA 5GALA 3ZO0B 1UZVA 3VKLA 1QOSA 4S2GA 3SITA 2A5ZA 5FYCA 1TEIA 4AHXA 5JZGA 4AFBA 2WR9A 4AHZA 1Z7S2 3VZOA 2VZOA 5EFUA 2PQSA 1IHMA 3WF4A 3R4DB 5FYMA 1HJFA 2VVDA 4JGZB 4BOWA 1AR63 2QQJA 4W4ZA 5C6CA 1XYPA 3AP7A 2GNBA 2G9GA 3HN1A 3I3BA 3O0VA 1QJX3 1W8TA 2D3SA 3S5QA 4CCNA 5J09A 3ZFGA 2C6SA 3SH5A 1REEA 2GNDA 4CDUB 2X5IB 4WZCA 1AYM2 2VZ1A 2WABA 4WM8C 2E7QA 3PVNA 4OCTA 4I09A 3WINE 4XZPA 4WVMB 5BV6A 5AC92 2ZGPA 2VZRA 4COYA 4CUBA 1SFPA 2BW8A 5I91A 4AHWA 5JSPA 2BDRA 1WMDA 2QE3A 3ZFEA 2BJSA 2TNFA 3AP4A 5LY2A 1Y7BA 3RWKX 2ERFA 2GDFA 2Y8KA 1E57A 5CG9A 2G19A 4S2DA 5JCTA 5FXXA 1UYPA 4Z82A 2PXJA 5BPXA 4GJYA 1PZ9A 2DCZA 2XBO2 3U75A 4HN0A 1MZ5A 3CJXA 4CRQA 3OBTA 2ZX2A 3LFIA 4DXSA 5A33A 1L7LA 2BBVA 5I93A 3B02A 2XJTA 3OCPA 4G9SB 1PO13 5K4LA 2IXLA 4NPLA 3RI9A 5FFOC 1YXWA 1B35B 1SLBA 1VBE3 1BQPA 2A1XA 1W6OA 2VU9A 4MGKE 5C3RA 1IKQA 1ZBA1 1DHKB 2MNGA 4XUPA 1COV1 3VKNA 2X29A 3D0JA 5EV7A 4AK3A 3LE0A 1JTZX 4FPLA 4GMP1 4XJ8A 2R061 1W9SA 2D97A 1PK6B 3CO2A 5T54A 2RM22 1PVC3 1XBFA 2CY6A 2VMFA 1ZA4A 2LALA 4QPIA 3MDPA 2C9KA 4FFFA 2B46X 1YEWA 2ZS6B 1S0EA 3WCRA 3GALA 4B1LA 5A7QA 5DN2A 4CDQA 2RHPA 1ODMA 3DYOA 2XLAA 1SBDA 3ES1A 2E51A 2DTYA 3I54A 4P9WA 1Q8OA 3ZSJA 3E6DA 3MFAA 1O4TA 3MW3A 1X8MA 2YC0A 3DYMA 4LUKA 4ZY9A 3WF0A 3VDAA 4QX8A 4HFSA 2JKXA 1J83A 2VW2A 2QDRA 2V73A 2D98A 2WBKA 3MI8A 4J6GA 4LBLA 5LZ6A 1MS3A 1N3QA 1H30A 1UNBA 4BQ3A 4B1MA 4D69A 5HCFA 1OLMA 1JYWA 1RUG2 4C8DA 3L9JT 1OLRA 3RJ2X 5ISLA 2CGPA 1ZM1A 2GNTA 1TE1B 2DVFA 2E32A 4LUMA 1KS5A 3OGJA 4K1ZA 1JZ4A 3NKGA 5IVYA 1JYCA 1UY1A 2YY1A 3HN3A 1SCSA 1LCLA 1NA1B 4XEZA 2AUYA 3IMMA 4CCEA 3MLKA 4JC1A 5E89A 3AKRA 3VBUC 4E4DX 4AVVA 3J8F1 3PIJA 1U0AA 2CTVA 1TME3 3K46A 3ZDSA 5A3PA 2RDNA 1STMA 3NL1A 4G4FA 3SHRA 4AQSA 3N9NA 2B42B 3NJVA 3Q8AA 4AFCA 1OKQA 2PAEA 3ACIA 1PIV3 5FCCA 1HN0A 3VV1A 2Y6HA 2XVGA 4YFZA 2FDGA 4DEQA 2ZHMA 3W9AA 1UKRA 1Y4WA 1GFF2 2EXIA 4XIOA 1CAVA 4CDXA 5LBEA 3FC0A 2Y0IA 2GP3A 1CR7A 4P9GA 4KGQA 2P37A 3VZLA 3ACFA 3BYWA 4OI2A 1QDCA 1X8EA 4LK6A 5E6HA 3VDDC 1X9PA 4EN6B 1JZ7A 2BWCA 2HWD1 4NHYA 1AR62 4Y1UA 4GMP0 4AAPA 4QKFA 2OQ6A 1JZ6A 1LHNA 4RHV3 1YQ8A 2ZACA 3PU8A 2FHRA 4WV8A 5G05L 1QQP1 3NSTA 4UFLA 1QNYA 3T08A 3POIA 5IK4A 3OD4A 4CEYB 5DAVA 5JI7A 1XNKA 1J1LA 1GMMA 1QOOA 3PLQA 3VBHB 2VCMA 1W06A 4DINB 1CQ9A 5L7OA 1J59A 1RUI1 1XNTA 2BBAA 1UF2C 1HKDA 1X33A 1JOBA 4A7YA 5C4WC 2DTWA 4XMIA 3O1SA 3T0DA 4MX3A 3RI8A 3KCCA 1HDKA 2BOIA 4H3WA 1G6NA 4J25A 3WV6A 1W28A 3M3QA 4SLIA 4I3GA 1FV2A 2W5FA 1TG7A 3LD8A 2ADEA 2XLFA 4S2FA 5KHKA 3AP6A 3C2UA 1DU3D 1PO12 5A7WB 3POSA 2WNUC 4LHLA 1JUIA 2PLV3 3RZLA 4QPGC 3RRDA 5FP9A 5ABJC 1WKYA 3T2QA 1XSRA 4URAA 1TNRA 1VMJA 3MIBA 3WX5A 1VBE2 2WT0A 5CYYA 3UYJA 4AVBA 2D93A 5A3OA 1A8MA 3DKQA 3IBMA 3DV8A 1R64A 1JBCA 2Y38A 2HWC3 2ZOEB 3FLPA 4Q1PA 3P3PA 4COUA 3RZJA 3BN6A 4FXKB 2XQXA 3ZIXA 1QKQA 1FATA 2VQUA 2MHFA 3APBA 1HB4A 2V5DA 2VZ3A 2W68A 1PVC2 2Z69A 4BQ1A 4I2OA 5A6YA 1O3QA 1BZWA 2FDKA 2LUWA 4PQ9A 4NHMA 1RXGA 1OXCA 4F83A 1UU5A 1KFUL 4MO3M 5CFCC 2TEPA 3D0SA 1Z78A 2CSGA 3AXDA 3E1F1 5IT6A 5ERLA 2WWUA 2HKXA 1H6XA 1QOTA 2WDBA 3W5MA 5LA9A 2MEV1 2VNOA 2VO5A 1MS0A 1AVBA 2LRPA 1W8ZA 3RQ0A 3WP4A 4QX5A 1WMEA 3UK9A 1GUIA 4HPKB 5FO8B 4ORFA 2SBAA 3AFKA 4AZZA 2NP0A 1GP4A 1ZBE3 2MPFA 3T0BA 2W39A 1R093 1IPKA 2XQRA 2VQAA 1AR72 2NZ9A 2R32A 2W87A 3ZPOA 1C1LA 4X8PA 2Z42A 3ZYPA 2V09A 4CXYA 4LKDA 5I8SA 5BNNC 4A3XA 1AZDA 3ETPA 2D5HA 1GSLA 1U5XA 1UPSA 2RS31 1K5MC 3AP9A 5FTTC 5FUPA 1TME2 4OZXA 4HONA 5HCBA 2UY8A 1D0HA 4Z1VA 4KNCA 2ZXQA 2ZCWA 3EYPA 4TXWA 3AMHA 1DYKA 3KHBA 3VUOA 3NAPC 1OH3A 4CUCA 4AEDC 1RUH1 1YCIA 3BALA 5BYNA 1AX0A 4MGSA 1LNSA 3BUCA 1HXS3 2EXHA 4SBVA 3OGSA 2D6OX 4XCBA 4D3WA 2BWAA 1N1SA 4QDRA 4XF1A 3O0XA 4TYSA 1NCRA 1LU2A 3MEPA 4RFT0 3VHPA 2A75A 3B69A 3HWJA 3A7QA 2ARCA 3J7NA 4PT6A 1KEXA 1GOFA 4YFWA 1YFWA 4M0NA 4RHV2 4I0AA 3OTFA 3GDBA 2YDEA 4Y1ZA 5T3NA 5JMOA 4RQPB 2YBKA 5FZIA 3USUB 5LA1A 1GWLA 4UFMA 1JHNA 1GWKA 2GC3A 4FFHA 2VTXJ 4I01A 2VECA 1VP6A 4QGLA 1ASJ2 2HWB1 1LKNA 1AR82 4AVSA 2JICA 2A6WA 1RUC3 3KVBA 1ZZ6A 1AXZA 3BIEA 4KWKA 5C4WB 3POFA 3GXUA 1U12A 5A32B 4PI0A 4K3UA 1POQA 2O14A 2CWSA 4LTAA 4CCDA 4DO0A 3SEPA 1GP6A 4BISA 2HWF3 2WQ4A 1QJU2 5DG1A 1S4CA 2WAAA 4CPBD 3ZMOA 1CJDA 3CMGA 3P3NA 1NE4A 5HCAA 1OHFA 5FP8A 2WNUB 5JSRA 3U37A 3LPGA 1GICA 4E4SA 2HBUA 4QPGB 4WVVA 2VMCA 5FZFA 5ABJB 2JG8A 3OPTA 4LA3A 2BOJA 3TYJA 4R52A 3ZN4A 3IPVA 4P9XA 2W2IA 2VG9A 3BVCA 3O7OA 1YQ2A 2ZTNA 5C7GA 4TLGA 4FPCA 1EAH1 2JB4A 5DAPA 1NYWA 1BBT3 4IUGA 1LENA 4D8MA 1VRH3 4CVUA 5C33A 2HWC2 3U1XA 1ZRDA 1VBB1 4IV1C 3VKOA 1LOFA 1ZZ7A 1W6NA 2PAKA 2VZSA 1C28A 5C3PA 3ON7A 4YNIA 1GNZA 1J3RA 4XXPA 5A6ZA 3TAYA 5JDBA 4YGCA 5FYIA 5LBCA 1RUD2 5CFDA 1WLCA 4I0BA 2WLQA 5IATA 1CESA 3I97A 1W0NA 2A7AA 4XQDA 2EXJA 2P17A 4LBNA 2WZEA 3AM2A 3MV01 3ZMNA 5CFCB 2D6PA 1RUE2 2CAVA 2OPWA 2H0BA 5EJZB 1A3KA 1VBD3 5FJKA 5FZGA 2DYCA 3VGIA 4Q8KA 2RR13 1OUXA 4PLMA 4CA9A 5SV8A 2D6NA 4Q4V3 4M3CE 4N53A 1NLQA 1C8M1 1XNDA 4YZ4A 2VD7A 2H6BA 1GOGA 3LA3A 4HSJA 4N43A 3HAGA 4GIQA 3VBSC 1QJY1 4FOQA 2IWGB 3FFZA 1C5HA 4META 5FUIA 4UBHA 1LGBA 1VIWB 2GC1A 2WO2A 4MSVA 5FXZA 5IVFA 5J7MA 4JVAA 3SMHA 2XONA 3WG4A 1R092 3ZXDA 4CYDA 4Z07A 1YNAA 3N4MA 5BNNB 5KHGA 3AMPA 2VTFA 5A3MA 4IEZA 3B00A 2JD9A 3IZOA 1JMUB 1RUJ1 2DCKA 3E97A 3T09A 3DN7A 4JKMA 4CXXA 1UU6A 2Y6KA 4QPYA 3UL2A 3ZXFA 3O1MA 3ZXGA 3TB0A 4XF4A 4XMAA 1RHI1 2IUWA 4L2NA 2VUDA 3FJSA 5FMOS 4OQ9A 4E2GA 4DEVA 2VVFA 4Q4X2 3MGUA 3PDQA 3UKTA 2IXJA 5FRAA 4EROA 4KGGA 5GJ6A 3NAPB 5F5QA 5FZLA 4IL7A 3S6PA 1WW6A 4Q26A 1GZWA 5IAVA 4XJZA 3VKFC 5FXVA 5A7OA 3NNFA 4OI4A 4BPZA 3OF1A 4MVTA 2Q8OA 4CCLA 2XWJB 3AYCA 4NHKA 5GZFA 5B4XA 2DF7A 1YLLA 4XDPA 4ZS2A 1X50A 2XH6A 1LGCA 3I59A 4W6XA 1WGPA 4GJZA 5CZKA 2A3YA 2VQ0A 5K7PA 5FYBA 1G8WA 1H4HA 4Q5OA 4JGZA 1DBNA 3JBG3 3QD6A 3WNPA 4CDWB 4DFSA 2ET7A 4JDNA 4PIYA 1V9U1 2FDHA 1VBC1 2JG9A 5JXIA 4QDQA 2HBTA 2IVIB 2WQ8A 5EIYB 1HRI2 2X5IA 4E27A 1OOPC 2PHDA 2Y64A 2IVJA 4FTEA 3KCXA 4XAEA 4QHBA 1S2EA 1RUC2 2WFF2 2ZAHA 3LDRA 2RVAA 4WVMA 1H9WA 1X7NA 1OC1A 3CZJA 1SDWA 4XETA 3P6BA 3FHAA 1S1AA 3G6JB 2VNVA 4B7KA 3LOBA 2ARBA 5FZHA 4AAXA 4TTGA 2RDRA 4BMBA 3MW2A 3WZ1A 5BNPB 2XB6C 3KQRA 3NNGA 3NV4A 4NJ4A 4DXRA 4NR1A 2HWF2 3S7EA 4YW5A 1FOD3 2W46A 1Z0HA 3WT3A 4EZHA 4YLZA 5A3TA 3PUHA 4BHPA 1W90A 1N3PA 2WA3A 5EYYA 1R1A2 1RYYA 4IGQA 2HLEA 5IWFA 5FP3A 2Y6JA 2ZGNA 3ZSMA 3VL9A 1CGPA 1IQDC 1JODA 2A6XA 4N7UA 4Q2FA 3OPZA 4NIDA 4P08A 3AC0A 5FZEA 5JIAA 3MPBA 1KGYA 2DCJA 4BQ4A 1FNZA 1MS1A 1PHMA 2WZR1 3OYWA 4IV1B 1B35A 1G9FA 4YG3A 4IEQA 3LA2A 1YI9A 5KXCA 5L73A 2B4KA 2FCVA 1GV9A 1AL21 3I2HA 5EYXA 1K5JA 5FR3A 3FUQA 5D8AB 2DFBA 4MGQA 2HEWF 4NAMA 5HBAA 2XWBB 4O7XA 4Q8LA 2PQQA 3CIHA 3CLPA 1VBD2 2J22A 3K4ZA 3BTYA 5A1AA 2RR12 3TEYA 4RD7A 4IV3B 4Q4V2 4IEUA 4FCAA 5DXDA 2R1DA 2X05A 2EIDA 4FQZA 3Q8FA 1F35A 1UOGA 2R073 3VBSB 3NWKA 1US2A 3PU3A 3WF1A 3LB9A 3CQOA 5FY4A 2UU8A 3AMQA 4NIIA 4MLOA 2VXJA 1DF0A 4F8AA 4YPJA 4AGRA 5T5JA 1LR5A 2YG0A 3DGTA 5LCWL 1DQ4A 5FYVA 1C57A 4R9CA 3ATGA 4D7SA 4IDZA 4NN0A 3DXTA 1QXJA 2BNOA 1VBA2 2GN3A 5FLIA 4EQVA 2UY9A 1BJQA 2RS11 2QQKA 3AVSA 1CVNA 4ZU4A 1FXZA 4PIZA 1KDMA 1NA1A 3DL3A 4YM1A 2DUQA 2ZGTA 5DG2A 4B7EA 4FPYA 3H1YA 1KXGA 1MS8A 2VW1A 2WFF1 2ZGKA 2WT1A 3ZOIA 4CCMA 3I3EA 5FLJA 3VKMA 1QXPA 4GWMA 4A6SA 5E16A 1ZNPA 4QGMA 1W9TA 2BRTA 3WF3A 4F3JA 3ZSEA 1YQ6A 1OQ1A 2YHJA 4ZU5A 5K0UB 3W21A 4A44A 1UY4A 2QQUA 3J7LA 4KBBA 3SLIA 4HKLA 4IXLA 5IK8A 2V72A 4GB31 1VMFA 5F39A 4XYXA 4BQ2A 2NM1A 3WG2A 3EJKA 5CKMA 5EZWA 1RUNA 1PMHX 2R16A 5JPMB 5F3EA 5ACA1 1AYN1 4IEYA 4L9BA 2C24A 1SZBA 1CIWA 2WA4A 3FUOA 4LHSA 1OOPB 4IEWA 4AEKA 2O1QA 5DAXA 3MYXA 5JVVA 1H1AA 2DWRA 4BK5A 1H8VA 4QQOA 4EE2A 4YARA 3OGRA 2KA3A 5FPAA 5JI9A 5KHIA 1H6YA 4RR3C 5KXBA 1QNWA 1YJKA 1ENXA 2Y33A 2JD4A 3NKTA 3G7DA 1JZ3A 3BU0A 4CEYA 3CJIB 5FZBA 2VH9A 2VUAA 1VRBA 1V6MA 5FZ7A 3KT4A 3VBHA 3GM8A 4CEWB 2QJVA 4K1YA 5FQ0B 3GGLA 3HR9A 4RSUA 5GLVA 3IAPA 4WM7B 2VOKA 3VBFC 1D2SA 4OUMA 3A23A 1W0OA 1YFYA 4L8QA 2W92A 4AI3A 1FOD2 1O3TA 3HOBA 3ZSLA 2XL9A 1UO9A 1YQCA 3FN9A 1R083 4A41A 1SLTA 4DPNA 1I9RA 3NNLA 4JGYC 1KRIA 3MO4A 1CIYA 3ZFFB 1W6QB 1FI2A 4LBOA 3VZMA 2Q1ZB 2BEOA 1H1MA 2DCYA 2WIIB 1RUI3 4A7KA 4FAHA 4P9LA 5A7WA 2QQPA 2G9ZA 4Q4W3 3GBWA 1W6PB 2ZGMA 5DUUA 1SFNA 4XFGA 3GBGA 4HK9A 1OD3A 1OQEA 2R49A 4V2VA 4FSJA 2VMGA 4LEJA 1OVSA 4K20A 3C7HA 3OUJA 3WCSA 2ZJCA 4UFHA 5DDJ1 5J37A 3IIAA 3IMNA 1VBA1 1YRZA 1X9TA 2XPJA 1YQ5A 2YXSA 1PGW2 1TQ5A 2AZ5A 4PDWC 1C3HA 3L2YA 3ZYIB 1VLNA 2ZMNA 1HJGA 4R9BA 5ANQA 4Z92B 1O8SA 3RJRA 2WUHA 5CAZA 1QHDA 5F3GA 4LNVA 4OUSA 5IJRA 5CIRA 1PMIA 5APAA 1H1IA 3OD0A 2CDOA 4R9AA 3OG2A 5BUVA 5IK5A 3DPRB 4RS5C 5DPNA 3T1MA 3A21A 2Q8CA 2FZ2A 2R072 1MQTA 1POV0 3ZYJB 2HWE3 4CPBA 4LE3A 3H3LA 1QIQA 1PO23 4MH0E 3RS6A 2RS53 1FPN2 1H2LA 1UW8A 4XBLA 1NY72 2WZPP 4AGVA 4EWEA 5BNOC 5FOJB 4OHVA 3WDUA 2R30A 4YZ3A 4FVVA 3BTAA 4YG6A 2JIJA 4D94A 5IYYA 5JOYA 4LO5B 4HVRA 2JDZA 4HPKA 2QVSB 1UOJA 4G3YC 4XABA 4N8MA 4UYBA 5DQ0A 5HXMA 1DZTA 1UOFA 2OW4A 5J1XA 1U5IA 2WNVA 2R041 3LEGA 1O59A 3FZ3A 4JAAA 4LA2A 1W8UA 3QACA 2CYFA 1OBNA 2BGOA 3ZXAC 2WJSA 2W94A 3CL1A 2L9LA 4XHXA 1G9BA 2XG3A 1XSQA 2RDSA 3TN91 4BCUA 4A3ZA 3RNSA 2HYXA 3WHTA 2W9XA 5EJ1B 2PHTA 3N36A 3ZVXA 3U4XA 3CF6E 4QB6A 3MF9A 2XMLA 2JX9A 4FPJA 4BIOA 4XUTA 1FMD3 1WCUA 4K8RB 4N7IA 3N7MA 4JQRA 1VMHA 4YVSB 2BNNA 4PI2A 2GNMA 4KU7A 4Z2AA 1ULOA 2ZX1A 2D6LX 1OKOA
chains in the Genus database with same CATH topology
1Q43A 1A6CA 2XVKA 5C9AC 2RS33 1JXNA 1FNYA 2VMHA 5AFBA 1RJ7A 1RUF3 3JD71 3Q9OA 4FOVA 1W0PA 5JPNB 1S0FA 3T1LA 5T5LA 4F7ZA 1EV13 3AJYA 3D5OA 1LHOA 1S0GA 4AFMA 4LO6B 1VAMA 2EXKA 4RR3B 4RQPA 2C1FA 3GZAA 3USUA 3GZUC 3VHNA 3AKSA 4FXGB 1RMU1 2EALA 1XU1A 5JSOA 4FPFA 5FBZA 1RITA 5T52A 4EWDA 4Q0QA 1M4WA 5C4WA 4M01A 3VBFB 1PGW1 5A32A 2JECA 3R0RA 4Q27A 1I1EA 1AR93 4Y4YA 3TNQA 1Q8QA 5FREA 3URFA 5FO9B 3V0AB 4ZU7A 4DRRA 1U5ZA 1NE6A 3B3QE 2HWB3 1RGSA 1YIFA 5EXOA 2C9AA 2WNUA 3LSEA 1ND2A 4QPGA 4FT8A 3AXEA 3W59A 1B09A 4Q4W2 1O3RA 3VBRC 1Z7S1 4AEJA 1S2BA 1YO8A 4QXKA 4KU8A 3UJQA 4KL1A 3THTA 1SMVA 4K8FA 3SCHA 2WKKA 4XFCA 1YIPA 3HD8B 4M00A 1G9CA 4YM0A 3RPQA 1AYM1 1BXHA 1MEC2 3HQXA 2QCSB 3NO8A 5JAXA 1NQJA 2XJPA 5C8CB 2BFUS 5AC91 3SXWA 4J1XA 4YW1A 1AXYA 4LLOA 2HWE2 4GH4A 3MF6A 1PO22 2B39A 3N7LA 1V6NA 2RS52 3SNMA 2A3WA 3A0NA 2OYZA 2KM2A 3PVOA 3ZFGC 2WWSA 4MGZE 1V00A 1NCQC 4QU2A 2XBO1 1EY2A 1JW6A 3R05A 1DQ2A 2GC0A 1XQNA 1QJX2 4R4ZA 1Y43B 4WM8B 5BNNA 3D6EA 3NV1A 3LWCA 3WW4A 2RMU3 1C8M3 3ZFEC 4XJUA 1OFSA 5SV5A 3PJYA 2WINB 1ULGA 3GHMA 4Q4Y3 3ECQA 4FPOB 2ZMLA 2XJUA 4XQ4A 1O5LA 5FLHA 3WY6A 4YZ1A 2Q5TA 4KWLA 5CBLA 4BM8A 1FMD2 1UKGA 4XJWA 3X29B 4EV0A 2RM21 3A0KA 3HT2A 3ROUA 1WLDA 1C1FA 1PGL2 2XLGA 1UU4A 4W65A 1REDA 2WSUA 1G9DA 3J9SA 3USSA 3BPZA 1MZFA 1EV12 4INDA 4Y24A 4CDWA 1FX5A 3M2MA 4AI0A 3B93A 1T6GC 1QF3A 2DUOA 1YI7A 1L3JA 1OFNA 3ZIWA 1LULA 2P2KA 4DB5A 1EYBA 1RUG1 2R6QA 3PJQA 4K7JA 1VB2A 1NXD1 2ZGLA 4QPIC 3HIFA 4H7MA 1AHSA 1BEV3 2D3PA 2W08A 2Z79A 4BLJA 1Q5OA 1AR92 5BNPA 4YM2A 1MEC1 3OJBA 4FPGA 3LA7A 2GALA 2VOXA 4EN8B 4FPHA 1LRHA 1HLCA 5GZGA 1R1ZA 2Q30A 4HETA 5I0TA 1Q8VA 1FAYA 4YSFA 5KXEA 1DGRA 1PZ8A 1EPZA 4FPKA 3WW3A 3VZJA 1TMF3 2D40A 4RGGA 1WCDJ 4RL7A 4IV1A 4MXVA 1EP0A 1AR61 2E63A 4XFAA 5H9PA 5FO7B 3OGGA 4QQ2A 3ZXKA 2I45A 3VBUB 3WDWA 1HRV3 5I0SA 1PM7A 5D8AA 1MR5A 4BLIA 4H55A 3FLRA 1DDLA 2DVDA 3MW4A 1PIV2 2WZR3 4C1XA 1LTEA 3HMYA 4IV3A 3QH7A 3VBSA 3D82A 5CB7A 3IDBB 1ULCA 1UPIA 4HLTA 3CU7A 5I0RA 3GYDA 4AQ6A 3VDDB 4HMZA 4DS0A 1NCQB 1ONAA 1AL23 4BMEA 1ND3A 2OA2A 4N9HA 2WL1A 4Y20B 1S2KA 2YGMA 3OY8B 1PO11 2RMU2 3N3HA 2ES3A 3ASIA 5K8SA 4Y1VA 1MZEA 1VBE1 1AX2A 4Q4Y2 1C4RA 2VNRA 2WT2A 5TSWA 1BKZA 4C0HA 4TSVA 3LAGA 1RIRA 2O0OA 1PNGA 4Y1YA 1UMZA 4QGNA 4AFDA 2YGLA 5A33B 2WS93 3AP5A 5KXDA 4OI0A 5E1RA 3FE5A 1O3SA 3C3VA 1PVC1 4PF5A 5GM0A 3K48A 1IOAA 2NMOA 2OIIA 4IEVA 1WCSA 1V70A 5K0UA 3WQ0A 2ET1A 2X53S 1RVF3 2OPKA 4FTSA 1JUHA 4XILA 2AH2A 4YW4A 4OHXA 4AYUA 2PLV2 1LHUA 3B7MA 4LE4A 4LULA 1D4M3 4EWAA 3KCYA 2BUKA 1Q56A 4TLFA 3SH4A 3NW4A 1REFA 3E5UA 4RGAA 3KLSA 2HYKA 2WSVA 1YJLA 1BEV2 3CJIA 1AR71 4BIFA 2G4IA 3RWNA 4CEWA 5FQ0A 1CJPA 1RINA 3RSJA 2BVVA 2QUOA 4R9DA 2D44A 3FFQA 4WM7A 3ZN6B 3AKQA 1TME1 2OUJA 3UKVA 3ZXJA 1U5YA 2BYVE 1ZRFA 3ZPYA 1F31A 5T55A 3WG3A 1QGLA 4YGEA 3GHNA 3AYAA 3ZFFA 1W6QA 5AVAA 1O5UA 4JTOA 1JH5A 3WG1A 1NLRA 1AXKA 4AVCA 4W6WA 2HJIA 4YVWA 2QKDA 1W6PA 3QBQA 3KGZA 1QH7A 2E6VA 1ZBE2 2AREA 5D1IA 3VN4A 1W2UA 3AZXA 4GKXA 2OZJA 4AFAA 2ZX4A 2PA7A 5J3UA 4RHV1 3ZN5A 1ZRCA 3DF0A 3O14A 1K5MB 3WOGA 1HRV2 5JOZA 2ZAAA 4LBKA 2CGNA 2XKOA 3AKPA 1KD7A 1ASJ1 1AR81 2HEVF 2IXKA 3V0BB 4OVEA 2C0ZA 3FBMA 2ZX3A 3DPRA 2EIGA 4AEDB 4HKWA 4XIKA 1DGWA 1MACA 1OD5A 2P3KA 4CTEA 2RJLA 1NCRC 3AFGA 3RDIA 1HXS2 1S0JA 2WC2A 2JJ6A 1O7FA 2IC1A 1QJU1 5CU1A 3WD5A 3ZXLA 3SCGA 2UWAA 4XBQA 4KWJA 5LK5A 3ENRA 4UW5A 5C8WA 2H6CA 4HL0A 1PVXA 4CDUA 4E9KA 1CPMA 3EXUA 2Q0AA 1OSGA 1QU0A 2DVGA 1YYNA 2HWC1 1I5ZA 3IKWA 2CAUA 2WS92 4K6BA 5E8AA 4CP2A 2XJQA 2K2SA 3NVCA 4IEOA 1RUD1 4YVSA 5KBFA 2AGSA 2ZHNA 3WVJA 1ZZBA 1BYHA 3INAA 2JG8C 4C0BA 4YZ5A 2YMZA 1HX6A 1RUE1 4BWOA 1FYUA 3B01A 1RVF2 3M3CA 4I30A 4DY3A 2B5HA 4OULA 3IWZA 4NPRA 3VZNA 3MIHA 5FPXA 2E9QA 1NG0A 4CZSA 1D4M2 5JR7B 4RR3A 5JOWA 3DKWA 1BBT2 1O4ZA 1VRH2 3JUUA 3EQEA 1R091 4XTMA 3U0ZA 5CG8A 4OHWA 1SACA 2BQPA 2QZ2A 4LR4A 1Y9QA 4GALA 4A7YA 4JRLA 1PK6A 2CL2A 1DG6A 2PHWA 3IDCB 2VPVA 1HQWA 4N43C 1AJKA 4A7ZA 4Q4X1 4GULA 3KS7A 5H9SA 3V0AA 4M3CF 1AF9A 3UV9A 2A6YA 1N1YA 4P9YA 1UZZA 1ZBA3 4FP2A 1COV3 1WCKA 2ZGQA 3PNAA 4GMP3 4AEMA 3J26N 4QM9A 2R063 2UWBA 1RC6A 2ZMKA 4LBJA 3R6SA 3WDYA 4ASLA 1RTVA 3BU7A 4YGDA 4OFGA 3MIGA 1CAXB 5GLZA 1WW5A 1UIJA 4Z2WA 1LHWA 1ULDA 1J3QA 3JB8A 4QMAA 2GAUA 1HV1A 4DMIA 2H0VA 1HRI1 1S55A 1LOEA 4MV2A 3NV2A 1LGNA 3R4UA 1MS9A 5C8CA 1AUYA 1RUC1 3M70A 1CX4A 2JKBA 3THPA 1NCRB 4R4XA 2IZWA 3AZZA 2XL7A 3FBYA 2PHUA 1YWKA 2ZHKA 1YUDA 4JGZC 4E2QA 4EJRA 1QH6A 4UBGA 4MZUA 2HWF1 4MXWB 1LOCA 2JG9C 3KMHA 3VBOC 3J8F3 1XYOA 1KDKA 1R1A1 2X5IC 5BNQA 4HN1A 3JBG2 1DGWX 3POYA 4LBMA 3UJOA 4AG4A 1C8NA 1MVEA 1POV1 2KXLA 2SLIA 1APNA 4PBPA 4ZKTB 4WM8A 1VAKA 3S30A 4ATFA 4IERA 4BE3A 1WA4A 2EAAA 2PFWA 3ZYRA 5JLVA 1RB8G 1BBT1 4FTBA 2IFRA 1VB4A 4HT1T 2VVEA 1UZYA 2HWD3 4TWTA 4XF0A 4ATEA 2B7YA 3BOWA 5J48A 4BYYA 3LGRA 3CEWA 4UW4A 5JMCA 5BXXA 4LO4B 2D43A 3WXPA 3JB4C 4PJYA 1VBD1 1QQP3 3EO6A 3PTYA 4JTNA 2NMNA 3PMSA 4MYEA 2RR11 1MS5A 4C90A 4IQPA 4Q4V1 1LOBA 3TWIA 2GH8A 4MGYE 5GKAC 2ZBJA 4Y22B 3BODA 4L92A 2K9ZA 3KB5A 5I0UA 1FV3A 3I4IA 1UX6A 3E5XA 3QH6A 2F4PA 4E4ZA 5B2GB 4AVTA 3PHMA 1XRUA 3M3IA 4ITCA 3U07A 4HZFA 5DZFA 1QMJA 2TUNA 1CAWB 4Q0VA 4DZGA 4GXLA 1V6IA 4GWNA 1ULEA 2W52A 5HXVA 2YROA 4B3NA 1RUG3 3WW1A 1BVP1 3ILRA 1LECA 3V64A 1ZBA2 3AJZA 1PZ7A 2R062 4LO7A 5GZEA 3I8TA 1NA1C 1MZ6A 4DQAA 1VR3A 3EHKA 4JCKA 3GF6A 2O8QA 4PBOA 3JBG1 2ARXA 5J98B 1UAIA 3SISA 3MLJA 3VBUA 1NQDA 2BGCA 2ZHLA 4J1WA 1OPOA 3RYPA 2MEV3 4P9JA 1H8TC 3MFCA 4XHBA 4BH9A 3HT1A 5E88A 4M3CB 3I59B 5F6KA 5KHJA 4BA6A 3DUIA 2G9FA 1HV0A 4A2UA 2OUHA 3M8LA 2IFWA 3JU9A 1ENQA 2PHFA 2NN8A 3BIWE 5L19A 3MIDA 1GYKA 2YV8A 1BVVA 1UL9A 1GKBA 4EN9B 3TBDA 2JG9B 3VBOB 3FHIB 3VDDA 1FOD1 4NHLA 4BZ4A 4K40A 1NCQA 1WBFA 3J8F2 4D7TA 4DXZA 2GN7A 4P5HA 5LRRA 1QY4A 4Y20A 3B9IA 4R8HA 3OY8A 4CEYC 2VY0A 3VBHC 1XU2A 1GR3A 5DUXA 3WUCA 3N35A 4XDQA 1SBFA 3BCWA 1RUH3 5FPZA 1D2QA 3JZVA 2Z5WA 4Y1XA 4HVOA 5H9RA 3ETQA 2I07B 5I8YA 2HWD2 1BCXA 5AFEA 2NPIA 4CP0A 4C1WA 1IKPA 3QCWA 3V65A 4K9SA 4S2HA 4AW7A 3AMNA 1GBGA 2GH2A 3FLTA 1N1TA 4JGYB 4XJ9A 4FO9A 1R082 1QQP2 3OYWB 1AX1A 4FPEA 4W6YA 1IQAA 4XBNA 2VUJA 2R071 2ZGRA 1JOJA 1RUI2 4GKYA 5ABJA 2C5DA 2ZABA 4YGBA 5FDBA 1J3PA 4LLFA 1FPN1 3WQ7A 4ES9A 4AQ2A 1NY71 2GMEA 3WDVA 5J36A 3IT8A 2UWCA 3S7IA 1ENSA 2PHXA 2OZ6A 1JYIA 2DV9A 4PLOA 4PDWB 2EAKA 1AJOA 4FP3A 1H0BA 1X36A 2PHLA 2XHKA 2UYAA 3R4SA 3WNXA 1V6OA 5LRSA 1Q8SA 1WW7A 1MQTC 4Q0SA 1S0BA 4FAGA 1XE8A 4RS5B 1NOVA 2XUMA 4XFHA 3ZN6A 1SLLA 2Z2SB 4YG0A 5CFCA 5JZGC 4ISQA 2QNKA 1EAH3 1IZ3A 3AMMA 3JCIA 3O5SA 5IUQA 2YUEA 2ZPXA 4YZ2A 1VBB3 5BNOB 4FQ4A 4YW3A 2UURA 4H7LA 3WDTA 1BMV1 1AR73 4E2SA 4AVAA 2VOVA 2WNVC 1F8VA 1URXA 4P14A 1LEDA 4HBNA 1SBEA 1PNFA 3O12A 3KM5A 2RE9A 4QM8A 3WLUA 5GLWA 4JDOA 4JV4A 1V6JA 1I3HA 3H3UA 4C91A 4DOUA 1H8TB 5JWPA 1GANA 1K5MA 2ZKLA 1D0GA 2MEV2 5CVRA 1DIWA 1QJY3 1LODA 1N47A 2DCTA 1ZX5A 2DU0A 4LBQB 3AYDA 4FOYA 2GMMA 2D6KA 5I8TA 3V0BA 4ASMB 1HQLA 1KS4A 1WLWA 2BFUL 4Q29A 3NAPA 2GZWA 2WFPA 4AEDA 4AI2A 2XJRA 4ONUA 5HI0A 4PLNA 4QQHA 5C9AB 1RUJ3 2B9UA 4XF9A 2RS32 1CAUB 1R081 1XXNA 2FMYA 4XE9A 5F9TA 1RHI3 1FT9A 1RUF2 4RQPC 2DVBA 1ASJ3 2QZ3A 3E6BA 1AR83 3SH3A 3KT7A 2PYTA 4H14A 3WQ1A 1VJ2A 3LSDA 1S0IA 4Q4W1 3H1MA 5EJ3A 1RUH2 2D5FA 2D6MA 2BPA2 2ZX0A 1WBLA 2A70A 2CWMA 3M1HA 4GQ7A 1QJU3 1LB2A 1OMIA 3M7AA 4XJAA 4CDQC 4PCRA 3B5LB 1DQ6A 3WP6A 1LJ7A 1VAVA 3L2HA 4DRVA 1V9U3 2DUPA 1G7YA 3H8UA 2BTVC 3KD4A 1ALYA 4HK8A 1VBC3 1ND2C 1ENRA 1OPMA 2ZA9A 4Z8BA 5JIUA 2HWB2 2A6ZA 4O9EA 4XXAA 5DZEA 2HWE1 3H7JA 3N7JA 2ENRA 1PO21 3VBRB 2RS51 2I74A 5AVPA 2GU9A 3I2DA 5CNAA 1W39A 2IXHA 2HEYF 1KFXL 4UW6A 1RUD3 1BK1A 4COZA 2NLRA 2IXIA 1KJLA 1W6MB 1H2KA 3RZZA 2PELA 2Q4SA 2CV6A 4AI1A 4WBBA 1RUE3 1G86A 1QJX1 1MQTB 2PTMA 2P34A 1OLQA