3M3IA

Hypothetical protein from leishmania major
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
195
structure length
177
Chain Sequence
QNTAEFWIKRLQLVPHPEGGYYSEVVRSAHKVDNEEGNRRHAYTTIYFLCTPESPSHLHRLCSDETWMYHAGDPLQLHVILKDPQDEDRRPKYQVYRRVLVGARVERGELLQYTVPGGAIFGSSVAADGADGQAGYSLVSCIVSPGFDYRDFEIFTQAQLMELYPQHEAVIKQMAYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Hypothetical protein from Leishmania major
rcsb
source organism Leishmania major
molecule tags Unknown function
total genus 42
structure length 177
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m3iA01
2IXCA 4XF3A 4O9EA 4HVRA 3HT2A 1YHFA 1NYWA 4QGNA 3FWEA 4QM9A 2Z69A 3SCFA 3UKTA 3DN7A 3PLQA 3PVBB 5KBFA 4KWKA 1PMIA 3FHIB 5I8SA 4J1WA 2BNNA 4D7SA 3G7DA 4O9GA 2ET1A 1XRUA 4F7ZA 2Q1ZB 3IIAA 1YFXA 4EROA 1UPIA 3QACA 4IEYA 1ZZ6A 3M70A 4MUVA 2CGPA 2MPFA 1DZRA 1CX4A 3ETQA 3RDIA 4HVQA 3MZHA 2K0GA 2ETEA 4KL1A 1JUHA 3OD0A 4QM8A 1X8EA 1LRHA 1U12A 5KHHA 4FAHA 4Q0PA 2O1QA 1PM7A 3H7JA 5CU1A 2QNKA 1G6NA 4ZU4A 1CGPA 5FLIA 1J58A 2C0ZA 3FZ3A 3JZVA 4E2GA 2O8QA 2XLGA 3OTFA 5KHKA 1WLTA 1I6XA 1EP0A 4NVPA 2IXKA 3FFQA 2GC0A 4FAGA 5JAXA 3RYKA 5KHIA 4HMZA 3SXWA 3D82A 1SEFA 1CAUA 1ZRFA 2PQQA 4AVBA 3EHKA 4IEUA 1L3JA 1DGWA 4QX5A 3D0SA 2B9UA 3E5QA 2OPKA 1CAXA 3N4MA 2QDRA 5CVRA 4MX3A 3DL3A 5JSOA 4LEJA 5JR7B 2VQAA 4I0BA 4YYOA 5I91A 3O14A 2PA7A 1Y3TA 5T3NA 4HN1A 3LZZA 3E6DA 4MH0E 1LR5A 5JSPA 2MNGA 3RZZA 3S7IA 1O4TA 1V70A 1QXRA 4D7TA 5D1IA 4I02A 1RL3A 1RTVA 1LB2A 5I0UA 2GC3A 3IWZA 2CAUA 2PTMA 1RUNA 2XLFA 5I0RA 1YFUA 5JSRA 2XLAA 2OA2A 5LRRA 4I2OA 4MGIE 2OYZA 4E2QA 4N9IA 1RGSA 1LKNA 4AQ2A 4CYDA 2CAVA 1TQ5A 4P9GA 3GYDA 4YARA 3MPBA 3IBMA 5J3UA 2WFPA 2I45A 3FE5A 4KU8A 5C8WA 2B8MA 1J3QA 3RPQA 5J48A 2FQPA 3H3ZA 4FT8A 3CO2A 3CEWA 5F1RA 1X7NA 5I8YA 4UXAA 4HBNA 3CL1A 2Q4SA 5CADA 2IC1A 4N9HA 1OFNA 3TNPB 3B02A 1UD1A 3I7DA 5BXXA 4XF4A 5K8SA 4HSLA 4ORFA 3FJSA 3MDPA 3NKTA 2ZCWA 4ZU7A 1IPJA 4L2NA 5KHGA 3RYRA 3H50A 1YFWA 3OCPA 4PIZA 1H1IA 3IDCB 3H7YA 4META 4EWAA 4KWJA 3QOPA 5BPXA 1DGRA 1FXZA 2PYTA 5AVPA 3BCWA 2BYVE 1UIKA 2D5FA 4HN0A 2VPVA 2MHFA 3ZDSA 1J59A 5E16A 1O7FA 3NL1A 1X8MA 4HSJA 4YNIA 1DZTA 3I59B 1YUDA 3CLPA 3IDBB 4F8AA 2E9QA 2P17A 4WVZA 2PAKA 4J1XA 3E6CC 4JVAA 2VECA 5FQ0A 3TNQA 1NE6A 5LEKA 2EAAA 3KGZA 4R8HA 1ZZ8A 1ZRDA 4JTNA 1YFYA 5I93A 4IEOA 4B29A 4IEQA 3ACLA 4R52A 1ZX5A 3ST7A 3LA7A 3ELNA 2B5HA 3SMHA 1ZVFA 4MGZE 1ZRCA 3CF6E 3LOIA 2XHKA 3ES1A 4HVOA 4MGKE 3D0JA 2H6CA 5E1RA 4UBHA 1ZZCA 2GC2A 3E5UA 4MZUA 1HW5A 1OD5A 1CAVB 3H8UA 3RYPA 2BNOA 3HQXA 4LULA 3LA2A 1GQHA 1J1LA 3UKNA 5BY5A 4XFGA 2PHDA 1WA4A 2Z2SB 5FPXA 4IEZA 3CJXA 4QXKA 1O3QA 3ROUA 4XFIA 5EFUA 3H9AA 3PNAA 1I5ZA 2PFWA 3DKWA 4GULA 4AXOA 4X6QB 4EWDA 1X82A 3SHRA 4IEXA 5BV6A 1ZNPA 3OGJA 3C3VA 1YWKA 3WW1A 2UY8A 3H1WA 1O3TA 2XL7A 3E6BA 3BALA 2EA7A 3WW3A 4YSFA 2UY9A 5I0SA 1VP6A 1CAWA 4AQ6A 3HT1A 2D93A 3S7EA 1Y9QA 4IERA 1IPKA 5JCTA 4XF0A 3NJZA 1QXJA 4L11A 1RC6A 1FI2A 4WBBA 1VR3A 3EBRA 3BU7A 2Q30A 3KGLA 1VJ2A 1UCXA 5HI0A 3BB6A 2QVSB 2GH2A 2V09A 3MYXA 2FMYA 3NW4A 4MV2A 2HKXA 2HJIA 4IESA 4XFCA 4PIXA 4BH9A 3WW2A 2KXLA 3HIFA 4UBGA 4BHPA 3RNSA 4IEWA 2K9ZA 3ES4A 3I54A 1ZZBA 4BIFA 2ZKLA 3U10A 1ZRRA 4LA2A 1OI6A 5I0TA 4XF1A 3DV8A 2ATFA 3GBFA 4JV4A 5FPZA 3SCHA 3OF1A 2XKOA 2Q0AA 1ZZ9A 5C6CA 2WC2A 5LEJA 4HLTA 5KHJA 4Z82A 3EQEA 1FT9A 2QCSB 2F4PA 4KU7A 5FLHA 3H3UA 4FBFA 5J7MA 2D40A 3BPZA 3S0MA 1O5LA 4ZU5A 3EO6A 4LUKA 4PIYA 4AVAA 4Q29A 1NE4A 3R6SA 4QMAA 1UIJA 3L2HA 4I01A 4Q0QA 3M3IA 5I8TA 2PAMA 2IXIA 1Q43A 5FQ0B 1O3SA 1SQ4A 2GAUA 3LAGA 1ZZ7A 4QGMA 5BUVA 4ONUA 4XFAA 4LA3A 2Y0OA 1CAUB 2XGXA 5EZWA 4WZCA 2BEOA 1CAXB 2IXLA 3H1YA 4XEZA 1GQGA 4MGYE 3SCGA 2DCTA 1H1MA 1Q3EA 2H0VA 3KMHA 4YRDA 2CV6A 5FDBA 1UW8A 2XL9A 3I59A 4XFFA 4PJYA 2ET7A 2PHLA 4I0AA 1J3PA 4OFGA 1OMIA 3FX3A 4LUMA 2IXJA 3EJKA 4IEVA 4Q0SA 1Q5OA 2EVXA 4Q0VA 1RUOA 3LA3A 4DINB 3U0ZA 1J3RA 1EY2A 4IETA 2OZJA 4XF9A 5FLJA 4BYYA 4Q0UA 1WGPA 1YLLA 4XFHA 3UKVA 2GZWA 2BGCA 4XFBA 1EYBA 1CAWB 2GU9A 2H6BA 3NVCA 2OZ6A 1O3RA 3NSTA 4K8FA 2XKPA 4AVCA 1QY4A 1NZCA 1QWRA 1XE7A 4EWEA 1CAVA 2BNMA 4IEPA 4RD7A 4TLFA 5FCCA 3WW4A 3E5XA 4E2SA 4EV0A 2QJVA 4H7LA 1O5UA 2UYAA 3KSCA 4XETA 4OLLA 4KWLA 4I09A 1XE8A 4X6RB 4LLOA 4HZFA 2GC1A 3E97A 1ZREA 2D5HA 3VHRA 5LRSA 3U11A 4I3PA 1EPZA 1NXMA 2PAEA 3H1MA 2N7GA 2UYBA 3KCCA 4QGLA 3LWCA 2IXHA 4JTOA 4LTAA 1SFNA 4Z07A 4A2UA 3USSA
chains in the Genus database with same CATH superfamily
2IXCA 2LM3A 4O9EA 5H9RA 4LOTA 5KR7A 2R0HA 4D6QA 3WUCA 1VMHA 4QGNA 1C8M1 4AEDB 1CR7A 2VE1A 1UU5A 3THCA 3DN7A 4YVWB 4IV3C 4KWKA 3AMQA 2YG0A 3KQRA 1G9DA 3P3NA 4Y5SA 1AR81 5F5QA 2YU1A 3I3DA 1A34A 1RUI2 3WQBA 1ENRA 2EIEA 3M70A 3ZFFC 4AGVA 3T2QA 4LORA 2G9ZA 2MPFA 1DZRA 1CX4A 3INAA 2DVGA 2HWC1 1MS3A 1LGNA 1BMV1 4HVQA 3B94A 3K4ZA 1NA1C 1S2EA 3JCIA 4N43B 2WSUA 2XMLA 3RZJA 1BVP1 3VBOC 1E5RA 2E32A 2R7EB 5C4WA 4BK5A 3ZMOA 1YYNA 1CJPA 1IOAA 1RVF1 3WHTA 5LBBA 4OQ8A 1U12A 1UQXA 3WSOA 3FBYA 3HJRA 5L7OC 1VRBA 3OG2A 4KG8A 2DUQA 3WD5A 2DVAA 2A1XA 5GZFA 2LTNA 2QNKA 3T0AA 4CU6A 3HNYM 4YG3A 1J58A 2C0ZA 4XBNA 3QH7A 2O0OA 3VBFA 5JZGB 1B35B 2CU5A 3VDDB 5KHKA 2XHNA 1YQ8A 1E5SA 2R49A 4GKYA 3M3EA 3VKNA 4FAGA 4LMFA 3KLSA 5FV3A 1EAH1 3CIHA 4UFHA 3PMEA 3BVCA 3PJYA 1JYXA 1HRI3 1UPSA 4B7EA 4FP2A 5A70A 2DVBA 3D82A 1TME3 1SEFA 3U07A 4RGGA 1K5MC 4AAXA 1RUH3 2P37A 4NHXA 4AVBA 5T5JA 3EHKA 3WQ7A 4X8PA 4YM0A 1L3JA 1DDLA 1ULGA 2BJSA 3N4MA 5FY5A 4P5HA 1CONA 2BOIA 4MX3A 5IFPA 5B4NA 1C8M3 4PLOA 5LK7B 4XBLA 3R4UA 2PHUA 3AMNA 3S5QA 4L92A 3JXSA 4PQ9A 2VQAA 1YEWA 4I0BA 3O14A 2PA7A 4JQTA 3POSA 3MUZ1 5DAQA 1AR83 1Y3TA 4HN1A 5T3NA 5HBAA 4CEYC 5H9QA 1AXYA 2ZAHA 2JDAA 3CNAA 2IWGB 4U36A 2MNGA 4D94A 1GOHA 1W2TA 4JHTA 1N1VA 4AI3A 3O0VA 2WLPA 2WL1A 4S2HA 2DCZA 4D7TA 1RJ8A 4XUOA 3MF6A 3AC0A 3TEZA 4DFSA 3T1MA 3BOWA 4M00A 3CJIA 4UF0A 4KI5M 2K2SA 5D8AA 3SKJE 3GZAA 3ZXEA 1LB2A 1G86A 4HANA 2GC3A 3IWZA 3MLLA 2CAUA 4XMAA 4U2AA 1QOTA 1YFUA 2AUYA 1AL23 5JSRA 5LA0A 3WQ1A 1RVF3 2XLAA 2OA2A 1N47A 3RS6A 5BNNC 1QNYA 5A6XA 3ZXJA 1H2KA 1WUVA 3PHMA 4KBZA 2OYZA 3T4VA 2A3WA 3NRUA 2VTFA 3MV11 2AREA 3W20A 4YM3A 1WKYA 3ZSMA 1V6NA 2FMDA 5F39A 1ULOA 4BQXA 1R1A2 1LKNA 2B7YA 1YI7A 3AP5A 4XUPA 5JI7A 3VKFC 3A0NA 5F5IA 3MFCA 1OVSA 4P9GA 3WINE 1PZ7A 2FD8A 1EV11 1NCRA 1W28A 2WNVC 4YARA 2ZJCA 5FY7A 3BIEA 5FXWA 3IBMA 1GLHA 3VHOA 2WFPA 3VDBA 5DG2A 2XDVA 3OJBA 1V6LA 4CDUB 4YGEA 2VCBA 1OF3A 1EAH3 4GJZA 4M0HA 5A1AA 3OY8B 3RPQA 2QDNA 2CDOA 1F4HA 2EIBA 5JPMB 1D7PM 3SNMA 2FQPA 3DGTA 1V6IA 3JQWA 3CEWA 2E63A 5F3EA 1FMD2 1ULEA 5F1RA 3P6BA 1U5IA 4Z2WA 1RUE1 4BMBA 4Q4Y2 2F4LA 1HB3A 4XXAA 1IG3A 4AEJA 3CL1A 5CADA 4P02B 1IGOA 2IC1A 3V56A 3WOGA 4BLJA 2WNOA 5A7WB 4A44A 3K77A 2A6VA 4URTA 2VXJA 2XVLA 5A7QA 3TNPB 4OI2A 2OUJA 4LO5B 1PX3A 3N9NA 5BXXA 2ZGMA 4ZPIA 4BISA 3RWKX 5K8SA 4ORFA 1FAYA 3MDPA 1U0AA 3HN3A 5KWRA 2ZCWA 1VBC1 1HB4A 4XURA 3UGHA 5C9AA 3LFMA 3MICA 3VBHB 4LK7A 1LHUA 4S2GA 3AKPA 5GLWA 5FWJA 3ZKUA 3OEAA 1LJ7A 1YFWA 1GZTA 5JOZA 4XCAA 3IDCB 2LALA 2RS31 1H2LA 4SBVA 3VZNA 1APNA 2VOXA 3BODA 2DVFA 4NHYA 2JEMA 2VULA 2I2SA 5C70A 2P6HA 1OOPC 3ZXLA 1KQRA 5F5CA 4YW5A 4AI2A 3OPWA 2VMIA 1HRV1 3U4XA 1RMU1 1VALA 4CSWA 3OPZA 2E53A 5J98B 1VBA3 2XPJA 4CUGA 3ZDSA 1DHKB 1W6NA 5JR2A 2VU9A 1J59A 3OUJA 4LBMA 2BWAA 5D21A 4HSJA 2ZHLA 2PQSA 1DZTA 1QDOA 2R071 4CP0A 2VY0A 5T54A 3KF3A 3PDQA 1UOJA 4XJ8A 1Y7BA 1T2XA 3N7KA 4UW6A 3OBAA 2RR11 4XVHA 1S0FA 1W6QA 1EV13 3RMYA 4CUCA 3E6CC 2OT7A 1CESA 1S2KA 2NMOA 3TNQA 2AR6A 4Q4X1 2VOKA 5FZOA 2R042 2J1EA 1GOFA 4QT6A 2YPJA 3ACLA 2A6WA 4XAEA 4IE6A 1DIWA 3MIFA 3VBRC 3NV3A 3ASIA 3O1OA 3ST7A 3MBWA 1RUE3 2VZPA 3WDUA 3AZXA 5T5PA 3CF6E 5C8CA 2BRTA 3CBNA 4JDOA 4MSVA 4NOTA 4HVOA 3BTAA 5FZ8A 4DQAA 3FLPA 2GP3A 3RZMA 5E1RA 4LIVA 3I2FA 4BQ5A 1LOFA 4XACA 2NLRA 1JU4A 1UO9A 4BWOA 5FUPA 3I3MA 1WD4A 1SG3A 4M3CA 1OD5A 4QXCA 2WNUC 5EHDA 1GP4A 1FOD2 2BNOA 5FP3A 1GQHA 1IG0A 3PIJA 4WM7A 1VBC3 1WA4A 3AZYA 2ERFA 5F6LB 5FJKA 4IEZA 1ZBA2 4QXKA 4UAPA 5AC91 2OS2A 1O3QA 4DXZA 2VR4A 1PGSA 3AYEA 1JODA 2ARXA 2ARAA 4WM8B 4YGCA 3ZSLA 1GYKA 2CL2A 2WZ8A 1GANA 2EXIA 3PNAA 4H2AA 4CUBA 2RS33 4EE2A 3CU7A 2G9FA 3VBFC 2WT1A 2RMU1 1OUXA 4K1ZA 3SHRA 1Q8QA 1HQLA 2JKXA 4GB32 4IV1A 2VMDA 1VRH1 3I3EA 3ZR5A 1NCQB 3Q9OA 4JRAA 3THDA 2CWMA 1PHMA 2ZZJA 5A33A 2XJSA 3NV4A 1UMZA 4YSFA 5ACA2 1RMU3 4JRLA 3TOJA 1VP6A 1CAWA 5LA9A 3USUB 1H2MA 2AC1A 1IS6A 1FPN3 1AR71 4NE9A 1GWMA 5IVCA 1RC6A 2VZQA 4P08A 3M8LA 5C3OA 2RR13 4P9YA 4XJZA 1VJ2A 2HYXA 4YW6A 4H14A 1AX0A 3ATGA 3O1RA 2YGLA 3FUQA 2V09A 2VBPA 4CXYA 4Q4X3 2FMYA 3NV1A 1UNBA 3LEMA 1FV3A 3LF7A 1G9FA 2HJIA 1MS0A 4R9AA 2KXLA 3RNSA 1OA3A 2A6ZA 4IEWA 3WNMA 3I54A 1BK0A 2NPIA 4GAZA 2V4VA 1VE0A 3BKZA 2YC4A 3S30A 1WMDA 5DXDA 2DCKA 1N3PA 3J7HA 1S0BA 2WFF2 4Q1PA 4PI0A 2RDQA 1C1LA 3PUAA 1LU1A 2B4KA 2FCUA 1UF2C 2JICA 2QQWA 1A78A 1EUTA 2EXHA 2WC2A 3GJAA 4ZZ8A 1D2QA 3D6EA 4AHYA 4MGQA 5KHJA 1WLCA 1XJAA 4Z82A 2VZOA 1POV1 1QIQA 1W90A 5ANNA 4AFBA 3WHUA 1A3KA 3WDTA 2AACA 2W68A 3H3UA 5AC93 1JMUB 5FTTC 2VJXA 1N1SA 3K4DA 2BTVC 1TVGA 4YVWA 3ZYIB 1UY0A 4PF1A 1CVNA 1IKPA 1LODA 5AVAA 1D4M2 2VC9A 4QKFA 4LJHA 4AE2A 4PIYA 2RMU3 2RM22 4IDZA 5LBCA 3JD72 1NCRC 1UAIA 4QMAA 4K21A 1VRH3 2JIJA 1K5JA 3B5LB 3NO8A 4XDQA 4OUMA 2WAOA 3L2HA 2BBAA 5F9TA 1VPHA 3WT3A 4I30A 5ANQA 4L0PA 1SLIA 2OX0A 3RJRA 1VBE1 5L9RA 1Q43A 4ARXA 1XXNA 2GNDA 5FQ0B 4EN6B 1K42A 1A6CA 4AHXA 2W52A 3LSDA 2G1MA 4YPJA 4AEMA 4AW7A 4OHXA 2WR9A 4CPBD 1ZZ7A 4Z2AA 3T0DA 4CCKA 4QGMA 1HIXA 3A23A 2YYOA 3VZKA 2JE9A 5IAVA 3UT0A 4CCLA 4DUXA 3OB8A 2GP5A 4K3UA 1LGCA 4BQ4A 1XNTA 1BEV2 3N9OA 3WF1A 1I1EA 1NZIA 5E6HA 3ZPYA 5IK4A 2IXLA 2C1FA 5FZ0A 1RJ7A 5IVYA 4CDQC 1Q3EA 3VBSB 2R0FA 1VBB1 1MS1A 1CZSA 2VMEA 1JN2P 4PLMA 4GMP0 3TYJA 4AI0A 2QZ2A 1GWKA 1CIWA 3ZYPA 3ZYHA 4WZFA 1MS9A 2YBKA 5FDBA 1NAEA 1AXKA 1B35A 4A7YA 1OUSA 2ET7A 4I0AA 4NAMA 3VDDA 1IQDC 2O8OA 1GZ9A 4KMQA 1QDCA 5A3OA 1IS4A 5JDBA 4QXHA 1F35A 1FATA 4DPNA 2IXJA 2WA3A 5DPNA 1X50A 3LA3A 4UF0B 3CJIB 3U0ZA 4CDXB 3J8F1 4LBQB 5JI9A 1KDKA 5F3GA 5HCBA 3AZWA 3B00A 2WKKA 4JGYC 1GZWB 5C33A 1UXZA 1PO21 5FZCA 4AHZA 4C0BA 1G7YA 1POV3 3FN9A 4JAAA 4XQ4A 4ASLA 1OH3A 3K46A 4HETA 4M4PA 4XFHA 2WUHA 2O14A 3VBUC 1VMJA 3ZSKA 4CVUA 3PVNA 3MW2A 3NSTA 4ZONA 2Y6JA 3O5SA 2ZGKA 4NWVA 1CAVA 2BNMA 1DQ1A 3N7LA 5BNPC 1MZFA 4ET7A 3WW4A 3E5XA 5DDJ2 4EV0A 2QJVA 2XB6C 5DZEA 4ZXEA 1DYKA 1MS4A 2P3IA 3OBTA 2W1WA 4LT5A 4Q5OA 2XQXA 4FPHA 2ZXQA 5T5OA 3NAPC 2TUNA 3KSCA 3V0BA 1SLCA 4YM2A 5GLUA 3S5AA 5CAZA 4I09A 4NRMA 1QJY3 2D3RA 4FTSA 4LKEA 1GQPA 1PZ9A 4C90A 5CFCA 4PHZA 4YZ1A 1ZREA 3FHQA 3VHRA 1JOBA 1JZ2A 3CZUA 2P5BA 3I2GA 1VBB3 3DYOA 2N7GA 3Q8FA 3LDKA 3KCCA 5FYSA 2PHTA 3LEIA 4WM7C 3ZKYA 3GHNA 3TRSB 3LWCA 3FC0A 2VUAA 4LO8A 3ETPA 4FFGA 4Y4RA 4DEVA 5HV4A 1SZBA 3O1MA 1PO11 2JD4A 3RQ0A 1D0HA 2JG9C 1ZBE2 4RR3C 1SLAA 2V5DA 4M4RA 1PVC1 2VBDA 4XF3A 1XYPA 1QJU2 2RS51 4HVRA 4EN0A 4ATFA 4LNVA 3OY8A 3ILNA 1IZ3A 1NY71 3M2MA 4YLZA 3URFA 2WWUA 4Z1VA 4IL7A 4MG2A 1NYWA 2YUEA 5ERLA 1Q8OA 3VB9A 3WNKA 5FY1A 1Y4WA 1ALYA 3SCFA 1YQCA 3AJYA 3POYA 4RA0A 5IFTA 1NG0A 1PMIA 4XJAA 3FHIB 4Y33A 3ZMNA 4J1WA 3ZYBA 1W0NA 1XQNA 4AI9A 4BQ2A 3TBDA 1AJKA 5A7WA 1XRUA 2PLV1 5CFDB 4F7ZA 3I97A 4W6YA 4EROA 5ABJA 1ZZ6A 4MUVA 1W6NB 1UMHA 1QJX2 1QMJA 3DYMA 2JDZA 3I4IA 2IVIB 1J1TA 3HBZA 3POEA 4LOSA 4P9JA 3DYPA 4CRQA 2XUMA 1Z7S1 5BNOB 4XYXA 4D3WA 1BBT1 3MZHA 2JE8A 2GNBA 1F15A 4AFAA 1W6QB 4KL1A 3AP6A 5FYYA 3UJOA 3OSDA 4QM8A 1AYM1 1REFA 4LHKA 5IVBA 1RUD2 1X8EA 4YG6A 1LRHA 1O4ZA 2HWB1 2VNOA 1SHWB 5FZOB 1F8VA 4QKDA 2YV8A 4NR1A 4E4ZA 2WS91 1UYXA 4O7XA 4Y4YA 3OPTA 1WWYA 1PM7A 2C9KA 3RWNA 1ASJ1 2GMMA 2DTYA 3X29B 1LNSA 5JXHA 5FLIA 3ZSEA 5C8CB 1QJEA 2D6OX 3A0KA 2O8QA 1FNYA 2XLGA 5C3PA 2X29A 5F7UA 3POJA 3OTFA 1MQTB 1I6XA 3B93A 5DAWA 4OI1A 2IXKA 3ILRA 2W94A 3CDZB 2V73A 2W9XA 4WV8A 4AI8A 2C24A 1JZ6A 1WCQA 3RYKA 2ILMA 2QUOA 1VAMA 3LEKA 4QKBA 1V6JA 4AG4A 4BXFA 2WA4A 4F83A 4AEDC 1ST8A 4A42A 5A3UA 1V0AA 1PO13 3N9PA 1CAUA 3ON7A 4Q4W1 4MO3M 5FPAA 4LO4B 4BLIA 2PQQA 3U75A 5AFEA 1KJRA 2RS53 3H8XA 5FYIA 2QQJA 3DUIA 3E5QA 4TTGA 5DG1A 2LUWA 2OQ6A 4K9SA 3DL3A 4R9BA 2WJSA 1LTEA 1K45A 4IV1B 5JSOA 1H6YA 1UKRA 3QH6A 4BOWA 5JR7B 2Q8OA 4EN9B 5C3QA 2BVVA 2VUJA 3N7MA 1ZYBA 2BGOA 2YY1A 4LPLA 3C7EA 1BLZA 4LHNA 1TZOA 2JG8B 3MIGA 4DS0A 2PLV3 4DOUA 4N43C 1JUIA 2KM2A 1LR5A 5GKAC 5JSPA 3R4SA 4A4AA 4AOCA 4Q8KA 3NMBA 1CWPA 1Z7S3 3BU0A 2ZOEB 1YQ2A 2D97A 2GDFA 1W8ZA 1RTVA 3KHBA 3WP3A 2QQNA 5I0UA 2FDFA 3ZFEB 5FIXA 2XVKA 4KG0A 1WZXA 5I0RA 2ZZQA 2VW0A 1DU3D 3NJXA 4DXTA 3DPRB 2C26A 3ZXFA 2Z4FA 4I2OA 2HWB3 4EQVA 1ENQA 3MLKA 5JZGC 2ZPXA 3JBG2 1O59A 1LEMA 1YI9A 4LQRA 4MGIE 3VZOA 2WS93 5L36A 3HEIA 3VDDC 5DZGA 2WRAA 4N9IA 2MEV2 4V1PA 1RXFA 5FBZA 1RGSA 1NCQA 4Q4V3 4AQ2A 2ZHKA 5FMOL 4PQQA 2CAVA 1W8FA 1TQ5A 3ZXGA 3J7LA 1T6BX 2P1BA 3GYDA 1KS5A 5FZHA 4CP2A 1R092 2BPA2 3MPBA 4INDA 4KGQA 1AJOA 1C5IA 4A3XA 3D4KA 1HRI1 3FE5A 3J4UH 4XE9A 4XJUA 1J3QA 1SBDA 1RUH1 5L9VA 1OKQA 4AL9A 5J48A 3H3ZA 2C9AA 3JU9A 4FT8A 4Y5TA 4XUNA 3WG2A 3UNPA 3T08A 3CO2A 4M3CF 4TSVA 4Y1VA 2PMWB 1KFUL 4G3YC 3O0WA 2DU0A 4Q4W3 2VL4A 2SLIA 4M01A 1ZRIA 5HXMA 1D2SA 2A6YA 2VW1A 2GSYA 4LK6A 4OCTA 4AFMA 4AEKA 1SDDB 5T50A 3WCRA 2W08A 2VO5A 1QXPA 2WINB 4N9HA 3RZKA 2Y0IA 3B02A 2YHJA 4HT1T 1OH4A 3RRDA 2EXKA 2R062 4RFT0 3IAQA 1V6OA 4LE4A 3ZR6A 4HSLA 4JGZA 3FJSA 3WG4A 3KV4A 5DUXA 3KZ4C 4ZU7A 3WQ0A 3ZXDA 4OHVA 2FZ2A 1MVEA 3O0XA 3MI8A 2JJ6A 2ARCA 1LU2A 1RUI1 1A8DA 1MPXA 1XBFA 4IXLA 5IYYA 3H50A 4PIZA 1HV0A 4NHLA 1F9KA 2P2KA 3H7YA 3MIBA 3B9CA 4KWJA 1AL21 5BPXA 2HWC2 2XBO3 5FOJB 3KCYA 3ZLIA 1MVQA 5JOWA 1QEXA 3BCWA 4NJ4A 4QDSA 2I07B 1W8HA 1LULA 1UIKA 2D5FA 4HKOA 4HXCA 3MEPA 4HN0A 1BK1A 4MOAA 1NT0A 1O7FA 2VMGA 3S6PA 4YNIA 3WP6A 4XIKA 4CDUC 1PVXA 3CLPA 1W9WA 2DCYA 4TLGA 4F8AA 4NIAA 2E9QA 4B8EA 1KJLA 1BJQA 1U5YA 2P17A 1FV2A 2PAKA 3NNFA 4J1XA 4WVZA 1TMF3 4JVAA 4XQDA 1QH7A 5FQ0A 5FJHA 1CD3G 1JYIA 2W46A 5LEKA 2ZEXA 2RS12 1ZRDA 1ZA7A 4JTNA 3MIHA 5I93A 4IEOA 3KD4A 2QQIA 1N3OA 2L9LA 4BQ3A 4I3GA 1XOYA 2BFUS 2RJ2A 1S2BA 3FHAA 4CPBA 1W0OA 3IM0A 1GFF2 3AB0A 2X5IB 3ELNA 3QLQA 1F2NA 4MVTA 4Y26A 1RHI2 4MGZE 4CP1A 4DRVA 1ZRCA 2WZR2 3LOIA 4LHSA 3VBSA 4MGKE 1DZQA 1XB9A 2XOMA 1GOGA 5IVFA 1WA6X 4GKXA 1NLRA 5A3WA 3H8OA 4M0NA 3I8TA 4UBHA 3VBHC 1HQNA 5CG9A 1HW5A 4UFLA 1UY3A 4AK3A 3N36A 1CAVB 2AH2A 3GM8A 3H8UA 2GH8A 1H9PA 1OQDA 3WG3A 1HN0A 2ZMKA 1J1LA 2EF6A 1KFXL 2E51A 4XFGA 4NIDA 1Z0HA 2Z2SB 4RS5B 4RYDA 5FPXA 4GD4A 3CJXA 4GH4A 1JYCA 3C7HA 2D3PA 4NROA 3VL9A 1COV2 1RUI3 1OXCA 3ALQA 5EFUA 3B3QE 4CDXA 3WXPA 4LBQA 3PL0A 3V0BB 4RN5A 1GZWA 4QPYA 5T5LA 4GA9A 2ZGTA 1W6OA 4EWDA 3KVBA 4LE3A 1JXNA 2VQTA 4P00B 3OGJA 3ZXAC 5IT6A 4MHRA 5CFCB 3C3VA 1W9SA 1YWKA 1GWLA 3WW1A 2ZMLA 3WF2A 2NYYA 3HPNA 2WYFA 1VBA1 1ONAA 3V0AA 2XL7A 3BALA 4GALA 3WW3A 2ZGSA 2UY9A 1GZCA 5LB6A 3MUY1 1PMHX 4JDNA 1BCXA 3O1VA 4AQ6A 1TEIA 4J25A 4ES9A 3HT1A 3LEGA 4QQLA 4XC9A 4YZ4A 2C5DA 1H8TC 2JB8A 3LPFA 2BVBA 4DMIA 1UY1A 1PM4A 1IPKA 1CIYA 5GLZA 3WNNA 5JCTA 1LHOA 3GXUA 4FQ4A 3CHXA 2VMCA 3KS7A 4NIIA 5IVJA 1AZDA 4WBBA 1VR3A 2Q30A 3KGLA 1R1A1 4V2VA 4QU1A 4D6RA 3N7JA 1GNYA 3BB6A 1VB4A 1DLLA 5DZFA 3ZN5A 2GH2A 4YW7A 4XILA 5LY1A 4YFZA 2Y38A 3NW4A 5E88A 2CGOA 4TYSA 4IESA 4XFCA 2J22A 3VHPA 1Q8VA 3WW2A 3HIFA 1W99A 3HQUA 4BHPA 1HXS2 2D6LX 3PVOA 1PZ8A 1ZZBA 3AMMA 3AYCA 4BIFA 5JVVA 2ZBJA 3AZZA 2ZKLA 1UZYA 4A6OA 1AR92 5ABJB 1FMD1 1W04A 3O12A 4FXGB 4OYUA 4CCMA 2TEPA 4AYUA 1OPOA 4Q4Y1 3DV8A 3NJVA 1C5HA 3HAGA 3WZ1A 2KD7A 4ISQA 4JV4A 5IUQA 3SCHA 5LW9A 4WM8C 2B42B 4GWIA 3LGRA 5IVEA 2QQMA 3OBRA 4OMDA 4CCCA 2VXRA 4CZSA 4A7KA 1XNDA 5EV7A 4QX2A 5JXGA 2QCSB 4DXSA 1XNBA 2Y6FA 3IPVA 2ZKNA 2A73B 4FFIA 5J7MA 3LIHA 4AAPA 1NCQC 3O7OA 2DDUA 3VGIA 3AKSA 1XYOA 3EO6A 1XC6A 1JBCA 4LUKA 3TEWA 4CU9A 3S57A 3ENRA 4Q29A 2KA3A 2EIDA 3U37A 1NE4A 3MFAA 1O6UA 3IAPA 4HONA 1IQAA 3BN6A 3ZYRA 1PGW2 3ZVXA 1Z78A 1UOFA 5F6KA 5CFDA 4K40A 3VLBB 5A3TA 2WN2A 4Q0QA 1BVVA 4NPMA 4TN7A 1RUG2 5JIUA 2PAMA 2IXIA 2FDGA 3NNJA 1FPN1 5BNOA 4W50A 4IGOA 2OW4A 3FUOA 1O3SA 1HRV2 1SQ4A 2GAUA 3OEBA 4CCEA 1SMVA 2NZ9A 4QPGA 2VOWA 4P14A 3AJZA 2P6CA 2HWE2 1RUJ2 1QF3A 2Y0OA 1CAUB 1L7LA 5FPLA 4MHUA 2R072 4NPLA 4WZCA 1R1A3 1OLQA 2ZX2A 3ORJA 4FPOB 1GQGA 2FCTA 2JECA 2XXZA 2YDEA 5IHRA 1Q8SA 2X8KA 3POWA 1HV1A 5IJRA 3ZXKA 1JOPA 2CTVA 1OLME 5JLVA 3KMHA 3VL8A 2NP0A 1S0DA 2PHFA 4JKKA 3O1UA 4Y3OA 3UGGA 2OQ7A 3BTXA 2CV6A 2J1RA 3IMNA 1UW8A 4XFFA 3I59A 3BI3A 1AYN2 5FUNA 1MQTA 3UETA 1M06G 4N53A 1DQ6A 4Y24A 1FMD3 1BZWA 5CB7A 5C4WC 1OSGA 4XZPA 3BTYA 4Q27A 4LUMA 4Q4Y3 3EJKA 1YRZA 4NMIA 3V65A 3ZFGA 2ENRA 1Q5OA 3B69A 4QPIB 4Q0VA 5C3SA 1W2AX 4JHZA 4Q8LA 1EY2A 1C1FA 2C6SA 1ENSA 5GLVA 3HD8B 1NQDA 2W1UA 4BK4A 2OKXA 1RUC2 1RUF2 3HR9A 2GNTA 1FOD1 3HMYA 2OZJA 3ZDVA 2ZHMA 2E26A 4BPZA 1PGL2 1GKBA 3OGGA 1W3VA 1ZBA1 3A7QA 1SDWA 1E5IA 2HWF2 3ZX7A 2GZWA 4O61A 3O1SA 1X33A 2BGCA 4DNYA 3I49A 4XFBA 3DEMA 4HKWA 1QJFA 4K8FA 4FOQA 3VD7A 2JG8A 4K6BA 5SV8A 1NZCA 2ZGPA 5FZDA 4BM8A 2WO2A 3POGA 5LASA 1LCLA 2E7QA 4GB31 5FR3A 3A21A 2AEYA 2VTXJ 2WQ8A 4E2SA 4GXLA 2HH9A 2BGPA 4ES8A 3QBQA 4FPLA 2WLQA 3T3YA 4A7ZA 2VBBA 1R082 4N8MA 1O5UA 1WCKA 2UYAA 4BMEA 3ZFEA 3RMXA 3VBSC 4OLLA 4QQOA 1DGLA 4CTEA 1W8OA 4YG0A 3OGVA 4XJ9A 5HCAA 1AR72 3DPRA 3NJYA 1OOPB 5C5UA 3TN92 3E97A 4LBKA 2VCAA 1URXA 2D5HA 2D43A 1UY2A 4LBNA 3U11A 3U1XA 4I3PA 1GNHA 4C1XA 3KWVA 4AFCA 1UZ0A 2PAEA 3UYJA 3J26N 2UYBA 3ABZA 1LOCA 2R043 4JGZB 2OIIA 2CY6A 2QFEA 1Q56A 5A80A 2G19A 4NHKA 3CJIC 5D8AC 3VUOA 4LTAA 5A1LA 5H9SA 1HJFA 1LECA 1ND2B 1JTZX 1OLMA 4DY5A 3HT2A 3WNLA 1PIV2 3LE0A 5EJ3A 5KXCA 5JXJA 2WFF1 2ZX3A 2YBPA 1LHWA 3AL6A 3FWEA 4PBOA 2QBXA 4NAOA 4MADA 4QM9A 5KXBA 1R1ZA 3PLQA 5KBFA 3RI8A 4CA9A 3TEXA 3H0OA 2YROA 1W8WA 2WABA 5I8SA 3RZGA 3VBRB 1LHVA 2VQUA 2VMHA 2DU1A 4X8NA 5K0UA 3WNXA 2WO7A 4D7SA 1FOD3 2ET1A 2ZGLA 2Q1ZB 1XSRA 2FBEA 1YFXA 3WDYA 3AP4A 1UPIA 1DFQA 1V9U2 2IFWA 3QACA 4IEYA 4RHV2 1LOEA 1ZBA3 1FNZA 2Y6KA 2VZSA 3R4DB 4CDWB 4AGGA 2CGPA 3K3OA 3ETQA 3KCXA 3SLIA 3WP5A 4IW3A 2W47A 4ZXKA 1D4M1 4Q1RA 4URAA 1F5JA 2ETEA 2RM21 3BOPA 3JD71 4CXXA 5EIYB 4RQPB 5JUVA 3AVRA 4GB33 3LFIA 4LBOA 1JUHA 1AR62 3OD0A 2VUCA 3P3PA 3PTRB 4XTPA 2W91A 2YGMA 1AHSA 3Q8AA 5BNNA 1H4GA 1DP0A 4QX3A 3CZJA 4Y22A 5ACA3 1QJY1 3M3QA 3W59A 1VBE2 2UWAA 4ITCA 5APAA 3H7JA 4L8QA 1YQ6A 5CKQA 5FOBB 1G6NA 4TZDA 3FZ3A 3JZVA 4L97A 1O91A 1W06A 3M1HA 4W65A 1S55A 1VAKA 5FZEA 2QQUA 3WG1A 3AFKA 1BEV1 2ES3A 1WLTA 5C9AC 1EP0A 3FFQA 2RE9A 1NLSA 5C3RA 3WDXA 2JDKA 1A8MA 5JAXA 3BTZA 4OHWA 2JKBA 1REEA 4NUBA 5LY2A 5DMYA 1NLQA 2ZGQA 2RJKA 3NKGA 3WVJA 3AXDA 1UYPA 2FZ1A 4Q26A 2HBTA 4GH4B 4QKNA 1ZRFA 3M4FA 4FPCA 4IEUA 1S0IA 4QX5A 2VD7A 3D0SA 3NWKA 1YO8A 1CAXA 2XWBB 3D5OA 4BB3A 2BZDA 5CVRA 3KV9A 5H9PA 3GCWA 3U78A 4K20A 2WFF3 5IK8A 1W6OB 5CFDC 1OPMA 5CEHA 1UU6A 1WMFA 2X5IA 4LEJA 5FY8A 1SCSA 5A32A 5FMOS 3MPPG 4YYOA 5LBFA 2IFRA 2X53S 3J8F2 3SKVA 5BNOC 1W6PB 5FUIA 5FPBA 3V0AB 2DF7A 1JYTA 2VW2A 3LZZA 5K4LA 1PO22 4CEWA 2QQVA 4JKMA 3AKRA 4ARYA 1ND3B 1ODMA 4EZHA 1JS9A 2XJRA 3ES1A 4MXWB 3S7IA 4D6SA 1O4TA 1V70A 1QXRA 4FXKB 4SLIA 5D1IA 4BA6A 2GMPA 4I02A 3F95A 1RL3A 1D4M3 1JU3A 1DQ2A 1UX6A 3AL5A 4TXWA 4YW3A 1H9WA 4IE7A 2RM23 5J1XA 5JMOA 4RS5A 3JD73 2PTMA 3O1PA 2XLFA 1H4HA 2XUEA 5FWEA 1DQ0A 2DUPA 4Y5Z0 2UWCA 4YW4A 5EQUA 3SEPA 1HB2A 1LOBA 4E9KA 4ZKTB 2WO1A 2RDSA 4FP3A 5C8CC 3CMGA 5DDJ1 3BYWA 3D8CA 4GZ9A 5LA2A 4IV3A 2VAUA 3WDWA 2D44A 1UZVA 1POV0 4MGTA 1LOFC 1OF4A 1KDMA 5E8AA 1OFSA 3ZIXA 4B1LA 5FY4A 1AL0G 5K7PA 3ECQA 5A3PA 5FO9B 1JZ8A 1BEV3 4XPVA 5GZDA 4YGBA 4A3ZA 1BQPA 3GZUC 3OUIA 4OI0A 2HWD2 2ADDA 4KU8A 5C8WA 2B8MA 5FBJA 2VOTA 3EYPA 4XDPA 1NA1A 1XSQA 2UU8A 3OD4A 5FZMA 4B3NA 3LCPA 5FMBA 5FXXA 5A7NA 3VBOA 5FRAA 2A71A 1NX9A 4QU2A 2CSGA 1IKQA 4IV1C 3IPVB 1PX4A 4CCJA 5FXVA 1X7NA 3SITA 5I8YA 3I3QA 3MW4A 2Q4SA 4JX0A 4RGKA 1MEC2 1OFNA 1PVC2 3UGFA 1QJU1 5HCFA 5FKCA 1K3IA 1UD1A 4QB1A 3M3OA 1SPPA 2QQKA 2QTWB 5A7OA 4BCUA 3IN9A 1YCIA 5K0UB 4XF4A 5A3LA 4BXSV 2JDHA 3W5MA 4XDOA 3LOBA 1VBD2 1ENXA 3AMHA 3PVEA 2WYSA 2Y33A 3FMGA 5FYCA 1IPJA 1X36A 4L2NA 2VNVA 3RYRA 1X9TA 5DAPA 3ZFEC 2PN5A 4LBLA 1F31A 3P5BA 3IDEA 4W6XA 4QPGB 1W8NA 4EN7B 3OCPA 3ZM8A 1H1IA 4FPYA 3DPRC 4K8RB 5DUVA 2Y26A 4META 1QJX1 1UOBA 2K46A 2W92A 5GZEA 3WNOA 4FOWA 3QOPA 4EWAA 4OHYA 4B4PA 1K5MA 4FOVA 1OA4A 2F17A 3CKHA 3K4AA 4CUAA 1BBT2 5FK7A 2EXJA 3JB4C 5HPOA 5CISA 5A6ZA 5C5TA 4QQHA 2PYTA 2CGNA 3ZOIA 5F8PA 2BYVE 2FDHA 1AYM2 3IT8A 4Q4V1 3SH3A 1RUD1 5DDJ3 4A41A 4XABA 3PJQA 2FHRA 2VPVA 1PNGA 3B01A 5E16A 3NL1A 3VBUB 3POBA 1QQP2 5FZ9A 3I59B 1N3QA 3AVSA 2J1UA 1NKGA 1W9TA 1YUDA 1WCDJ 3IDBB 1DBNA 5EWSA 5JIAA 4N53B 1OHFA 4BQYA 1ASJ2 5G05L 2VECA 1O8PA 1LEDA 2B46X 3ZFGB 3ITQA 2A5ZA 3EB7A 1ACCA 4L9BA 5C7GA 2AYHA 3KGZA 1IS5A 5C71A 5FAXA 2JDUA 1BKZA 1D0GA 3KT1A 4O65A 1ZX5A 4R52A 4YVWC 2J7MA 3RG0A 3LA7A 5FK8A 1OQ1A 3FLTA 1WLWA 3PUSA 3WUDA 5T55A 4N7UA 5FY0A 4WVMB 2Z79A 2XHKA 1ZBE3 2A3XA 1GBGA 1MZ5A 1UN1A 1HN1A 2LRPA 1DLCA 2JDPA 2ZGRA 3D0JA 4XXPA 2P3JA 4MYEA 4EYUA 1QJU3 1GR3A 3I2HA 5LA1A 1ZZCA 2GC2A 4MZUA 4QDQA 2BU9A 3JUUA 1KITA 4AFDA 2B9VA 4AWDA 4Y1UA 3IMMA 4P9WA 3UKNA 1N1YA 2VZVA 2WNVA 1E57A 2PHDA 2XH6A 4DEQA 2W1SA 4RR3B 3MF9A 4QPIA 2AGSA 3ROUA 4UFMA 4YW1A 4XFIA 2XBO1 3H9AA 5FFOC 1QJX3 4AXOA 1US3A 4X6QB 4FFFA 1X82A 1WBLA 2YC0A 1ZNPA 4QPWA 3F2ZA 2CYFA 4UT5A 2DFCA 1B35C 1LESA 2UY8A 3H1WA 2VGDA 1HDKA 1QHDA 3MW3A 5I0SA 3E6BA 3SC7X 2XG3A 1BYHA 4LKDA 1PK6B 4OUSA 3J9SA 4NN0A 4CXWA 1RUD3 2Q1FA 4Q2FA 3VD5A 3GZTB 2DYCA 2D6MA 5IW0A 1YJLA 1N1TA 1US2A 4KNCA 3H3LA 1Y9QA 2E7TA 2ZS6B 3K48A 4DRRA 1TMF1 2BV4A 1DGRN 4XF0A 3NJZA 1QXJA 4BQ1A 5J37A 2MEV1 1FI2A 1LGBA 1UYYA 2Y60A 3EBRA 3BU7A 4MLOA 2WZPP 1UCXA 4G4FA 5HI0A 2W95A 4E4HA 1OURA 2QVSB 5LZ6A 4DZGA 2ID4A 4ISRA 4PI2A 4DY3A 3MYXA 4AHWA 1R091 2A3YA 1DGWX 4OZXA 4WVVA 3OGRA 2HKXA 2X10A 5L9BA 5LK5A 4COVA 1HRI2 4CU7A 3ACIA 4BH9A 5CZKA 1TME2 4UBGA 1M4WA 1OOPA 2E33A 2D98A 2W1QA 3AYAA 5DUWA 1RUH2 4C1WA 3DCQA 4E4SA 4FFHA 1WBFA 2W39A 4LIUA 4XUQA 3B9IA 5FPVA 4B1MA 4BU2A 5A3MA 3EMRA 4FI9A 2GMEA 1ZRRA 4G9SB 4HL0A 4LA2A 5I0TA 2YB7A 1C8M2 2VNRA 2YMZA 1W9YA 3I2KA 4XF1A 4A6SA 4JDMA 2VH9A 4RS5C 3FBMA 2ATFA 4NRQA 2ZAAA 2BERA 3PUIA 1HX6A 5SV5A 1VIWB 2YBSA 4YVSB 2EAKA 3I2IA 1JW6A 4KGGA 4N90A 5FYHA 2V4AA 2Q0AA 2BUKA 1UWWA 2XKOA 3ZN6B 1AR82 2R061 3JB8A 4LO6B 4HLTA 5A1FA 1ND2A 5C6CA 1WCSA 5LEJA 3T2TA 3THTA 3AFGA 4RL7A 3EQEA 4XHBA 5FLHA 1KGYA 5TSWA 5CA6A 5DAXA 5FZAA 4FBFA 5B4XA 5CFCC 3Q8CA 2ZEYA 1DQ5A 2D40A 3DXTA 4Y22B 3BPZA 2R6QA 1BMV2 2D6KA 1KEXA 3AX4A 3T09A 2A75A 4IE4A 3OBZA 4UWDA 4BZ4A 3IZOA 4AVAA 2VM9A 2YFUA 3VBRA 1KS4A 2DBNA 2ZX0A 1C8NA 4Z8BA 3LDRA 1AL22 2XJUA 1RVF2 3AYDA 1SCRA 4FVVA 4CDWA 2Q5TA 5K9YA 4YFWA 5I8TA 1WMXA 3ZPOA 4CE8A 5A6YA 2KR2A 4COYA 5FP9A 2QQOA 5GZCA 4ASKA 4Y20A 3R05A 1JH5A 3JBG3 3GBWA 5FYUA 2WO3A 2WNUA 1TG7A 3GBGA 4RQPA 1XPWA 4ONUA 4K7JA 3SH4A 3HOBA 2HBUA 1H8VA 1L7RA 1FYUA 2MEV3 2EIGA 5CG8A 3KB5A 4KBBA 2BEOA 2HEVF 4AVSA 1CAXB 1OKOA 5FZKA 3H1YA 4XEZA 1YJKA 3APBA 4MGYE 4QB2A 1QU0A 2DCTA 1H1MA 3LQCA 1EAH2 1R093 4OQ9A 1F5FA 1EPWA 1W2UA 2ZMNA 5CBLA 4MXVA 5ABJC 3HQRA 2RDRA 2R30A 5A32B 2RS11 3DKQA 3U4SA 2JX9A 2JB4A 2ZGUA 2XL9A 5F3IA 3M7AA 4RSUA 4PDWB 4E4DX 3DECA 2VCCA 3MIDA 4CEWB 5FP4A 3I3BA 5FZ4A 4BDVB 1L7QA 1OMIA 1RHI1 3FX3A 4C0HA 4UFJA 2WZR1 4XOGA 4TWTA 2J1VA 1RUOA 3POIA 4R9DA 5DN2A 3VZLA 1WW4A 5FYBA 4AF9A 5A7SA 2OUHA 1OVPA 3ZYGA 2R063 1B09A 3QCWA 4Y1YA 2GN3A 4S2FA 1IHMA 4PCRA 1S4CA 1R64A 4LXLA 1H0BA 4B7KA 4QX0A 1LHNA 4XF9A 5FLJA 5E89A 4FPKA 5J09A 2Y6GA 3GHMA 4Q0UA 1WGPA 1YLLA 2IZWA 2VTXA 4IV3B 4P9IA 2VZ1A 5FYTA 4H7MA 3UKVA 5BYNA 1COV1 4HOOA 1PMJX 5F3CA 1K12A 3PIGA 3RZHA 1W6PA 3NVCA 1E5HA 4FQZA 2BWCA 1O3RA 2XKPA 2XONA 4OI4A 4AVCA 1Y43B 1MZ6A 1QWRA 1XE7A 4EWEA 1C3HA 2QZ3A 1H30A 2HWC3 3ZFFB 2JD9A 4QXBA 1ND3A 4RD7A 4GIQA 4TLFA 3U14A 1GNZA 4MXWA 1MR5A 1W3XA 3J7NA 1JYVA 1RXGA 4LO7A 4XJWA 2UWBA 1VBA2 1S0JA 5EP9A 4H7LA 4OVEA 2G4IA 3RFRA 4BIOA 1NA1B 3VKOA 2PHRA 4YZ2A 4XW3A 5JMCA 3VBOB 1UL9A 3WF3A 5GALA 4XETA 2NN8A 4LKSA 4FTBA 4QQ2A 1C57A 3SH5A 3C7FA 1EV12 3MGUA 5FYMA 1OQEA 3G6JB 4QHOA 4AZZA 4DUWA 4HZFA 2GC1A 3K51A 5KC6A 1MACA 5L7OB 2TBVA 3RI9A 1WLDA 2ZGOA 3FL7A 4UYBA 4GQ7A 5LRSA 1EPZA 1NXMA 1TE1B 2AZ5A 1SPPB 1OA2A 2Q8CA 1G9CA 2DBIA 2B39A 4ATEA 5EJ1B 4QGLA 2RS13 1QNWA 3D3AA 4CP9A 3LD8A 1TNFA 3MIEA 1GMMA 1U5ZA 2IXHA 1JHJA 3GDBA 4QPIC 4IE0A 1RUE2 4JQRA 3JQXA 4XZUG 5JWPA 4Z07A 5CNAA 1BHGA 1CZVA 4B4QA 5FMCA 1HXS1 1GP5A 4A2UA 3USSA 2R32A 3BIWE 3N9QA 2YPDA 1RHI3 1JOJA 1AR91 2BQPA 2WZR3 3M3CA 4IUGA 4M3CE 1YHFA 1JI6A 1QKQA 3AKQA 4C8DA 2Z69A 1I3HA 3IIIA 1GU3A 1K5MB 2QQLA 3UKTA 2HLEA 3PVBB 5B2GB 1UX7A 1VBC2 4QHZA 3MLJA 3CQOA 3OYWB 1S0CA 2BNNA 3LKJA 5FZ7A 3G7DA 4O9GA 2CWSA 3GNEA 4CDQA 4P9LA 3IIAA 2WZEA 3RGBA 4XHXA 2RS32 3OOXA 3KV6A 2SBAA 1PNFA 2H0BA 4HPKB 1COV3 4PLNA 3KHCA 1HB1A 1NQJA 3RDIA 4D69A 5FO8B 1QH6A 3BPSA 4CEYB 2K0GA 1DG6A 1XNKA 2ORZA 3AXEA 1XU1A 2IUWA 3ZO0B 1PGW1 1RMU2 4NRPA 1J84A 1UXXX 1REDA 4RGAA 4RFRB 3RJ2X 2Y8KA 4JC1A 1RUG1 5KHHA 2YU2A 4FAHA 3PUHA 1FPN2 4DB5A 4Q0PA 2O1QA 3IDAA 1W2NA 4JGYA 3VZJA 2FDIA 2WBKA 1SFYA 1S0EA 5CU1A 3T2PA 2RR12 2JWPA 3MHZA 4ZU4A 1CGPA 4E2GA 2HWE1 2XJQA 1RUJ1 4JGZC 5BNNB 4OUEA 3KQ4B 2ZHNA 2VQ0A 4Q4X2 4UW5A 1RINA 1RB8G 2R041 4NVPA 1AXZA 4UI9L 2VZUA 5CYYA 3VBUA 1W2OA 1WCUA 1DCSA 2GC0A 1ND2C 1YC61 3V64A 5A3NA 2Y6LA 1H8TB 1W8UA 5KHIA 4HMZA 1F4AA 4NPRA 3T0BA 3W21A 5A6QA 2IVJA 3PURA 3HVDA 2WNVB 2DVDA 4GJYA 1GV9A 5CKMA 3SXWA 5BNPA 4Y1XA 5GZGA 1HXS3 2PHWA 5ISLA 4FPEA 1AYN1 1O4YA 4IQPA 2VVFA 1DGWA 4OHZA 2B9UA 4QWNA 1AR93 2OPKA 2RV9A 2ADEA 1GICA 2QDRA 4K1YA 3PU8A 2XJTA 5EPAA 3HN1A 3NAPA 3VHNA 5M0TA 3H8RA 3VDCA 5DABA 2XJVA 3GGLA 5IATA 1JZ5A 4CDWC 4PT6A 3ZN4A 1AX1A 1CX1A 1UU4A 5I91A 3AM2A 4WVMA 1W03A 2LS6A 4H55A 1XNAA 5AC92 1ZA4A 3J7MA 2Y64A 2P3KA 3I2OA 1NXD1 2VVEA 1MS8A 1RUC1 2PXJA 1RUF1 3E6DA 1HKDA 4MH0E 4RQPC 4UW3A 3UL2A 3GALA 1KRIA 5GLTA 3UJQA 1J83A 1XYNA 1PGL1 3RZZA 2RMU2 4C91A 4FCAA 3MV01 4DIQA 3Q8BA 1SBFA 2HWF1 1VRH2 2D6PA 5FZIA 4HFSA 1X9PA 2J1SA 4LLFA 2WQZC 2JG9A 4YGDA 1VMFA 2UURA 4RR3A 2P3YA 1RUNA 4GMP1 3C7GA 5ACA1 2VZTA 5KC5A 4COWA 3K3NA 1ULCA 5LRRA 1CQ9A 2BFUL 4FOYA 1RUG3 1CPMA 1I5PA 4D8MA 4XCBA 3VV1A 3K2OA 5FZ6A 1HRV3 4E2QA 3HBKA 4H3WA 4E8DA 4B4RA 2EICA 1RIRA 2I74A 1R081 2FCVA 3RSJA 4CYDA 3BUCA 3N3HA 4R4XA 2HWE3 1S1AA 1RUJ3 2VVDA 3NQHA 4Y1ZA 3SISA 3VKMA 1PK6A 4YWAA 4HK8A 2R073 4ZS2A 1ULFA 1G9BA 3TWIA 4NWWA 3TN91 5FZBA 5J3UA 5J36A 4QHBA 4GH4C 5FZ3A 2ZABA 2I45A 1JZ7A 4LHLA 4CDXC 1AF9A 3WNPA 3ACFA 2QKDA 4DUVA 5IAXA 4QQPA 1FX5A 3Q8EA 4L99A 2JDNA 3LPGA 5D2AA 1JYNA 3LDBA 2J42A 1AYN3 2Z42A 3TB0A 4UXAA 4HBNA 4XTMA 1D4VB 3IB3A 3L9JT 3AKTA 4COZA 3AP7A 3I2DA 5AFBA 3LIGA 2ZEWA 3WDVA 1PIV1 1LOAA 4AVTA 2VNGA 3I7DA 1YIPA 2WT2A 1ND3C 2J1AA 1ULPA 1W6MA 2JDMA 3KVAA 2W87A 1W9FA 5DUUA 1QJZA 2DFBA 3ZIWA 1UZZA 5FKBA 3NKTA 3KF5A 2EALA 1RUC3 5KHGA 1RUF3 5C4WB 5F32A 4Y20B 1UZWA 2AENA 5EJZB 2A7AA 4YVSA 2DCJA 2E7AA 2WNUB 3ZYFA 1V9U1 4RHV1 3ZN6A 3ACHA 4YW2A 2HWF3 4AEDA 1EUUA 3A22A 3C8XA 4ZHNA 1DGRA 1FXZA 1GSLA 3AK0A 4HK9A 2GNMA 4F3JA 3TEYA 4GMP3 3POFA 3GCXA 3W9AA 1MZEA 2HYKA 4W4ZA 1VB2A 4BQWA 2FDJA 5BNQA 4D7YA 5AVPA 1AR61 3VBFB 2YFZA 4HKLA 4I0WB 1YNAA 3W5NA 2G9GA 2RVAA 5FMDA 2W2IA 4LR4A 2ZX1A 2MHFA 1SLTA 1YXWA 1Q8PA 5DAVA 5FZ1A 1MS5A 1X8MA 3AZVA 1QJY2 2WQ4A 5FXZA 1G8WA 2ZGNA 1R083 3C7OA 4EN8B 2XQRA 2DWRA 1O8SA 3W58A 3GZEA 4N43A 5FYVA 5KXDA 3R0RA 3SEEA 1AR73 2VZRA 5F2WA 5FREA 3TN93 1WD3A 4EZ4A 4XMIA 2VG9A 1VBB2 5HCHA 1NE6A 1V6MA 1POQA 2EAAA 4E8CA 4R8HA 1ZZ8A 3K75B 2BBVA 3IKWA 1YFYA 4B29A 2CDPA 4IEQA 2BDRA 1TNRA 2TNFA 1UOGA 3DF0A 3KM5A 1Y9MA 2A70A 3LB9A 2D6NA 2FDKA 3AMPA 1U5XA 1AX2A 2YC2A 2HEYF 3NNLA 1CJDA 3WP4A 1UKGA 4W8JA 1QOOA 2E31A 2B5HA 3SMHA 4XBQA 1ZVFA 2RHPA 3PU3A 1DYPA 1YQ5A 5JZGA 5KXEA 3THPA 4E27A 3QD6A 5J96B 2BW8A 2H6CA 5LCWL 3VKLA 3NV2A 1PIV3 3E5UA 4LBQD 2Y34A 4PDWA 2AEZA 3WF0A 1V00A 4FTEA 3DXUA 4QPGC 3NNGA 3RVHA 5JOYA 3WR0A 1GUIA 3ZSJA 3RYPA 3HQXA 2ZA9A 2BOJA 3LA2A 4LULA 5BY5A 2J1TA 5D8AB 4UOJA 1VLNA 1P8JA 2PELA 1I9RA 5HV0A 4AGRA 4OULA 5FP7A 4CCDA 1WW5A 1OT5A 1OLRA 1V9U3 1I5ZA 2PFWA 2Y6HA 3DKWA 3GJBA 4GULA 4RHV3 5L73A 5LBEA 5FYZA 3WLUA 5FZLA 5T52A 3OUHA 2JENA 2RG4A 4IEXA 5BV6A 5LWBA 1CPNA 4ZS3A 4DXRA 1W0PA 4LKFA 4XAAA 2Q8EA 2OXBA 2YXSA 3I2JA 3EXUA 1O3TA 1C4RA 1MQTC 1UMIA 4ZY9A 4N53C 1AR63 2EA7A 4HG6B 5F5AA 5F2SA 4IE5A 2WN3A 3HWJA 1JYWA 1NCRB 2D93A 4CP9B 2NQYA 1SACA 3ZFGC 3S7EA 3ME2A 3ACGA 4IERA 4AQSA 5FY9A 2QE3A 1VBE3 3ZFFA 1ZM1A 4JZRA 4L11A 4J6GA 1HLCA 2XWJB 3UK9A 4COUA 2D3SA 1Y9GA 2C4XA 1AUYA 2JIGA 4FPFA 3HNBM 2JDYA 2D7FA 4KH9A 4MV2A 5FO7B 2R16A 2V5YA 3KT7A 4XQWA 2HWD1 4PIXA 3N9LA 1QGLA 2W3JA 3SQOA 1PO12 2Q8DA 5LATA 1ZBE1 2K9ZA 3ES4A 3KV5A 3HNMA 5L7OA 3AP9A 2JG8C 4P5YA 4CDQB 2VCMA 2RS52 3WF4A 1WW6A 2P4EA 3U10A 1NY72 1OI6A 3WY6A 1UY4A 5C9AB 3MO4A 1SLLA 2WT0A 3VZMA 3WCSA 1STMA 1BXHA 4AQTA 4UFKA 1MEC1 3GBFA 2Z5WA 5FPZA 4CDUA 1W05A 3OF1A 3N9MA 1VAVA 2VZ3A 1ZZ9A 2WAAA 4NO4A 4FO9A 5CKNA 4QDRA 2F6BA 2PLV2 4JCKA 1SFPA 3J8F3 1FT9A 2F4PA 4KU7A 1VBD1 4N7IA 1G9AA 1H6XA 3S0MA 2NMNA 5IK5A 1PO23 1O5LA 1Z7S2 2RDNA 4V2WA 3N35A 5EYXA 4ZU5A 3T4HB 4JGYB 2VUDA 4CU8A 5JPNB 3GF6A 4QX1A 1H1AA 1PK6C 2QQPA 3OYWA 1SBEA 3R6SA 3NNMA 1ULDA 2R1BA 1H2NA 1UIJA 5FP8A 4I01A 1S0GA 4W6WA 2HWB2 3UV9A 2GN7A 3M3IA 4HPKA 3VD4A 2WS92 3VBHA 2XJPA 4NIGA 4S2DA 3WEZA 4CEYA 4Q4V2 3LAGA 4KQ7A 1YIFA 2YZ4A 5BUVA 1IS3A 2WNEA 1OBNA 4XFAA 3VDAA 5G04L 3WV6A 4LA3A 2NM1A 5BNPB 3FLRA 1T6GC 1QQP1 2XGXA 5EZWA 5EYYA 1XU2A 2ZX4A 4YM1A 4AVVA 4YZ3A 3PMSA 3A4UA 4FPJA 1AVBA 4GWMA 5A7PA 2R1DA 5I0DA 4UFIA 5K0UC 2LW8A 1LOGA 5DQ0A 3SCGA 4FSJA 2CNAA 3NAPB 4UW4A 1DQ4A 2H0VA 3BGAA 5IVVA 2DTWA 2JXAA 1CN1A 4YRDA 3ZYJB 4NIHA 5GJ6A 5L19A 2HWD3 1LENA 1KD7A 3VD9A 1CZTA 1V6KA 2E6VA 2OPWA 1W8TA 1XNCA 3FFZA 4GWJA 5FZFA 4Q4W2 4PJYA 4D0QA 2PHLA 2GALA 4QX8A 1J3PA 4M3CB 4YVSC 4AI1A 3TAYA 4OFGA 3WX5A 4WM7B 1ODNA 2XVGA 1H8TA 1RYYA 3VD3A 4IEVA 4Q0SA 4P9XA 2EVXA 5GM0A 3H42B 1MEC3 1NUKA 5HXVA 4DINB 3KT4A 4IGPA 2PHXA 1PVC3 1J3RA 3T30A 2JG9B 2DURA 1UYZA 4IGQA 4QB6A 5FZGA 2VOVA 4CCOA 2P34A 4AR2A 5EXOA 1SLBA 4FPGA 5F37A 4IETA 1XE0A 2WDBA 4CCNA 3PTYA 2CHHA 1DF0A 3E1F1 1KXGA 4WVWA 1HJGA 1VBD3 4ZZ5A 2WWJA 3VN4A 4ASMB 2JE7A 4QD2A 4BYYA 5JOXA 2A6XA 4QAWA 5A33B 1C28A 1HQWA 2BP6A 4PBPA 1NOVA 1EYBA 1CAWB 2GU9A 4XUTA 2XBO2 1QOSA 2H6BA 2OZ6A 3O1TA 5CIRA 1QY4A 2X05A 4BJ0A 5JXIA 1JZ4A 4NHMA 4IEPA 3C2UA 1JHNA 4QX7A 2DV9A 2ZTNA 2ZEZA 2DUOA 1BBT3 4OZOA 3JBG1 5FCCA 4Z92B 3RZLA 2ARBA 4R9CA 3ILFA 3P1IA 2W0XA 1WMEA 4R4ZA 3B7MA 4A45A 2WIIB 1LAJA 2X09A 1W39A 4WM8A 1AYM3 4LITA 1DYOA 4LBJA 4KWLA 5FPUA 4EJRA 2RJLA 1QQP3 1OC1A 1XE8A 2V72A 1TMF2 2X5IC 4KWUA 4LLOA 4X6RB 5IWFA 1WW7A 3LSEA 4MGSA 2ORXA 3OGSA 1GP6A 2ZACA 3L2YA 4YZ5A 2VMFA 3PUQA 1ASJ3 2B45X 2W5FA 4PDWC 2WSVA 4CEWC 1IPSA 4BE3A 3H1MA 2Q1MA 2XR4A 4GWNA 4JKLA 4XIOA 1W6MB 4DO0A 3USUA 2LROA 4PF5A 5IK7A 1OD3A 4JTOA 4OMCA 3UESA 1TME1 1SFNA 1RITA 2OVUA 3T2OA 3T1LA 2WWSA 1JZ3A 2HEWF
chains in the Genus database with same CATH topology
2IXCA 2LM3A 4O9EA 5H9RA 2R0HA 3WUCA 4AEDB 4QGNA 1C8M1 1CR7A 1UU5A 3DN7A 4YVWB 4IV3C 4KWKA 3AMQA 3KQRA 1G9DA 3P3NA 1AR81 5F5QA 1RUI2 1ENRA 3M70A 3ZFFC 4AGVA 2MPFA 1DZRA 1CX4A 3INAA 2DVGA 2HWC1 1MS3A 1LGNA 1BMV1 4HVQA 3B94A 1NA1C 3JCIA 4N43B 2WSUA 1BVP1 3VBOC 5C4WA 3ZMOA 1YYNA 1CJPA 1IOAA 1RVF1 3WHTA 1U12A 3FBYA 5L7OC 4KG8A 2DUQA 3WD5A 2DVAA 5GZFA 2LTNA 2QNKA 4YG3A 1J58A 2C0ZA 4XBNA 3QH7A 2O0OA 3VBFA 5JZGB 1B35B 3VDDB 5KHKA 2R49A 4GKYA 3M3EA 3VKNA 4FAGA 3KLSA 1EAH1 3PMEA 3PJYA 1HRI3 1UPSA 4B7EA 4FP2A 2DVBA 3D82A 1TME3 1SEFA 3U07A 4RGGA 1K5MC 1RUH3 2P37A 4AVBA 5T5JA 3EHKA 3WQ7A 4X8PA 4YM0A 1L3JA 1DDLA 1ULGA 3N4MA 4P5HA 1CONA 4MX3A 1C8M3 4PLOA 5LK7B 4XBLA 3R4UA 2PHUA 3AMNA 4L92A 4PQ9A 2VQAA 4I0BA 3O14A 2PA7A 3POSA 1AR83 1Y3TA 4HN1A 5T3NA 5HBAA 4CEYC 5H9QA 1AXYA 2ZAHA 3CNAA 2IWGB 4U36A 2MNGA 4D94A 1N1VA 4AI3A 2WLPA 2WL1A 4S2HA 2DCZA 4D7TA 1RJ8A 3MF6A 4DFSA 3T1MA 3BOWA 4M00A 3CJIA 5D8AA 3ZXEA 2K2SA 1LB2A 3GZAA 1G86A 4HANA 2GC3A 3IWZA 3MLLA 2CAUA 4XMAA 4U2AA 1QOTA 1YFUA 2AUYA 1AL23 5JSRA 3WQ1A 1RVF3 2XLAA 2OA2A 1N47A 3RS6A 5BNNC 1QNYA 3ZXJA 1H2KA 1WUVA 3PHMA 2OYZA 4YM3A 2A3WA 2AREA 3ZSMA 1V6NA 2FMDA 1R1A2 1LKNA 2B7YA 1YI7A 3AP5A 3VKFC 5JI7A 3A0NA 3MFCA 4P9GA 3WINE 1PZ7A 1EV11 1NCRA 2WNVC 4YARA 2ZJCA 3IBMA 1GLHA 3VHOA 2WFPA 5DG2A 3OJBA 1V6LA 4CDUB 4YGEA 4M0HA 1EAH3 3OY8B 3RPQA 2QDNA 5JPMB 3SNMA 2FQPA 3DGTA 1V6IA 3JQWA 3CEWA 2E63A 1FMD2 1ULEA 5F1RA 1U5IA 4Z2WA 1RUE1 4BMBA 4Q4Y2 4AEJA 4XXAA 3CL1A 5CADA 3WOGA 1IGOA 2IC1A 3V56A 4BLJA 2A6VA 4URTA 2XVLA 3TNPB 4OI2A 2OUJA 4LO5B 5BXXA 2ZGMA 5K8SA 4ORFA 1FAYA 3MDPA 1U0AA 5KWRA 2ZCWA 1VBC1 5C9AA 3MICA 3VBHB 1LHUA 4S2GA 3AKPA 5GLWA 1LJ7A 1YFWA 5JOZA 3IDCB 2LALA 2RS31 1H2LA 4SBVA 3VZNA 1APNA 2VOXA 3BODA 2DVFA 2JEMA 2VULA 2I2SA 1OOPC 3ZXLA 1KQRA 4YW5A 4AI2A 2VMIA 1HRV1 3U4XA 1RMU1 1VALA 3OPZA 2E53A 5J98B 1VBA3 2XPJA 3ZDSA 1DHKB 1W6NA 1J59A 2VU9A 4LBMA 2BWAA 4HSJA 2ZHLA 1DZTA 1QDOA 2R071 4CP0A 2VY0A 5T54A 4XJ8A 1Y7BA 4UW6A 3N7KA 3RMYA 2RR11 3E6CC 1S0FA 1W6QA 1EV13 1CESA 1S2KA 2NMOA 3TNQA 2AR6A 4Q4X1 2VOKA 2R042 4QT6A 2YPJA 3ACLA 2A6WA 1DIWA 3MIFA 3VBRC 3NV3A 3ASIA 3ST7A 1RUE3 3WDUA 3AZXA 5T5PA 3CF6E 5C8CA 4MSVA 4JDOA 4NOTA 4HVOA 3BTAA 4DQAA 3FLPA 5E1RA 1LOFA 2NLRA 4BWOA 1WD4A 4M3CA 1OD5A 2WNUC 1FOD2 2BNOA 1GQHA 4WM7A 1VBC3 1WA4A 3AZYA 2ERFA 5F6LB 4IEZA 1ZBA2 4QXKA 5AC91 1O3QA 4DXZA 3AYEA 1PGSA 4WM8B 4YGCA 2ARXA 3ZSLA 1GYKA 2CL2A 3PNAA 1GANA 2EXIA 2RS33 3CU7A 2G9FA 3VBFC 2WT1A 2RMU1 4K1ZA 3SHRA 1Q8QA 1HQLA 4GB32 4IV1A 1VRH1 1NCQB 3Q9OA 4JRAA 2CWMA 1PHMA 2ZZJA 5A33A 2XJSA 3NV4A 1UMZA 4YSFA 5ACA2 1RMU3 4JRLA 3TOJA 1VP6A 1CAWA 3USUB 1H2MA 1IS6A 1FPN3 1AR71 1RC6A 3M8LA 2RR13 4P9YA 4XJZA 1VJ2A 4H14A 1AX0A 3ATGA 2YGLA 3FUQA 2V09A 4Q4X3 2FMYA 3NV1A 1FV3A 1G9FA 2HJIA 1MS0A 4R9AA 2KXLA 3RNSA 1OA3A 2A6ZA 4IEWA 3I54A 2NPIA 3S30A 1WMDA 5DXDA 2DCKA 1N3PA 1S0BA 2WFF2 4Q1PA 1C1LA 1LU1A 2JICA 1UF2C 1A78A 2EXHA 2WC2A 1D2QA 3D6EA 4AHYA 5KHJA 1WLCA 4Z82A 1POV1 4AFBA 3WHUA 1A3KA 3WDTA 2W68A 3H3UA 5AC93 5FTTC 1N1SA 2BTVC 4YVWA 3ZYIB 5AVAA 1CVNA 1IKPA 1LODA 4AE2A 1D4M2 4PIYA 2RMU3 2RM22 3JD72 1NCRC 1UAIA 4QMAA 4K21A 1VRH3 3B5LB 3NO8A 4XDQA 4OUMA 3L2HA 5F9TA 3WT3A 4I30A 1SLIA 3RJRA 1VBE1 1Q43A 1XXNA 2GNDA 5FQ0B 4EN6B 1A6CA 4AHXA 2W52A 3LSDA 4AW7A 4AEMA 4OHXA 1ZZ7A 4QGMA 1HIXA 2YYOA 3VZKA 2JE9A 4K3UA 1LGCA 1BEV2 1I1EA 3ZPYA 5IK4A 2IXLA 2C1FA 1RJ7A 4CDQC 1Q3EA 3VBSB 2R0FA 1VBB1 1MS1A 3TYJA 4PLMA 1JN2P 4AI0A 4GMP0 2QZ2A 3ZYPA 1CIWA 4WZFA 1MS9A 5FDBA 1AXKA 1B35A 4A7YA 2ET7A 4I0AA 3VDDA 2O8OA 1GZ9A 1QDCA 1IS4A 5JDBA 1FATA 4DPNA 2IXJA 2WA3A 1X50A 3LA3A 3CJIB 3U0ZA 4CDXB 3J8F1 4LBQB 5JI9A 1KDKA 5HCBA 3AZWA 3B00A 2WKKA 4JGYC 1GZWB 5C33A 1PO21 4AHZA 4C0BA 1G7YA 1POV3 4JAAA 4XQ4A 4ASLA 4HETA 4XFHA 3VBUC 3ZSKA 3PVNA 3MW2A 3NSTA 3O5SA 2ZGKA 4NWVA 1CAVA 2BNMA 1DQ1A 3N7LA 5BNPC 1MZFA 3WW4A 3E5XA 5DDJ2 4EV0A 2QJVA 2XB6C 5DZEA 1DYKA 1MS4A 2P3IA 3OBTA 4LT5A 4FPHA 5T5OA 3NAPC 2TUNA 3KSCA 3V0BA 1SLCA 4YM2A 5GLUA 5CAZA 4I09A 1QJY3 2D3RA 4FTSA 1PZ9A 4C90A 5CFCA 4YZ1A 1ZREA 3VHRA 1VBB3 2N7GA 3KCCA 2PHTA 4WM7C 3GHNA 3TRSB 3LWCA 3FC0A 2VUAA 4LO8A 1PO11 2JD4A 3RQ0A 1D0HA 2JG9C 1ZBE2 4RR3C 1SLAA 4XF3A 1PVC1 1XYPA 1QJU2 2RS51 4HVRA 4EN0A 4ATFA 4LNVA 3OY8A 3ILNA 1IZ3A 1NY71 3M2MA 4YLZA 3URFA 4Z1VA 4IL7A 1NYWA 2YUEA 1Q8OA 1ALYA 3SCFA 3AJYA 3POYA 4RA0A 1NG0A 1PMIA 4XJAA 3FHIB 3ZMNA 4J1WA 1XQNA 3TBDA 1AJKA 1XRUA 2PLV1 5CFDB 4F7ZA 5ABJA 4W6YA 4EROA 1ZZ6A 4MUVA 1W6NB 1QJX2 1QMJA 2JDZA 3I4IA 4P9JA 1J1TA 3HBZA 4CRQA 5BNOB 2XUMA 1Z7S1 4XYXA 4D3WA 1BBT1 3MZHA 2GNBA 4AFAA 1W6QB 4KL1A 3AP6A 3UJOA 4QM8A 1AYM1 1REFA 4LHKA 1RUD2 1X8EA 4YG6A 1LRHA 1O4ZA 2HWB1 2VNOA 1F8VA 2YV8A 4NR1A 4E4ZA 2WS91 4Y4YA 1PM7A 3RWNA 1ASJ1 2GMMA 2DTYA 3X29B 5FLIA 3ZSEA 5C8CB 2D6OX 3A0KA 2O8QA 1FNYA 2XLGA 2X29A 3OTFA 1MQTB 1I6XA 3B93A 4OI1A 2IXKA 3ILRA 4WV8A 2V73A 4AI8A 3RYKA 2ILMA 2QUOA 1VAMA 1V6JA 4AG4A 2WA4A 4F83A 4AEDC 1PO13 1CAUA 4BLIA 4Q4W1 4LO4B 5AFEA 2PQQA 1KJRA 2RS53 3DUIA 3E5QA 5DG1A 2LUWA 4K9SA 3DL3A 4R9BA 2WJSA 1LTEA 4IV1B 5JSOA 1UKRA 3QH6A 4BOWA 5JR7B 2Q8OA 4EN9B 2BVVA 2VUJA 3N7MA 1ZYBA 2YY1A 4LHNA 2JG8B 3MIGA 4DS0A 2PLV3 4DOUA 4N43C 1JUIA 2KM2A 1LR5A 5GKAC 5JSPA 3R4SA 4Q8KA 1Z7S3 2ZOEB 2D97A 2GDFA 1RTVA 3WP3A 5I0UA 3ZFEB 2XVKA 4KG0A 5I0RA 2ZZQA 2VW0A 1DU3D 3DPRB 3ZXFA 4I2OA 2HWB3 1ENQA 3MLKA 5JZGC 2ZPXA 3JBG2 1YI9A 1LEMA 4MGIE 3VZOA 2WS93 5L36A 3VDDC 5DZGA 4N9IA 2MEV2 4V1PA 5FBZA 1RGSA 1NCQA 4Q4V3 4AQ2A 2ZHKA 5FMOL 2CAVA 1TQ5A 3ZXGA 3GYDA 1KS5A 4CP2A 1R092 2BPA2 3MPBA 4INDA 4KGQA 1AJOA 1C5IA 4A3XA 3D4KA 1HRI1 3FE5A 3J4UH 4XE9A 4XJUA 1J3QA 1SBDA 1RUH1 1OKQA 5J48A 3H3ZA 2C9AA 3JU9A 4FT8A 3WG2A 3CO2A 4M3CF 4TSVA 4Y1VA 1KFUL 4G3YC 3O0WA 2DU0A 4Q4W3 2SLIA 4M01A 1D2SA 2A6YA 2VW1A 2GSYA 4AFMA 4AEKA 5T50A 5K0UB 3WCRA 2W08A 2WINB 1QXPA 4N9HA 2Y0IA 3B02A 2YHJA 4HT1T 3RRDA 2EXKA 2R062 4RFT0 1V6OA 4LE4A 4HSLA 4JGZA 3FJSA 3WG4A 5DUXA 3KZ4C 4ZU7A 3WQ0A 3ZXDA 4OHVA 2FZ2A 1MVEA 3O0XA 3MI8A 2JJ6A 4IXLA 1LU2A 1RUI1 1A8DA 3H50A 4PIZA 1HV0A 4NHLA 1F9KA 2P2KA 3H7YA 3MIBA 3B9CA 4KWJA 1AL21 5BPXA 2HWC2 2XBO3 5FOJB 3KCYA 1MVQA 5JOWA 3BCWA 2I07B 1LULA 1UIKA 2D5FA 4HKOA 3MEPA 4HN0A 1BK1A 1O7FA 2VMGA 3S6PA 4YNIA 3WP6A 4XIKA 4CDUC 1PVXA 3CLPA 2DCYA 4F8AA 2E9QA 4B8EA 1KJLA 1BJQA 1U5YA 2P17A 1FV2A 2PAKA 4J1XA 4WVZA 3WDYA 1TMF3 4JVAA 4XQDA 1QH7A 5FQ0A 1CD3G 1JYIA 5LEKA 2RS12 1ZRDA 4JTNA 3MIHA 5I93A 4IEOA 3KD4A 1N3OA 4I3GA 2BFUS 1S2BA 1W0OA 3IM0A 1GFF2 3AB0A 2X5IB 3ELNA 3QLQA 1F2NA 4MVTA 4Y26A 1RHI2 4MGZE 4CP1A 4DRVA 1ZRCA 2WZR2 3LOIA 3VBSA 4MGKE 1DZQA 4GKXA 1NLRA 4M0NA 3I8TA 4UBHA 3VBHC 1HQNA 5CG9A 1HW5A 4AK3A 3N36A 1CAVB 2AH2A 3H8UA 2GH8A 1H9PA 1OQDA 3WG3A 2ZMKA 1J1LA 2EF6A 1KFXL 2E51A 4XFGA 1Z0HA 2Z2SB 4RS5B 5FPXA 3CJXA 4GH4A 1JYCA 2D3PA 3VL9A 1COV2 1RUI3 4CDXA 3ALQA 5EFUA 3B3QE 3WXPA 4LBQA 3V0BB 1GZWA 4QPYA 5T5LA 4GA9A 2ZGTA 1W6OA 4EWDA 4LE3A 1JXNA 5IT6A 3OGJA 3ZXAC 5CFCB 3C3VA 1YWKA 3WW1A 2ZMLA 2NYYA 1VBA1 1ONAA 3V0AA 2XL7A 3BALA 4GALA 3WW3A 2ZGSA 2UY9A 1GZCA 4JDNA 1BCXA 4AQ6A 1TEIA 4ES9A 3HT1A 4QQLA 4YZ4A 2C5DA 1H8TC 4DMIA 2BVBA 1IPKA 5GLZA 5JCTA 1LHOA 4FQ4A 3KS7A 1AZDA 4WBBA 1VR3A 2Q30A 3KGLA 1R1A1 3N7JA 3BB6A 1VB4A 1DLLA 5DZFA 3ZN5A 2GH2A 4YFZA 2Y38A 3NW4A 5E88A 2CGOA 4TYSA 4IESA 4XFCA 3VHPA 1Q8VA 3WW2A 3HIFA 4BHPA 1HXS2 2D6LX 3PVOA 1PZ8A 1ZZBA 3AMMA 3AYCA 4BIFA 5JVVA 2ZBJA 3AZZA 2ZKLA 1UZYA 1AR92 5ABJB 1FMD1 4FXGB 3O12A 2TEPA 4AYUA 1OPOA 4Q4Y1 3DV8A 1C5HA 3HAGA 3WZ1A 4ISQA 5IUQA 4JV4A 3SCHA 4WM8C 2B42B 3LGRA 3OBRA 4CZSA 2VXRA 4A7KA 1XNDA 5EV7A 2QCSB 1XNBA 3IPVA 2ZKNA 2A73B 5J7MA 1NCQC 3O7OA 3VGIA 3AKSA 1XYOA 3EO6A 1JBCA 4LUKA 3ENRA 4Q29A 2KA3A 1NE4A 3MFAA 1IQAA 3ZYRA 1PGW2 3ZVXA 1Z78A 5F6KA 5CFDA 4K40A 3VLBB 4Q0QA 1BVVA 1RUG2 5JIUA 2PAMA 2IXIA 1FPN1 5BNOA 2OW4A 3FUOA 1O3SA 1HRV2 1SQ4A 2GAUA 1SMVA 2NZ9A 4QPGA 2VOWA 4P14A 3AJZA 2HWE2 1RUJ2 1QF3A 2Y0OA 1CAUB 2R072 4WZCA 1R1A3 1OLQA 2ZX2A 4FPOB 1GQGA 2JECA 2YDEA 1Q8SA 2X8KA 3POWA 1HV1A 3ZXKA 5JLVA 2CTVA 2NP0A 3KMHA 3VL8A 1S0DA 2PHFA 2CV6A 3IMNA 1UW8A 4XFFA 3I59A 1AYN2 1MQTA 1M06G 4N53A 1DQ6A 4Y24A 1FMD3 1BZWA 5CB7A 5C4WC 1OSGA 4XZPA 4Q27A 4LUMA 4Q4Y3 3EJKA 1YRZA 3V65A 3ZFGA 2ENRA 1Q5OA 3B69A 4QPIB 4Q0VA 4Q8LA 1EY2A 1C1FA 1ENSA 5GLVA 3HD8B 1NQDA 1RUC2 1RUF2 3HR9A 2GNTA 1FOD1 3HMYA 2OZJA 2ZHMA 4BPZA 1PGL2 1GKBA 3OGGA 1ZBA1 3ZX7A 1SDWA 2HWF2 2GZWA 1X33A 2BGCA 4DNYA 4XFBA 4HKWA 4K8FA 4FOQA 2JG8A 4K6BA 5SV8A 1NZCA 2ZGPA 4BM8A 1LCLA 2E7QA 4GB31 4E2SA 4GXLA 4ES8A 3QBQA 4FPLA 2WLQA 4A7ZA 1R082 1O5UA 1WCKA 2UYAA 4BMEA 3ZFEA 3RMXA 3VBSC 4OLLA 4QQOA 1DGLA 4CTEA 4YG0A 4XJ9A 5HCAA 1AR72 3DPRA 1OOPB 3TN92 3E97A 4LBKA 1URXA 2D5HA 2D43A 4LBNA 3U11A 4I3PA 1GNHA 4C1XA 4AFCA 2PAEA 3J26N 2UYBA 1LOCA 2R043 4JGZB 2OIIA 2CY6A 2QFEA 1Q56A 4NHKA 3CJIC 5D8AC 3VUOA 4LTAA 5H9SA 1LECA 1ND2B 1JTZX 4DY5A 3HT2A 1PIV2 5EJ3A 5KXCA 2WFF1 2ZX3A 3FWEA 1LHWA 4QM9A 4XILA 4PBOA 5KXBA 1R1ZA 3PLQA 5KBFA 3RI8A 3H0OA 2YROA 5I8SA 3VBRB 1LHVA 2VMHA 2DU1A 4X8NA 5K0UA 3WNXA 4D7SA 1FOD3 2ET1A 2ZGLA 2Q1ZB 2FBEA 1YFXA 3AP4A 1UPIA 1DFQA 1V9U2 2IFWA 3QACA 4IEYA 4RHV2 1LOEA 1ZBA3 1FNZA 3R4DB 4CDWB 2CGPA 4AGGA 3ETQA 3KCXA 3SLIA 3WP5A 4ZXKA 1D4M1 4Q1RA 1F5JA 2ETEA 2RM21 3BOPA 3JD71 4RQPB 4GB33 4LBOA 1JUHA 1AR62 3OD0A 3P3PA 4XTPA 2YGMA 1AHSA 5BNNA 1H4GA 4Y22A 5ACA3 1QJY1 3M3QA 3W59A 1VBE2 2UWAA 4ITCA 3H7JA 4L8QA 5FOBB 1G6NA 4TZDA 3FZ3A 3JZVA 4L97A 1O91A 3M1HA 4W65A 1S55A 1VAKA 3WG1A 3AFKA 1BEV1 2ES3A 1WLTA 5C9AC 1EP0A 3FFQA 2RE9A 1NLSA 3WDXA 1A8MA 5JAXA 4OHWA 2JKBA 1REEA 2ZGQA 2RJKA 3NKGA 3WVJA 3AXDA 2FZ1A 4Q26A 4GH4B 1ZRFA 3M4FA 4FPCA 4IEUA 1S0IA 4QX5A 3D0SA 3NWKA 1YO8A 1CAXA 2XWBB 3D5OA 5CVRA 5H9PA 5IK8A 4K20A 2WFF3 1W6OB 5CFDC 1OPMA 1UU6A 1WMFA 2X5IA 4LEJA 5A32A 1SCSA 5FMOS 3MPPG 4YYOA 2IFRA 2X53S 3J8F2 5BNOC 1W6PB 3V0AB 2DF7A 2VW2A 3LZZA 4CEWA 1PO22 3AKRA 1ND3B 2XJRA 4MXWB 3S7IA 1O4TA 1V70A 1QXRA 4FXKB 4SLIA 5D1IA 4BA6A 2GMPA 4I02A 1RL3A 1D4M3 1UX6A 1DQ2A 4YW3A 1H9WA 2RM23 4RS5A 3JD73 2PTMA 2XLFA 1H4HA 1DQ0A 2DUPA 4Y5Z0 2UWCA 4YW4A 4E9KA 1LOBA 4ZKTB 4FP3A 5C8CC 5DDJ1 3D8CA 4IV3A 3WDWA 2D44A 1POV0 1LOFC 1KDMA 5E8AA 1OFSA 3ZIXA 1AL0G 5K7PA 3ECQA 5FO9B 1BEV3 4XPVA 5GZDA 4YGBA 1BQPA 3GZUC 4OI0A