3M3IA

Hypothetical protein from leishmania major
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
195
structure length
177
Chain Sequence
b'QNTAEFWIKRLQLVPHPEGGYYSEVVRSAHKVDNEEGNRRHAYTTIYFLCTPESPSHLHRLCSDETWMYHAGDPLQLHVILKDPQDEDRRPKYQVYRRVLVGARVERGELLQYTVPGGAIFGSSVAADGADGQAGYSLVSCIVSPGFDYRDFEIFTQAQLMELYPQHEAVIKQMAYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Hypothetical protein from Leishmania major
rcsb
source organism Leishmania major
molecule tags Unknown function
total genus 42
structure length 177
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m3iA01
3H7YA 1GQGA 3I54A 4KU7A 4HZFA 4CYDA 5CVRA 5E1RA 1J1LA 2XL9A 4XF0A 1GQHA 3ES1A 2KXLA 3RPQA 4B29A 4KL1A 3CF6E 4AQ2A 2XLGA 4BYYA 4Q0UA 1Y3TA 5KHIA 3MPBA 2QVSB 1YFXA 2ZCWA 4IEZA 1CAWA 4EV0A 2WC2A 4XF3A 4XEZA 5I91A 1DZRA 4H7LA 4AVCA 2UY9A 2Q4SA 2IC1A 3C3VA 2OPKA 1YUDA 3FX3A 2GC3A 4O9GA 3FWEA 3UKVA 3CL1A 4YSFA 2PQQA 3NKTA 1ZNPA 4Q0QA 3R6SA 4MGZE 1EY2A 2EAAA 4FT8A 1ZZCA 1G6NA 3RYRA 5T3NA 1Q43A 2BNOA 3DKWA 4LUKA 2P17A 3I59A 2Z2SB 3FHIB 4LA3A 2BYVE 5JR7B 5FDBA 5KHHA 4XFIA 4Q29A 3IBMA 4E2QA 3PLQA 4XFCA 1J58A 4MZUA 3S7IA 4XFGA 4Q0PA 4ORFA 2IXKA 3D82A 2I45A 5KHGA 2B5HA 4R8HA 2ET1A 5LRSA 1O7FA 5FQ0B 3NSTA 1YFWA 3BB6A 3H7JA 4UBGA 4MV2A 3KMHA 4IEYA 4WZCA 1YFUA 4QX5A 3FJSA 4LEJA 3QACA 2OZJA 5HI0A 4I2OA 3JZVA 3S7EA 1CAVA 2PHDA 2Q30A 1EPZA 2ZKLA 4IERA 1QY4A 1XE7A 4HN0A 3TNPB 1UIJA 4AVAA 3UKNA 5KHJA 1FXZA 4MUVA 4A2UA 2XL7A 1CAXA 3EJKA 4KWLA 3OD0A 1SFNA 4QMAA 4LULA 4AVBA 3OF1A 2F4PA 4LLOA 4I3PA 2XLFA 1EYBA 4IEQA 2IXJA 2UYBA 1DGWA 2ET7A 3OGJA 4META 4EROA 2MNGA 2GC2A 5I0SA 1U12A 4WVZA 4JV4A 3IIAA 4L11A 3E6CC 1QXJA 3LAGA 2BNMA 1RL3A 1X7NA 5JAXA 3KGZA 3VHRA 2FQPA 4KWJA 3DN7A 1ZRCA 4Q0SA 1ZVFA 3NVCA 2N7GA 3D0JA 1OMIA 1WGPA 1NE4A 3GYDA 2PAMA 5JCTA 4HSJA 3HQXA 1ZRDA 4X6QB 2BGCA 3OCPA 1J3RA 1L3JA 2GH2A 2H6BA 1CAVB 1ZX5A 4IESA 3FZ3A 1PM7A 5FCCA 4PJYA 2PYTA 1LKNA 1H1IA 1NYWA 4Q0VA 2K0GA 4GULA 4OFGA 1RUNA 4HMZA 2QDRA 3SCGA 3IWZA 4EWAA 4HSLA 1DZTA 2XKOA 5C6CA 3E97A 4I02A 3BU7A 5LEJA 2WFPA 3H1WA 3QOPA 4KU8A 4BIFA 3RYKA 3TNQA 1ZRRA 5BXXA 2K9ZA 2OYZA 3ZDSA 4I0BA 4YYOA 3WW3A 3HIFA 5I8TA 1ZZ7A 2PAKA 4IETA 3IDCB 4J1WA 4N9IA 3EQEA 5JSPA 1X8EA 3L2HA 2QNKA 5JSRA 2XGXA 1UW8A 1NE6A 3LZZA 3NW4A 2HJIA 3S0MA 2D5HA 1TQ5A 3RDIA 2IXCA 3LA2A 3PNAA 4J1XA 1UIKA 4QGNA 4XFHA 2GC1A 4QXKA 2CGPA 4YNIA 5KHKA 2QJVA 1J59A 5E16A 1LR5A 5I8SA 1RTVA 4E2GA 5LRRA 1LB2A 5I0RA 2EA7A 4MGYE 3USSA 4QGLA 1CAWB 1I5ZA 2H6CA 1O3TA 1VP6A 1ZZBA 2UY8A 2D5FA 4KWKA 1IPJA 5I0TA 1VJ2A 3WW2A 2PAEA 1QWRA 4FAHA 1CGPA 3ES4A 3FE5A 1X82A 4IEWA 4JTOA 3HT1A 2O1QA 1ZZ8A 1QXRA 3CLPA 2ATFA 3LWCA 5J7MA 2EVXA 4P9GA 3MDPA 4PIYA 3M70A 1OI6A 5D1IA 2IXLA 4WBBA 1EP0A 3U0ZA 1X8MA 3BPZA 1H1MA 1UPIA 1I6XA 5FLHA 4PIXA 1O3QA 4HLTA 3MZHA 3I59B 5C8WA 3H3ZA 5F1RA 3U11A 2XKPA 5EZWA 4D7TA 2H0VA 3E5QA 4I01A 4E2SA 3N4MA 2CAUA 3EO6A 1O5UA 1SEFA 3H50A 4HVQA 3H9AA 4HVOA 3FFQA 2CV6A 3G7DA 2GC0A 4AQ6A 3M3IA 2IXIA 4EWDA 2D93A 4IEUA 4FBFA 1XRUA 3E5XA 4YARA 5BY5A 3ROUA 3D0SA 3U10A 4IEVA 2XHKA 3DV8A 1RUOA 1XE8A 4QM9A 4AXOA 1YLLA 3KSCA 1CAUA 1DGRA 3GBFA 3RZZA 5K8SA 1ZZ6A 2OA2A 2PA7A 5EFUA 5I0UA 4Z82A 2V09A 4HBNA 4XFFA 3B02A 1ZRFA 3NL1A 1O4TA 4MGKE 2GU9A 5FQ0A 2GAUA 4FAGA 4F7ZA 1IPKA 1CAXB 3NJZA 2XLAA 1CX4A 4I09A 5BV6A 4UXAA 1O3RA 1UD1A 4HN1A 3H1MA 5FPXA 2O8QA 2FMYA 4BH9A 2OZ6A 2MHFA 4ZU5A 2ETEA 2HKXA 3BCWA 3EBRA 3OTFA 4JVAA 4N9HA 4YRDA 3MYXA 2BEOA 2VPVA 3RYPA 3E6DA 4L2NA 3ST7A 1RGSA 3H1YA 4XF1A 1Y9QA 1OD5A 1YWKA 3SMHA 1FT9A 1HW5A 3LOIA 1Q3EA 5FLIA 4DINB 4UBHA 2MPFA 4JTNA 5BUVA 3RNSA 4Z07A 4XFBA 1SQ4A 4I0AA 1LRHA 2B8MA 3LA7A 1CAUB 3ELNA 3E6BA 1WLTA 4D7SA 3PVBB 2Q0AA 2B9UA 2VQAA 2DCTA 5CU1A 3EHKA 2UYAA 5I8YA 2C0ZA 4K8FA 3SCFA 3UKTA 2BNNA 4IEXA 5AVPA 4LUMA 3WW4A 5LEKA 1RC6A 4X6RB 1NXMA 3O14A 1V70A 5BPXA 4LA2A 2Z69A 3SCHA 4MX3A 3KCCA 3HT2A 4TLFA 4LTAA 4XF9A 3ETQA 2Y0OA 4IEPA 2VECA 4ZU4A 1OFNA 3I7DA 4BHPA 3DL3A 1JUHA 5KBFA 5FLJA 4O9EA 4XFAA 1NZCA 4RD7A 5J3UA 1ZREA 3ACLA 1VR3A 1PMIA 1YHFA 3BALA 4IEOA 3SXWA 1WA4A 5I93A 3KGLA 4XETA 1J3QA 4QM8A 1Q5OA 2Q1ZB 4NVPA 3CJXA 3SHRA 3LA3A 4ONUA 3IDBB 2CAVA 3CO2A 5J48A 2D40A 3E5UA 4XF4A 5CADA 5FPZA 4EWEA 3CEWA 4OLLA 2GZWA 3WW1A 4ZU7A 4PIZA 2E9QA 4MGIE 4HVRA 1ZZ9A 2PTMA 4F8AA 1FI2A 1O5LA 4MH0E 2PHLA 1J3PA 1O3SA 2QCSB 4R52A 5JSOA 1YFYA 1UCXA 3H3UA 4QGMA 3H8UA 2PFWA 2IXHA
chains in the Genus database with same CATH superfamily
2ZTNA 1CPMA 5JR2A 4HZFA 2YB7A 3VKLA 5HXMA 3ACGA 5A32B 1VBA1 1JHJA 2XL9A 3SH3A 3ES1A 1ULPA 2KXLA 3TOJA 4B29A 3AP4A 4QDRA 3N9LA 4PHZA 2XLGA 4BYYA 4XDQA 2KA3A 4MVTA 4EZ4A 1PX3A 1YXWA 4UFMA 3ORJA 4RQPB 1MS9A 1K12A 2KR2A 1YFXA 2R063 2ZCWA 3HNYM 4Y1YA 4XF3A 3WR0A 3VBOB 5I91A 3OB8A 5DZFA 1PMHX 4B4RA 4CDUA 1A6CA 5L9RA 5A3MA 1RUE2 2R16A 2VCBA 4M3CF 4AVCA 1YIFA 5F37A 5BYNA 2ZGKA 3OG2A 5EHDA 4AI9A 2IC1A 3C3VA 2P3YA 3FX3A 4QQHA 4O9GA 4HETA 3AKPA 4K1YA 3CL1A 3EMRA 4ET7A 5IUQA 3R4DB 1OF3A 1V00A 3PU8A 4COZA 2HWC1 4BISA 3WQ1A 1EY2A 1ZBE1 4J6GA 4CCKA 2WNUB 1RUD1 4GWIA 5CFCB 4CU6A 4KH9A 3IB3A 3PIJA 5C8CB 2MEV2 4QHZA 3ZSEA 4P9LA 2LRPA 4ASMB 2ZKNA 4K20A 4LUKA 2XHNA 3GZUC 3OEBA 2W5FA 5FAXA 2Z2SB 4FPLA 3FHIB 2VJXA 5D21A 5HBAA 1ZYBA 1RUH2 3VBFA 4Q26A 4QX3A 2RMU1 4PI0A 4SLIA 1ONAA 5JR7B 2VMDA 5KHHA 5F39A 5FZ3A 4CEYA 4Y1UA 2B7YA 2Y6KA 1NLSA 5T52A 1RINA 1RHI1 4AEMA 4CP9A 3UT0A 1FMD1 1VAMA 4N43C 1VRH3 2IXKA 2VZRA 3FC0A 4LE3A 4B4PA 2RM23 4XJUA 3ZYIB 1DQ2A 2I45A 3VD7A 2B5HA 4DRRA 4FFIA 1ND2C 1FOD2 3AMPA 2PHUA 3J8F2 3NSTA 2E63A 3PIGA 4W8JA 3RI8A 1KDKA 3W21A 2C9AA 5FYIA 3ZR6A 1GP6A 2CDPA 5GLUA 3UETA 2AC1A 2XUMA 1UZZA 4DXSA 3W5MA 4AFDA 2OZJA 3OY8B 4DNYA 2RDSA 1H30A 3AC0A 4I2OA 2A1XA 1QJEA 1VBE1 1Y4WA 4QD2A 4XHBA 1SDDB 3JZVA 1KDMA 1JYCA 3I8TA 3N7LA 3ZSKA 4OVEA 1JZ2A 5FYSA 1W0OA 2VW2A 4N7UA 1YQ6A 4M4PA 5DG1A 3ASIA 4OHWA 4IERA 4RR3A 2P37A 2QQLA 5FZ7A 3SEPA 2WWSA 4BMBA 2Q8CA 2ZHKA 1H2MA 3BOPA 2VUJA 2V4AA 3O12A 5FZDA 4IQPA 2XJQA 4A2UA 2XL7A 3PHMA 5A6QA 4MSVA 5FO9B 4B7KA 5A7OA 2WQ4A 3I2HA 4KWLA 4EZHA 2J1EA 1O4ZA 1D4M2 1OPOA 1WMXA 4I3GA 4QMAA 4NPMA 2VVEA 1OLMA 5FRAA 1N47A 4FPJA 5IVEA 1BVP1 1JZ6A 3PUQA 3WDUA 2YU1A 1HDKA 1LOFA 1XBFA 1KFXL 4NHMA 4Q4X3 4FTSA 1C8NA 5L7OB 4IDZA 1AJKA 3IN9A 2IXJA 3KQRA 3PJYA 3THTA 3QH6A 2P3KA 3AJZA 4PDWA 1W6NB 3K75B 5FZ0A 4AEJA 3DPRA 2GC2A 4PF5A 1H8TC 2CYFA 3K4AA 1GKBA 4XUTA 1U12A 3K3NA 2ZS6B 4QPIA 4E4ZA 2DBNA 1QXJA 3LAGA 4AAXA 1UL9A 2ZXQA 5E8AA 1TG7A 2YZ4A 1FPN3 4HPKB 1AX0A 2RJ2A 3KGZA 4CVUA 5M0TA 1LCLA 3DN7A 4GIQA 2DCYA 3WNNA 1ENRA 3C7EA 4DPNA 3VB9A 3AZYA 3D0JA 2AEYA 5FZIA 1IKQA 1NUKA 4J25A 2DCJA 1WGPA 3ZXEA 4NROA 1WLCA 2R041 2WZR3 1NCRB 4K6BA 3GYDA 4OZOA 5JCTA 4HSJA 2VL4A 4YVSA 3WNPA 1ZRDA 2QQOA 3WUDA 2BGCA 5IK8A 3OCPA 2VH9A 2NMNA 2GH2A 4PI2A 2WN2A 2WFF2 3ZO0B 4GJZA 1HQWA 3FZ3A 4NIIA 5J36A 1QKQA 1GFF2 3FLTA 1XOYA 3VZMA 2HWD1 5CKQA 5T55A 1U5ZA 3VHNA 3WP4A 1QJX2 1OH4A 4IE6A 4Z92B 5HCBA 1HQLA 1RUNA 3ZYJB 2WO7A 4LBQA 4QB2A 5EQUA 3E97A 2RR11 3ZYRA 5FYVA 3VBRB 2AR6A 5HCHA 4KU8A 3W58A 1DQ5A 4O7XA 2JKBA 4AVTA 1TME1 1SLCA 4LMFA 1ASJ3 5K0UA 1K45A 3NO8A 4I0BA 5JXIA 3WW3A 1AUYA 3HIFA 3I4IA 3ZKUA 4QQPA 1ZZ7A 3ZYPA 2PAKA 2OUHA 2YPDA 3ABZA 4Q4Y1 4IETA 3WF0A 3ZSMA 4J1WA 1V6KA 2QTWB 3EQEA 1UY0A 4NAOA 3M3QA 2CNAA 2XGXA 4QX8A 1UW8A 5A1LA 4BIOA 3LZZA 1GOFA 2W1SA 2J1TA 1W8ZA 4QPGA 2JDMA 2EXJA 4R9BA 4XYXA 1TQ5A 4NHXA 4R9DA 3RDIA 4XE9A 3ZFFB 3U07A 1BVVA 2W52A 3OBRA 5C4WB 3VKMA 1UIKA 3VZLA 5HV4A 1UX7A 1WKYA 1CX1A 5JOYA 1RUI3 3E1F1 4CDXA 3I3MA 1QJY2 2G4IA 1SHWB 1VRBA 2PHRA 1SCRA 2XBO3 4RFT0 4XBQA 4XMIA 5FP3A 5A1AA 1LR5A 4QX0A 2D7FA 3K2OA 1BEV3 5FUPA 1RTVA 2XVKA 3LQCA 2XONA 1QIQA 5LBFA 3R4UA 4P9XA 2YXSA 3OEAA 3PUAA 4WM8B 3GCXA 1KITA 1T2XA 1W6PA 3RFRA 1HXS1 5GLZA 3TBDA 4QGLA 1CAWB 1MVEA 1N1VA 2H6CA 5EV7A 2XR4A 1ZZBA 3GDBA 1IPJA 1N3QA 1V6IA 2VZUA 3SKVA 2QZ3A 3WW2A 1QWRA 3MF9A 1XNTA 3ES4A 4DMIA 5KXEA 3LDRA 1UYXA 2B45X 2O1QA 4CDUC 3KD4A 3LWCA 1QXRA 3CLPA 2XPJA 5J7MA 4CPBD 3VDBA 2OW4A 3CHXA 4BB3A 5A32A 3ILRA 1SZBA 5DXDA 2C1FA 4YFZA 1HN1A 4FPKA 2CWMA 1LEDA 2WS93 4LPLA 1UAIA 2W95A 3I3DA 4QAWA 1V6MA 1JU3A 3WDWA 4HKLA 4RQPA 5FK7A 5F5QA 2PN5A 3CNAA 4AFAA 4G3YC 2PHTA 1AR82 1X8MA 4R9AA 1GWLA 1TZOA 5FZ1A 5DPNA 2VGDA 1W0NA 3VBOA 1I9RA 1UKGA 3NWKA 2EXIA 3JQXA 4HLTA 2DVFA 3HJRA 5EIYB 1U5IA 4YGCA 5K7PA 4Y26A 1DQ6A 4IE7A 2CDOA 4TSVA 5FV3A 1TMF2 1B35C 2XKPA 4GWJA 4AHWA 4GA9A 2YG0A 2ZABA 5JOWA 1XNCA 4FP3A 4XAAA 1SBEA 1COV3 2JEMA 1SEFA 3H50A 3LEGA 4CXYA 3VBFC 1BK1A 5A80A 3THPA 2VD7A 1MZFA 1PO11 2LUWA 4BXFA 3G7DA 2NMOA 1A3KA 4UWDA 3AL6A 4E4HA 2YDEA 4NAMA 5CFCA 5F6KA 2WNUA 2VMHA 4MGQA 4P5HA 4Q27A 4AF9A 4GQ7A 5C8CA 2JECA 1BQPA 3E5XA 3IDAA 3N7KA 5BY5A 4NWWA 1GNYA 1H2LA 4XURA 3JBG3 1VBB1 5SV5A 2VW1A 3VGIA 4NN0A 4DO0A 1MZEA 5CYYA 1R1ZA 4GB32 4AXOA 1YLLA 3FLRA 4C0HA 4HK9A 1K42A 1GZWB 3JQWA 5F5AA 5FY4A 2R072 3RZZA 1AYN1 1ZZ6A 4XABA 5A3OA 1FV3A 1NX9A 2TEPA 2V72A 2HWF3 3J26N 5EFUA 3RMXA 1WCKA 3ZXKA 4XFFA 2DFCA 4RHV1 3LSEA 5G04L 1JOJA 1UF2C 2HEYF 3NL1A 4L97A 4COUA 1W2UA 3BI3A 4YW5A 1QJU2 4FOWA 2R0FA 3DGTA 3O1MA 5FMDA 2GAUA 4HKOA 2WA4A 2RS53 1VBC3 4C90A 4FAGA 4A7KA 4F7ZA 1C5HA 1C8M3 1K3IA 3OY8A 4ASKA 2UWCA 3RWKX 5LA1A 1SPPB 4UXAA 1HRI3 2ZMKA 1WW4A 3KB5A 4OQ9A 2CWSA 3NV3A 4HN1A 4ZS3A 5FPXA 1GOGA 1QQP1 3MPPG 2MHFA 3OUHA 4OI4A 1PO23 2ETEA 4QXHA 3OTFA 4JVAA 2D6KA 2ES3A 3WX5A 1G86A 1KD7A 2DBIA 4P9YA 1LOFC 5K9YA 4N53B 4B1MA 4AK3A 1GP5A 2ID4A 4KG8A 1V9U3 1AR93 3PTRB 3AYEA 4A45A 3INAA 2P3IA 3N9PA 3F2ZA 1F9KA 3VBSB 4QU1A 1N3PA 2WT2A 3JU9A 4PDWC 2A3YA 4DUVA 4P14A 5KXDA 1QOSA 2R061 2E33A 1OD5A 1YWKA 3NAPA 4QPIC 1FT9A 2GN7A 1HW5A 3LOIA 4A7YA 1NG0A 2G9GA 5FYHA 4QWNA 4D3WA 5KC6A 2EALA 2MPFA 4UBHA 2YHJA 3PUHA 4PLOA 2JDAA 1OBNA 4AHXA 3O7OA 1GOHA 3WP6A 3X29B 3IMNA 3KLSA 4A4AA 5BUVA 4FTEA 3I2JA 4ZS2A 1JN2P 2W08A 3ZR5A 1OA4A 2BZDA 3AP9A 4N7IA 1R083 1HN0A 2VU9A 1OLQA 5IAXA 1LHOA 5DDJ2 1G9DA 4Y20A 5A1FA 3P6BA 4CPBA 1LRHA 2B8MA 5FYUA 2ORZA 1CJPA 4LKDA 3E6BA 1WLTA 4YVSC 1D4VB 4RGAA 3UGGA 4ARXA 3AXDA 1Y43B 1RXFA 1FX5A 3WG2A 1W2OA 2HWE2 4KBBA 4YM2A 1T6BX 4FVVA 5JXHA 5JXGA 1CPNA 5CU1A 4YW6A 1LAJA 3NJVA 3WINE 1AZDA 2WDBA 1OKOA 4BDVB 2LM3A 5FUNA 2AENA 1GP4A 4QXBA 2I74A 1XPWA 3AKSA 2J1UA 2VAUA 4LUMA 5F5IA 5CG9A 1NCRA 3J7LA 3O14A 1V70A 3PVEA 2ZGMA 4AZZA 3O1OA 4NUBA 2HWB2 5A3LA 3Q8BA 2ZA9A 2IWGB 4Q4V3 1E5IA 4FP2A 3TEWA 3MFCA 4XF9A 1PZ9A 1D2SA 1VRH1 2D3RA 2Y0OA 4MXWB 5K0UC 2WA3A 2RM21 1PM4A 3MICA 4R4ZA 1AX1A 4FOQA 5FZFA 3VHOA 3DL3A 1XE0A 4XJAA 4LOTA 1JYVA 1YNAA 5FLJA 1OA2A 3M1HA 1JYIA 3NV1A 2VXJA 4JX0A 3I3EA 1U0AA 4WV8A 3AFKA 4W4ZA 4LQRA 3KZ4C 5DUVA 3LSDA 2OUJA 3T1LA 2ADDA 1W2AX 3VBRA 4QPGC 2R6QA 1C1LA 2B4KA 2ARBA 1L7LA 3TN93 3V56A 2G9ZA 2XJVA 3PL0A 5HXVA 3WLUA 1WA4A 1AJOA 5C33A 4NIGA 1SCSA 1J3QA 3AMHA 5C5TA 2Q1ZB 4BWOA 3AP7A 4NVPA 3OYWB 3VHPA 3CJXA 1MEC2 1OQ1A 2JWPA 4YG3A 2R32A 4IW3A 5E88A 3BPSA 3IDBB 2VOVA 4HT1T 5J48A 5AC92 2D40A 1CVNA 2NQYA 2CL2A 3IIIA 4XF4A 1RJ7A 5CADA 4EWEA 5FZ6A 4OLLA 4LITA 4HVRA 2QQIA 5FTTC 1ZZ9A 2BOIA 2PTMA 2XQRA 5FP8A 1YI7A 4F8AA 5CA6A 3ZFFA 1RJ8A 2J1AA 2WQZC 1VBA2 3H3LA 3K77A 3KT4A 4GZ9A 4H3WA 4GJYA 4MH0E 5C4WA 1YCIA 1CR7A 3LE0A 3VUOA 1US3A 4R52A 2VNOA 1UOGA 3BVCA 4FFHA 2YPJA 2HBTA 3O1PA 4YW4A 1IZ3A 3H8UA 4Q4X1 2AUYA 1W05A 1G9CA 1WLWA 1V6NA 2OQ6A 3PVNA 3I54A 5F8PA 2ARXA 2VTXA 3VBUB 2AZ5A 5CVRA 1SLLA 4M3CA 1JZ7A 5AFEA 1XNKA 3RPQA 3NNMA 2X5IB 3USUB 4XUNA 5EYYA 2Y38A 1SLIA 3N36A 4UAPA 3ZFGB 3ZN6B 1W0PA 5CEHA 4Y4YA 2VG9A 2QVSB 5LASA 4IEZA 3ZN4A 2WN3A 1CAWA 5LZ6A 1W9WA 2PHFA 5E89A 5FMCA 1GZTA 1ZM1A 4LBOA 5EXOA 4LO6B 3LCPA 1DZRA 5GLTA 1UZYA 3WNOA 3ZMOA 1PIV3 1AR63 3OOXA 4CUGA 4DZGA 5JPNB 2JIJA 3VBOC 1HIXA 2BW8A 3RRDA 2HWC2 2XXZA 4WVMB 1ZBE2 2UY9A 2WO2A 4CA9A 2Q4SA 1RUD2 3M2MA 2JKXA 2WZR1 2GC3A 4YZ3A 5J09A 2VQUA 1R1A3 4CP1A 5IVBA 2PQQA 4QQOA 4AWDA 1ZNPA 3R6SA 1TVGA 1E57A 2W1UA 3T2PA 1LU1A 2TBVA 2D3PA 3AP6A 2EAAA 2RMU2 4FT8A 4LO4B 5L9BA 3ZXLA 3GBGA 4V1PA 4XW3A 1G6NA 3GM8A 4UF0B 1UZWA 5T3NA 5CFCC 2WNUC 1Q43A 1RHI2 3QBQA 4PBOA 1DLCA 1H8TA 1FMD2 2P17A 3POYA 5FY8A 2OT7A 4P00B 1PK6C 3GJAA 5LB6A 5FDBA 3T2QA 3AYCA 3HWJA 2C4XA 4Q29A 3IBMA 4BM8A 2B9VA 4E2QA 3HN1A 3GZTB 3PLQA 2UWBA 5CIRA 4RFRB 3WUCA 1J58A 1VAVA 1RXGA 1ASJ1 3L9JT 4Y5SA 4GWMA 4ZKTB 3EB7A 1GR3A 1VBE2 2A5ZA 3D82A 3LPFA 2ZGRA 1JODA 4A3XA 4R8HA 3HNMA 5LRSA 4LLFA 4RGKA 4UFJA 1PNGA 1PGL1 1F15A 1NZIA 2A73B 1OFSA 1LOCA 1UU5A 2ZGOA 4FOVA 4UBGA 1AL23 4XTMA 2NYYA 5FJHA 2RDQA 2O8OA 3A22A 1W8NA 1RITA 2L9LA 1HJGA 1IPSA 3VZOA 1REFA 2YC4A 2FCTA 4MYEA 5A70A 4EJRA 2WKKA 2J1SA 5IVYA 1OD3A 1LOAA 3OBTA 1CAVA 1GZWA 3S7EA 4COYA 1RUI1 4DEVA 2FDJA 1EPZA 1GSLA 2KD7A 2JDYA 2XBO1 2ZX2A 3TNPB 1UIJA 4UFLA 3MW3A 3UKNA 3DCQA 3RQ0A 1BEV1 2HYKA 4XHXA 3WQBA 4DUWA 1FXZA 1D4M3 1DCSA 2K46A 4BJ0A 5F2SA 2Q1MA 1PVC3 2QE3A 5F3CA 3ZLIA 2JG8B 4MGTA 2YFZA 1Y9MA 1BBT3 2ZX3A 2FCUA 5JI7A 4EQVA 1PMJX 1SPPA 3RZGA 4UOJA 3F95A 4CUCA 3I3BA 1AX2A 5L19A 4TZDA 3HMYA 3POJA 2FDFA 4YVWB 4AE2A 3J7HA 3OF1A 5LATA 2XLFA 1MS0A 4YWAA 1EAH3 3T30A 1AXKA 1RUF3 4IEQA 4UFHA 4OMDA 4XJ9A 2ARAA 3C7HA 3N9OA 2ET7A 4META 4EROA 2JE9A 4N53A 4TTGA 2QQMA 4M00A 5L7OC 2W92A 3WDXA 5C71A 3CKHA 4WVZA 5EPAA 2WS91 4XVHA 3O0VA 3H8XA 3E6CC 4AI8A 2CHHA 1RL3A 1X7NA 2VVDA 2R042 2LALA 5JUVA 2DCZA 5FO8B 2P6CA 3VHRA 1JS9A 4KWJA 4BQ2A 1EUUA 4N8MA 4BK5A 3MIGA 3NVCA 4R9CA 1W3XA 2D6LX 3OGGA 3SLIA 1LHUA 2EIDA 2RS33 4NWVA 2WFF3 3HQXA 5T5LA 5FZCA 3WT3A 1UU4A 3KCXA 2HWD2 4S2DA 2XJSA 4XCBA 1KXGA 1COV1 1R093 2KM2A 2NPIA 1NCRC 2H6BA 4LKEA 3ZSLA 2ZGPA 4Y24A 1QJX3 2JG9B 2WAAA 4DXRA 1W04A 3ZM8A 4DS0A 5T54A 4YZ2A 5FZOB 5FCCA 5CKNA 5BNNB 4OUEA 1TME2 2PYTA 5IVJA 3CDZB 4Q0VA 1BCXA 2EICA 1UOBA 3JBG1 1F5FA 1VALA 1WCUA 2QDRA 4HMZA 3PU3A 4HFSA 4HSLA 1RIRA 2ZJCA 4Q4Y2 1PVXA 4BLIA 1XYPA 1CZSA 1RMU3 3BU7A 3WDVA 2WFPA 4U36A 5JVVA 5LEJA 3GGLA 4H55A 4YLZA 1AYM3 4OQ8A 1RUJ2 2RS13 3H42B 2OYZA 3VBRC 4D7YA 5KC5A 1JZ4A 2HWF1 3NNJA 4YYOA 3V65A 2VZ3A 4K8RB 4CCEA 4UW4A 4MXWA 4AW7A 1RUC3 4MXVA 1W6OB 1MACA 4BZ4A 1PK6B 1BLZA 1B35A 1POV0 2LS6A 4JCKA 1X8EA 3L2HA 4LBQD 1QH7A 5JSPA 1DGLA 4YW3A 4CCCA 2RS51 1VBC1 5J96B 2FDIA 2HJIA 1NQDA 3O5SA 4AOCA 4GMP0 4P9IA 3W59A 1HRI1 3LA2A 4QU2A 1ZBA3 3PNAA 4J1XA 4XFHA 1OC1A 2F4LA 5E6HA 3NNGA 3ZFFC 2A6VA 4BXSV 2VXRA 2QJVA 5C4WC 1PO21 1J59A 4LBMA 4RA0A 3N7MA 3I2IA 4FPOB 3OYWA 5I8SA 2BBAA 4E2GA 1XJAA 2IFWA 5LRRA 3ZKYA 4N90A 1CJDA 1LB2A 1LGCA 1UMHA 1AR91 1OUXA 1V9U1 3T1MA 1X36A 3MIEA 1LULA 5C3PA 1C3HA 2EA7A 2IUWA 2DU1A 5B4XA 1JMUB 4Q4W3 1HB2A 2A71A 3USSA 3N9MA 4WM8C 3RZHA 1RUG3 3N3HA 4ATEA 2BFUS 1V6JA 1VP6A 1ND3C 2UY8A 3JD73 5FYBA 1WLDA 1VJ2A 5I0TA 3VBHB 4DRVA 2V5DA 5FREA 1IS5A 1CGPA 4LORA 4GMP3 4LE4A 4DQAA 4JTOA 1D2QA 5LW9A 3HT1A 4CUAA 5FKCA 2PLV3 1CESA 3U78A 1ZZ8A 4KGQA 1S0BA 4OYUA 4ZONA 1LENA 1R081 4AI3A 2V73A 4M0HA 1GWKA 1ENSA 3FMGA 3ZPOA 5FP7A 2A75A 2X5IA 1C28A 4PIYA 1W9TA 4WVVA 1EUTA 1OI6A 2ORXA 3ZFGA 4C1XA 1JYXA 1HJFA 2Q5TA 2IXLA 4WBBA 3OUJA 3U4XA 3BU0A 5FY1A 1Q56A 5FWEA 4L8QA 4QXCA 5JZGB 5HV0A 2FHRA 3TRSB 1UPIA 4UYBA 3H8RA 2GMMA 2WQ8A 1XXNA 2DYCA 5LK7B 4LHKA 1PO12 1OT5A 1NCQC 1OVSA 4NRPA 1QGLA 3ACFA 3RZMA 4KNCA 3LIGA 3U4SA 4WVMA 5A7QA 3U11A 5F9TA 2SLIA 2WSUA 5EZWA 4AEDC 3I2GA 3NJYA 2H0VA 3E5QA 4RS5B 1NKGA 2W9XA 2ZEYA 5A33A 2CAUA 2JE7A 4E2SA 5HCAA 1O5UA 3Q8AA 5LWBA 3H9AA 4NO4A 5JLVA 4V2WA 3WEZA 1VBB2 3BN6A 1UY4A 2GC0A 4Q4V1 4FFFA 2X10A 2IXIA 3GF6A 4EWDA 2XQXA 4FTBA 1WBFA 4FBFA 1ALYA 2V5YA 2FZ2A 1OHFA 3I2DA 4EN0A 1YEWA 3D0SA 4OUMA 4YARA 4UF0A 1AYN2 5JPMB 1X33A 2PHXA 3JCIA 5JOXA 2W2IA 1OPMA 3Q8CA 5BNQA 2ZHLA 5IAVA 3S57A 1QNWA 4RHV2 1OOPB 1ZA4A 1SLAA 2A6ZA 2QQNA 3OJBA 1LOGA 1SLBA 3SH4A 4WVWA 1UO9A 2HBUA 2PA7A 1SBDA 4ZHNA 2WR9A 2WLPA 3B00A 4Z82A 2V09A 1U5XA 2WBKA 1YQ5A 1YQCA 2X09A 3HAGA 1GU3A 1DBNA 2X53S 2VNRA 2GU9A 1DYPA 3UNPA 1QQP2 3POFA 5FZMA 4TLGA 5EP9A 2ZX0A 4NR1A 5H9PA 3BIEA 4XJWA 1IPKA 5F3GA 4CUBA 2GP3A 2HEVF 2ILMA 1WW5A 4Y4RA 5F7UA 4I09A 5BV6A 5DAXA 3O1VA 5FPLA 2UURA 2ZOEB 4Q2FA 2Q1FA 3MIBA 3H1MA 3VLBB 2O8QA 4XJZA 2FMYA 2OX0A 1UU6A 4BH9A 2W39A 1OLRA 5J98B 3ACHA 3MV11 2HKXA 3BCWA 4CU8A 2R062 5KXCA 4N9HA 1MS1A 3ZXDA 4W65A 5F3IA 2WIIB 5LBBA 2ZX4A 5BNPB 1CQ9A 1W9SA 1GLHA 2JG8A 3RYPA 4K9SA 4C0BA 4N53C 2VBDA 4XACA 4HK8A 5EJ3A 3NV2A 3H1YA 3ZN5A 1OUSA 4D94A 1Y9QA 3SMHA 1YRZA 1TNFA 3VBSC 1XSRA 3W9AA 5A3NA 5FR3A 5FLIA 2AGSA 1W9YA 5EJZB 4LBNA 2LTNA 1ULCA 3T4HB 1H8VA 1AXYA 2GDFA 2VZOA 1PIV1 1AR61 3AMQA 1AVBA 1LHNA 4XFBA 4Z07A 5H9RA 3U1XA 2BU9A 2WZPP 4TXWA 4NIDA 4DFSA 3GBWA 2RVAA 2G19A 4CEWB 4AVVA 5ERLA 5FBZA 5A7PA 3RZJA 5LA0A 4I0AA 1ND3B 3LA7A 1CAUB 1R1A1 2WJSA 5A6ZA 2VOKA 5ACA3 2E51A 3A21A 4IUGA 3L2YA 4D7SA 4GH4C 3VKOA 2P6HA 2GNMA 1W06A 2YUEA 2VQAA 4P08A 2DCTA 2WAOA 4LHSA 5I0DA 2IVJA 4DB5A 3OBZA 4OMCA 3VDCA 1AR73 5I8YA 5C70A 2DURA 1OQEA 1JOPA 2ZAAA 3LDKA 2VZPA 3D8CA 2P4EA 1TNRA 3LKJA 2A7AA 3UKTA 3VL9A 1HV0A 1VRH2 2JIGA 4IEXA 4P02B 3MIDA 2RM22 5FXXA 1T6GC 1S4CA 2VTXJ 2W3JA 3WF4A 1NXMA 4JDOA 4BQ5A 4X8NA 1VLNA 1QNYA 5BPXA 4LO8A 1DZQA 4LO7A 4D69A 4MX3A 4OHVA 4ES9A 3KV4A 3HT2A 4TLFA 2JG9A 4JAAA 4AFBA 4BOWA 3WG3A 1NCQB 3WF2A 2BGPA 3IKWA 4IEPA 4QX7A 4A6OA 2C9KA 1O59A 2Q8DA 1OFNA 3WCRA 3ZXGA 2XOMA 5FZOA 5A3UA 4BHPA 3V0BB 4A41A 2ZMNA 5BNNA 4AEDB 5KBFA 1XYNA 3M7AA 4O9EA 1AL21 2BBVA 1OSGA 4D6SA 2O14A 2XWBB 4XTPA 1W9FA 4YFWA 3BTZA 2VMCA 5J3UA 1ZREA 4JHZA 1CWPA 1H2NA 3KVAA 1VR3A 5K4LA 1VB2A 1S1AA 2Y33A 2I2SA 5JIAA 5AC93 1YYNA 3MGUA 4AGRA 5GLVA 2ZGTA 3LB9A 4KQ7A 3LFMA 1H1AA 4UW3A 1EV13 4B8EA 1W6OA 1PK6A 1S0DA 2X8KA 2BWAA 2G9FA 2CAVA 3M8LA 1Q8OA 1VBA3 3QCWA 4FQZA 1F4AA 1PVC1 3E5UA 3I2OA 3APBA 3CEWA 4Q4X2 1BBT1 4ZU7A 4PIZA 2DUQA 1TE1B 4W6YA 5T5PA 1Z0HA 2E7QA 2WL1A 1HRV3 1I5PA 2W1WA 3VDDB 3ZYBA 2W0XA 4CXWA 5CBLA 1Z7S3 1O5LA 1UY2A 3RMYA 2PHLA 1KQRA 2IFRA 2QCSB 3AZWA 4RSUA 1JYNA 3HEIA 1US2A 1YFYA 4QT6A 2BFUL 5IVCA 1ULGA 1D0HA 1YQ8A 1STMA 3MBWA 2J1VA 1EAH1 2A3WA 1GQGA 1RUF1 2VMGA 3H7YA 3ILNA 4KU7A 1CONA 4CYDA 2SBAA 2ENRA 5JWPA 4AGGA 4XF0A 2XMLA 2ARCA 2JICA 4FI9A 3VBUC 2W91A 3O1SA 3WNLA 4B1LA 2HEWF 1DDLA 2A6YA 3HVDA 1Y3TA 4G9SB 4MHRA 5FO7B 5KHIA 5JOZA 2X5IC 1G8WA 3FHQA 1YI9A 1UMIA 3ZFGC 4B4QA 1VMJA 2WZR2 4EV0A 2WC2A 3IZOA 2R49A 2GNTA 3VBHA 4NHKA 4CCLA 3B94A 1K5JA 1E5HA 4WZFA 1D7PM 1DF0A 2BJSA 2NLRA 4XXPA 3Q8EA 4EYUA 3MW2A 2OPKA 2RS31 1YUDA 2WFF1 3ILFA 3K3OA 3AP5A 4DXZA 2VCAA 3B01A 2DWRA 2GN3A 2OPWA 3LF7A 3MI8A 1R091 3SNMA 4IV3B 3NKTA 3T0DA 3THCA 3RI9A 3ZX7A 3S5AA 4HOOA 2DTWA 3SITA 1LJ7A 4DUXA 2JDKA 2D6PA 4TWTA 3T08A 3MF6A 4NPRA 2ZEZA 5JZGA 1ZZCA 4JGYC 4PF1A 4PLNA 1VPHA 4XJ8A 3RYRA 3FL7A 5L7OA 2BNOA 1ASJ2 1OKQA 3DKWA 1J84A 4LR4A 1M4WA 1HB3A 1SFPA 2RDNA 1AL0G 4GH4B 1W6NA 5ANNA 1G9BA 1A8MA 1RMU1 4AL9A 5FJKA 4XFIA 4RS5A 1PGL2 3K46A 3WDTA 1QDCA 1AYM1 5FMOS 4CCDA 3S7IA 2ZGLA 2RS11 5C5UA 5C9AB 4HPKA 4Q0PA 4ORFA 1W8WA 1RUC1 2ET1A 3KWVA 1BXHA 4XZUG 5FQ0B 3BB6A 3ZXAC 3H7JA 2JENA 4MV2A 3KMHA 1MVQA 4HXCA 4IEYA 2YBKA 1YFUA 4WZCA 4QX5A 3SC7X 3FJSA 2WSVA 4FPYA 1GWMA 1RVF3 5J1XA 4FXKB 4H2AA 4FXGB 3IM0A 5APAA 2RDRA 5C3OA 5GJ6A 1UQXA 1BEV2 1GICA 5LA2A 1U5YA 2GALA 3MV01 1W8TA 5LA9A 4CU9A 4OI0A 1ZBA1 4RGGA 1CZTA 2PHDA 4CXXA 3WD5A 2Q30A 1VMHA 5L36A 2ZKLA 3B9CA 3O0XA 1QY4A 1GUIA 4HN0A 2E31A 2DUOA 4UW6A 1W39A 4YZ1A 3BYWA 3KVBA 4EN6B 1DQ0A 1R64A 1S2EA 1IG0A 2BTVC 4WM7B 2QQVA 2VZTA 5GLWA 3T2TA 3VZNA 4CE8A 2PQSA 4AFCA 3WY6A 5DG2A 2VZ1A 5LEKA 4Q4W1 2QKDA 1SFNA 2DCKA 2JG8C 4Z1VA 1RUG1 2ZEXA 2CGNA 3B7MA 4MHUA 4H7MA 4LULA 1JHNA 3JD71 4AVBA 5A3TA 3HR9A 4O65A 4IE5A 1KJRA 1OQDA 2F4PA 2WS92 3ECQA 3IAPA 5FKBA 1O91A 2DVAA 2ZGQA 1EYBA 1W03A 3NRUA 2UYBA 4C91A 2DFBA 1W8HA 2PLV1 2YY1A 4YVWC 1DGWA 1VAKA 1W8UA 3G6JB 3OGJA 1VBD3 4AQTA 5LK5A 3W5NA 2R043 2MNGA 3C2UA 4LHNA 1MZ6A 5DAQA 4DEQA 1DP0A 1JXNA 2P5BA 4CEYB 5BNPA 3WP3A 5I0SA 5J37A 3GHNA 1HB1A 2E32A 3MO4A 1W2TA 3J4UH 4L92A 4RYDA 4L11A 4YM1A 4BQXA 5IK7A 4FO9A 2BNMA 4LKFA 3OPZA 3WDYA 2BERA 4NE9A 2FQPA 3ZDVA 4LNVA 4BLJA 1UYYA 1OF4A 3C7OA 4FQ4A 4Q0SA 1ZRCA 1COV2 1XSQA 2E53A 3BOWA 3TYJA 1H9WA 1ZVFA 2GNDA 3WHTA 3LEMA 4KI5M 3K51A 4S2GA 2WINB 1OMIA 2GH8A 5D2AA 1N1SA 4PCRA 1UY3A 4JQTA 1F5JA 1NA1B 2QDNA 4JKLA 2YU2A 4WM8A 5TSWA 3AKQA 3AZVA 4QX2A 1ND3A 3OGVA 2BP6A 1RUE3 1UYZA 3EXUA 1G9AA 3POSA 3JBG2 2XVLA 1FPN1 5FYYA 4NJ4A 4IESA 4E8DA 5CISA 3HOBA 2ZHNA 3IT8A 5DAPA 1QU0A 1PM7A 4RR3B 4HONA 4M0NA 2JG9C 2WNVB 4RL7A 3WZ1A 4PJYA 3QD6A 4C8DA 3TWIA 2ZZQA 1NYWA 4FFGA 3ZYGA 2HWF2 1J1TA 1RUJ3 2TNFA 3J7NA 5D8AB 3SCGA 3IWZA 5BNNC 1DZTA 2XKOA 3A4UA 3WF3A 3J9SA 1APNA 4I02A 3WHUA 3U14A 3DEMA 3RVHA 1UXXX 3VKFC 2MEV3 5CB7A 4BIFA 1ZRRA 5DUWA 3VD9A 2JDNA 2RS52 1VBC2 3M3CA 4JGYB 3ZDSA 4B3NA 2W94A 5I8TA 3D4KA 4BA6A 1NCQA 1NT0A 1UNBA 2DUPA 2G1MA 1RUH3 4H14A 1HRI2 2JDHA 4N9IA 2XVGA 3V0BA 1UOJA 2YC0A 4AEDA 4URTA 2QNKA 1N3OA 2P34A 1NE6A 3S0MA 2VR4A 2CY6A 3MUY1 3VN4A 1UN1A 2D5HA 4AHYA 2ZACA 2E6VA 4FPHA 2IXCA 2YYOA 3LD8A 4I30A 3BTYA 4XDPA 3UESA 1EPWA 4EN9B 1W28A 3J8F3 1FOD3 4PBPA 4QGNA 2GC1A 1V9U2 1AR92 4QXKA 4W6XA 2D3SA 1YJKA 5FYMA 3WG1A 1FAYA 1AXZA 2FCVA 2EIEA 1ZRIA 1YJLA 1GNZA 1S0CA 3DUIA 5E16A 2Y60A 4YGEA 3VKNA 4OHYA 2NN8A 2DVBA 1ZA7A 1QOTA 2WLQA 4OHXA 4YW7A 5DMYA 4ZXKA 2Q8OA 1GNHA 5IATA 4HG6B 4Y33A 5FZ9A 5I0RA 2XG3A 1LGNA 1WBLA 1D0GA 3O1TA 5KXBA 4MGYE 4AGVA 2YFUA 1DGWX 2ZGSA 3DF0A 1DFQA 4JDNA 4Y22B 4YG0A 4AHZA 2HYXA 1VE0A 3VDDA 1H6YA 1R082 3AFGA 2D5FA 3DYMA 3IPVB 4KWKA 3J7MA 4FPCA 4D6RA 4FAHA 1LHVA 4YZ4A 1S0JA 4Q8KA 3MLLA 4IEWA 3VBHC 1O8PA 2Y0IA 5FPVA 1WD3A 2QZ2A 1J83A 1H4GA 1HV1A 3POEA 1SBFA 5JXJA 1VMFA 4COVA 3VL8A 3TEYA 1GZCA 3M70A 5D1IA 5ACA1 5CFDB 1MS8A 1NY71 2VULA 4OI1A 5BNOB 4MG2A 4QKFA 1E5SA 4HL0A 1EP0A 2Y6JA 2VTFA 2ZMLA 3N9NA 3VZJA 3N9QA 1I6XA 3ZMNA 1AR71 4OI2A 4RN5A 5G05L 5FLHA 4PIXA 3KT7A 4XQ4A 4XUOA 1ULDA 3I59B 1NLQA 4Q4V2 5C8WA 5JZGC 1YQ2A 3H3ZA 2VNVA 1NOVA 2C6SA 4F3JA 1M06G 1SLTA 2PHWA 2DTYA 3MFAA 1HKDA 5T5JA 5A6XA 2ZPXA 4I01A 4CRQA 3N4MA 3ON7A 3EO6A 3VBSA 1H0BA 1ENXA 1S0IA 3NQHA 4HVOA 3WCSA 3GZAA 4OCTA 4RS5C 4AQ6A 1QOOA 3M3IA 3NKGA 4GXLA 5FMOL 3WNXA 3MEPA 4NHLA 1SACA 1XRUA 3CJIC 2XJRA 1C57A 3JXSA 3U10A 1ODNA 2EIGA 4L0PA 2OKXA 4CDWB 4D0QA 4Z2AA 5FY0A 2WYFA 1YO8A 1XU2A 4GKXA 3B93A 3VV1A 1RUOA 3ZIWA 1W8FA 2J7MA 1W6PB 4GH4A 1XE8A 2JB4A 5FZEA 3POWA 3KHCA 1IGOA 3N7JA 1DGRA 1URXA 5K8SA 1OOPC 3KQ4B 4CZSA 3QLQA 3I2KA 4P5YA 5FXZA 4PQQA 2EIBA 5I0UA 2RR12 5AC91 5C9AA 5DAWA 5IFPA 3AYAA 5IYYA 1V6LA 1IQAA 5A7SA 1NAEA 1CIWA 1QF3A 1REEA 1ZRFA 2Z79A 2WABA 1EV11 3NNLA 1X9TA 5FQ0A 5JIUA 4XOGA 1PZ7A 3JUUA 4QKNA 5FZBA 1CAXB 2XLAA 3NJZA 4LHLA 1CX4A 5FY9A 2BQPA 1HRV1 5GZDA 3DKQA 3AXEA 3ZXJA 2OQ7A 1Z7S1 4JRLA 1UZ0A 5C3SA 4Y5TA 1QDOA 2OZ6A 3NJXA 4BU2A 3RJRA 3FLPA 4ZU5A 3SISA 1XC6A 3FBYA 3EBRA 4I0WB 5A6YA 1LOEA 1SDWA 4BMEA 3AKRA 4IE4A 4GAZA 3K48A 3TB0A 2P3JA 2VOXA 3AX4A 3OBAA 3KV5A 3MLKA 4WM7A 4YGBA 4A7ZA 1C8M1 1UKRA 3E6DA 1PIV2 2XDVA 1QJY3 1IHMA 4L2NA 1AR62 1LOBA 2F6BA 1RGSA 1XQNA 1ACCA 2NM1A 1Q8QA 3DECA 5DUXA 4E9KA 5BNPC 3Q8FA 1LEMA 2EXHA 5L73A 4EN7B 2FD8A 5KWRA 1R1A2 4XIOA 1HXS2 1DHKB 3ACIA 3AYDA 4JTNA 4S2FA 3RNSA 5AFBA 1CN1A 4IXLA 4Y1XA 2BVBA 1WD4A 3RSJA 4URAA 2D6NA 4IV1B 4AG4A 4X8PA 2PMWB 2CGOA 3ELNA 4CEWC 3S6PA 3PVBB 1JOBA 1F31A 3ETPA 3I97A 1POV3 5F6LB 5F3EA 2B9UA 4Y1ZA 1O8SA 1KFUL 2D6OX 2WT0A 2JDUA 3PUSA 1RYYA 3B3QE 1DGRN 3KF5A 4MLOA 1BZWA 2C0ZA 4JZRA 2DU0A 1W90A 2AREA 4K8FA 4AAPA 3VBUA 3I2FA 4D6QA 2J42A 1V0AA 4G4FA 1BMV1 5AVPA 1UOFA 3SH5A 3WW4A 1NA1A 1AR83 4K21A 4CSWA 4JGZB 4JHTA 3USUA 2Y8KA 3MUZ1 1WUVA 4CCOA 3PDQA 5GM0A 5GZEA 5A3WA 4Y5Z0 3ZN6A 1OXCA 2Z69A 1AL22 3RJ2X 3AVSA 4UT5A 3CMGA 5GKAC 2WUHA 4UW5A 2WWUA 3TAYA 5GZCA 3ETQA 1TMF3 1C5IA 1PGW1 1S0GA 4DIQA 3VD4A 3QH7A 4LT5A 1C4RA 4ISRA 3H8OA 1GQPA 2WNVA 1K5MB 3TEZA 3GZEA 1QHDA 1CIYA 1HLCA 1JUHA 1VIWB 3M3EA 4QB6A 5FYTA 4XFAA 1NZCA 3LPGA 4AQSA 4RD7A 3FHAA 3P5BA 1W99A 3KV9A 4LKSA 5D8AA 5GZGA 1RVF1 4QQ2A 3ACLA 5CNAA 4SBVA 1L7QA 5T50A 5CG8A 3NAPB 4LBKA 5HPOA 3W20A 3OSDA 3T2OA 1PVC2 3BALA 4IEOA 1DU3D 3SXWA 4PQ9A 3KF3A 4AI2A 3CJIB 3FBMA 3KGLA 4GD4A 4JGYA 1BBT2 4A42A 4BQ3A 5I93A 1Q5OA 5F5CA 3C8XA 3GJBA 3ZOIA 5FP9A 4XILA 4GB33 3ZFEB 1F8VA 1CD3G 4ONUA 1UPSA 2R073 3CO2A 4Y20B 1GANA 2W47A 4B7EA 2NP0A 3MLJA 1SG3A 4LO5B 1AHSA 1MQTB 5FPZA 1W6QB 2GZWA 3WW1A 1EAH2 1P8JA 1RUF2 4MGIE 1W2NA 2O0OA 5DABA 3PUIA 3ZSJA 1WW6A 3EYPA 3ITQA 1UX6A 1FI2A 1UZVA 4UFIA 1QJU3 5AVAA 3TN91 3LGRA 3UYJA 1XU1A 2XH6A 1J3PA 2Y6FA 3PMSA 2AYHA 4K40A 3VDDC 2ZEWA 2UWAA 3OUIA 1UCXA 3H3UA 4BQ1A 2ZBJA 2A6WA 1HQNA 3AJYA 5DUUA 4CCNA 1QH6A 2GP5A 2QFEA 4XZPA 3U37A 5E1RA 1VBD1 1J1LA 4F83A 4QKBA 2P2KA 3D6EA 1GQHA 1GZ9A 1LU2A 4KL1A 3CF6E 4AQ2A 4Q0UA 2R7EB 3POBA 3KS7A 2ZHMA 4LJHA 1JI6A 3MPBA 4K3UA 4Q1RA 5IJRA 5FOBB 2VM9A 4Y22A 4DY3A 2RV9A 1A78A 2RS32 2EF6A 4CCJA 4XEZA 3IPVA 1MR5A 2J1RA 4UI9L 1WZXA 2CU5A 1R092 4ATFA 4K1ZA 4LIUA 4H7LA 2OIIA 2W87A 3FUQA 1BYHA 4PLMA 4A3ZA 2EXKA 2JB8A 3DYOA 4AFMA 4CDQC 3FWEA 3UKVA 4UFKA 4P9JA 1PHMA 4YSFA 1E5RA 1JW6A 1RUE1 5CFDA 3BUCA 5BNOA 4Q0QA 1TEIA 2RE9A 2VMIA 5FP4A 4M01A 4MGZE 3BKZA 3VZKA 4IV3C 1RMU2 1SMVA 5DDJ3 4IGPA 4YVWA 4BQYA 2BPA2 1JYWA 3OPWA 1AYM2 2LW8A 4P9WA 2I07B 2RS12 4CCMA 2OXBA 4AR2A 3I59A 1RUJ1 1QEXA 2V4VA 2HWE3 4LA3A 5FWJA 1RUC2 2BYVE 5LBCA 1Q8PA 3BTXA 4IGQA 1G7YA 4N43B 2VOTA 2MEV1 4L99A 5H9SA 1WCQA 4XFCA 1PGSA 4MZUA 2XWJB 1IKPA 2E26A 3SEEA 5IT6A 5IK5A 4XFGA 5ABJC 2ERFA 1ND2B 2WO1A 3A7QA 3HBKA 4QX1A 5KHGA 1RUH1 1XYOA 3S30A 5C9AC 1O7FA 1ZBA2 4R4XA 1XNBA 4M3CB 1YFWA 2HWB3 1GBGA 3R0RA 1Q8VA 4CDWA 2CTVA 2R0HA 1LGBA 3QACA 4LEJA 5H9QA 5HI0A 3V64A 1F4HA 4CP0A 1IS3A 3ME2A 3WNMA 4MADA 5FOJB 4XMAA 1H9PA 1W6MB 1Y9GA 4QPWA 1KS5A 3J8F1 1FOD1 1C1FA 2RJKA 3AK0A 5L9VA 2GSYA 1BJQA 4IE0A 4OULA 5FZ8A 3ZYFA 1LESA 3HBZA 4L9BA 4XXAA 3IDEA 4DOUA 1XE7A 4Q4W2 4AVAA 5ANQA 5FPUA 2WNOA 1RUG2 3OGSA 5KHJA 4M3CE 1JH5A 3JD72 4BCUA 4MUVA 4ISQA 2WT1A 2JE8A 3LEIA 1WW7A 5LY1A 1CAXA 3EJKA 5FMBA 3IMMA 2PLV2 3OD0A 2OVUA 2YROA 4WM7C 5IWFA 2WO3A 1MEC3 3AZXA 4NRQA 1F2NA 4FOYA 2HH9A 2Y6HA 1B09A 2Z4FA 2VUAA 4DXTA 4E4DX 3POGA 1KGYA 4LLOA 4I3PA 4LXLA 3GCWA 3SQOA 5IK4A 2P1BA 1H8TB 1FATA 1JU4A 3IAQA 1D4M1 3T0AA 3C7FA 1OA3A 3WP5A 2AH2A 3UL2A 4CP2A 4NPLA 2VUCA 3NV4A 3I49A 3O0WA 2BGOA 4Q5OA 1JZ5A 3B5LB 3RZKA 4XDOA 1ULOA 4JV4A 3WQ7A 2D44A 3IIAA 1A34A 2AACA 2E7AA 1MS4A 2R1BA 3AKTA 4ZY9A 4CEYC 5JAXA 2ZGNA 3T3YA 5LY2A 4FPEA 4W6WA 4E27A 2VE1A 3DXTA 2VW0A 2YV8A 5FZHA 4XC9A 1A8DA 4OUSA 4HKWA 2N7GA 1N1YA 1FPN2 4FCAA 2Z42A 3OGRA 4Y3OA 4BPZA 1NE4A 2PAMA 1FNZA 2JD9A 2YGLA 1W8OA 3AMNA 2J22A 4X6QB 4NIAA 4IV1A 3URFA 1O4YA 3T0BA 4KWUA 1NA1C 1J3RA 1HB4A 1L3JA 2Y34A 1CAVB 4NIHA 3WOGA 1ZX5A 2HWC3 4HANA 4EN8B 1X50A 1ZBE3 2QUOA 1IS4A 5FXWA 5EJ1B 1QXPA 1RUD3 2XJTA 4JKMA 1LTEA 3UV9A 2JJ6A 4EE2A 3N35A 4MOAA 3WF1A 3BTAA 3K4DA 1LKNA 1H1IA 3PJQA 4RR3C 4CDQB 4D8MA 4XUQA 1QJZA 1HX6A 2K0GA 2WNVC 2R30A 4GULA 4OFGA 2PELA 5EWSA 3ENRA 4EWAA 1H6XA 5FZAA 5C6CA 1POQA 4YZ5A 3KM5A 2RMU3 2DVGA 2LROA 2WNEA 3H1WA 3QOPA 4JGZA 5D8AC 1S0FA 3RYKA 1NLRA 4NHYA 5FZKA 3TNQA 2FDGA 5BXXA 1CZVA 1ODMA 1QJX1 1RHI3 2K9ZA 2RHPA 3AM2A 1FMD3 2BOJA 2VBBA 5C3QA 2FDKA 1DQ4A 1GV9A 1V6OA 3GHMA 3MW4A 1DYKA 5A7WB 3IDCB 4XCAA 4XBLA 5FFOC 3PTYA 2D98A 5IFTA 1UXZA 1K5MA 2BWCA 3D5OA 5FXVA 5JSRA 1BKZA 3WQ0A 4AVSA 2D97A 4YW2A 3NW4A 4KMQA 4TYSA 4U2AA 3I3QA 4YPJA 5FK8A 4ZZ8A 1PZ8A 1VBE3 2DV9A 2A6XA 3DPRC 3R4SA 1DG6A 4IL7A 5ABJB 3CU7A 2WZEA 2JD4A 2GMEA 4XQDA 2BDRA 3KV6A 5IW0A 2WWJA 4E4SA 3V0AB 1WA6X 4YNIA 3OD4A 1AF9A 2C26A 1DLLA 3TEXA 2CGPA 3CJIA 1X9PA 5C3RA 4TN7A 5KHKA 1PNFA 1UYPA 1GMMA 2OS2A 3S5QA 2QQWA 1S2BA 3AL5A 4Y1VA 5FIXA 2RJLA 2BV4A 1RUI2 3ZFEA 2VCCA 4INDA 4QHBA 2Y64A 4ZXEA 2Z5WA 2JDZA 2IZWA 4YGDA 2Y6GA 2XBO2 3VDAA 4KG0A 1MQTA 3BODA 2PXJA 1W6QA 4LOSA 1OOPA 1QJY1 4BQWA 5DAVA 3PURA 1REDA 4XAEA 2QQJA 1I5ZA 3AZZA 3OPTA 4LK6A 1O3TA 3P3PA 1I3HA 2BVVA 2DDUA 2PAEA 1JYTA 4DY5A 4CDUB 2VBPA 3FE5A 1X82A 3AMMA 5HCFA 4E8CA 5ACA2 4GWNA 1NY72 4OHZA 3PVOA 4A44A 2VOWA 5JDBA 1PX4A 1ENQA 2JXAA 3LFIA 4ASLA 2ATFA 2EVXA 1W3VA 2YMZA 3GALA 2ZAHA 1AR72 4P9GA 2YBPA 2VCMA 2QBXA 3MDPA 5LCWL 2BRTA 1MZ5A 3WVJA 1POV1 2VZSA 4NRMA 1OURA 2C5DA 3HN3A 2GMPA 5FZ4A 5FZLA 5CFDC 3U0ZA 5BNOC 4JC1A 4QB1A 3BPZA 1H1MA 2TUNA 2A3XA 3K4ZA 4XIKA 5A7NA 1L7RA 5IVFA 4GMP1 3AB0A 1B35B 1SFYA 1O3QA 4QDQA 3O1UA 3LIHA 3MZHA 3HQUA 5JI9A 5F1RA 2R1DA 3WSOA 1KS4A 3VBFB 1JZ3A 4D7TA 1AR81 2NZ9A 1WCSA 4FPFA 3B9IA 4HVQA 1IOAA 4CP9B 3FFQA 2CV6A 3HD8B 1ST8A 4OZXA 5DZEA 4KBZA 3U75A 2QQKA 3A0KA 1TMF1 2YGMA 1FNYA 2D93A 4ARYA 1S0EA 2HWD3 2UU8A 2XB6C 2H0BA 4IEUA 4CDXC 2DF7A 3HNBM 3ROUA 5C7GA 4IEVA 4YM0A 4BQ4A 3Q9OA 4QQLA 1BHGA 2XHKA 5FBJA 1JZ8A 5GALA 1IG3A 4AI1A 3R05A 3DV8A 3DYPA 1IS6A 4CEWA 2RR13 2VVFA 1H4HA 4CDWC 3VD5A 4QM9A 5FY7A 1EV12 3KSCA 4S2HA 1CAUA 4YG6A 2X29A 4QHOA 1TME3 2RG4A 4N43A 4BK4A 3GBFA 3FUOA 4JQRA 5FPBA 2OA2A 2XUEA 3JB4C 4ITCA 1XNAA 5IHRA 3HQRA 1BK0A 4HBNA 1WWYA 1ND2A 2E7TA 2VC9A 3C7GA 1S2KA 2Y6LA 4JDMA 4M4RA 4Q4Y3 1FV2A 4XUPA 3B02A 1HRV2 3M3OA 4GB31 1KEXA 1O4TA 1YIPA 1Z7S2 2Y26A 4MGKE 1F35A 2WZ8A 3UJQA 2R071 1KRIA 5EYXA 3NNFA 3CZUA 4ES8A 1FYUA 3MIFA 3ALQA 1O3RA 1UD1A 4KGGA 2W68A 1W6MA 4YW1A 1DQ1A 1QJU1 3UGFA 3A0NA 2B39A 1VB4A 4AYUA 1DYOA 1C8M2 3FN9A 4K7JA 4RQPC 1YC61 5FUIA 3RZLA 4MGSA 4LK7A 3UGHA 3ZYHA 4PT6A 2JX9A 1I1EA 4A6SA 4V2VA 4PDWB 4YRDA 5FYCA 3KCYA 2C24A 3DPRB 3MYXA 3P1IA 2BEOA 1ULEA 2QQUA 3B69A 4NMIA 2VPVA 1PO22 5A33B 2ADEA 1ULFA 4QPIB 4YM3A 4Z8BA 1H2KA 1HXS3 4JKKA 3ST7A 3RGBA 5CZKA 3T4VA 4XF1A 1OLME 2D6MA 1G9FA 1LODA 1LECA 1WMDA 1XB9A 3AVRA 4MO3M 4COWA 2VY0A 5FPAA 1Q3EA 5CAZA 2FDHA 1KJLA 2W46A 4DINB 3THDA 4JRAA 4XBNA 5KR7A 4AI0A 3RG0A 4C1WA 5B2GB 4ZZ5A 3PMEA 1LHWA 5C8CC 4YVSB 5F2WA 5A3PA 3CZJA 1LNSA 1SQ4A 3LDBA 3ATGA 2BUKA 3BIWE 3GNEA 3RS6A 5SV8A 2Q0AA 4NOTA 1JBCA 4IV1C 1BMV2 1O6UA 2YBSA 3UJOA 1QJFA 3LEKA 3VD3A 2FMDA 3WXPA 2IVIB 4Z2WA 4XQWA 5DDJ1 1N1TA 3EHKA 2UYAA 3NMBA 5GZFA 5T5OA 4FSJA 3A23A 1RB8G 3ZVXA 5DZGA 2D43A 2ZGUA 4AEKA 5DN2A 2VMEA 3SCFA 1WMEA 2AEZA 5ISLA 5FYZA 4LBQB 2EAKA 1PGW2 2BNNA 2VQ0A 5LBEA 2B42B 2HWE1 1RC6A 4X6RB 3CBNA 3BGAA 2VO5A 1MS3A 1WCDJ 4LA2A 3SCHA 3WV6A 5K0UB 1PO13 1UWWA 5DQ0A 1UMZA 3KCCA 5JMOA 4JGZC 4LTAA 3ZXFA 5IVVA 2VZVA 4Q8LA 4ZPIA 1RVF2 1Z78A 2HLEA 2VECA 2A70A 4QDSA 4ZU4A 1MPXA 1OVPA 3D3AA 2ZZJA 1S55A 3I7DA 1JTZX 2WYSA 3POIA 1NQJA 4Q1PA 3CQOA 3WG4A 2HWB1 2VZQA 2B46X 4CDQA 5FZGA 2FBEA 5FY5A 1VBB3 4LBLA 5B4NA 4QPGB 1K5MC 2DVDA 4FPGA 3RWNA 3SKJE 3CIHA 4GKYA 3GXUA 3O1RA 4LIVA 4O61A 4BE3A 2CSGA 2VMFA 2YC2A 3P3NA 1PMIA 4IV3A 4LBJA 5F32A 1YHFA 2GNBA 1GYKA 2VUDA 1AYN3 3UK9A 3M4FA 4CU7A 1Q8SA 4CDXB 2Q8EA 2W1QA 4XETA 3ZPYA 3LOBA 1UY1A 4QM8A 3KT1A 3NAPC 2ZX1A 2VQTA 4IGOA 4RHV3 3HPNA 4QPYA 4XPVA 2VNGA 3KHBA 5A7WA 3SHRA 3TN92 3LA3A 3DXUA 4CTEA 5CKMA 3MHZA 1QMJA 3MIHA 4GALA 1DIWA 1NXD1 3T09A 2K2SA 2X05A 2XJPA 1OH3A 2F17A 3JB8A 3ZFEC 2FZ1A 2E9QA 3H0OA 1IQDC 3ZIXA 5ABJA 2QQPA 1MQTC 1MEC1 1MS5A 1VBD2 2JDPA 3FFZA 1Y7BA 2WRAA 1QQP3 1O3SA 5JSOA 1WMFA 3WNKA 5JMCA 3V0AA 1XNDA 4W50A 2XJUA 4QGMA 4QKDA 1JUIA 2PFWA 2IXHA
chains in the Genus database with same CATH topology
2ZTNA 1CPMA 4HZFA 3VKLA 5A32B 1VBA1 2XL9A 3SH3A 3ES1A 3TOJA 2KXLA 4B29A 3AP4A 2XLGA 4BYYA 4XDQA 2KA3A 4MVTA 1YXWA 4RQPB 1MS9A 2R063 1YFXA 2ZCWA 4Y1YA 4XF3A 3WR0A 3VBOB 5I91A 5DZFA 4B4RA 4CDUA 1A6CA 5A3MA 1RUE2 2R16A 4M3CF 4AVCA 1YIFA 5BYNA 2ZGKA 2IC1A 3C3VA 3FX3A 4QQHA 4O9GA 4HETA 3AKPA 4K1YA 3CL1A 5IUQA 3R4DB 4COZA 1V00A 2HWC1 3WQ1A 1EY2A 1ZBE1 4J6GA 5CFCB 2WNUB 1RUD1 4KH9A 5C8CB 2MEV2 3ZSEA 4P9LA 4ASMB 2ZKNA 4K20A 4LUKA 5FAXA 3GZUC 2Z2SB 4FPLA 3FHIB 5HBAA 1ZYBA 1RUH2 3VBFA 4Q26A 4SLIA 2RMU1 5JR7B 5KHHA 1ONAA 4CEYA 4Y1UA 2B7YA 1NLSA 5T52A 1RINA 1RHI1 4AEMA 1FMD1 1VAMA 4N43C 1VRH3 2IXKA 3FC0A 4LE3A 4B4PA 2RM23 4XJUA 3ZYIB 1DQ2A 2I45A 2B5HA 4DRRA 1ND2C 1FOD2 3AMPA 2PHUA 3J8F2 3NSTA 2E63A 3RI8A 1KDKA 2C9AA 5GLUA 2XUMA 1UZZA 4AFDA 2OZJA 3OY8B 4DNYA 1H30A 4I2OA 1VBE1 4QD2A 4XHBA 3JZVA 1KDMA 1JYCA 3I8TA 3N7LA 3ZSKA 4OVEA 1W0OA 2VW2A 4N7UA 5DG1A 3ASIA 4OHWA 4IERA 4RR3A 2P37A 2WWSA 4BMBA 2ZHKA 1H2MA 3BOPA 2VUJA 3O12A 4IQPA 2XJQA 4A2UA 2XL7A 3PHMA 4MSVA 5FO9B 4B7KA 2WQ4A 4KWLA 1O4ZA 1D4M2 1OPOA 4I3GA 4QMAA 5FRAA 2VVEA 1N47A 4FPJA 1BVP1 3WDUA 1HDKA 1LOFA 4NHMA 1KFXL 4Q4X3 4FTSA 1C8NA 5L7OB 1AJKA 3IN9A 2IXJA 3KQRA 3PJYA 3THTA 3QH6A 2P3KA 3AJZA 4PDWA 1W6NB 4AEJA 3DPRA 2GC2A 4PF5A 1H8TC 2CYFA 1GKBA 1U12A 2ZS6B 4QPIA 4E4ZA 1QXJA 3LAGA 1UL9A 5E8AA 2YZ4A 1FPN3 4HPKB 1AX0A 3KGZA 1LCLA 3DN7A 4GIQA 2DCYA 1ENRA 4DPNA 3AZYA 3D0JA 1IKQA 2DCJA 1WGPA 3ZXEA 1WLCA 2R041 2WZR3 1NCRB 4K6BA 3GYDA 5JCTA 4HSJA 4YVSA 1ZRDA 3WUDA 2BGCA 5IK8A 3OCPA 2VH9A 2NMNA 2GH2A 2WFF2 3ZO0B 1HQWA 3FZ3A 5J36A 1QKQA 1GFF2 3FLTA 3VZMA 2HWD1 5T55A 1U5ZA 3VHNA 3WP4A 1QJX2 4Z92B 5HCBA 1HQLA 1RUNA 3ZYJB 4LBQA 3E97A 2RR11 3ZYRA 3VBRB 2AR6A 4KU8A 3W58A 1DQ5A 2JKBA 4AVTA 1TME1 1SLCA 1ASJ3 5K0UA 4I0BA 3NO8A 3WW3A 1AUYA 3HIFA 3I4IA 4QQPA 1ZZ7A 3ZYPA 2PAKA 2OUHA 4Q4Y1 4IETA 3ZSMA 4J1WA 1V6KA 3EQEA 3M3QA 2CNAA 2XGXA 1UW8A 4BIOA 3LZZA 4QPGA 2EXJA 4R9BA 4XYXA 1TQ5A 3RDIA 4R9DA 4XE9A 3ZFFB 3U07A 1BVVA 2W52A 3OBRA 5C4WB 3VKMA 1UIKA 3VZLA 5JOYA 1RUI3 4CDXA 1QJY2 2G4IA 2PHRA 1SCRA 2XBO3 4RFT0 4XBQA 4XMIA 1LR5A 2D7FA 1BEV3 1RTVA 2XVKA 3R4UA 4P9XA 2YXSA 4WM8B 1KITA 1W6PA 1HXS1 5GLZA 3TBDA 4QGLA 1CAWB 1MVEA 1N1VA 2H6CA 5EV7A 1ZZBA 1IPJA 1N3QA 1V6IA 2QZ3A 3WW2A 1QWRA 3MF9A 3ES4A 4DMIA 5KXEA 2B45X 2O1QA 4CDUC 3KD4A 3LWCA 1QXRA 3CLPA 2XPJA 5J7MA 2OW4A 5A32A 3ILRA 5DXDA 2C1FA 4YFZA 4FPKA 2CWMA 1LEDA 2WS93 1UAIA 1V6MA 3WDWA 4HKLA 4RQPA 5F5QA 2PN5A 3CNAA 4AFAA 4G3YC 2PHTA 1AR82 1X8MA 4R9AA 2VGDA 3VBOA 1I9RA 1UKGA 3NWKA 2EXIA 3JQXA 4HLTA 2DVFA 1U5IA 4YGCA 5K7PA 4Y26A 1DQ6A 4TSVA 1TMF2 1B35C 2XKPA 4AHWA 4GA9A 2ZABA 5JOWA 1XNCA 4FP3A 1SBEA 1COV3 2JEMA 1SEFA 3H50A 3VBFC 1BK1A 3THPA 1MZFA 1PO11 2LUWA 3G7DA 2NMOA 1A3KA 2YDEA 5CFCA 5F6KA 2WNUA 2VMHA 4P5HA 4Q27A 4AF9A 4GQ7A 5C8CA 2JECA 1BQPA 3E5XA 3N7KA 5BY5A 4NWWA 1H2LA 3JBG3 1VBB1 5SV5A 2VW1A 3VGIA 4NN0A 1MZEA 1R1ZA 4GB32 4AXOA 1YLLA 3FLRA 4C0HA 4HK9A 1GZWB 3JQWA 3RZZA 2R072 1AYN1 1ZZ6A 1I1EA 1FV3A 2TEPA 3RMXA 5EFUA 2HWF3 3J26N 3ZXKA 1WCKA 4XFFA 2DFCA 4RHV1 3LSEA 1JOJA 1UF2C 2HEYF 3NL1A 4L97A 4COUA 1W2UA 4YW5A 1QJU2 4FOWA 2R0FA 3DGTA 2GAUA 4HKOA 2WA4A 2RS53 1VBC3 4C90A 4FAGA 4A7KA 4F7ZA 1C5HA 1C8M3 3OY8A 2UWCA 4UXAA 1HRI3 2ZMKA 1WW4A 3KB5A 2CWSA 3NV3A 4HN1A 5FPXA 1QQP1 3MPPG 2MHFA 4OI4A 1PO23 2ETEA 3OTFA 4JVAA 2D6KA 2ES3A 3WX5A 1G86A 1KD7A 4P9YA 5K9YA 1LOFC 4N53B 4AK3A 4KG8A 1V9U3 1AR93 3AYEA 3INAA 2P3IA 1F9KA 3VBSB 1N3PA 2WT2A 3JU9A 4PDWC 2A3YA 5KXDA 4P14A 1QOSA 2R061 1OD5A 1YWKA 3NAPA 4QPIC 1FT9A 2GN7A 1HW5A 3LOIA 4A7YA 1NG0A 2G9GA 4D3WA 5KC6A 2EALA 2MPFA 4UBHA 2YHJA 4PLOA 4AHXA 3O7OA 3WP6A 3X29B 5BUVA 3IMNA 3KLSA 4FTEA 1JN2P 2W08A 1OA4A 3AP9A 4N7IA 1R083 2VU9A 1G9DA 1OLQA 1LHOA 5DDJ2 4Y20A 1LRHA 2B8MA 1CJPA 3E6BA 1WLTA 4YVSC 1D4VB 4RGAA 3AXDA 1Y43B 1FX5A 3WG2A 2HWE2 4KBBA 4YM2A 4FVVA 1CPNA 5CU1A 3WINE 1AZDA 2LM3A 2AENA 2I74A 3AKSA 4LUMA 5CG9A 1NCRA 3O14A 1V70A 3PVEA 2ZGMA 2HWB2 5A3LA 2ZA9A 2IWGB 4Q4V3 4FP2A 3MFCA 4XF9A 2Y0OA 1D2SA 1PZ9A 1VRH1 2D3RA 4MXWB 5K0UC 2WA3A 2RM21 3MICA 4R4ZA 1AX1A 4FOQA 3VHOA 3DL3A 4XJAA 1YNAA 5FLJA 1OA2A 3M1HA 1JYIA 3NV1A 1U0AA 4WV8A 3AFKA 3KZ4C 5DUVA 3LSDA 2OUJA 3T1LA 3VBRA 4QPGC 2R6QA 1C1LA 2ARBA 3TN93 3V56A 5HXVA 2XJVA 3WLUA 1WA4A 1AJOA 5C33A 1SCSA 1J3QA 3AMHA 2Q1ZB 4BWOA 3AP7A 4NVPA 3OYWB 3VHPA 3CJXA 1MEC2 1OQ1A 4YG3A 2R32A 5E88A 3IDBB 2VOVA 4HT1T 5J48A 5AC92 2NQYA 1CVNA 2D40A 2CL2A 4XF4A 1RJ7A 5CADA 4EWEA 4OLLA 4HVRA 5FTTC 1ZZ9A 2PTMA 4F8AA 5CA6A 1YI7A 3ZFFA 1RJ8A 2WQZC 4H3WA 1VBA2 3KT4A 4MH0E 5C4WA 3VUOA 1YCIA 1CR7A 4R52A 2VNOA 2YPJA 4YW4A 1IZ3A 3H8UA 4Q4X1 2AUYA 1G9CA 5IK5A 1WLWA 1V6NA 3PVNA 3VBUB 3I54A 2ARXA 2AZ5A 5CVRA 1SLLA 4M3CA 5AFEA 1XNKA 3RPQA 2X5IB 3USUB 5EYYA 2Y38A 1SLIA 3N36A 3ZFGB 3ZN6B 1W0PA 4Y4YA 2VG9A 2QVSB 4IEZA 3ZN4A 1CAWA 2PHFA 5E89A 1ZM1A 4LBOA 5EXOA 4LO6B 3LCPA 1DZRA 5GLTA 1UZYA 3ZMOA 1PIV3 1AR63 5JPNB 4DZGA 3VBOC 1HIXA 2BW8A 3RRDA 2HWC2 4WVMB 1ZBE2 2UY9A 2Q4SA 1RUD2 3M2MA 2WZR1 2GC3A 4YZ3A 5J09A 4CP1A 1R1A3 2PQQA 4QQOA 4AWDA 1ZNPA 3R6SA 1E57A 1LU1A 2TBVA 2D3PA 3AP6A 2EAAA 2RMU2 4FT8A 4LO4B 3ZXLA 3GBGA 4V1PA 4XW3A 1G6NA 5T3NA 5CFCC 2WNUC 1Q43A 1RHI2 3QBQA 4PBOA 1H8TA 1FMD2 2P17A 3POYA 1PK6C 5FDBA 3AYCA 3HWJA 4Q29A 3IBMA 4BM8A 4E2QA 3HN1A 3GZTB 3PLQA 2UWBA 5CIRA 3WUCA 1J58A 1VAVA 1ASJ1 3L9JT 4GWMA 4ZKTB 1GR3A 1VBE2 2A5ZA 3D82A 2ZGRA 4A3XA 4R8HA 5LRSA 4LLFA 1PNGA 1PGL1 2A73B 1OFSA 1LOCA 1UU5A 2ZGOA 4FOVA 4UBGA 1AL23 4XTMA 2NYYA 2O8OA 1RITA 3VZOA 1REFA 4MYEA 4EJRA 2WKKA 1LOAA 3OBTA 1CAVA 1GZWA 3S7EA 4COYA 1RUI1 1EPZA 1GSLA 2XBO1 2ZX2A 3TNPB 1UIJA 3MW3A 3UKNA 3RQ0A 1BEV1 2HYKA 4XHXA 1FXZA 1D4M3 2Q1MA 1PVC3 2QE3A 2JG8B 2ZX3A 1BBT3 5JI7A 1AX2A 5L19A 4TZDA 3HMYA 4YVWB 4AE2A 3OF1A 2XLFA 1MS0A 1EAH3 1AXKA 1RUF3 4IEQA 4XJ9A 2ET7A 4META 4EROA 2JE9A 4N53A 4M00A 5L7OC 3WDXA 4WVZA 2WS91 3O0VA 3E6CC 4AI8A 1RL3A 1X7NA 2VVDA 2R042 2LALA 2DCZA 5FO8B 3VHRA 4KWJA 3MIGA 3NVCA 4R9CA 2D6LX 3OGGA 3SLIA 1LHUA 2RS33 4NWVA 2WFF3 3HQXA 5T5LA 3WT3A 1UU4A 3KCXA 2HWD2 4S2DA 2XJSA 1KXGA 1COV1 1R093 2KM2A 2NPIA 1NCRC 2H6BA 3ZSLA 2ZGPA 4Y24A 1QJX3 2JG9B 4DS0A 5T54A 4YZ2A 5FCCA 5BNNB 1TME2 2PYTA 4Q0VA 1BCXA 3JBG1 1F5FA 1VALA 2QDRA 4HMZA 4HFSA 4BLIA 4HSLA 1RIRA 2ZJCA 4Q4Y2 1PVXA 1XYPA 1RMU3 3BU7A 3WDVA 5LEJA 2WFPA 4U36A 5JVVA 4H55A 4YLZA 1AYM3 1RUJ2 2RS13 3VBRC 2OYZA 4D7YA 5KC5A 2HWF1 4YYOA 3V65A 4UW4A 4MXWA 1RUC3 4MXVA 1W6OB 1MACA 4BZ4A 1PK6B 1B35A 1POV0 5JSPA 4JCKA 1X8EA 3L2HA 4LBQD 1QH7A 1DGLA 4YW3A 2RS51 1VBC1 5J96B 2HJIA 1NQDA 3O5SA 4GMP0 4P9IA 3W59A 1HRI1 3LA2A 4QU2A 1ZBA3 3PNAA 4J1XA 4XFHA 3ZFFC 2A6VA 2VXRA 2QJVA 5C4WC 1PO21 1J59A 4LBMA 4RA0A 3N7MA 4FPOB 3OYWA 5I8SA 4E2GA 2IFWA 5LRRA 4N90A 1CJDA 1LB2A 1LGCA 1V9U1 1AR91 3T1MA 1X36A 3MIEA 1LULA 1C3HA 2EA7A 2DU1A 4Q4W3 2A71A 3USSA 4WM8C 1RUG3 3N3HA 4ATEA 2BFUS 1V6JA 1VP6A 1ND3C 2UY8A 3JD73 5I0TA 1WLDA 1VJ2A 3VBHB 4DRVA 5FREA 1IS5A 1CGPA 4GMP3 4LE4A 4DQAA 4JTOA 1D2QA 3HT1A 2PLV3 1CESA 1ZZ8A 4KGQA 1S0BA 1LENA 1R081 4AI3A 2V73A 4M0HA 1ENSA 3FMGA 2A75A 2X5IA 1C28A 4PIYA 4WVVA 3ZFGA 1OI6A 4C1XA 2Q5TA 2IXLA 4WBBA 3U4XA 1Q56A 4L8QA 5JZGB 2FHRA 3TRSB 1UPIA 2GMMA 1XXNA 2DYCA 5LK7B 4LHKA 1PO12 1NCQC 1QGLA 4KNCA 4WVMA 3U11A 5F9TA 2SLIA 2WSUA 5EZWA 4AEDC 2H0VA 3E5QA 4RS5B 5A33A 5HCAA 4E2SA 2CAUA 2JE7A 1O5UA 3H9AA 4NO4A 5JLVA 1VBB2 2GC0A 4Q4V1 2IXIA 3GF6A 4EWDA 4FTBA 1WBFA 4FBFA 1ALYA 2V5YA 2FZ2A 1OHFA 3I2DA 4EN0A 4YARA 3D0SA 4OUMA 1AYN2 5JPMB 1X33A 2PHXA 3JCIA 5JOXA 1OPMA 5BNQA 2ZHLA 1QNWA 4RHV2 1OOPB 1ZA4A 1SLAA 2A6ZA 3OJBA 1LOGA 1SLBA 3SH4A 4WVWA 2PA7A 1SBDA 2WLPA 3B00A 4Z82A 2V09A 1U5XA 3HAGA 1DBNA 2X53S 2VNRA 2GU9A 1DYPA 1QQP2 2ZX0A 4NR1A 5H9PA 4XJWA 1IPKA 2HEVF 2ILMA 1WW5A 4I09A 5BV6A 2UURA 2ZOEB 4Q2FA 3MIBA 3H1MA 3VLBB 2O8QA 4XJZA 2FMYA 1UU6A 4BH9A 2W39A 1OLRA 5J98B 2HKXA 3BCWA 2R062 5KXCA 4N9HA 1MS1A 3ZXDA 4W65A 2WIIB 2ZX4A 5BNPB 1CQ9A 2JG8A 1GLHA 4C0BA 3RYPA 4K9SA 4N53C 5EJ3A 4HK8A 3NV2A 3H1YA 3ZN5A 4D94A 1Y9QA 3SMHA 1YRZA 1TNFA 3VBSC 3W9AA 5FLIA 2AGSA 4LBNA 2LTNA 1ULCA 1H8VA 1AXYA 2GDFA 3AMQA 1PIV1 1AR61 5H9RA 1AVBA 1LHNA 4XFBA 4Z07A 2WZPP 4DFSA 3GBWA 4CEWB 4AVVA 5FBZA 4I0AA 1ND3B 3LA7A 1CAUB 1R1A1 2WJSA 2VOKA 5ACA3 2E51A 4D7SA 3L2YA 4GH4C 3VKOA 2GNMA 2YUEA 2VQAA 2DCTA 4DB5A 5I8YA 1AR73 2DURA 1OQEA 2ZAAA 3D8CA 1TNRA 3LKJA 2A7AA 3UKTA 3VL9A 1HV0A 1VRH2 4IEXA 3MIDA 2RM22 5LEKA 1T6GC 1NXMA 4JDOA 4X8NA 1VLNA 1QNYA 5BPXA 4LO8A 1DZQA 4LO7A 4D69A 4MX3A 4OHVA 4ES9A 4TLFA 3HT2A 2JG9A 4JAAA 4AFBA 4BOWA 3WG3A 1NCQB 3IKWA 4IEPA 3ZXGA 1OFNA 3WCRA 4BHPA 3V0BB 2ZMNA 5BNNA 4AEDB 5KBFA 1XYNA 3M7AA 4O9EA 1AL21 2BBVA 1OSGA 2XWBB 4XTPA 4YFWA 5J3UA 1ZREA 1H2NA 1VR3A 1VB2A 1S1AA 2I2SA 5JIAA 5AC93 1YYNA 3MGUA 4AGRA 5GLVA 2ZGTA 3LB9A 4KQ7A 1H1AA 4UW3A 1EV13 4B8EA 1W6OA 1PK6A 1S0DA 2X8KA 2BWAA 2G9FA 2CAVA 3M8LA 1Q8OA 1VBA3 3QCWA 4FQZA 1PVC1 3E5UA 3APBA 3CEWA 4Q4X2 1BBT1 4ZU7A 4PIZA 2DUQA 1TE1B 4W6YA 5T5PA 1Z0HA 2E7QA 2WL1A 1HRV3 3VDDB 5CBLA 2W0XA 1Z7S3 1O5LA 3RMYA 2PHLA 1KQRA 2IFRA 2QCSB 3AZWA 4RSUA 1YFYA 4QT6A 2BFUL 1ULGA 1D0HA 1EAH1 2A3WA 1GQGA 1RUF1 2VMGA 3H7YA 3ILNA 4KU7A 1CONA 4CYDA 2SBAA 2ENRA 5JWPA 4AGGA 4XF0A 2JICA 3VBUC 2HEWF 1DDLA 2A6YA 1Y3TA 4G9SB 5FO7B 5KHIA 5JOZA 2X5IC 1G8WA 1YI9A 3ZFGC 4B4QA 2WZR2 4EV0A 2WC2A 2R49A 2GNTA 3VBHA 4NHKA 3B94A 4WZFA 1DF0A 2NLRA 4XXPA 3MW2A 2OPKA 2RS31 1YUDA 2WFF1 3ILFA 3AP5A 4DXZA 3B01A 2DWRA 2GN3A 3MI8A 3SNMA 1R091 4IV3B 3NKTA 3RI9A 3ZX7A 2DTWA 3SITA 1LJ7A 2D6PA 4TWTA 3MF6A 4NPRA 5JZGA 1ZZCA 4JGYC 4PLNA 3RYRA 4XJ8A 5L7OA 2BNOA 1ASJ2 1OKQA 3DKWA 4LR4A 1M4WA 1AL0G 4GH4B 1W6NA 1G9BA 1A8MA 1RMU1 4XFIA 4RS5A 1PGL2 3WDTA 1QDCA 1AYM1 5FMOS 3S7IA 2ZGLA 2RS11 5C9AB 4HPKA 4Q0PA 4ORFA 1RUC1 2ET1A 1BXHA 5FQ0B 3BB6A 3ZXAC 3H7JA 2JENA 4MV2A 3KMHA 1MVQA 4IEYA 4WZCA 1YFUA 4QX5A 3FJSA 2WSVA 4FPYA 1RVF3 4FXKB 4FXGB 3IM0A 5GJ6A 1BEV2 1GICA 1U5YA 2GALA 4OI0A 1ZBA1 4RGGA 2PHDA 3WD5A 2Q30A 5L36A 2ZKLA 3B9CA 3O0XA 1QY4A 4HN0A 2DUOA 4UW6A 1W39A 4YZ1A 4EN6B 1DQ0A 5GLWA 2BTVC 4WM7B 3T2TA 3VZNA 4AFCA 3WY6A 5DG2A 4Q4W1 2QKDA 1SFNA 2DCKA 2JG8C 4Z1VA 1RUG1 2CGNA 3B7MA 4H7MA 4LULA 1JHNA 3JD71 4AVBA 3HR9A 1KJRA 1OQDA 2F4PA 2WS92 3ECQA 1O91A 2DVAA 2ZGQA 1EYBA 2UYBA 4C91A 2DFBA 2PLV1 2YY1A