3M3MA

Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
201
structure length
201
Chain Sequence
SLYKVYGDYRSGNCYKIKLMLNLLGLPYEWQAVDILGGDTQTEAFLAKNPNGKIPVLELEDGTCLWESNAILNFLADGSQFLPSEPRLRTQVLQWQFFEQYSHEPYIAVARFIQLYEGLPEERREEYLKLHKRGYKALDVMEKQLSRTPYLVGEHYSIADIALYAYTHVADEGGFDLSRYPGIQAWMQRVQSHPRHVPMLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of glutathione S-transferase from Pseudomonas fluorescens [Pf-5]
rcsb
source organism Pseudomonas fluorescens
molecule tags Transferase
total genus 73
structure length 201
sequence length 201
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3m3mA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3m3mA01
2OE0A 1FHEA 1ZOFA 4HUAA 5IMVA 3VWVA 3OR5A 2P31A 4KCEA 1O6JA 2IWTA 1A8YA 2CAIA 2WJUA 18GSA 4KE3A 3RPPA 3LG6A 3VPTA 3GN3A 3MSZA 1V40A 1SK0A 2BJXA 3ZITA 4IJIA 3TRQA 4ZL9A 4POLA 1J0FA 2L6DA 3ZYWA 1UA5A 4ULXA 3TUEA 5IOXA 3KH9A 1BAYA 2VCQA 1FB0A 6GSWA 1TP9A 1K3LA 4PX1A 1TI1A 2X8GA 3L78A 1X9SB 4IP1A 3FEUA 3LYKA 1U88A 2B1KA 4KUNA 3HHVA 4JEDA 4I2UA 4ZB6A 2IL3A 3ZLPA 5DJLA 3N5OA 1M2BA 2P5QA 2E0QA 4EO3A 5GAND 4K8MA 4ZILA 5IPHA 2XC2A 8GSSA 4P3YB 3HD5A 4K9ZA 3W8JA 2CVKA 1O8XA 2I81A 3GL3A 5FWGA 1LU4A 3MWHA 3IXRA 1N8JA 3E9JB 1OKDA 4K0NA 5J3RA 3ZZXA 3BCKA 1Z7RA 2GT5A 2YANA 2MBTA 4PGTA 5AISA 2WS2A 3EU3A 1TI3A 4KNDA 2DSAA 3TKSC 1PL2A 1K0DA 1F6MC 4GSNA 3EINA 1TRSA 2YV7A 4PQ1A 1K0NA 3D0ZA 5A4VA 3EVIA 3GRXA 4GCIA 2FD3A 3APOA 4Q5FA 1Z5YE 1Z3EA 5IMFA 1TRUA 4K7NA 5JWQB 4J57E 5D96A 3I69A 1TK0B 3CTFA 5ELGA 2YJHA 5CYYA 2FNOA 1XWAA 1GSEA 3A2XA 4TR4A 3UVTA 1AAZA 14GSA 4TR0A 5HR1A 2EC4A 4WR4A 1JZRA 2V41A 1WMJA 4MK3A 4MP4A 2ZUPA 3EU4A 3FKFA 3VLNA 2H75A 1WRYA 2KLXA 1PX6A 1G6WA 1THOA 2GT6A 2HZFA 3KJYA 5AN1A 1I5GA 3LWAA 2C80A 5GSSA 1SYXA 4EVMA 4H86A 2GS3A 2YJ7A 2UZ8A 5EVOA 3W6GA 1CQGA 5IMZA 3G7JA 5F07A 1ML6A 2O89A 5D8IA 1JLVA 5ECPB 2KP1A 4DVCA 1GSQA 19GSA 4F03A 17GSA 4LA1A 1XOAA 4V2MA 1J08A 2H6YA 5J9CA 4L0UA 2EIOA 2CVDA 4MJCA 2YWIA 1B4QA 5D93A 2YNXA 3TOTA 1WE0A 4OO4A 3GURA 2H73A 1YF1A 1SD9A 2RLIA 5IPGA 4K6XA 4NWYA 2L4QA 3WT1A 3ZVJA 1ERVA 4HU9A 1O81A 1JZWA 2E7PA 2I1UA 3IRAA 1B9XC 5ENUA 2LNTA 2V6OA 4BVYB 1YZXA 2LS5A 1OC9B 3QDNA 3ZIJA 5JWOB 3FYGA 3CMIA 3WT2A 1WP0A 3FZ4A 5FT3A 1TW9A 1SJZA 4F0BA 1QMVA 3FHKA 2A4VA 3KIJA 4ISDA 3IE3A 1JLWA 3GX0A 4KF9A 2HSMA 2E2GA 3F6FA 1TOFA 2PUKC 5DBQA 1ZYQB 2M72A 2YV9A 3IA1A 3UARA 2H71A 3FK8A 2PU9C 3GV1A 5IMAA 4ZBDA 2H0HA 22GSA 3ZMKA 2DJ2A 5A4WA 4G9HA 1M2DA 1EZKA 4KCAA 4IQ1A 3KZQA 5ECLB 3DGQA 2DIZA 1PN9A 5GZZB 2C3QA 4OFNA 4N0ZA 3F3QA 2FCHA 1M9BA 3GSSA 5F06A 4JBBA 5EL8A 4V1Ag 5CNWA 3US3A 1ZMAA 1GULA 3FRCA 3C71A 3BOAA 2WGRA 1ABAA 2N5AA 4TVEA 2JL4A 1XW5A 2H6XA 1S3AA 2DIYA 1MDKA 3CBUA 5ELAA 1R5AA 1W4VA 4HZ2A 4KDUA 2L4CA 1OC9A 3GKKA 1M0UA 1URMA 2BTOT 5ECSA 4HOJA 1G7OA 2X64A 3IC4A 4DSSB 1GWCA 3P90A 3HVXA 16GSA 4E8HA 2GVPA 3TKRA 3D6IA 3TRXA 1SK1A 3EYTA 4N0VA 3TDGA 1S3CA 1SL0B 1SKSB 1GSYA 4DEJA 6GSVA 4MCUA 1PA3A 4E8EA 3FY7A 3QOUA 2JSYA 2MMNA 5C00A 3E3EA 5JWRB 3WGDA 3L0HA 4LMVA 3F6DA 1A23A 4KDXA 1JZDA 2GZPA 1CQHA 2CV4A 4L5OA 5IO0A 2LQOA 3UAPA 1XOBA 3D5JA 4ML6A 5CREA 4BA7A 3GKNA 2CAQA 2LKUA 3LQ7A 4K7OA 4POMA 4MABA 4WBRD 4L8EA 2GSTA 3NOFA 1J9BA 1EGOA 2VM1A 3GKMA 1T7PB 5ID2A 5J41A 1GNEA 4EXJA 5H5RA 2QC7A 4EF0A 1Z9HA 3GSTA 4MF6A 1X0RA 4K1FA 1NM3A 1V58A 1XVWA 4AJ7A 3IV4A 1RK4A 4OD7A 1FG4A 3VFIA 4TR3A 4NAXA 4AF2A 5D9XA 1X5DA 2HSYA 5CRWA 1T8EB 3HKRA 3Q6OA 2DJKA 1EV4A 2CX4A 5HFKA 4ID0A 2H6ZA 3VWUA 2FLSA 1QFNA 2JACA 2F51A 2TRXA 5ECOB 1THXA 3KP9A 2LRCA 1TK8B 1YEXA 1FB6A 5HFIA 3LYPA 4FYUA 3KEBA 1WWJA 5COHA 4IJ3A 3R2QA 1F9MA 3UBLA 1M2AA 4DSSA 4IKHA 2OBIA 2CZ3A 3KGKA 2IMFA 3U6VA 4YQVA 2DJ3A 3DWVA 3L9SA 4N10A 3GL5A 3KTBA 2I9HA 4HU7A 2N5BA 2RUEA 3ERWA 2K8VA 12GSA 1GTUA 4EKZA 1A0RP 4GXZA 2LSTA 4KH7A 2GSRA 3GTUA 2IN3A 1DE2A 1BYEA 4RQXA 2FUG2 1A2JA 1B8XA 2H0GA 2GGTA 3FZ9A 1IYHA 1FO5A 3QFAC 1A24A 3WGEA 3O3TA 1EV9A 4HJMA 3DD3A 2B3SA 2V2GA 5CRHA 3C7MA 4MH2A 4FIWA 4EDYA 3IOSA 2TIRA 2HRFA 4RUVA 4G10A 3VWXA 4GTUA 3VURA 3C1RA 2H01A 4G19A 3RHCA 2LJAA 4GRFA 3KMOA 5LD0A 1EEJA 3HCZA 4IELA 3M9JA 1XWGA 3RPNA 3TJFA 1KBNA 5G30A 1GSFA 3FR6A 2WRTA 1Y25A 5J5NA 2CA8A 4TXOA 1QUWA 4ZBAA 4Q5RA 2HRKB 2VOCA 4YQMA 2C0FA 4EUYA 2AV4A 2K6VA 4MJBA 2WZ9A 2VLTA 2HRAA 1A0FA 2BMXA 3GYKA 3A2VA 1BQ7A 2H1GA 2GZYA 1SJ6A 2MMZA 3H8QA 3EURA 1XWBA 2DC5A 4ACSA 1MEKA 3TGZA 4DSQA 3F3RA 2IMDA 4K2DA 3ERGA 2A2SA 1GTIA 2MZCA 3F4RA 1E6BA 2FHEA 2VL2C 2PERA 2M80A 3R3EA 3ME7A 3ISOA 5J9BA 1AUCA 4QQ7A 1ZL9A 4IGJA 3EE2A 1NHYA 3CSJA 5B6NA 3UEMA 1RW1A 1MD3A 2YOIA 3ED3A 2Z9SA 4PNFA 2PGTA 1Z7PA 4XRAA 2C0EA 2P0GA 1ZYEA 1XWKA 2HXKA 4NV5A 1QK8A 2XPDA 2DJ0A 1U87A 1JFUA 2K9FA 4O32A 3D22A 2V32A 5IMCA 4FO5A 5G31A 1OAZA 3M1GA 1TJDA 2YCDA 5INYA 1GL8A 1B48A 4NPBA 2C0GA 5G1LA 4I97A 1PRXA 1I9DA 2HRNA 5EPFA 1Z6NA 4MJEA 3VI5A 2HRKA 2AYTA 2NBSA 2H8LA 2H74A 4XTSA 2AAWA 3N9JA 1YF0A 3UBKA 4CHSA 5DCHA 5A5KA 4NV2A 4J56E 4F2IA 2C1YA 2FWHA 6GSSA 1O7UA 4I2TA 1PX7A 1XIYA 4G0IA 3AY8A 4MJAA 1AQXA 4WEYA 3P2AA 3BJ5A 4V2NA 3ZTLA 4I8BA 3QPMA 2REMA 2G2QA 2WB9A 4NHWA 3TKSE 4I5QA 4HQSA 1UN2A 4GWRA 4KA0A 1ERTA 3IAS2 3GX8A 1AQWA 4O92A 2GLRA 3MDKA 2GQLA 3EWLA 4MA9A 3ZFLA 1S3DA 2OADA 3E0UA 1PQNA 3RDWA 1LJRA 2JZRA 2VL2A 4KSOA 5IIZA 1XXUA 1QXHA 1ERWA 3D21A 2LJKA 3BBYA 1K0AA 1EGRA 4K7IA 4XS6A 1GUHA 2CQ9A 5E59A 4OCEA 1WJKA 3LXTA 2L5LA 3APQA 1ON4A 1FVKA 5AIVA 5GSTA 5AIXA 3WYWA 1TTZA 2FY6A 5H5SA 4JE1A 1VGLA 3O76A 1A2LA 1SD8A 2NTOA 3LXZA 2OBKA 5IMDA 2HE3A 3UMAA 2RUFA 5G5FA 2TRCP 1F37A 4HDEA 5L71A 2H1AA 4ECJA 5CP1A 4ZBBA 1HYUA 5D73A 3KD0A 1BG5A 4WF4A 2FGXA 1MTCA 2R5GA 2V6KA 3UJ1A 1SL2B 4YAVA 5HR2A 2VM2A 1GTAA 1GLPA 1EOGA 2WCIA 2QGVA 1H75A 4KX4A 1SU9A 4RQRA 1XCCA 5KEJA 1XBSA 11GSA 2IMEA 2DJ1A 5D9VA 1W89A 1SJIA 2R6KA 5A4UA 1GLQA 4IP6A 2ALBA 3HVSA 5LCZA 2PBJA 3HZ4A 3UVHA 4BWSA 1ZZYA 3L4NA 4POKA 2H72A 4WF5A 5ECMB 4XCSA 3GKXA 4TR1B 1EEMA 9GSSA 1G6YA 4XHMA 4HEA2 2JZTA 3IBHA 1XW9A 2FA4A 4MPGA 3SWLA 2B7JA 4MLYA 4IW9A 3HYPA 1SENA 1V2AA 4PQIA 2H66A 3TKPA 3HJOA 3KTLA 2GQKA 2IFQB 2GDRA 2JSZA 3F8UA 3IPZA 5AGYA 1YKAA 2OJLA 4ECCA 4IQAA 3DVWA 1TXXA 1EP8A 4GQFA 4EDZA 4POBA 4F0CA 4BVYA 2QKEA 5B7CA 1KNGA 4KB3A 7GSSA 3IDVA 3C8EA 5G2ZA 1H4OA 1OC3A 1VRSD 1EOHA 1OC8A 2F3MA 4O7HA 3ZREA 4KGIA 1ACVA 1FVJA 2CX3A 4G2EA 1OE7A 2K8SA 4BL7B 3I43A 1M7TA 2FWEA 2MBSA 4IVFA 3WGXA 4WXTA 3HDCA 3NZNA 1M99A 2PMTA 4OCFA 5JCUA 2CVBA 3M0FA 5D9WA 2F8AA 5ECHB 3BCIA 1ZGNA 3QMXA 2DLXA 4GQCA 1RQMA 3CXGA 4F9ZA 3QAVA 3MAKA 4IBPA 2XHFA 6GSXA 1F3BA 4XIHA 1Q4JA 2X99A 2WDUA 1SL1B 2XBIA 3KP8A 2C0DA 3QFBC 5IQYA 2J9HA 3A2WA 3G9BA 4ILFA 5F8BA 4TR1A 2WFCA 5HR0A 4X1UA 3CRUA 3HVVA 4X43A 3GMFA 4MF7A 2FWGA 5CAXA 2X8HA 5CRDA 5D9TA 4HZ4A 3FW2A 3HA9A 4G0LA 1GP1A 5C04A 5KN0A 2L5OA 10GSA 2IFQA 2JU5A 1MDIA 3IK9A 3ZIVA 4XS1A 2KUCA 3CSHA 2AHEA 2KP2A 1YDKA 5JCWA 2R2JA 2DJJA 3U5RE 4GF0A 4MZCA 2HI7A 1VF3A 4PXOA 2B1LA 1GSDA 1AC1A 2YPMA 4ZL8A 3KM6A 1XPVA 4MF5A 3MNGA 2L57A 4JRRA 1QGVA 3DEXA 1Z6MA 2CT6A 3APSA 3F0IA 3UIWA 4BL7A 4NHZA 1E2YA 1BEDA 1XWCA 2DMMA 4ZXGA 2O87A 4EL1A 4F82A 2OKAA 2YP6A 3IAM2 2IIYA 2LTKA 3IR4A 1XVQA 1A8LA 4FYCA 2ZCTA 2A2RA 4GLTA 5B8BA 3PGTA 2RM5A 3TOUA 3J7Yk 3Q18A 2LRNA 1VF4A 2PN8A 2PPTA 4PNGA 1ILOA 2VL3A 4K0GA 2HYXA 1MDJA 3G7IA 1GSSA 2ZNMA 3H93A 3LFLA 1DSBA 2NDOA 3DVXA 2C3NA 2AB6A 4MZWA 5F05A 1PGTA 1XZOA 4YH2A 3ERFA 1K0CA 3M3MA 3WD6A 5B8AA 1ERUA 2WULA 5ECRB 3ZL5A 5IO2A 4EE0A 3VWWA 1R4WA 3EMPA 1F3AA 2CZ2A 2XPEA 1AIUA 3L9VA 2C3TA 6GSUA 1AXDA 1VF2A 4OMVA 6GSTA 1WIKA 1V57A 2YWMA 4I6XA 4KAEA 5DCGA 3LORA 3FZ5A 3TCOA 3ME8A 1TRWA 3KH7A 4JU5A 3GFKA 5HFGA 2C8UA 1HQOA 5ABRA 1PMTA 4MH3A 5BMUA 2DBCA 1GTBA 4N11A 1R26A 1X5EA 1TRVA 4BPYA 1T00A 2NPBA 3GH9A 3A3TA 1YJ6A 3ZRDA 1PL1A 4ECBA 4CW9A 1B4PA 4MPFA 3F4TA 3O6TA 3ZFBA 3GUSA 1K0MA 4TW5A 3GIXA 1O85A 1PKWA 3IHQA 4TXVA 1PKZA 3GH6A 2HSHA 4V2LA 4WKWA 4CDOA 1NSWA 1DUGA 13GSA 5ECIB 4LLRA 4BWQA 3FR9A 4YAPA 4MDCA 1GH2A 2B5YA 1TU7A 1X9MB 5E4WA 1X9WB 1R7HA 3TB2A 1BX9A 1V98A 3ZMLA 1V9WA 1QQ2A 3PR8A 1YKCA 2I3YA 1PD21 2LV3A 3PH9A 2GSSA 4IS0A 2VCVA 2F8FA 4G0KA 1OYJA 5JCGA 4FYBA 2ES7A 3G7YA 1TKDB 2VO4A 1WOUA 5KN1A 1O8WA 3EMXA 3TJKA 2VCWA 3FR3A 1SYRA 3H4KA 1U6TA 4JR4A 2VLVA 2YWOA 2B5XA 4YQUA 2L6CA 2K18A 2G0FA 1GRXA 2LQQA 1BJXA 4MMMA 4QL9A 2IMKA 1K0OA 5FHIA 5DAKB 4O5RA 5DQYA 3H1NA 1TDIA 4KDYA 4AJ8A 4MZBA 5DJMA 2N5FA 3A5WA 2AJQB 1USBA 3RBTA 3GNJA 1XW6A 3LGCA 3D4TA 2HSMB 3DYRA 3W8SA 1HD2A 5LNKe 2LUSA 1U3IA 4ZB9A 3C1SA 1F2EA 1T3BA 3RHBA 2H0IA 2VLUA 1XFLA 1Q98A 2PVQA 3KXOA 1DE1A 5F0GA 2YZUA 1R5PA 3H79A 4D73B 4V1Ap 2PWJA 1SKRB 2I4AA 1A2MA 3M9KA 2HFDA 2L59A 5CO3A 4ZB8A 2VCXA 4KW6A 3I9V2 1G0TA 4JR6A 3HXSA 2VCZA 3F63A 2VL9A 5HR3A 2EIQA 3ZVJD 1NW2A 4N30A 1YEPA 4PURA 2D2ZA 3SBCA 3LJRA 4J2FA 2H76A 1GNWA 4QL7A 1DBYA 3LEFA 2GSQA 3PPUA 2VIMA 4OFTA 4RI6A 4OFMA 2GZZA 3HJPA 3P7XA 5DALB 2ON5A 4WBJA 3TRPA 3QCPA 3JCML 4L5LA 5G1KA 5DAKA 4Q5QA 3TKSA 2HZEB 3D4MA 4RI7A 2J23A 1K3OA 2B5EA 2YWNA 4WR5A 4IHUA 2F9SA 2PVOC 5HQPA 3VPQA 2LEGA 3C73A 1OE8A 3CSIA 5KN3A 1T4ZA 3Q19A 4GSTA 2C4JA 4PUAA 1K0BA 1TU8A 3BD2A 3HJMA 1PSQA 3J7Yb 3K8NA 3LSZA 2QSIA 3QR6A 2YZHA 5DDLA 3I6AA 3UOMA 4BVXB 2H70A 2HLSA 5H5QA 1HNAA 2LRTA 4D73A 2OA7A 1HNCA 2GTUA 2LJRA 1NHOA 2IMIA 1O73A 3GA4A 3L9UA 1WPIA 4HQZA 4AJ6A 1SKWB 4ZIJA 5B6MA 5ECQB 5ID2B 1IYIA 5J4UA 1LBKA 4USSA 1JZOA 1TK5B 4PQHA 3P8WA 1FW1A 4TRXA 6GSYA 1YQ1A 4NXIA 3FZAA 4EC0A 2EIRA 3NIVA 1N2AA 1EWXA 2O85A 4TOPA 2IPAA 2IJYA 1OVNA 20GSA 2FWFA 2AUVA 1C72A 5G5EA 3TKQA 1AW9A 2M46A 1FAAA 3VK9A 2JADA 3DMLA 1G7EA 2E2MA 3GHAA 3VI7A 2H30A 2HQTA 2RIIA 2VUPA 5DALA 3HZ8A 3DXBA 2JZSA 3DKSA 1VF1A 5IOWA 3M8NA 5ECNB 2HZEA 2V1MA 4PTSA 3F9UA 1UVZA 1MD4A 3IC8A 1B9YC 2LNSA 2VCTA 3EC3A 4HJ2A 3DRNA 2R4VA 5KN2A 1AQVA 5IM9A 2OACA 1EP7A 4XS4B 1OKTA 4L0WA 4JZQA 4LL4B 1KTEA 2OE3A 2VD1A 4XRDA 3GTUB 2OE1A 2R37A 4Z7XA 4BVXA 1GUKA 1JHBA 2H19A 4ECIA 3DIEA 2GQMA 2VD0A 2YN1A 4LMWA 4LL1B 4FQUA 2RM6A 1T4YA 2XBQA 4ZL7A 4DSRA 1K3YA 4FH8A 1HNBA 2R3XA 4TN8A 3Q74A 1SK2A 5DVBA 3V1WA 1Y6EA 4OO5A 1U3AA 4KSMA 2B6MA 2H1DA 2O8VB 2HT9A 2KOKA 1ZCPA 1X5CA 4WETA 1M9AA 3F4SA 3RAZA 4OWYA 3QAGA 4ML1A 1FOVA 2X8CA 5CRGA 3IK7A 3S9FA 3CTGA 3KMNA 2MYGA 5DQSA 5GAPD 1GSUA 2DMLA 4TXOB 2MMOA 4X0XA 3QD9A 2FA8A 2B7KA 5ECKB 3TJBA 2HNLA 2HSNB 4GSSA 4HI7A 2O7KA 1UC7A 2KHPA 3UL3A 1YY7A 3HY2A 4HS1A 3CYNA 4NMUA 2ON7A 2NVLA 3TJJA 4IN0A 2P5RA 2MMAA 1GUMA 3KCMA 1KEBA 1ST9A 3QAWA 4TKYA 2VAFA 2H1BA 4Q5NA 3TJGA 4XS4A 4PUFC 5EY6A 1T1VA 4AGSA 3PINA 3CRTA
chains in the Genus database with same CATH superfamily
2OE0A 1FHEA 1ZOFA 4HUAA 5IMVA 3VWVA 3OR5A 2P31A 4KCEA 1O6JA 2IWTA 1A8YA 2CAIA 2WJUA 1M3IA 18GSA 4KE3A 3RPPA 2WW0A 2EFEA 3LG6A 3VPTA 3GN3A 3MSZA 1V40A 1SK0A 2BJXA 3ZITA 1TXUA 4IJIA 3TRQA 4ZL9A 4POLA 1J0FA 2L6DA 3ZYWA 1UA5A 4ULXA 3TUEA 5IOXA 3KH9A 1BAYA 2R0CA 2VCQA 1FB0A 6GSWA 1TP9A 1K3LA 4PX1A 1TI1A 4PHZC 2X8GA 3L78A 1X9SB 4IP1A 3FEUA 3LYKA 1U88A 2B1KA 4KUNA 3HHVA 4JEDA 4I2UA 4ZB6A 2IL3A 3ZLPA 5DJLA 3N5OA 1M2BA 2P5QA 2E0QA 4EO3A 5GAND 4K8MA 4ZILA 5IPHA 5A34A 8GSSA 2XC2A 4P3YB 4E68A 3HD5A 4K9ZA 3W8JA 2CVKA 1O8XA 2I81A 3GL3A 5FWGA 1LU4A 3MWHA 3IXRA 1N8JA 5J47A 3E9JB 1OKDA 4K0NA 5J3RA 4HSCX 3ZZXA 3BCKA 5J4VA 1Z7RA 2GT5A 2YANA 2MBTA 4PGTA 5AISA 2WS2A 3EU3A 1TI3A 4KNDA 2DSAA 3TKSC 1PL2A 4ICYA 1K0DA 1F6MC 4GSNA 3EINA 1TRSA 2YV7A 4PQ1A 1K0NA 3D0ZA 5A4VA 3EVIA 3GRXA 4GCIA 2FD3A 3APOA 4Q5FA 1Z5YE 1Z3EA 5A1NB 5IMFA 1TRUA 4K7NA 5JWQB 4J57E 5D96A 3I69A 1TK0B 3CTFA 5ELGA 2YJHA 5CYYA 2FNOA 1XWAA 1GSEA 3A2XA 4TR4A 3UVTA 4Z2UA 1AAZA 14GSA 4TR0A 5HR1A 2EC4A 4WR4A 1JZRA 2V41A 1WMJA 4MK3A 4MP4A 2ZUPA 3EU4A 3FKFA 2DKIA 3VLNA 2H75A 1WRYA 2KLXA 1PX6A 1G6WA 1THOA 2GT6A 2HZFA 3KJYA 5AN1A 1I5GA 3LWAA 2C80A 5GSSA 1SYXA 4EVMA 4H86A 2GS3A 2YJ7A 2UZ8A 5EVOA 3W6GA 2X4AA 1CQGA 5IMZA 3G7JA 5F07A 1ML6A 2O89A 5D8IA 1JLVA 5ECPB 2KP1A 4DVCA 1GSQA 1Y1UA 19GSA 4F03A 17GSA 4LA1A 1XOAA 4V2MA 1J08A 2WVZA 2H6YA 5J9CA 4L0UA 2EIOA 2CVDA 4MJCA 2WVXB 2YWIA 1B4QA 5D93A 2YNXA 3CQFA 3TOTA 1WE0A 4OO4A 3GURA 2H73A 1YF1A 1SD9A 2RLIA 5IPGA 4K6XA 4NWYA 2L4QA 3WT1A 3ZVJA 1ERVA 4HU9A 1O81A 1JZWA 2E7PA 2I1UA 3IRAA 1B9XC 5ENUA 2LNTA 2V6OA 4BVYB 1YZXA 2LS5A 1OC9B 3QDNA 3ZIJA 5JWOB 3RGBC 3FYGA 2WW2A 3CMIA 3WT2A 1WP0A 3FZ4A 5FT3A 1TW9A 1YVLA 1SJZA 4F0BA 1QMVA 3FHKA 4W66A 2A4VA 3KIJA 4ISDA 3IE3A 1JLWA 3GX0A 4KF9A 2HSMA 2E2GA 3F6FA 1TOFA 2PUKC 5DBQA 1ZYQB 2M72A 2YV9A 3IA1A 3UARA 2H71A 3FK8A 2PU9C 3GV1A 5IMAA 4ZBDA 2H0HA 22GSA 3ZMKA 2DJ2A 5A4WA 4G9HA 1M2DA 1EZKA 4KCAA 4IQ1A 3KZQA 5ECLB 3MIXA 3DGQA 2DIZA 1PN9A 2WVXA 5GZZB 2C3QA 4OFNA 2H1LA 4N0ZA 3F3QA 2FCHA 1M9BA 3GSSA 5F06A 4JBBA 5EL8A 4V1Ag 5CNWA 3US3A 1ZMAA 2O5VA 1GULA 3FRCA 3C71A 3BOAA 2WGRA 1ABAA 2N5AA 4TVEA 2JL4A 1XW5A 2H6XA 1S3AA 2DIYA 1MDKA 3CBUA 5ELAA 1R5AA 1W4VA 4HZ2A 4KDUA 2L4CA 4YKFA 1OC9A 3GKKA 1M0UA 1URMA 2BTOT 5ECSA 4HOJA 1G7OA 2X64A 3IC4A 4DSSB 1GWCA 3P90A 3HVXA 16GSA 4E8HA 2GVPA 3TKRA 3D6IA 3TRXA 1SK1A 3EYTA 4N0VA 3TDGA 1S3CA 1SL0B 1SKSB 1GSYA 4DEJA 6GSVA 4MCUA 1PA3A 4E8EA 3FY7A 3QOUA 1N25A 2JSYA 2MMNA 5C00A 2R0GA 3E3EA 5JWRB 3WGDA 3L0HA 4LMVA 3F6DA 1A23A 4KDXA 4X4JA 1JZDA 2GZPA 1CQHA 2CV4A 4L5OA 5IO0A 2LQOA 3UAPA 1XOBA 3D5JA 4ML6A 5CREA 4BA7A 3GKNA 2CAQA 2LKUA 3LQ7A 4K7OA 4POMA 4MABA 4WBRD 4L8EA 2GSTA 3NOFA 1J9BA 1EGOA 2VM1A 3GKMA 1T7PB 5ID2A 5J41A 1GNEA 4EXJA 5H5RA 2QC7A 4EF0A 1Z9HA 3GSTA 4MF6A 1X0RA 4K1FA 1NM3A 1V58A 1XVWA 4AJ7A 3IV4A 2QA1A 1RK4A 4OD7A 1FG4A 3VFIA 4TR3A 4NAXA 4AF2A 5D9XA 1X5DA 2HSYA 5CRWA 1T8EB 3HKRA 3Q6OA 2DJKA 1EV4A 2CX4A 5HFKA 4ID0A 2H6ZA 3VWUA 1SVOA 2FLSA 1QFNA 2JACA 2F51A 2TRXA 5ECOB 4AKXB 1THXA 3KP9A 2LRCA 1TK8B 1YEXA 1FB6A 5HFIA 3LYPA 4FYUA 3KEBA 1WWJA 5COHA 4IJ3A 3R2QA 5BMUB 1F9MA 3UBLA 1M2AA 4DSSA 4IKHA 2OBIA 2CZ3A 3KGKA 2IMFA 3U6VA 4YQVA 2DJ3A 3DWVA 3L9SA 4N10A 3GL5A 3KTBA 2I9HA 4HU7A 2N5BA 2RUEA 3ERWA 2K8VA 12GSA 1GTUA 4EKZA 1A0RP 4GXZA 2LSTA 4KH7A 2GSRA 3GTUA 2IN3A 1DE2A 1BYEA 4RQXA 2FUG2 1A2JA 5J4YA 1B8XA 2H0GA 2GGTA 3FZ9A 1IYHA 1FO5A 3QFAC 1A24A 3WGEA 3O3TA 1EV9A 3DD3A 4HJMA 2B3SA 2V2GA 5CRHA 3C7MA 4MH2A 2O36A 4FIWA 4EDYA 3IOSA 5BRTA 4O5UA 2TIRA 2HRFA 2WVYA 4RUVA 4G10A 3VWXA 4GTUA 3VURA 3C1RA 2H01A 4G19A 4BIKA 3RHCA 2LJAA 4GRFA 3KMOA 5LD0A 1EEJA 3HCZA 4IELA 3M9JA 1XWGA 3RPNA 3TJFA 1KBNA 5G30A 1GSFA 3FR6A 2WRTA 1Y25A 5J5NA 2CA8A 4TXOA 1QUWA 4ZBAA 4Q5RA 2HRKB 2EFCA 2VOCA 4YQMA 2C0FA 4EUYA 2AV4A 2K6VA 4MJBA 2WZ9A 2VLTA 2HRAA 1A0FA 2BMXA 2HSNA 3GYKA 3A2VA 1BQ7A 2H1GA 2GZYA 1SJ6A 2MMZA 3H8QA 3EURA 1XWBA 2DC5A 2UV8G 4ACSA 1MEKA 3TGZA 4DSQA 3F3RA 2IMDA 3ERGA 2A2SA 1GTIA 4K2DA 2MZCA 3F4RA 1E6BA 2FHEA 2VL2C 2PERA 2M80A 3R3EA 3ME7A 3ISOA 5J9BA 1AUCA 4QQ7A 4FXYP 1ZL9A 4IGJA 3EE2A 1NHYA 3CSJA 5B6NA 3UEMA 1RW1A 1MD3A 2YOIA 3ED3A 2Z9SA 4PNFA 2PGTA 1Z7PA 4XRAA 2C0EA 2P0GA 1ZYEA 1XWKA 2HXKA 5KOXA 4NV5A 1QK8A 2XPDA 2DJ0A 4GDFA 1U87A 1JFUA 2K9FA 4O32A 3D22A 1S3RA 2V32A 5IMCA 4FO5A 5G31A 1OAZA 3M1GA 1TJDA 2YCDA 1SVLA 5INYA 1GL8A 1B48A 4NPBA 2VKZG 2C0GA 5G1LA 4I97A 1PRXA 1I9DA 2HRNA 5EPFA 1Z6NA 4MJEA 3VI5A 2HRKA 2AYTA 3LW9A 2NBSA 2H8LA 2H74A 4XTSA 2AAWA 4Z2TA 3N9JA 1YF0A 3CHXC 3UBKA 4CHSA 5DCHA 5A5KA 4NV2A 4J56E 4F2IA 2C1YA 2FWHA 6GSSA 1O7UA 4I2TA 1PX7A 1XIYA 4G0IA 3AY8A 4MJAA 1AQXA 4WEYA 3P2AA 3BJ5A 4V2NA 3ZTLA 4I8BA 1PFOA 3QPMA 2REMA 2G2QA 2WB9A 4NHWA 3TKSE 1YEWC 4I5QA 4HQSA 1UN2A 4GWRA 4KA0A 1ERTA 3IAS2 3GX8A 1AQWA 4O92A 2GLRA 3MDKA 2GQLA 3EWLA 4MA9A 3ZFLA 1S3DA 2OADA 3E0UA 1PQNA 3RDWA 1LJRA 2JZRA 2VL2A 4KSOA 5IIZA 1XXUA 1QXHA 1ERWA 3D21A 2LJKA 3BBYA 1K0AA 1EGRA 4K7IA 4AKIA 4XS6A 1GUHA 2CQ9A 5E59A 4OCEA 1WJKA 3LXTA 2L5LA 3APQA 1ON4A 1FVKA 5AIVA 5GSTA 5AIXA 3WYWA 1TTZA 2FY6A 5H5SA 4JE1A 1VGLA 3O76A 5A1NA 1A2LA 1SD8A 2NTOA 3LXZA 2OBKA 5IMDA 2HE3A 3UMAA 2RUFA 5G5FA 2TRCP 1F37A 4HDEA 5L71A 2H1AA 4ECJA 5CP1A 4ZBBA 1HYUA 3FMWA 5D73A 3KD0A 1BG5A 4WF4A 2FGXA 1MTCA 2R5GA 2V6KA 2X49A 1FOHA 3UJ1A 1SL2B 4YAVA 5HR2A 2VM2A 1GTAA 1GLPA 1EOGA 2WCIA 2QGVA 1H75A 4KX4A 1SU9A 4RQRA 1XCCA 5KEJA 1XBSA 11GSA 2IMEA 2DJ1A 5D9VA 1W89A 1SJIA 2R6KA 5A4UA 1GLQA 4IP6A 2ALBA 3HVSA 3IHGA 5LCZA 2PBJA 3HZ4A 3UVHA 4BWSA 1ZZYA 3L4NA 4POKA 4EIPA 3EPTA 2H72A 4WF5A 5ECMB 4A5PA 4XCSA 3GKXA 4TR1B 1EEMA 9GSSA 1G6YA 4XHMA 4N3ZA 4HEA2 2JZTA 3IBHA 1XW9A 2FA4A 4MPGA 3SWLA 2B7JA 4MLYA 4IW9A 3HYPA 1SENA 1V2AA 4PQIA 2H66A 3TKPA 3HJOA 3KTLA 2GQKA 2IFQB 2GDRA 2JSZA 3F8UA 3IPZA 5AGYA 1YKAA 2OJLA 4ECCA 4IQAA 3DVWA 1TXXA 1EP8A 4GQFA 4EDZA 4POBA 4F0CA 4BVYA 2QKEA 5B7CA 1KNGA 4KB3A 7GSSA 3IDVA 3C8EA 5G2ZA 1H4OA 1OC3A 1VRSD 1EOHA 1OC8A 2F3MA 4O7HA 3ZREA 4KGIA 1ACVA 1FVJA 2CX3A 4G2EA 1OE7A 2K8SA 3HVNA 4BL7B 3I43A 1M7TA 2FWEA 2MBSA 4IVFA 3WGXA 4WXTA 3HDCA 3NZNA 1M99A 2PMTA 4OCFA 3MYDA 5JCUA 2CVBA 3M0FA 5D9WA 2F8AA 5ECHB 3BCIA 1ZGNA 3QMXA 2DLXA 4GQCA 1RQMA 3CXGA 4F9ZA 3QAVA 3MAKA 4IBPA 2XHFA 6GSXA 1F3BA 4XIHA 1Q4JA 2X99A 2WDUA 1SL1B 2XBIA 3KP8A 2C0DA 3QFBC 5IQYA 2J9HA 3A2WA 3G9BA 4ILFA 5F8BA 4TR1A 2WFCA 5HR0A 4X1UA 3CRUA 3HVVA 4X43A 3GMFA 1XG8A 4MF7A 2FWGA 5CAXA 2X8HA 5CRDA 5D9TA 4HZ4A 3FW2A 3HA9A 4G0LA 1GP1A 5C04A 5KN0A 2L5OA 10GSA 3A5IA 2IFQA 2JU5A 1MDIA 3IK9A 3ZIVA 4XS1A 2KUCA 3CSHA 2AHEA 2KP2A 4CY8A 1YDKA 5JCWA 2R2JA 2DJJA 3U5RE 4GF0A 5J40A 4MZCA 2HI7A 1VF3A 4PXOA 2B1LA 1GSDA 1AC1A 2YPMA 4ZL8A 3KM6A 1XPVA 4MF5A 3MNGA 2L57A 4JRRA 1QGVA 3DEXA 1Z6MA 2CT6A 3APSA 3F0IA 3UIWA 4BL7A 4NHZA 1E2YA 1BEDA 1XWCA 2DMMA 4ZXGA 2O87A 4EL1A 4F82A 2OKAA 2YP6A 3IAM2 2IIYA 2LTKA 3IR4A 1XVQA 1A8LA 4FYCA 2ZCTA 2A2RA 4GLTA 5B8BA 1S4BP 3PGTA 2RM5A 3TOUA 3J7Yk 3Q18A 2LRNA 1VF4A 2PN8A 2PPTA 4PNGA 1ILOA 3HMJG 2VL3A 2WW1A 4K0GA 2HYXA 1MDJA 3G7IA 1GSSA 2ZNMA 5A34B 3H93A 3LFLA 1DSBA 2NDOA 3DVXA 2C3NA 2AB6A 4MZWA 1SVMA 5F05A 1PGTA 1XZOA 4YH2A 3ERFA 1K0CA 3M3MA 3WD6A 5B8AA 1ERUA 2WULA 5ECRB 3ZL5A 5IO2A 4EE0A 3VWWA 1R4WA 3EMPA 1F3AA 2CZ2A 2XPEA 1AIUA 3L9VA 2C3TA 6GSUA 1AXDA 1VF2A 4OMVA 6GSTA 1WIKA 1V57A 2YWMA 4I6XA 4KAEA 5DCGA 4CY6A 3LORA 3FZ5A 3TCOA 3ME8A 1TRWA 3KH7A 4JU5A 3GFKA 5HFGA 2C8UA 1HQOA 5ABRA 1PMTA 3RFRC 4MH3A 5BMUA 2DBCA 1GTBA 4N11A 1R26A 1X5EA 1TRVA 4BPYA 1T00A 2NPBA 3GH9A 2EFDA 3A3TA 1YJ6A 3ZRDA 1PL1A 4ECBA 4CW9A 1B4PA 4MPFA 3F4TA 4YKGA 3O6TA 3ZFBA 3GUSA 1K0MA 4TW5A 4ZB7A 3GIXA 1O85A 1PKWA 3IHQA 4TXVA 1PKZA 3GH6A 2HSHA 4V2LA 4WKWA 4CDOA 1NSWA 1DUGA 13GSA 5ECIB 4LLRA 4BWQA 3FR9A 4YAPA 4MDCA 1GH2A 2B5YA 1TU7A 1X9MB 1ZYPA 2DKHA 5E4WA 1X9WB 1R7HA 3TB2A 1BX9A 1V98A 3ZMLA 1PN0A 1V9WA 1QQ2A 3PR8A 1YKCA 2I3YA 1PD21 2LV3A 3PH9A 2GSSA 4IS0A 2VCVA 2F8FA 4G0KA 1OYJA 2WZSA 5JCGA 4FYBA 2ES7A 3G7YA 1TKDB 2VO4A 1WOUA 5KN1A 1O8WA 3EMXA 3TJKA 2VCWA 3FR3A 1SYRA 3H4KA 1U6TA 4JR4A 2VLVA 2YWOA 2B5XA 4YQUA 2L6CA 2K18A 2G0FA 1GRXA 4O5QA 2LQQA 1BJXA 4MMMA 4QL9A 2IMKA 1K0OA 5FHIA 5DAKB 4O5RA 4PI2C 5DQYA 3H1NA 1TDIA 4KDYA 4AJ8A 4MZBA 5DJMA 2N5FA 3A5WA 2AJQB 1USBA 3RBTA 3GNJA 1XW6A 3LGCA 3D4TA 2HSMB 3DYRA 3W8SA 1HD2A 5LNKe 2LUSA 1U3IA 4ZB9A 3C1SA 1F2EA 1T3BA 3RHBA 2H0IA 2VLUA 1XFLA 1Q98A 2PVQA 3KXOA 1DE1A 1BG1A 4Z2RA 5F0GA 4G01A 2YZUA 1R5PA 3H79A 4K5RA 4V1Ap 4D73B 2PWJA 1SKRB 2I4AA 1A2MA 3M9KA 1M3JA 2HFDA 2L59A 5CO3A 4ZB8A 2VCXA 4KW6A 3I9V2 1G0TA 4JR6A 1I1IP 3CWGA 3HXSA 2VCZA 3F63A 2VL9A 5HR3A 2EIQA 3ZVJD 1NW2A 4N30A 1YEPA 4PURA 2D2ZA 3SBCA 3LJRA 4J2FA 2H76A 1GNWA 4QL7A 1DBYA 3LEFA 2GSQA 3PPUA 4AI6A 2VIMA 2WW3A 4OFTA 4RI6A 4OFMA 2GZZA 3HJPA 3P7XA 5DALB 2ON5A 4WBJA 3TRPA 3QCPA 3JCML 4L5LA 5G1KA 5DAKA 4Q5QA 3TKSA 2HZEB 3D4MA 4RI7A 2J23A 1K3OA 2OT3A 2B5EA 2R0PA 2YWNA 4WR5A 4IHUA 2F9SA 2PVOC 5HQPA 3VPQA 2LEGA 3C73A 1OE8A 3CSIA 5KN3A 1T4ZA 3Q19A 4GSTA 2C4JA 4PUAA 2EFHA 1K0BA 1TU8A 3BD2A 3HJMA 1PSQA 3J7Yb 3K8NA 3LSZA 2QSIA 3QR6A 2A2PA 4K2XA 2YZHA 5DDLA 3I6AA 3UOMA 4BVXB 2H70A 2A4HA 2HLSA 5H5QA 1HNAA 2LRTA 4D73A 2OA7A 1HNCA 2GTUA 2LJRA 1NHOA 2IMIA 4AKGA 1O73A 3GA4A 3L9UA 1WPIA 4HQZA 4AJ6A 1SKWB 4ZIJA 5B6MA 5ECQB 5ID2B 1ZYNA 1IYIA 5J4UA 1LBKA 4USSA 1JZOA 1TK5B 4PQHA 3P8WA 1FW1A 4TRXA 6GSYA 1YQ1A 4NXIA 3FZAA 4EC0A 2EIRA 4EIQA 3NIVA 1N2AA 1EWXA 2O85A 4TOPA 2IPAA 5A5HB 2IJYA 1OVNA 20GSA 2FWFA 2AUVA 1C72A 5G5EA 3TKQA 1AW9A 2M46A 1FAAA 3VK9A 2JADA 3DMLA 1G7EA 2E2MA 3GHAA 3VI7A 2H30A 2HQTA 2RIIA 2VUPA 5DALA 3HZ8A 3DXBA 4MNNA 2JZSA 3DKSA 1VF1A 5IOWA 3M8NA 5ECNB 2QA2A 2HZEA 2V1MA 4PTSA 3F9UA 1UVZA 1MD4A 3IC8A 1B9YC 2LNSA 2VCTA 3EC3A 4HJ2A 3DRNA 2R4VA 5KN2A 1AQVA 5IM9A 2OACA 1EP7A 4XS4B 1OKTA 4L0WA 4JZQA 4LL4B 1KTEA 2OE3A 2VD1A 4XRDA 3GTUB 2OE1A 2R37A 4Z7XA 4QMKA 4BVXA 1GUKA 1JHBA 2H19A 4ECIA 3DIEA 2GQMA 2VD0A 2YN1A 4LMWA 4LL1B 4FQUA 2RM6A 1T4YA 2XBQA 4ZL7A 4DSRA 1K3YA 4FH8A 1HNBA 2R3XA 4TN8A 3Q74A 1SK2A 5DVBA 3V1WA 1Y6EA 4OO5A 1U3AA 4KSMA 2B6MA 2H1DA 4PI0C 2O8VB 2HT9A 2KOKA 1ZCPA 3TU3B 1X5CA 4WETA 1M9AA 3F4SA 3RAZA 4OWYA 3QAGA 2O3EA 4ML1A 1FOVA 2X8CA 5CRGA 3IK7A 1BF5A 5A5HA 3S9FA 3CTGA 3KMNA 2MYGA 5DQSA 5GAPD 1GSUA 2DMLA 4TXOB 2MMOA 4X0XA 3QD9A 2FA8A 2B7KA 5ECKB 3TJBA 5KOWA 2HNLA 2HSNB 4GSSA 4HI7A 2O7KA 1UC7A 2KHPA 3UL3A 1YY7A 3HY2A 4HS1A 3CYNA 4NMUA 2ON7A 2NVLA 3TJJA 4IN0A 2P5RA 2MMAA 4K5SA 1GUMA 3KCMA 1KEBA 1ST9A 3QAWA 4TKYA 2VAFA 2H1BA 4Q5NA 3TJGA 4AKHA 4XS4A 4PUFC 5EY6A 1T1VA 4AGSA 3PINA 3CRTA
chains in the Genus database with same CATH topology
2OE0A 1FHEA 1ZOFA 4HUAA 5IMVA 3VWVA 3OR5A 2P31A 4KCEA 1O6JA 2IWTA 1A8YA 2CAIA 2WJUA 18GSA 4KE3A 3RPPA 2EFEA 3LG6A 3VPTA 3GN3A 3MSZA 1V40A 1SK0A 2BJXA 3ZITA 1TXUA 4IJIA 3TRQA 4ZL9A 4POLA 1J0FA 2L6DA 3ZYWA 1UA5A 4ULXA 3TUEA 5IOXA 3KH9A 1BAYA 2R0CA 2VCQA 1FB0A 6GSWA 1TP9A 1K3LA 4PX1A 1TI1A 2X8GA 3L78A 1X9SB 4IP1A 3FEUA 3LYKA 1U88A 2B1KA 4KUNA 3HHVA 4JEDA 4I2UA 4ZB6A 2IL3A 3ZLPA 5DJLA 3N5OA 1M2BA 2P5QA 2E0QA 4EO3A 5GAND 4K8MA 4ZILA 5IPHA 5A34A 8GSSA 2XC2A 4P3YB 4E68A 3HD5A 4K9ZA 3W8JA 2CVKA 1O8XA 2I81A 3GL3A 5FWGA 1LU4A 3MWHA 3IXRA 1N8JA 5J47A 3E9JB 1OKDA 4K0NA 5J3RA 3ZZXA 3BCKA 5J4VA 1Z7RA 2GT5A 2YANA 2MBTA 4PGTA 5AISA 2WS2A 3EU3A 1TI3A 4KNDA 2DSAA 3TKSC 1PL2A 4ICYA 1K0DA 1F6MC 4GSNA 3EINA 1TRSA 2YV7A 4PQ1A 1K0NA 3D0ZA 5A4VA 3EVIA 3GRXA 4GCIA 2FD3A 3APOA 4Q5FA 1Z5YE 1Z3EA 5A1NB 5IMFA 1TRUA 4K7NA 5JWQB 4J57E 5D96A 3I69A 1TK0B 3CTFA 5ELGA 2YJHA 5CYYA 2FNOA 1XWAA 1GSEA 3A2XA 4TR4A 3UVTA 4Z2UA 1AAZA 14GSA 4TR0A 5HR1A 2EC4A 4WR4A 1JZRA 2V41A 1WMJA 4MK3A 4MP4A 2ZUPA 3EU4A 3FKFA 2DKIA 3VLNA 2H75A 1WRYA 2KLXA 1PX6A 1G6WA 1THOA 2GT6A 2HZFA 3KJYA 5AN1A 1I5GA 3LWAA 2C80A 5GSSA 1SYXA 4EVMA 4H86A 2GS3A 2YJ7A 2UZ8A 5EVOA 3W6GA 2X4AA 1CQGA 5IMZA 3G7JA 5F07A 1ML6A 2O89A 5D8IA 1JLVA 5ECPB 2KP1A 4DVCA 1GSQA 1Y1UA 19GSA 4F03A 17GSA 4LA1A 1XOAA 4V2MA 1J08A 2H6YA 5J9CA 4L0UA 2EIOA 2CVDA 4MJCA 2YWIA 1B4QA 5D93A 2YNXA 3TOTA 1WE0A 4OO4A 3GURA 2H73A 1YF1A 1SD9A 2RLIA 5IPGA 4K6XA 4NWYA 2L4QA 3WT1A 3ZVJA 1ERVA 4HU9A 1O81A 1JZWA 2E7PA 2I1UA 3IRAA 1B9XC 5ENUA 2LNTA 2V6OA 4BVYB 1YZXA 2LS5A 1OC9B 3QDNA 3ZIJA 5JWOB 3FYGA 3CMIA 3WT2A 1WP0A 3FZ4A 5FT3A 1TW9A 1YVLA 1SJZA 4F0BA 1QMVA 3FHKA 4W66A 2A4VA 3KIJA 4ISDA 3IE3A 1JLWA 3GX0A 4KF9A 2HSMA 2E2GA 3F6FA 1TOFA 2PUKC 5DBQA 1ZYQB 2M72A 2YV9A 3IA1A 3UARA 2H71A 3FK8A 2PU9C 3GV1A 5IMAA 4ZBDA 2H0HA 22GSA 3ZMKA 2DJ2A 5A4WA 4G9HA 1M2DA 1EZKA 4KCAA 4IQ1A 3KZQA 5ECLB 3MIXA 3DGQA 2DIZA 1PN9A 5GZZB 2C3QA 4OFNA 2H1LA 4N0ZA 3F3QA 2FCHA 1M9BA 3GSSA 5F06A 4JBBA 5EL8A 4V1Ag 5CNWA 3US3A 1ZMAA 2O5VA 1GULA 3FRCA 3C71A 3BOAA 2WGRA 1ABAA 2N5AA 4TVEA 2JL4A 1XW5A 2H6XA 1S3AA 2DIYA 1MDKA 3CBUA 5ELAA 1R5AA 1W4VA 4HZ2A 4KDUA 2L4CA 4YKFA 1OC9A 3GKKA 1M0UA 1URMA 2BTOT 5ECSA 4HOJA 1G7OA 2X64A 3IC4A 4DSSB 1GWCA 3P90A 3HVXA 16GSA 4E8HA 2GVPA 3TKRA 3D6IA 3TRXA 1SK1A 3EYTA 4N0VA 3TDGA 1S3CA 1SL0B 1SKSB 1GSYA 4DEJA 6GSVA 4MCUA 1PA3A 4E8EA 3FY7A 3QOUA 1N25A 2JSYA 2MMNA 5C00A 2R0GA 3E3EA 5JWRB 3WGDA 3L0HA 4LMVA 3F6DA 1A23A 4KDXA 4X4JA 1JZDA 2GZPA 1CQHA 2CV4A 4L5OA 5IO0A 2LQOA 3UAPA 1XOBA 3D5JA 4ML6A 5CREA 4BA7A 3GKNA 2CAQA 2LKUA 3LQ7A 4K7OA 4POMA 4MABA 4WBRD 4L8EA 2GSTA 3NOFA 1J9BA 1EGOA 2VM1A 3GKMA 1T7PB 5ID2A 5J41A 1GNEA 4EXJA 5H5RA 2QC7A 4EF0A 1Z9HA 3GSTA 4MF6A 1X0RA 4K1FA 1NM3A 1V58A 1XVWA 4AJ7A 3IV4A 2QA1A 1RK4A 4OD7A 1FG4A 3VFIA 4TR3A 4NAXA 4AF2A 5D9XA 1X5DA 2HSYA 5CRWA 1T8EB 3HKRA 3Q6OA 2DJKA 1EV4A 2CX4A 5HFKA 4ID0A 2H6ZA 3VWUA 1SVOA 2FLSA 1QFNA 2JACA 2F51A 2TRXA 5ECOB 4AKXB 1THXA 3KP9A 2LRCA 1TK8B 1YEXA 1FB6A 5HFIA 3LYPA 4FYUA 3KEBA 1WWJA 5COHA 4IJ3A 3R2QA 5BMUB 1F9MA 3UBLA 1M2AA 4DSSA 4IKHA 2OBIA 2CZ3A 3KGKA 2IMFA 3U6VA 4YQVA 2DJ3A 3DWVA 3L9SA 4N10A 3GL5A 3KTBA 2I9HA 4HU7A 2N5BA 2RUEA 3ERWA 2K8VA 12GSA 1GTUA 4EKZA 1A0RP 4GXZA 2LSTA 4KH7A 2GSRA 3GTUA 2IN3A 1DE2A 1BYEA 4RQXA 2FUG2 1A2JA 5J4YA 1B8XA 2H0GA 2GGTA 3FZ9A 1IYHA 1FO5A 3QFAC 1A24A 3WGEA 3O3TA 1EV9A 3DD3A 4HJMA 2B3SA 2V2GA 5CRHA 3C7MA 4MH2A 4FIWA 4EDYA 3IOSA 5BRTA 4O5UA 2TIRA 2HRFA 4RUVA 4G10A 3VWXA 4GTUA 3VURA 3C1RA 2H01A 4G19A 3RHCA 2LJAA 4GRFA 3KMOA 5LD0A 1EEJA 3HCZA 4IELA 3M9JA 1XWGA 3RPNA 3TJFA 1KBNA 5G30A 1GSFA 3FR6A 2WRTA 1Y25A 5J5NA 2CA8A 4TXOA 1QUWA 4ZBAA 4Q5RA 2HRKB 2EFCA 2VOCA 4YQMA 2C0FA 4EUYA 2AV4A 2K6VA 4MJBA 2WZ9A 2VLTA 2HRAA 1A0FA 2BMXA 2HSNA 3GYKA 3A2VA 1BQ7A 2H1GA 2GZYA 1SJ6A 2MMZA 3H8QA 3EURA 1XWBA 2DC5A 2UV8G 4ACSA 1MEKA 3TGZA 4DSQA 3F3RA 2IMDA 3ERGA 2A2SA 1GTIA 4K2DA 2MZCA 3F4RA 1E6BA 2FHEA 2VL2C 2PERA 2M80A 3R3EA 3ME7A 3ISOA 5J9BA 1AUCA 4QQ7A 1ZL9A 4IGJA 3EE2A 1NHYA 3CSJA 5B6NA 3UEMA 1RW1A 1MD3A 2YOIA 3ED3A 2Z9SA 4PNFA 2PGTA 1Z7PA 4XRAA 2C0EA 2P0GA 1ZYEA 1XWKA 2HXKA 5KOXA 4NV5A 1QK8A 2XPDA 2DJ0A 4GDFA 1U87A 1JFUA 2K9FA 4O32A 3D22A 2V32A 5IMCA 4FO5A 5G31A 1OAZA 3M1GA 1TJDA 2YCDA 1SVLA 5INYA 1GL8A 1B48A 4NPBA 2VKZG 2C0GA 5G1LA 4I97A 1PRXA 1I9DA 2HRNA 5EPFA 1Z6NA 4MJEA 3VI5A 2HRKA 2AYTA 3LW9A 2NBSA 2H8LA 2H74A 4XTSA 2AAWA 4Z2TA 3N9JA 1YF0A 3UBKA 4CHSA 5DCHA 5A5KA 4NV2A 4J56E 4F2IA 2C1YA 2FWHA 6GSSA 1O7UA 4I2TA 1PX7A 1XIYA 4G0IA 3AY8A 4MJAA 1AQXA 4WEYA 3P2AA 3BJ5A 4V2NA 3ZTLA 4I8BA 3QPMA 2REMA 2G2QA 2WB9A 4NHWA 3TKSE 4I5QA 4HQSA 1UN2A 4GWRA 4KA0A 1ERTA 3IAS2 3GX8A 1AQWA 4O92A 2GLRA 3MDKA 2GQLA 3EWLA 4MA9A 3ZFLA 1S3DA 2OADA 3E0UA 1PQNA 3RDWA 1LJRA 2JZRA 2VL2A 4KSOA 5IIZA 1XXUA 1QXHA 1ERWA 3D21A 2LJKA 3BBYA 1K0AA 1EGRA 4K7IA 4AKIA 4XS6A 1GUHA 2CQ9A 5E59A 4OCEA 1WJKA 3LXTA 2L5LA 3APQA 1ON4A 1FVKA 5AIVA 5GSTA 5AIXA 3WYWA 1TTZA 2FY6A 5H5SA 4JE1A 1VGLA 3O76A 5A1NA 1A2LA 1SD8A 2NTOA 3LXZA 2OBKA 5IMDA 2HE3A 3UMAA 2RUFA 5G5FA 2TRCP 1F37A 4HDEA 5L71A 2H1AA 4ECJA 5CP1A 4ZBBA 1HYUA 3FMWA 5D73A 3KD0A 1BG5A 4WF4A 2FGXA 1MTCA 2R5GA 2V6KA 2X49A 1FOHA 3UJ1A 1SL2B 4YAVA 5HR2A 2VM2A 1GTAA 1GLPA 1EOGA 2WCIA 2QGVA 1H75A 4KX4A 1SU9A 4RQRA 1XCCA 5KEJA 1XBSA 11GSA 2IMEA 2DJ1A 5D9VA 1W89A 1SJIA 2R6KA 5A4UA 1GLQA 4IP6A 2ALBA 3HVSA 3IHGA 5LCZA 2PBJA 3HZ4A 3UVHA 4BWSA 1ZZYA 3L4NA 4POKA 4EIPA 3EPTA 2H72A 4WF5A 5ECMB 4A5PA 4XCSA 3GKXA 4TR1B 1EEMA 9GSSA 1G6YA 4XHMA 4N3ZA 4HEA2 2JZTA 3IBHA 1XW9A 2FA4A 4MPGA 3SWLA 2B7JA 4MLYA 4IW9A 3HYPA 1SENA 1V2AA 4PQIA 2H66A 3TKPA 3HJOA 3KTLA 2GQKA 2IFQB 2GDRA 2JSZA 3F8UA 3IPZA 5AGYA 1YKAA 2OJLA 4ECCA 4IQAA 3DVWA 1TXXA 1EP8A 4GQFA 4EDZA 4POBA 4F0CA 4BVYA 2QKEA 5B7CA 1KNGA 4KB3A 7GSSA 3IDVA 3C8EA 5G2ZA 1H4OA 1OC3A 1VRSD 1EOHA 1OC8A 2F3MA 4O7HA 3ZREA 4KGIA 1ACVA 1FVJA 2CX3A 4G2EA 1OE7A 2K8SA 4BL7B 3I43A 1M7TA 2FWEA 2MBSA 4IVFA 3WGXA 4WXTA 3HDCA 3NZNA 1M99A 2PMTA 4OCFA 3MYDA 5JCUA 2CVBA 3M0FA 5D9WA 2F8AA 5ECHB 3BCIA 1ZGNA 3QMXA 2DLXA 4GQCA 1RQMA 3CXGA 4F9ZA 3QAVA 3MAKA 4IBPA 2XHFA 6GSXA 1F3BA 4XIHA 1Q4JA 2X99A 2WDUA 1SL1B 2XBIA 3KP8A 2C0DA 3QFBC 5IQYA 2J9HA 3A2WA 3G9BA 4ILFA 5F8BA 4TR1A 2WFCA 5HR0A 4X1UA 3CRUA 3HVVA 4X43A 3GMFA 4MF7A 2FWGA 5CAXA 2X8HA 5CRDA 5D9TA 4HZ4A 3FW2A 3HA9A 4G0LA 1GP1A 5C04A 5KN0A 2L5OA 10GSA 3A5IA 2IFQA 2JU5A 1MDIA 3IK9A 3ZIVA 4XS1A 2KUCA 3CSHA 2AHEA 2KP2A 4CY8A 1YDKA 5JCWA 2R2JA 2DJJA 3U5RE 4GF0A 5J40A 4MZCA 2HI7A 1VF3A 4PXOA 2B1LA 1GSDA 1AC1A 2YPMA 4ZL8A 3KM6A 1XPVA 4MF5A 3MNGA 2L57A 4JRRA 1QGVA 3DEXA 1Z6MA 2CT6A 3APSA 3F0IA 3UIWA 4BL7A 4NHZA 1E2YA 1BEDA 1XWCA 2DMMA 4ZXGA 2O87A 4EL1A 4F82A 2OKAA 2YP6A 3IAM2 2IIYA 2LTKA 3IR4A 1XVQA 1A8LA 4FYCA 2ZCTA 2A2RA 4GLTA 5B8BA 3PGTA 2RM5A 3TOUA 3J7Yk 3Q18A 2LRNA 1VF4A 2PN8A 2PPTA 4PNGA 1ILOA 3HMJG 2VL3A 4K0GA 2HYXA 1MDJA 3G7IA 1GSSA 2ZNMA 5A34B 3H93A 3LFLA 1DSBA 2NDOA 3DVXA 2C3NA 2AB6A 4MZWA 1SVMA 5F05A 1PGTA 1XZOA 4YH2A 3ERFA 1K0CA 3M3MA 3WD6A 5B8AA 1ERUA 2WULA 5ECRB 3ZL5A 5IO2A 4EE0A 3VWWA 1R4WA 3EMPA 1F3AA 2CZ2A 2XPEA 1AIUA 3L9VA 2C3TA 6GSUA 1AXDA 1VF2A 4OMVA 6GSTA 1WIKA 1V57A 2YWMA 4I6XA 4KAEA 5DCGA 4CY6A 3LORA 3FZ5A 3TCOA 3ME8A 1TRWA 3KH7A 4JU5A 3GFKA 5HFGA 2C8UA 1HQOA 5ABRA 1PMTA 4MH3A 5BMUA 2DBCA 1GTBA 4N11A 1R26A 1X5EA 1TRVA 4BPYA 1T00A 2NPBA 3GH9A 2EFDA 3A3TA 1YJ6A 3ZRDA 1PL1A 4ECBA 4CW9A 1B4PA 4MPFA 3F4TA 4YKGA 3O6TA 3ZFBA 3GUSA 1K0MA 4TW5A 4ZB7A 3GIXA 1O85A 1PKWA 3IHQA 4TXVA 1PKZA 3GH6A 2HSHA 4V2LA 4WKWA 4CDOA 1NSWA 1DUGA 13GSA 5ECIB 4LLRA 4BWQA 3FR9A 4YAPA 4MDCA 1GH2A 2B5YA 1TU7A 1X9MB 1ZYPA 2DKHA 5E4WA 1X9WB 1R7HA 3TB2A 1BX9A 1V98A 3ZMLA 1PN0A 1V9WA 1QQ2A 3PR8A 1YKCA 2I3YA 1PD21 2LV3A 3PH9A 2GSSA 4IS0A 2VCVA 2F8FA 4G0KA 1OYJA 5JCGA 4FYBA 2ES7A 3G7YA 1TKDB 2VO4A 1WOUA 5KN1A 1O8WA 3EMXA 3TJKA 2VCWA 3FR3A 1SYRA 3H4KA 1U6TA 4JR4A 2VLVA 2YWOA 2B5XA 4YQUA 2L6CA 2K18A 2G0FA 1GRXA 4O5QA 2LQQA 1BJXA 4MMMA 4QL9A 2IMKA 1K0OA 5FHIA 5DAKB 4O5RA 5DQYA 3H1NA 1TDIA 4KDYA 4AJ8A 4MZBA 5DJMA 2N5FA 3A5WA 2AJQB 1USBA 3RBTA 3GNJA 1XW6A 3LGCA 3D4TA 2HSMB 3DYRA 3W8SA 1HD2A 5LNKe 2LUSA 1U3IA 4ZB9A 3C1SA 1F2EA 1T3BA 3RHBA 2H0IA 2VLUA 1XFLA 1Q98A 2PVQA 3KXOA 1DE1A 1BG1A 4Z2RA 5F0GA 4G01A 2YZUA 1R5PA 3H79A 4K5RA 4V1Ap 4D73B 2PWJA 1SKRB 2I4AA 1A2MA 3M9KA 2HFDA 2L59A 5CO3A 4ZB8A 2VCXA 4KW6A 3I9V2 1G0TA 4JR6A 3CWGA 3HXSA 2VCZA 3F63A 2VL9A 5HR3A 2EIQA 3ZVJD 1NW2A 4N30A 1YEPA 4PURA 2D2ZA 3SBCA 3LJRA 4J2FA 2H76A 1GNWA 4QL7A 1DBYA 3LEFA 2GSQA 3PPUA 4AI6A 2VIMA 4OFTA 4RI6A 4OFMA 2GZZA 3HJPA 3P7XA 5DALB 2ON5A 4WBJA 3TRPA 3QCPA 3JCML 4L5LA 5G1KA 5DAKA 4Q5QA 3TKSA 2HZEB 3D4MA 4RI7A 2J23A 1K3OA 2OT3A 2B5EA 2R0PA 2YWNA 4WR5A 4IHUA 2F9SA 2PVOC 5HQPA 3VPQA 2LEGA 3C73A 1OE8A 3CSIA 5KN3A 1T4ZA 3Q19A 4GSTA 2C4JA 4PUAA 2EFHA 1K0BA 1TU8A 3BD2A 3HJMA 1PSQA 3J7Yb 3K8NA 3LSZA 2QSIA 3QR6A 2A2PA 4K2XA 2YZHA 5DDLA 3I6AA 3UOMA 4BVXB 2H70A 2A4HA 2HLSA 5H5QA 1HNAA 2LRTA 4D73A 2OA7A 1HNCA 2GTUA 2LJRA 1NHOA 2IMIA 4AKGA 1O73A 3GA4A 3L9UA 1WPIA 4HQZA 4AJ6A 1SKWB 4ZIJA 5B6MA 5ECQB 5ID2B 1ZYNA 1IYIA 5J4UA 1LBKA 4USSA 1JZOA 1TK5B 4PQHA 3P8WA 1FW1A 4TRXA 6GSYA 1YQ1A 4NXIA 3FZAA 4EC0A 2EIRA 4EIQA 3NIVA 1N2AA 1EWXA 2O85A 4TOPA 2IPAA 5A5HB 2IJYA 1OVNA 20GSA 2FWFA 2AUVA 1C72A 5G5EA 3TKQA 1AW9A 2M46A 1FAAA 3VK9A 2JADA 3DMLA 1G7EA 2E2MA 3GHAA 3VI7A 2H30A 2HQTA 2RIIA 2VUPA 5DALA 3HZ8A 3DXBA 4MNNA 2JZSA 3DKSA 1VF1A 5IOWA 3M8NA 5ECNB 2QA2A 2HZEA 2V1MA 4PTSA 3F9UA 1UVZA 1MD4A 3IC8A 1B9YC 2LNSA 2VCTA 3EC3A 4HJ2A 3DRNA 2R4VA 5KN2A 1AQVA 5IM9A 2OACA 1EP7A 4XS4B 1OKTA 4L0WA 4JZQA 4LL4B 1KTEA 2OE3A 2VD1A 4XRDA 3GTUB 2OE1A 2R37A 4Z7XA 4QMKA 4BVXA 1GUKA 1JHBA 2H19A 4ECIA 3DIEA 2GQMA 2VD0A 2YN1A 4LMWA 4LL1B 4FQUA 2RM6A 1T4YA 2XBQA 4ZL7A 4DSRA 1K3YA 4FH8A 1HNBA 2R3XA 4TN8A 3Q74A 1SK2A 5DVBA 3V1WA 1Y6EA 4OO5A 1U3AA 4KSMA 2B6MA 2H1DA 2O8VB 2HT9A 2KOKA 1ZCPA 3TU3B 1X5CA 4WETA 1M9AA 3F4SA 3RAZA 4OWYA 3QAGA 4ML1A 1FOVA 2X8CA 5CRGA 3IK7A 1BF5A 5A5HA 3S9FA 3CTGA 3KMNA 2MYGA 5DQSA 5GAPD 1GSUA 2DMLA 4TXOB 2MMOA 4X0XA 3QD9A 2FA8A 2B7KA 5ECKB 3TJBA 5KOWA 2HNLA 2HSNB 4GSSA 4HI7A 2O7KA 1UC7A 2KHPA 3UL3A 1YY7A 3HY2A 4HS1A 3CYNA 4NMUA 2ON7A 2NVLA 3TJJA 4IN0A 2P5RA 2MMAA 4K5SA 1GUMA 3KCMA 1KEBA 1ST9A 3QAWA 4TKYA 2VAFA 2H1BA 4Q5NA 3TJGA 4AKHA 4XS4A 4PUFC 5EY6A 1T1VA 4AGSA 3PINA 3CRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OE0 A;  1FHE A;  1ZOF A;  4HUA A;  5IMV A;  3VWV A;  3OR5 A;  2P31 A;  4KCE A;  1O6J A;  2IWT A;  1A8Y A;  2CAI A;  2WJU A;  18GS A;  4KE3 A;  3RPP A;  3LG6 A;  3VPT A;  3GN3 A;  3MSZ A;  1V40 A;  1SK0 A;  2BJX A;  3ZIT A;  4IJI A;  3TRQ A;  4ZL9 A;  4POL A;  1J0F A;  2L6D A;  3ZYW A;  1UA5 A;  4ULX A;  3TUE A;  5IOX A;  3KH9 A;  1BAY A;  2VCQ A;  1FB0 A;  6GSW A;  1TP9 A;  1K3L A;  4PX1 A;  1TI1 A;  2X8G A;  3L78 A;  1X9S B;  4IP1 A;  3FEU A;  3LYK A;  1U88 A;  2B1K A;  4KUN A;  3HHV A;  4JED A;  4I2U A;  4ZB6 A;  2IL3 A;  3ZLP A;  5DJL A;  3N5O A;  1M2B A;  2P5Q A;  2E0Q A;  4EO3 A;  5GAN D;  4K8M A;  4ZIL A;  5IPH A;  2XC2 A;  8GSS A;  4P3Y B;  3HD5 A;  4K9Z A;  3W8J A;  2CVK A;  1O8X A;  2I81 A;  3GL3 A;  5FWG A;  1LU4 A;  3MWH A;  3IXR A;  1N8J A;  3E9J B;  1OKD A;  4K0N A;  5J3R A;  3ZZX A;  3BCK A;  1Z7R A;  2GT5 A;  2YAN A;  2MBT A;  4PGT A;  5AIS A;  2WS2 A;  3EU3 A;  1TI3 A;  4KND A;  2DSA A;  3TKS C;  1PL2 A;  1K0D A;  1F6M C;  4GSN A;  3EIN A;  1TRS A;  2YV7 A;  4PQ1 A;  1K0N A;  3D0Z A;  5A4V A;  3EVI A;  3GRX A;  4GCI A;  2FD3 A;  3APO A;  4Q5F A;  1Z5Y E;  1Z3E A;  5IMF A;  1TRU A;  4K7N A;  5JWQ B;  4J57 E;  5D96 A;  3I69 A;  1TK0 B;  3CTF A;  5ELG A;  2YJH A;  5CYY A;  2FNO A;  1XWA A;  1GSE A;  3A2X A;  4TR4 A;  3UVT A;  1AAZ A;  14GS A;  4TR0 A;  5HR1 A;  2EC4 A;  4WR4 A;  1JZR A;  2V41 A;  1WMJ A;  4MK3 A;  4MP4 A;  2ZUP A;  3EU4 A;  3FKF A;  3VLN A;  2H75 A;  1WRY A;  2KLX A;  1PX6 A;  1G6W A;  1THO A;  2GT6 A;  2HZF A;  3KJY A;  5AN1 A;  1I5G A;  3LWA A;  2C80 A;  5GSS A;  1SYX A;  4EVM A;  4H86 A;  2GS3 A;  2YJ7 A;  2UZ8 A;  5EVO A;  3W6G A;  1CQG A;  5IMZ A;  3G7J A;  5F07 A;  1ML6 A;  2O89 A;  5D8I A;  1JLV A;  5ECP B;  2KP1 A;  4DVC A;  1GSQ A;  19GS A;  4F03 A;  17GS A;  4LA1 A;  1XOA A;  4V2M A;  1J08 A;  2H6Y A;  5J9C A;  4L0U A;  2EIO A;  2CVD A;  4MJC A;  2YWI A;  1B4Q A;  5D93 A;  2YNX A;  3TOT A;  1WE0 A;  4OO4 A;  3GUR A;  2H73 A;  1YF1 A;  1SD9 A;  2RLI A;  5IPG A;  4K6X A;  4NWY A;  2L4Q A;  3WT1 A;  3ZVJ A;  1ERV A;  4HU9 A;  1O81 A;  1JZW A;  2E7P A;  2I1U A;  3IRA A;  1B9X C;  5ENU A;  2LNT A;  2V6O A;  4BVY B;  1YZX A;  2LS5 A;  1OC9 B;  3QDN A;  3ZIJ A;  5JWO B;  3FYG A;  3CMI A;  3WT2 A;  1WP0 A;  3FZ4 A;  5FT3 A;  1TW9 A;  1SJZ A;  4F0B A;  1QMV A;  3FHK A;  2A4V A;  3KIJ A;  4ISD A;  3IE3 A;  1JLW A;  3GX0 A;  4KF9 A;  2HSM A;  2E2G A;  3F6F A;  1TOF A;  2PUK C;  5DBQ A;  1ZYQ B;  2M72 A;  2YV9 A;  3IA1 A;  3UAR A;  2H71 A;  3FK8 A;  2PU9 C;  3GV1 A;  5IMA A;  4ZBD A;  2H0H A;  22GS A;  3ZMK A;  2DJ2 A;  5A4W A;  4G9H A;  1M2D A;  1EZK A;  4KCA A;  4IQ1 A;  3KZQ A;  5ECL B;  3DGQ A;  2DIZ A;  1PN9 A;  5GZZ B;  2C3Q A;  4OFN A;  4N0Z A;  3F3Q A;  2FCH A;  1M9B A;  3GSS A;  5F06 A;  4JBB A;  5EL8 A;  4V1A g;  5CNW A;  3US3 A;  1ZMA A;  1GUL A;  3FRC A;  3C71 A;  3BOA A;  2WGR A;  1ABA A;  2N5A A;  4TVE A;  2JL4 A;  1XW5 A;  2H6X A;  1S3A A;  2DIY A;  1MDK A;  3CBU A;  5ELA A;  1R5A A;  1W4V A;  4HZ2 A;  4KDU A;  2L4C A;  1OC9 A;  3GKK A;  1M0U A;  1URM A;  2BTO T;  5ECS A;  4HOJ A;  1G7O A;  2X64 A;  3IC4 A;  4DSS B;  1GWC A;  3P90 A;  3HVX A;  16GS A;  4E8H A;  2GVP A;  3TKR A;  3D6I A;  3TRX A;  1SK1 A;  3EYT A;  4N0V A;  3TDG A;  1S3C A;  1SL0 B;  1SKS B;  1GSY A;  4DEJ A;  6GSV A;  4MCU A;  1PA3 A;  4E8E A;  3FY7 A;  3QOU A;  2JSY A;  2MMN A;  5C00 A;  3E3E A;  5JWR B;  3WGD A;  3L0H A;  4LMV A;  3F6D A;  1A23 A;  4KDX A;  1JZD A;  2GZP A;  1CQH A;  2CV4 A;  4L5O A;  5IO0 A;  2LQO A;  3UAP A;  1XOB A;  3D5J A;  4ML6 A;  5CRE A;  4BA7 A;  3GKN A;  2CAQ A;  2LKU A;  3LQ7 A;  4K7O A;  4POM A;  4MAB A;  4WBR D;  4L8E A;  2GST A;  3NOF A;  1J9B A;  1EGO A;  2VM1 A;  3GKM A;  1T7P B;  5ID2 A;  5J41 A;  1GNE A;  4EXJ A;  5H5R A;  2QC7 A;  4EF0 A;  1Z9H A;  3GST A;  4MF6 A;  1X0R A;  4K1F A;  1NM3 A;  1V58 A;  1XVW A;  4AJ7 A;  3IV4 A;  1RK4 A;  4OD7 A;  1FG4 A;  3VFI A;  4TR3 A;  4NAX A;  4AF2 A;  5D9X A;  1X5D A;  2HSY A;  5CRW A;  1T8E B;  3HKR A;  3Q6O A;  2DJK A;  1EV4 A;  2CX4 A;  5HFK A;  4ID0 A;  2H6Z A;  3VWU A;  2FLS A;  1QFN A;  2JAC A;  2F51 A;  2TRX A;  5ECO B;  1THX A;  3KP9 A;  2LRC A;  1TK8 B;  1YEX A;  1FB6 A;  5HFI A;  3LYP A;  4FYU A;  3KEB A;  1WWJ A;  5COH A;  4IJ3 A;  3R2Q A;  1F9M A;  3UBL A;  1M2A A;  4DSS A;  4IKH A;  2OBI A;  2CZ3 A;  3KGK A;  2IMF A;  3U6V A;  4YQV A;  2DJ3 A;  3DWV A;  3L9S A;  4N10 A;  3GL5 A;  3KTB A;  2I9H A;  4HU7 A;  2N5B A;  2RUE A;  3ERW A;  2K8V A;  12GS A;  1GTU A;  4EKZ A;  1A0R P;  4GXZ A;  2LST A;  4KH7 A;  2GSR A;  3GTU A;  2IN3 A;  1DE2 A;  1BYE A;  4RQX A;  2FUG 2;  1A2J A;  1B8X A;  2H0G A;  2GGT A;  3FZ9 A;  1IYH A;  1FO5 A;  3QFA C;  1A24 A;  3WGE A;  3O3T A;  1EV9 A;  4HJM A;  3DD3 A;  2B3S A;  2V2G A;  5CRH A;  3C7M A;  4MH2 A;  4FIW A;  4EDY A;  3IOS A;  2TIR A;  2HRF A;  4RUV A;  4G10 A;  3VWX A;  4GTU A;  3VUR A;  3C1R A;  2H01 A;  4G19 A;  3RHC A;  2LJA A;  4GRF A;  3KMO A;  5LD0 A;  1EEJ A;  3HCZ A;  4IEL A;  3M9J A;  1XWG A;  3RPN A;  3TJF A;  1KBN A;  5G30 A;  1GSF A;  3FR6 A;  2WRT A;  1Y25 A;  5J5N A;  2CA8 A;  4TXO A;  1QUW A;  4ZBA A;  4Q5R A;  2HRK B;  2VOC A;  4YQM A;  2C0F A;  4EUY A;  2AV4 A;  2K6V A;  4MJB A;  2WZ9 A;  2VLT A;  2HRA A;  1A0F A;  2BMX A;  3GYK A;  3A2V A;  1BQ7 A;  2H1G A;  2GZY A;  1SJ6 A;  2MMZ A;  3H8Q A;  3EUR A;  1XWB A;  2DC5 A;  4ACS A;  1MEK A;  3TGZ A;  4DSQ A;  3F3R A;  2IMD A;  4K2D A;  3ERG A;  2A2S A;  1GTI A;  2MZC A;  3F4R A;  1E6B A;  2FHE A;  2VL2 C;  2PER A;  2M80 A;  3R3E A;  3ME7 A;  3ISO A;  5J9B A;  1AUC A;  4QQ7 A;  1ZL9 A;  4IGJ A;  3EE2 A;  1NHY A;  3CSJ A;  5B6N A;  3UEM A;  1RW1 A;  1MD3 A;  2YOI A;  3ED3 A;  2Z9S A;  4PNF A;  2PGT A;  1Z7P A;  4XRA A;  2C0E A;  2P0G A;  1ZYE A;  1XWK A;  2HXK A;  4NV5 A;  1QK8 A;  2XPD A;  2DJ0 A;  1U87 A;  1JFU A;  2K9F A;  4O32 A;  3D22 A;  2V32 A;  5IMC A;  4FO5 A;  5G31 A;  1OAZ A;  3M1G A;  1TJD A;  2YCD A;  5INY A;  1GL8 A;  1B48 A;  4NPB A;  2C0G A;  5G1L A;  4I97 A;  1PRX A;  1I9D A;  2HRN A;  5EPF A;  1Z6N A;  4MJE A;  3VI5 A;  2HRK A;  2AYT A;  2NBS A;  2H8L A;  2H74 A;  4XTS A;  2AAW A;  3N9J A;  1YF0 A;  3UBK A;  4CHS A;  5DCH A;  5A5K A;  4NV2 A;  4J56 E;  4F2I A;  2C1Y A;  2FWH A;  6GSS A;  1O7U A;  4I2T A;  1PX7 A;  1XIY A;  4G0I A;  3AY8 A;  4MJA A;  1AQX A;  4WEY A;  3P2A A;  3BJ5 A;  4V2N A;  3ZTL A;  4I8B A;  3QPM A;  2REM A;  2G2Q A;  2WB9 A;  4NHW A;  3TKS E;  4I5Q A;  4HQS A;  1UN2 A;  4GWR A;  4KA0 A;  1ERT A;  3IAS 2;  3GX8 A;  1AQW A;  4O92 A;  2GLR A;  3MDK A;  2GQL A;  3EWL A;  4MA9 A;  3ZFL A;  1S3D A;  2OAD A;  3E0U A;  1PQN A;  3RDW A;  1LJR A;  2JZR A;  2VL2 A;  4KSO A;  5IIZ A;  1XXU A;  1QXH A;  1ERW A;  3D21 A;  2LJK A;  3BBY A;  1K0A A;  1EGR A;  4K7I A;  4XS6 A;  1GUH A;  2CQ9 A;  5E59 A;  4OCE A;  1WJK A;  3LXT A;  2L5L A;  3APQ A;  1ON4 A;  1FVK A;  5AIV A;  5GST A;  5AIX A;  3WYW A;  1TTZ A;  2FY6 A;  5H5S A;  4JE1 A;  1VGL A;  3O76 A;  1A2L A;  1SD8 A;  2NTO A;  3LXZ A;  2OBK A;  5IMD A;  2HE3 A;  3UMA A;  2RUF A;  5G5F A;  2TRC P;  1F37 A;  4HDE A;  5L71 A;  2H1A A;  4ECJ A;  5CP1 A;  4ZBB A;  1HYU A;  5D73 A;  3KD0 A;  1BG5 A;  4WF4 A;  2FGX A;  1MTC A;  2R5G A;  2V6K A;  3UJ1 A;  1SL2 B;  4YAV A;  5HR2 A;  2VM2 A;  1GTA A;  1GLP A;  1EOG A;  2WCI A;  2QGV A;  1H75 A;  4KX4 A;  1SU9 A;  4RQR A;  1XCC A;  5KEJ A;  1XBS A;  11GS A;  2IME A;  2DJ1 A;  5D9V A;  1W89 A;  1SJI A;  2R6K A;  5A4U A;  1GLQ A;  4IP6 A;  2ALB A;  3HVS A;  5LCZ A;  2PBJ A;  3HZ4 A;  3UVH A;  4BWS A;  1ZZY A;  3L4N A;  4POK A;  2H72 A;  4WF5 A;  5ECM B;  4XCS A;  3GKX A;  4TR1 B;  1EEM A;  9GSS A;  1G6Y A;  4XHM A;  4HEA 2;  2JZT A;  3IBH A;  1XW9 A;  2FA4 A;  4MPG A;  3SWL A;  2B7J A;  4MLY A;  4IW9 A;  3HYP A;  1SEN A;  1V2A A;  4PQI A;  2H66 A;  3TKP A;  3HJO A;  3KTL A;  2GQK A;  2IFQ B;  2GDR A;  2JSZ A;  3F8U A;  3IPZ A;  5AGY A;  1YKA A;  2OJL A;  4ECC A;  4IQA A;  3DVW A;  1TXX A;  1EP8 A;  4GQF A;  4EDZ A;  4POB A;  4F0C A;  4BVY A;  2QKE A;  5B7C A;  1KNG A;  4KB3 A;  7GSS A;  3IDV A;  3C8E A;  5G2Z A;  1H4O A;  1OC3 A;  1VRS D;  1EOH A;  1OC8 A;  2F3M A;  4O7H A;  3ZRE A;  4KGI A;  1ACV A;  1FVJ A;  2CX3 A;  4G2E A;  1OE7 A;  2K8S A;  4BL7 B;  3I43 A;  1M7T A;  2FWE A;  2MBS A;  4IVF A;  3WGX A;  4WXT A;  3HDC A;  3NZN A;  1M99 A;  2PMT A;  4OCF A;  5JCU A;  2CVB A;  3M0F A;  5D9W A;  2F8A A;  5ECH B;  3BCI A;  1ZGN A;  3QMX A;  2DLX A;  4GQC A;  1RQM A;  3CXG A;  4F9Z A;  3QAV A;  3MAK A;  4IBP A;  2XHF A;  6GSX A;  1F3B A;  4XIH A;  1Q4J A;  2X99 A;  2WDU A;  1SL1 B;  2XBI A;  3KP8 A;  2C0D A;  3QFB C;  5IQY A;  2J9H A;  3A2W A;  3G9B A;  4ILF A;  5F8B A;  4TR1 A;  2WFC A;  5HR0 A;  4X1U A;  3CRU A;  3HVV A;  4X43 A;  3GMF A;  4MF7 A;  2FWG A;  5CAX A;  2X8H A;  5CRD A;  5D9T A;  4HZ4 A;  3FW2 A;  3HA9 A;  4G0L A;  1GP1 A;  5C04 A;  5KN0 A;  2L5O A;  10GS A;  2IFQ A;  2JU5 A;  1MDI A;  3IK9 A;  3ZIV A;  4XS1 A;  2KUC A;  3CSH A;  2AHE A;  2KP2 A;  1YDK A;  5JCW A;  2R2J A;  2DJJ A;  3U5R E;  4GF0 A;  4MZC A;  2HI7 A;  1VF3 A;  4PXO A;  2B1L A;  1GSD A;  1AC1 A;  2YPM A;  4ZL8 A;  3KM6 A;  1XPV A;  4MF5 A;  3MNG A;  2L57 A;  4JRR A;  1QGV A;  3DEX A;  1Z6M A;  2CT6 A;  3APS A;  3F0I A;  3UIW A;  4BL7 A;  4NHZ A;  1E2Y A;  1BED A;  1XWC A;  2DMM A;  4ZXG A;  2O87 A;  4EL1 A;  4F82 A;  2OKA A;  2YP6 A;  3IAM 2;  2IIY A;  2LTK A;  3IR4 A;  1XVQ A;  1A8L A;  4FYC A;  2ZCT A;  2A2R A;  4GLT A;  5B8B A;  3PGT A;  2RM5 A;  3TOU A;  3J7Y k;  3Q18 A;  2LRN A;  1VF4 A;  2PN8 A;  2PPT A;  4PNG A;  1ILO A;  2VL3 A;  4K0G A;  2HYX A;  1MDJ A;  3G7I A;  1GSS A;  2ZNM A;  3H93 A;  3LFL A;  1DSB A;  2NDO A;  3DVX A;  2C3N A;  2AB6 A;  4MZW A;  5F05 A;  1PGT A;  1XZO A;  4YH2 A;  3ERF A;  1K0C A;  3M3M A;  3WD6 A;  5B8A A;  1ERU A;  2WUL A;  5ECR B;  3ZL5 A;  5IO2 A;  4EE0 A;  3VWW A;  1R4W A;  3EMP A;  1F3A A;  2CZ2 A;  2XPE A;  1AIU A;  3L9V A;  2C3T A;  6GSU A;  1AXD A;  1VF2 A;  4OMV A;  6GST A;  1WIK A;  1V57 A;  2YWM A;  4I6X A;  4KAE A;  5DCG A;  3LOR A;  3FZ5 A;  3TCO A;  3ME8 A;  1TRW A;  3KH7 A;  4JU5 A;  3GFK A;  5HFG A;  2C8U A;  1HQO A;  5ABR A;  1PMT A;  4MH3 A;  5BMU A;  2DBC A;  1GTB A;  4N11 A;  1R26 A;  1X5E A;  1TRV A;  4BPY A;  1T00 A;  2NPB A;  3GH9 A;  3A3T A;  1YJ6 A;  3ZRD A;  1PL1 A;  4ECB A;  4CW9 A;  1B4P A;  4MPF A;  3F4T A;  3O6T A;  3ZFB A;  3GUS A;  1K0M A;  4TW5 A;  3GIX A;  1O85 A;  1PKW A;  3IHQ A;  4TXV A;  1PKZ A;  3GH6 A;  2HSH A;  4V2L A;  4WKW A;  4CDO A;  1NSW A;  1DUG A;  13GS A;  5ECI B;  4LLR A;  4BWQ A;  3FR9 A;  4YAP A;  4MDC A;  1GH2 A;  2B5Y A;  1TU7 A;  1X9M B;  5E4W A;  1X9W B;  1R7H A;  3TB2 A;  1BX9 A;  1V98 A;  3ZML A;  1V9W A;  1QQ2 A;  3PR8 A;  1YKC A;  2I3Y A;  1PD2 1;  2LV3 A;  3PH9 A;  2GSS A;  4IS0 A;  2VCV A;  2F8F A;  4G0K A;  1OYJ A;  5JCG A;  4FYB A;  2ES7 A;  3G7Y A;  1TKD B;  2VO4 A;  1WOU A;  5KN1 A;  1O8W A;  3EMX A;  3TJK A;  2VCW A;  3FR3 A;  1SYR A;  3H4K A;  1U6T A;  4JR4 A;  2VLV A;  2YWO A;  2B5X A;  4YQU A;  2L6C A;  2K18 A;  2G0F A;  1GRX A;  2LQQ A;  1BJX A;  4MMM A;  4QL9 A;  2IMK A;  1K0O A;  5FHI A;  5DAK B;  4O5R A;  5DQY A;  3H1N A;  1TDI A;  4KDY A;  4AJ8 A;  4MZB A;  5DJM A;  2N5F A;  3A5W A;  2AJQ B;  1USB A;  3RBT A;  3GNJ A;  1XW6 A;  3LGC A;  3D4T A;  2HSM B;  3DYR A;  3W8S A;  1HD2 A;  5LNK e;  2LUS A;  1U3I A;  4ZB9 A;  3C1S A;  1F2E A;  1T3B A;  3RHB A;  2H0I A;  2VLU A;  1XFL A;  1Q98 A;  2PVQ A;  3KXO A;  1DE1 A;  5F0G A;  2YZU A;  1R5P A;  3H79 A;  4D73 B;  4V1A p;  2PWJ A;  1SKR B;  2I4A A;  1A2M A;  3M9K A;  2HFD A;  2L59 A;  5CO3 A;  4ZB8 A;  2VCX A;  4KW6 A;  3I9V 2;  1G0T A;  4JR6 A;  3HXS A;  2VCZ A;  3F63 A;  2VL9 A;  5HR3 A;  2EIQ A;  3ZVJ D;  1NW2 A;  4N30 A;  1YEP A;  4PUR A;  2D2Z A;  3SBC A;  3LJR A;  4J2F A;  2H76 A;  1GNW A;  4QL7 A;  1DBY A;  3LEF A;  2GSQ A;  3PPU A;  2VIM A;  4OFT A;  4RI6 A;  4OFM A;  2GZZ A;  3HJP A;  3P7X A;  5DAL B;  2ON5 A;  4WBJ A;  3TRP A;  3QCP A;  3JCM L;  4L5L A;  5G1K A;  5DAK A;  4Q5Q A;  3TKS A;  2HZE B;  3D4M A;  4RI7 A;  2J23 A;  1K3O A;  2B5E A;  2YWN A;  4WR5 A;  4IHU A;  2F9S A;  2PVO C;  5HQP A;  3VPQ A;  2LEG A;  3C73 A;  1OE8 A;  3CSI A;  5KN3 A;  1T4Z A;  3Q19 A;  4GST A;  2C4J A;  4PUA A;  1K0B A;  1TU8 A;  3BD2 A;  3HJM A;  1PSQ A;  3J7Y b;  3K8N A;  3LSZ A;  2QSI A;  3QR6 A;  2YZH A;  5DDL A;  3I6A A;  3UOM A;  4BVX B;  2H70 A;  2HLS A;  5H5Q A;  1HNA A;  2LRT A;  4D73 A;  2OA7 A;  1HNC A;  2GTU A;  2LJR A;  1NHO A;  2IMI A;  1O73 A;  3GA4 A;  3L9U A;  1WPI A;  4HQZ A;  4AJ6 A;  1SKW B;  4ZIJ A;  5B6M A;  5ECQ B;  5ID2 B;  1IYI A;  5J4U A;  1LBK A;  4USS A;  1JZO A;  1TK5 B;  4PQH A;  3P8W A;  1FW1 A;  4TRX A;  6GSY A;  1YQ1 A;  4NXI A;  3FZA A;  4EC0 A;  2EIR A;  3NIV A;  1N2A A;  1EWX A;  2O85 A;  4TOP A;  2IPA A;  2IJY A;  1OVN A;  20GS A;  2FWF A;  2AUV A;  1C72 A;  5G5E A;  3TKQ A;  1AW9 A;  2M46 A;  1FAA A;  3VK9 A;  2JAD A;  3DML A;  1G7E A;  2E2M A;  3GHA A;  3VI7 A;  2H30 A;  2HQT A;  2RII A;  2VUP A;  5DAL A;  3HZ8 A;  3DXB A;  2JZS A;  3DKS A;  1VF1 A;  5IOW A;  3M8N A;  5ECN B;  2HZE A;  2V1M A;  4PTS A;  3F9U A;  1UVZ A;  1MD4 A;  3IC8 A;  1B9Y C;  2LNS A;  2VCT A;  3EC3 A;  4HJ2 A;  3DRN A;  2R4V A;  5KN2 A;  1AQV A;  5IM9 A;  2OAC A;  1EP7 A;  4XS4 B;  1OKT A;  4L0W A;  4JZQ A;  4LL4 B;  1KTE A;  2OE3 A;  2VD1 A;  4XRD A;  3GTU B;  2OE1 A;  2R37 A;  4Z7X A;  4BVX A;  1GUK A;  1JHB A;  2H19 A;  4ECI A;  3DIE A;  2GQM A;  2VD0 A;  2YN1 A;  4LMW A;  4LL1 B;  4FQU A;  2RM6 A;  1T4Y A;  2XBQ A;  4ZL7 A;  4DSR A;  1K3Y A;  4FH8 A;  1HNB A;  2R3X A;  4TN8 A;  3Q74 A;  1SK2 A;  5DVB A;  3V1W A;  1Y6E A;  4OO5 A;  1U3A A;  4KSM A;  2B6M A;  2H1D A;  2O8V B;  2HT9 A;  2KOK A;  1ZCP A;  1X5C A;  4WET A;  1M9A A;  3F4S A;  3RAZ A;  4OWY A;  3QAG A;  4ML1 A;  1FOV A;  2X8C A;  5CRG A;  3IK7 A;  3S9F A;  3CTG A;  3KMN A;  2MYG A;  5DQS A;  5GAP D;  1GSU A;  2DML A;  4TXO B;  2MMO A;  4X0X A;  3QD9 A;  2FA8 A;  2B7K A;  5ECK B;  3TJB A;  2HNL A;  2HSN B;  4GSS A;  4HI7 A;  2O7K A;  1UC7 A;  2KHP A;  3UL3 A;  1YY7 A;  3HY2 A;  4HS1 A;  3CYN A;  4NMU A;  2ON7 A;  2NVL A;  3TJJ A;  4IN0 A;  2P5R A;  2MMA A;  1GUM A;  3KCM A;  1KEB A;  1ST9 A;  3QAW A;  4TKY A;  2VAF A;  2H1B A;  4Q5N A;  3TJG A;  4XS4 A;  4PUF C;  5EY6 A;  1T1V A;  4AGS A;  3PIN A;  3CRT A; 
#chains in the Genus database with same CATH topology
 2OE0 A;  1FHE A;  1ZOF A;  4HUA A;  5IMV A;  3VWV A;  3OR5 A;  2P31 A;  4KCE A;  1O6J A;  2IWT A;  1A8Y A;  2CAI A;  2WJU A;  1M3I A;  18GS A;  4KE3 A;  3RPP A;  2WW0 A;  2EFE A;  3LG6 A;  3VPT A;  3GN3 A;  3MSZ A;  1V40 A;  1SK0 A;  2BJX A;  3ZIT A;  1TXU A;  4IJI A;  3TRQ A;  4ZL9 A;  4POL A;  1J0F A;  2L6D A;  3ZYW A;  1UA5 A;  4ULX A;  3TUE A;  5IOX A;  3KH9 A;  1BAY A;  2R0C A;  2VCQ A;  1FB0 A;  6GSW A;  1TP9 A;  1K3L A;  4PX1 A;  1TI1 A;  4PHZ C;  2X8G A;  3L78 A;  1X9S B;  4IP1 A;  3FEU A;  3LYK A;  1U88 A;  2B1K A;  4KUN A;  3HHV A;  4JED A;  4I2U A;  4ZB6 A;  2IL3 A;  3ZLP A;  5DJL A;  3N5O A;  1M2B A;  2P5Q A;  2E0Q A;  4EO3 A;  5GAN D;  4K8M A;  4ZIL A;  5IPH A;  5A34 A;  8GSS A;  2XC2 A;  4P3Y B;  4E68 A;  3HD5 A;  4K9Z A;  3W8J A;  2CVK A;  1O8X A;  2I81 A;  3GL3 A;  5FWG A;  1LU4 A;  3MWH A;  3IXR A;  1N8J A;  5J47 A;  3E9J B;  1OKD A;  4K0N A;  5J3R A;  4HSC X;  3ZZX A;  3BCK A;  5J4V A;  1Z7R A;  2GT5 A;  2YAN A;  2MBT A;  4PGT A;  5AIS A;  2WS2 A;  3EU3 A;  1TI3 A;  4KND A;  2DSA A;  3TKS C;  1PL2 A;  4ICY A;  1K0D A;  1F6M C;  4GSN A;  3EIN A;  1TRS A;  2YV7 A;  4PQ1 A;  1K0N A;  3D0Z A;  5A4V A;  3EVI A;  3GRX A;  4GCI A;  2FD3 A;  3APO A;  4Q5F A;  1Z5Y E;  1Z3E A;  5A1N B;  5IMF A;  1TRU A;  4K7N A;  5JWQ B;  4J57 E;  5D96 A;  3I69 A;  1TK0 B;  3CTF A;  5ELG A;  2YJH A;  5CYY A;  2FNO A;  1XWA A;  1GSE A;  3A2X A;  4TR4 A;  3UVT A;  4Z2U A;  1AAZ A;  14GS A;  4TR0 A;  5HR1 A;  2EC4 A;  4WR4 A;  1JZR A;  2V41 A;  1WMJ A;  4MK3 A;  4MP4 A;  2ZUP A;  3EU4 A;  3FKF A;  2DKI A;  3VLN A;  2H75 A;  1WRY A;  2KLX A;  1PX6 A;  1G6W A;  1THO A;  2GT6 A;  2HZF A;  3KJY A;  5AN1 A;  1I5G A;  3LWA A;  2C80 A;  5GSS A;  1SYX A;  4EVM A;  4H86 A;  2GS3 A;  2YJ7 A;  2UZ8 A;  5EVO A;  3W6G A;  2X4A A;  1CQG A;  5IMZ A;  3G7J A;  5F07 A;  1ML6 A;  2O89 A;  5D8I A;  1JLV A;  5ECP B;  2KP1 A;  4DVC A;  1GSQ A;  1Y1U A;  19GS A;  4F03 A;  17GS A;  4LA1 A;  1XOA A;  4V2M A;  1J08 A;  2WVZ A;  2H6Y A;  5J9C A;  4L0U A;  2EIO A;  2CVD A;  4MJC A;  2WVX B;  2YWI A;  1B4Q A;  5D93 A;  2YNX A;  3CQF A;  3TOT A;  1WE0 A;  4OO4 A;  3GUR A;  2H73 A;  1YF1 A;  1SD9 A;  2RLI A;  5IPG A;  4K6X A;  4NWY A;  2L4Q A;  3WT1 A;  3ZVJ A;  1ERV A;  4HU9 A;  1O81 A;  1JZW A;  2E7P A;  2I1U A;  3IRA A;  1B9X C;  5ENU A;  2LNT A;  2V6O A;  4BVY B;  1YZX A;  2LS5 A;  1OC9 B;  3QDN A;  3ZIJ A;  5JWO B;  3RGB C;  3FYG A;  2WW2 A;  3CMI A;  3WT2 A;  1WP0 A;  3FZ4 A;  5FT3 A;  1TW9 A;  1YVL A;  1SJZ A;  4F0B A;  1QMV A;  3FHK A;  4W66 A;  2A4V A;  3KIJ A;  4ISD A;  3IE3 A;  1JLW A;  3GX0 A;  4KF9 A;  2HSM A;  2E2G A;  3F6F A;  1TOF A;  2PUK C;  5DBQ A;  1ZYQ B;  2M72 A;  2YV9 A;  3IA1 A;  3UAR A;  2H71 A;  3FK8 A;  2PU9 C;  3GV1 A;  5IMA A;  4ZBD A;  2H0H A;  22GS A;  3ZMK A;  2DJ2 A;  5A4W A;  4G9H A;  1M2D A;  1EZK A;  4KCA A;  4IQ1 A;  3KZQ A;  5ECL B;  3MIX A;  3DGQ A;  2DIZ A;  1PN9 A;  2WVX A;  5GZZ B;  2C3Q A;  4OFN A;  2H1L A;  4N0Z A;  3F3Q A;  2FCH A;  1M9B A;  3GSS A;  5F06 A;  4JBB A;  5EL8 A;  4V1A g;  5CNW A;  3US3 A;  1ZMA A;  2O5V A;  1GUL A;  3FRC A;  3C71 A;  3BOA A;  2WGR A;  1ABA A;  2N5A A;  4TVE A;  2JL4 A;  1XW5 A;  2H6X A;  1S3A A;  2DIY A;  1MDK A;  3CBU A;  5ELA A;  1R5A A;  1W4V A;  4HZ2 A;  4KDU A;  2L4C A;  4YKF A;  1OC9 A;  3GKK A;  1M0U A;  1URM A;  2BTO T;  5ECS A;  4HOJ A;  1G7O A;  2X64 A;  3IC4 A;  4DSS B;  1GWC A;  3P90 A;  3HVX A;  16GS A;  4E8H A;  2GVP A;  3TKR A;  3D6I A;  3TRX A;  1SK1 A;  3EYT A;  4N0V A;  3TDG A;  1S3C A;  1SL0 B;  1SKS B;  1GSY A;  4DEJ A;  6GSV A;  4MCU A;  1PA3 A;  4E8E A;  3FY7 A;  3QOU A;  1N25 A;  2JSY A;  2MMN A;  5C00 A;  2R0G A;  3E3E A;  5JWR B;  3WGD A;  3L0H A;  4LMV A;  3F6D A;  1A23 A;  4KDX A;  4X4J A;  1JZD A;  2GZP A;  1CQH A;  2CV4 A;  4L5O A;  5IO0 A;  2LQO A;  3UAP A;  1XOB A;  3D5J A;  4ML6 A;  5CRE A;  4BA7 A;  3GKN A;  2CAQ A;  2LKU A;  3LQ7 A;  4K7O A;  4POM A;  4MAB A;  4WBR D;  4L8E A;  2GST A;  3NOF A;  1J9B A;  1EGO A;  2VM1 A;  3GKM A;  1T7P B;  5ID2 A;  5J41 A;  1GNE A;  4EXJ A;  5H5R A;  2QC7 A;  4EF0 A;  1Z9H A;  3GST A;  4MF6 A;  1X0R A;  4K1F A;  1NM3 A;  1V58 A;  1XVW A;  4AJ7 A;  3IV4 A;  2QA1 A;  1RK4 A;  4OD7 A;  1FG4 A;  3VFI A;  4TR3 A;  4NAX A;  4AF2 A;  5D9X A;  1X5D A;  2HSY A;  5CRW A;  1T8E B;  3HKR A;  3Q6O A;  2DJK A;  1EV4 A;  2CX4 A;  5HFK A;  4ID0 A;  2H6Z A;  3VWU A;  1SVO A;  2FLS A;  1QFN A;  2JAC A;  2F51 A;  2TRX A;  5ECO B;  4AKX B;  1THX A;  3KP9 A;  2LRC A;  1TK8 B;  1YEX A;  1FB6 A;  5HFI A;  3LYP A;  4FYU A;  3KEB A;  1WWJ A;  5COH A;  4IJ3 A;  3R2Q A;  5BMU B;  1F9M A;  3UBL A;  1M2A A;  4DSS A;  4IKH A;  2OBI A;  2CZ3 A;  3KGK A;  2IMF A;  3U6V A;  4YQV A;  2DJ3 A;  3DWV A;  3L9S A;  4N10 A;  3GL5 A;  3KTB A;  2I9H A;  4HU7 A;  2N5B A;  2RUE A;  3ERW A;  2K8V A;  12GS A;  1GTU A;  4EKZ A;  1A0R P;  4GXZ A;  2LST A;  4KH7 A;  2GSR A;  3GTU A;  2IN3 A;  1DE2 A;  1BYE A;  4RQX A;  2FUG 2;  1A2J A;  5J4Y A;  1B8X A;  2H0G A;  2GGT A;  3FZ9 A;  1IYH A;  1FO5 A;  3QFA C;  1A24 A;  3WGE A;  3O3T A;  1EV9 A;  3DD3 A;  4HJM A;  2B3S A;  2V2G A;  5CRH A;  3C7M A;  4MH2 A;  2O36 A;  4FIW A;  4EDY A;  3IOS A;  5BRT A;  4O5U A;  2TIR A;  2HRF A;  2WVY A;  4RUV A;  4G10 A;  3VWX A;  4GTU A;  3VUR A;  3C1R A;  2H01 A;  4G19 A;  4BIK A;  3RHC A;  2LJA A;  4GRF A;  3KMO A;  5LD0 A;  1EEJ A;  3HCZ A;  4IEL A;  3M9J A;  1XWG A;  3RPN A;  3TJF A;  1KBN A;  5G30 A;  1GSF A;  3FR6 A;  2WRT A;  1Y25 A;  5J5N A;  2CA8 A;  4TXO A;  1QUW A;  4ZBA A;  4Q5R A;  2HRK B;  2EFC A;  2VOC A;  4YQM A;  2C0F A;  4EUY A;  2AV4 A;  2K6V A;  4MJB A;  2WZ9 A;  2VLT A;  2HRA A;  1A0F A;  2BMX A;  2HSN A;  3GYK A;  3A2V A;  1BQ7 A;  2H1G A;  2GZY A;  1SJ6 A;  2MMZ A;  3H8Q A;  3EUR A;  1XWB A;  2DC5 A;  2UV8 G;  4ACS A;  1MEK A;  3TGZ A;  4DSQ A;  3F3R A;  2IMD A;  3ERG A;  2A2S A;  1GTI A;  4K2D A;  2MZC A;  3F4R A;  1E6B A;  2FHE A;  2VL2 C;  2PER A;  2M80 A;  3R3E A;  3ME7 A;  3ISO A;  5J9B A;  1AUC A;  4QQ7 A;  4FXY P;  1ZL9 A;  4IGJ A;  3EE2 A;  1NHY A;  3CSJ A;  5B6N A;  3UEM A;  1RW1 A;  1MD3 A;  2YOI A;  3ED3 A;  2Z9S A;  4PNF A;  2PGT A;  1Z7P A;  4XRA A;  2C0E A;  2P0G A;  1ZYE A;  1XWK A;  2HXK A;  5KOX A;  4NV5 A;  1QK8 A;  2XPD A;  2DJ0 A;  4GDF A;  1U87 A;  1JFU A;  2K9F A;  4O32 A;  3D22 A;  1S3R A;  2V32 A;  5IMC A;  4FO5 A;  5G31 A;  1OAZ A;  3M1G A;  1TJD A;  2YCD A;  1SVL A;  5INY A;  1GL8 A;  1B48 A;  4NPB A;  2VKZ G;  2C0G A;  5G1L A;  4I97 A;  1PRX A;  1I9D A;  2HRN A;  5EPF A;  1Z6N A;  4MJE A;  3VI5 A;  2HRK A;  2AYT A;  3LW9 A;  2NBS A;  2H8L A;  2H74 A;  4XTS A;  2AAW A;  4Z2T A;  3N9J A;  1YF0 A;  3CHX C;  3UBK A;  4CHS A;  5DCH A;  5A5K A;  4NV2 A;  4J56 E;  4F2I A;  2C1Y A;  2FWH A;  6GSS A;  1O7U A;  4I2T A;  1PX7 A;  1XIY A;  4G0I A;  3AY8 A;  4MJA A;  1AQX A;  4WEY A;  3P2A A;  3BJ5 A;  4V2N A;  3ZTL A;  4I8B A;  1PFO A;  3QPM A;  2REM A;  2G2Q A;  2WB9 A;  4NHW A;  3TKS E;  1YEW C;  4I5Q A;  4HQS A;  1UN2 A;  4GWR A;  4KA0 A;  1ERT A;  3IAS 2;  3GX8 A;  1AQW A;  4O92 A;  2GLR A;  3MDK A;  2GQL A;  3EWL A;  4MA9 A;  3ZFL A;  1S3D A;  2OAD A;  3E0U A;  1PQN A;  3RDW A;  1LJR A;  2JZR A;  2VL2 A;  4KSO A;  5IIZ A;  1XXU A;  1QXH A;  1ERW A;  3D21 A;  2LJK A;  3BBY A;  1K0A A;  1EGR A;  4K7I A;  4AKI A;  4XS6 A;  1GUH A;  2CQ9 A;  5E59 A;  4OCE A;  1WJK A;  3LXT A;  2L5L A;  3APQ A;  1ON4 A;  1FVK A;  5AIV A;  5GST A;  5AIX A;  3WYW A;  1TTZ A;  2FY6 A;  5H5S A;  4JE1 A;  1VGL A;  3O76 A;  5A1N A;  1A2L A;  1SD8 A;  2NTO A;  3LXZ A;  2OBK A;  5IMD A;  2HE3 A;  3UMA A;  2RUF A;  5G5F A;  2TRC P;  1F37 A;  4HDE A;  5L71 A;  2H1A A;  4ECJ A;  5CP1 A;  4ZBB A;  1HYU A;  3FMW A;  5D73 A;  3KD0 A;  1BG5 A;  4WF4 A;  2FGX A;  1MTC A;  2R5G A;  2V6K A;  2X49 A;  1FOH A;  3UJ1 A;  1SL2 B;  4YAV A;  5HR2 A;  2VM2 A;  1GTA A;  1GLP A;  1EOG A;  2WCI A;  2QGV A;  1H75 A;  4KX4 A;  1SU9 A;  4RQR A;  1XCC A;  5KEJ A;  1XBS A;  11GS A;  2IME A;  2DJ1 A;  5D9V A;  1W89 A;  1SJI A;  2R6K A;  5A4U A;  1GLQ A;  4IP6 A;  2ALB A;  3HVS A;  3IHG A;  5LCZ A;  2PBJ A;  3HZ4 A;  3UVH A;  4BWS A;  1ZZY A;  3L4N A;  4POK A;  4EIP A;  3EPT A;  2H72 A;  4WF5 A;  5ECM B;  4A5P A;  4XCS A;  3GKX A;  4TR1 B;  1EEM A;  9GSS A;  1G6Y A;  4XHM A;  4N3Z A;  4HEA 2;  2JZT A;  3IBH A;  1XW9 A;  2FA4 A;  4MPG A;  3SWL A;  2B7J A;  4MLY A;  4IW9 A;  3HYP A;  1SEN A;  1V2A A;  4PQI A;  2H66 A;  3TKP A;  3HJO A;  3KTL A;  2GQK A;  2IFQ B;  2GDR A;  2JSZ A;  3F8U A;  3IPZ A;  5AGY A;  1YKA A;  2OJL A;  4ECC A;  4IQA A;  3DVW A;  1TXX A;  1EP8 A;  4GQF A;  4EDZ A;  4POB A;  4F0C A;  4BVY A;  2QKE A;  5B7C A;  1KNG A;  4KB3 A;  7GSS A;  3IDV A;  3C8E A;  5G2Z A;  1H4O A;  1OC3 A;  1VRS D;  1EOH A;  1OC8 A;  2F3M A;  4O7H A;  3ZRE A;  4KGI A;  1ACV A;  1FVJ A;  2CX3 A;  4G2E A;  1OE7 A;  2K8S A;  3HVN A;  4BL7 B;  3I43 A;  1M7T A;  2FWE A;  2MBS A;  4IVF A;  3WGX A;  4WXT A;  3HDC A;  3NZN A;  1M99 A;  2PMT A;  4OCF A;  3MYD A;  5JCU A;  2CVB A;  3M0F A;  5D9W A;  2F8A A;  5ECH B;  3BCI A;  1ZGN A;  3QMX A;  2DLX A;  4GQC A;  1RQM A;  3CXG A;  4F9Z A;  3QAV A;  3MAK A;  4IBP A;  2XHF A;  6GSX A;  1F3B A;  4XIH A;  1Q4J A;  2X99 A;  2WDU A;  1SL1 B;  2XBI A;  3KP8 A;  2C0D A;  3QFB C;  5IQY A;  2J9H A;  3A2W A;  3G9B A;  4ILF A;  5F8B A;  4TR1 A;  2WFC A;  5HR0 A;  4X1U A;  3CRU A;  3HVV A;  4X43 A;  3GMF A;  1XG8 A;  4MF7 A;  2FWG A;  5CAX A;  2X8H A;  5CRD A;  5D9T A;  4HZ4 A;  3FW2 A;  3HA9 A;  4G0L A;  1GP1 A;  5C04 A;  5KN0 A;  2L5O A;  10GS A;  3A5I A;  2IFQ A;  2JU5 A;  1MDI A;  3IK9 A;  3ZIV A;  4XS1 A;  2KUC A;  3CSH A;  2AHE A;  2KP2 A;  4CY8 A;  1YDK A;  5JCW A;  2R2J A;  2DJJ A;  3U5R E;  4GF0 A;  5J40 A;  4MZC A;  2HI7 A;  1VF3 A;  4PXO A;  2B1L A;  1GSD A;  1AC1 A;  2YPM A;  4ZL8 A;  3KM6 A;  1XPV A;  4MF5 A;  3MNG A;  2L57 A;  4JRR A;  1QGV A;  3DEX A;  1Z6M A;  2CT6 A;  3APS A;  3F0I A;  3UIW A;  4BL7 A;  4NHZ A;  1E2Y A;  1BED A;  1XWC A;  2DMM A;  4ZXG A;  2O87 A;  4EL1 A;  4F82 A;  2OKA A;  2YP6 A;  3IAM 2;  2IIY A;  2LTK A;  3IR4 A;  1XVQ A;  1A8L A;  4FYC A;  2ZCT A;  2A2R A;  4GLT A;  5B8B A;  1S4B P;  3PGT A;  2RM5 A;  3TOU A;  3J7Y k;  3Q18 A;  2LRN A;  1VF4 A;  2PN8 A;  2PPT A;  4PNG A;  1ILO A;  3HMJ G;  2VL3 A;  2WW1 A;  4K0G A;  2HYX A;  1MDJ A;  3G7I A;  1GSS A;  2ZNM A;  5A34 B;  3H93 A;  3LFL A;  1DSB A;  2NDO A;  3DVX A;  2C3N A;  2AB6 A;  4MZW A;  1SVM A;  5F05 A;  1PGT A;  1XZO A;  4YH2 A;  3ERF A;  1K0C A;  3M3M A;  3WD6 A;  5B8A A;  1ERU A;  2WUL A;  5ECR B;  3ZL5 A;  5IO2 A;  4EE0 A;  3VWW A;  1R4W A;  3EMP A;  1F3A A;  2CZ2 A;  2XPE A;  1AIU A;  3L9V A;  2C3T A;  6GSU A;  1AXD A;  1VF2 A;  4OMV A;  6GST A;  1WIK A;  1V57 A;  2YWM A;  4I6X A;  4KAE A;  5DCG A;  4CY6 A;  3LOR A;  3FZ5 A;  3TCO A;  3ME8 A;  1TRW A;  3KH7 A;  4JU5 A;  3GFK A;  5HFG A;  2C8U A;  1HQO A;  5ABR A;  1PMT A;  3RFR C;  4MH3 A;  5BMU A;  2DBC A;  1GTB A;  4N11 A;  1R26 A;  1X5E A;  1TRV A;  4BPY A;  1T00 A;  2NPB A;  3GH9 A;  2EFD A;  3A3T A;  1YJ6 A;  3ZRD A;  1PL1 A;  4ECB A;  4CW9 A;  1B4P A;  4MPF A;  3F4T A;  4YKG A;  3O6T A;  3ZFB A;  3GUS A;  1K0M A;  4TW5 A;  4ZB7 A;  3GIX A;  1O85 A;  1PKW A;  3IHQ A;  4TXV A;  1PKZ A;  3GH6 A;  2HSH A;  4V2L A;  4WKW A;  4CDO A;  1NSW A;  1DUG A;  13GS A;  5ECI B;  4LLR A;  4BWQ A;  3FR9 A;  4YAP A;  4MDC A;  1GH2 A;  2B5Y A;  1TU7 A;  1X9M B;  1ZYP A;  2DKH A;  5E4W A;  1X9W B;  1R7H A;  3TB2 A;  1BX9 A;  1V98 A;  3ZML A;  1PN0 A;  1V9W A;  1QQ2 A;  3PR8 A;  1YKC A;  2I3Y A;  1PD2 1;  2LV3 A;  3PH9 A;  2GSS A;  4IS0 A;  2VCV A;  2F8F A;  4G0K A;  1OYJ A;  2WZS A;  5JCG A;  4FYB A;  2ES7 A;  3G7Y A;  1TKD B;  2VO4 A;  1WOU A;  5KN1 A;  1O8W A;  3EMX A;  3TJK A;  2VCW A;  3FR3 A;  1SYR A;  3H4K A;  1U6T A;  4JR4 A;  2VLV A;  2YWO A;  2B5X A;  4YQU A;  2L6C A;  2K18 A;  2G0F A;  1GRX A;  4O5Q A;  2LQQ A;  1BJX A;  4MMM A;  4QL9 A;  2IMK A;  1K0O A;  5FHI A;  5DAK B;  4O5R A;  4PI2 C;  5DQY A;  3H1N A;  1TDI A;  4KDY A;  4AJ8 A;  4MZB A;  5DJM A;  2N5F A;  3A5W A;  2AJQ B;  1USB A;  3RBT A;  3GNJ A;  1XW6 A;  3LGC A;  3D4T A;  2HSM B;  3DYR A;  3W8S A;  1HD2 A;  5LNK e;  2LUS A;  1U3I A;  4ZB9 A;  3C1S A;  1F2E A;  1T3B A;  3RHB A;  2H0I A;  2VLU A;  1XFL A;  1Q98 A;  2PVQ A;  3KXO A;  1DE1 A;  1BG1 A;  4Z2R A;  5F0G A;  4G01 A;  2YZU A;  1R5P A;  3H79 A;  4K5R A;  4V1A p;  4D73 B;  2PWJ A;  1SKR B;  2I4A A;  1A2M A;  3M9K A;  1M3J A;  2HFD A;  2L59 A;  5CO3 A;  4ZB8 A;  2VCX A;  4KW6 A;  3I9V 2;  1G0T A;  4JR6 A;  1I1I P;  3CWG A;  3HXS A;  2VCZ A;  3F63 A;  2VL9 A;  5HR3 A;  2EIQ A;  3ZVJ D;  1NW2 A;  4N30 A;  1YEP A;  4PUR A;  2D2Z A;  3SBC A;  3LJR A;  4J2F A;  2H76 A;  1GNW A;  4QL7 A;  1DBY A;  3LEF A;  2GSQ A;  3PPU A;  4AI6 A;  2VIM A;  2WW3 A;  4OFT A;  4RI6 A;  4OFM A;  2GZZ A;  3HJP A;  3P7X A;  5DAL B;  2ON5 A;  4WBJ A;  3TRP A;  3QCP A;  3JCM L;  4L5L A;  5G1K A;  5DAK A;  4Q5Q A;  3TKS A;  2HZE B;  3D4M A;  4RI7 A;  2J23 A;  1K3O A;  2OT3 A;  2B5E A;  2R0P A;  2YWN A;  4WR5 A;  4IHU A;  2F9S A;  2PVO C;  5HQP A;  3VPQ A;  2LEG A;  3C73 A;  1OE8 A;  3CSI A;  5KN3 A;  1T4Z A;  3Q19 A;  4GST A;  2C4J A;  4PUA A;  2EFH A;  1K0B A;  1TU8 A;  3BD2 A;  3HJM A;  1PSQ A;  3J7Y b;  3K8N A;  3LSZ A;  2QSI A;  3QR6 A;  2A2P A;  4K2X A;  2YZH A;  5DDL A;  3I6A A;  3UOM A;  4BVX B;  2H70 A;  2A4H A;  2HLS A;  5H5Q A;  1HNA A;  2LRT A;  4D73 A;  2OA7 A;  1HNC A;  2GTU A;  2LJR A;  1NHO A;  2IMI A;  4AKG A;  1O73 A;  3GA4 A;  3L9U A;  1WPI A;  4HQZ A;  4AJ6 A;  1SKW B;  4ZIJ A;  5B6M A;  5ECQ B;  5ID2 B;  1ZYN A;  1IYI A;  5J4U A;  1LBK A;  4USS A;  1JZO A;  1TK5 B;  4PQH A;  3P8W A;  1FW1 A;  4TRX A;  6GSY A;  1YQ1 A;  4NXI A;  3FZA A;  4EC0 A;  2EIR A;  4EIQ A;  3NIV A;  1N2A A;  1EWX A;  2O85 A;  4TOP A;  2IPA A;  5A5H B;  2IJY A;  1OVN A;  20GS A;  2FWF A;  2AUV A;  1C72 A;  5G5E A;  3TKQ A;  1AW9 A;  2M46 A;  1FAA A;  3VK9 A;  2JAD A;  3DML A;  1G7E A;  2E2M A;  3GHA A;  3VI7 A;  2H30 A;  2HQT A;  2RII A;  2VUP A;  5DAL A;  3HZ8 A;  3DXB A;  4MNN A;  2JZS A;  3DKS A;  1VF1 A;  5IOW A;  3M8N A;  5ECN B;  2QA2 A;  2HZE A;  2V1M A;  4PTS A;  3F9U A;  1UVZ A;  1MD4 A;  3IC8 A;  1B9Y C;  2LNS A;  2VCT A;  3EC3 A;  4HJ2 A;  3DRN A;  2R4V A;  5KN2 A;  1AQV A;  5IM9 A;  2OAC A;  1EP7 A;  4XS4 B;  1OKT A;  4L0W A;  4JZQ A;  4LL4 B;  1KTE A;  2OE3 A;  2VD1 A;  4XRD A;  3GTU B;  2OE1 A;  2R37 A;  4Z7X A;  4QMK A;  4BVX A;  1GUK A;  1JHB A;  2H19 A;  4ECI A;  3DIE A;  2GQM A;  2VD0 A;  2YN1 A;  4LMW A;  4LL1 B;  4FQU A;  2RM6 A;  1T4Y A;  2XBQ A;  4ZL7 A;  4DSR A;  1K3Y A;  4FH8 A;  1HNB A;  2R3X A;  4TN8 A;  3Q74 A;  1SK2 A;  5DVB A;  3V1W A;  1Y6E A;  4OO5 A;  1U3A A;  4KSM A;  2B6M A;  2H1D A;  4PI0 C;  2O8V B;  2HT9 A;  2KOK A;  1ZCP A;  3TU3 B;  1X5C A;  4WET A;  1M9A A;  3F4S A;  3RAZ A;  4OWY A;  3QAG A;  2O3E A;  4ML1 A;  1FOV A;  2X8C A;  5CRG A;  3IK7 A;  1BF5 A;  5A5H A;  3S9F A;  3CTG A;  3KMN A;  2MYG A;  5DQS A;  5GAP D;  1GSU A;  2DML A;  4TXO B;  2MMO A;  4X0X A;  3QD9 A;  2FA8 A;  2B7K A;  5ECK B;  3TJB A;  5KOW A;  2HNL A;  2HSN B;  4GSS A;  4HI7 A;  2O7K A;  1UC7 A;  2KHP A;  3UL3 A;  1YY7 A;  3HY2 A;  4HS1 A;  3CYN A;  4NMU A;  2ON7 A;  2NVL A;  3TJJ A;  4IN0 A;  2P5R A;  2MMA A;  4K5S A;  1GUM A;  3KCM A;  1KEB A;  1ST9 A;  3QAW A;  4TKY A;  2VAF A;  2H1B A;  4Q5N A;  3TJG A;  4AKH A;  4XS4 A;  4PUF C;  5EY6 A;  1T1V A;  4AGS A;  3PIN A;  3CRT A; 
#chains in the Genus database with same CATH homology
 2OE0 A;  1FHE A;  1ZOF A;  4HUA A;  5IMV A;  3VWV A;  3OR5 A;  2P31 A;  4KCE A;  1O6J A;  2IWT A;  1A8Y A;  2CAI A;  2WJU A;  18GS A;  4KE3 A;  3RPP A;  2EFE A;  3LG6 A;  3VPT A;  3GN3 A;  3MSZ A;  1V40 A;  1SK0 A;  2BJX A;  3ZIT A;  1TXU A;  4IJI A;  3TRQ A;  4ZL9 A;  4POL A;  1J0F A;  2L6D A;  3ZYW A;  1UA5 A;  4ULX A;  3TUE A;  5IOX A;  3KH9 A;  1BAY A;  2R0C A;  2VCQ A;  1FB0 A;  6GSW A;  1TP9 A;  1K3L A;  4PX1 A;  1TI1 A;  2X8G A;  3L78 A;  1X9S B;  4IP1 A;  3FEU A;  3LYK A;  1U88 A;  2B1K A;  4KUN A;  3HHV A;  4JED A;  4I2U A;  4ZB6 A;  2IL3 A;  3ZLP A;  5DJL A;  3N5O A;  1M2B A;  2P5Q A;  2E0Q A;  4EO3 A;  5GAN D;  4K8M A;  4ZIL A;  5IPH A;  5A34 A;  8GSS A;  2XC2 A;  4P3Y B;  4E68 A;  3HD5 A;  4K9Z A;  3W8J A;  2CVK A;  1O8X A;  2I81 A;  3GL3 A;  5FWG A;  1LU4 A;  3MWH A;  3IXR A;  1N8J A;  5J47 A;  3E9J B;  1OKD A;  4K0N A;  5J3R A;  3ZZX A;  3BCK A;  5J4V A;  1Z7R A;  2GT5 A;  2YAN A;  2MBT A;  4PGT A;  5AIS A;  2WS2 A;  3EU3 A;  1TI3 A;  4KND A;  2DSA A;  3TKS C;  1PL2 A;  4ICY A;  1K0D A;  1F6M C;  4GSN A;  3EIN A;  1TRS A;  2YV7 A;  4PQ1 A;  1K0N A;  3D0Z A;  5A4V A;  3EVI A;  3GRX A;  4GCI A;  2FD3 A;  3APO A;  4Q5F A;  1Z5Y E;  1Z3E A;  5A1N B;  5IMF A;  1TRU A;  4K7N A;  5JWQ B;  4J57 E;  5D96 A;  3I69 A;  1TK0 B;  3CTF A;  5ELG A;  2YJH A;  5CYY A;  2FNO A;  1XWA A;  1GSE A;  3A2X A;  4TR4 A;  3UVT A;  4Z2U A;  1AAZ A;  14GS A;  4TR0 A;  5HR1 A;  2EC4 A;  4WR4 A;  1JZR A;  2V41 A;  1WMJ A;  4MK3 A;  4MP4 A;  2ZUP A;  3EU4 A;  3FKF A;  2DKI A;  3VLN A;  2H75 A;  1WRY A;  2KLX A;  1PX6 A;  1G6W A;  1THO A;  2GT6 A;  2HZF A;  3KJY A;  5AN1 A;  1I5G A;  3LWA A;  2C80 A;  5GSS A;  1SYX A;  4EVM A;  4H86 A;  2GS3 A;  2YJ7 A;  2UZ8 A;  5EVO A;  3W6G A;  2X4A A;  1CQG A;  5IMZ A;  3G7J A;  5F07 A;  1ML6 A;  2O89 A;  5D8I A;  1JLV A;  5ECP B;  2KP1 A;  4DVC A;  1GSQ A;  1Y1U A;  19GS A;  4F03 A;  17GS A;  4LA1 A;  1XOA A;  4V2M A;  1J08 A;  2H6Y A;  5J9C A;  4L0U A;  2EIO A;  2CVD A;  4MJC A;  2YWI A;  1B4Q A;  5D93 A;  2YNX A;  3TOT A;  1WE0 A;  4OO4 A;  3GUR A;  2H73 A;  1YF1 A;  1SD9 A;  2RLI A;  5IPG A;  4K6X A;  4NWY A;  2L4Q A;  3WT1 A;  3ZVJ A;  1ERV A;  4HU9 A;  1O81 A;  1JZW A;  2E7P A;  2I1U A;  3IRA A;  1B9X C;  5ENU A;  2LNT A;  2V6O A;  4BVY B;  1YZX A;  2LS5 A;  1OC9 B;  3QDN A;  3ZIJ A;  5JWO B;  3FYG A;  3CMI A;  3WT2 A;  1WP0 A;  3FZ4 A;  5FT3 A;  1TW9 A;  1YVL A;  1SJZ A;  4F0B A;  1QMV A;  3FHK A;  4W66 A;  2A4V A;  3KIJ A;  4ISD A;  3IE3 A;  1JLW A;  3GX0 A;  4KF9 A;  2HSM A;  2E2G A;  3F6F A;  1TOF A;  2PUK C;  5DBQ A;  1ZYQ B;  2M72 A;  2YV9 A;  3IA1 A;  3UAR A;  2H71 A;  3FK8 A;  2PU9 C;  3GV1 A;  5IMA A;  4ZBD A;  2H0H A;  22GS A;  3ZMK A;  2DJ2 A;  5A4W A;  4G9H A;  1M2D A;  1EZK A;  4KCA A;  4IQ1 A;  3KZQ A;  5ECL B;  3MIX A;  3DGQ A;  2DIZ A;  1PN9 A;  5GZZ B;  2C3Q A;  4OFN A;  2H1L A;  4N0Z A;  3F3Q A;  2FCH A;  1M9B A;  3GSS A;  5F06 A;  4JBB A;  5EL8 A;  4V1A g;  5CNW A;  3US3 A;  1ZMA A;  2O5V A;  1GUL A;  3FRC A;  3C71 A;  3BOA A;  2WGR A;  1ABA A;  2N5A A;  4TVE A;  2JL4 A;  1XW5 A;  2H6X A;  1S3A A;  2DIY A;  1MDK A;  3CBU A;  5ELA A;  1R5A A;  1W4V A;  4HZ2 A;  4KDU A;  2L4C A;  4YKF A;  1OC9 A;  3GKK A;  1M0U A;  1URM A;  2BTO T;  5ECS A;  4HOJ A;  1G7O A;  2X64 A;  3IC4 A;  4DSS B;  1GWC A;  3P90 A;  3HVX A;  16GS A;  4E8H A;  2GVP A;  3TKR A;  3D6I A;  3TRX A;  1SK1 A;  3EYT A;  4N0V A;  3TDG A;  1S3C A;  1SL0 B;  1SKS B;  1GSY A;  4DEJ A;  6GSV A;  4MCU A;  1PA3 A;  4E8E A;  3FY7 A;  3QOU A;  1N25 A;  2JSY A;  2MMN A;  5C00 A;  2R0G A;  3E3E A;  5JWR B;  3WGD A;  3L0H A;  4LMV A;  3F6D A;  1A23 A;  4KDX A;  4X4J A;  1JZD A;  2GZP A;  1CQH A;  2CV4 A;  4L5O A;  5IO0 A;  2LQO A;  3UAP A;  1XOB A;  3D5J A;  4ML6 A;  5CRE A;  4BA7 A;  3GKN A;  2CAQ A;  2LKU A;  3LQ7 A;  4K7O A;  4POM A;  4MAB A;  4WBR D;  4L8E A;  2GST A;  3NOF A;  1J9B A;  1EGO A;  2VM1 A;  3GKM A;  1T7P B;  5ID2 A;  5J41 A;  1GNE A;  4EXJ A;  5H5R A;  2QC7 A;  4EF0 A;  1Z9H A;  3GST A;  4MF6 A;  1X0R A;  4K1F A;  1NM3 A;  1V58 A;  1XVW A;  4AJ7 A;  3IV4 A;  2QA1 A;  1RK4 A;  4OD7 A;  1FG4 A;  3VFI A;  4TR3 A;  4NAX A;  4AF2 A;  5D9X A;  1X5D A;  2HSY A;  5CRW A;  1T8E B;  3HKR A;  3Q6O A;  2DJK A;  1EV4 A;  2CX4 A;  5HFK A;  4ID0 A;  2H6Z A;  3VWU A;  1SVO A;  2FLS A;  1QFN A;  2JAC A;  2F51 A;  2TRX A;  5ECO B;  4AKX B;  1THX A;  3KP9 A;  2LRC A;  1TK8 B;  1YEX A;  1FB6 A;  5HFI A;  3LYP A;  4FYU A;  3KEB A;  1WWJ A;  5COH A;  4IJ3 A;  3R2Q A;  5BMU B;  1F9M A;  3UBL A;  1M2A A;  4DSS A;  4IKH A;  2OBI A;  2CZ3 A;  3KGK A;  2IMF A;  3U6V A;  4YQV A;  2DJ3 A;  3DWV A;  3L9S A;  4N10 A;  3GL5 A;  3KTB A;  2I9H A;  4HU7 A;  2N5B A;  2RUE A;  3ERW A;  2K8V A;  12GS A;  1GTU A;  4EKZ A;  1A0R P;  4GXZ A;  2LST A;  4KH7 A;  2GSR A;  3GTU A;  2IN3 A;  1DE2 A;  1BYE A;  4RQX A;  2FUG 2;  1A2J A;  5J4Y A;  1B8X A;  2H0G A;  2GGT A;  3FZ9 A;  1IYH A;  1FO5 A;  3QFA C;  1A24 A;  3WGE A;  3O3T A;  1EV9 A;  3DD3 A;  4HJM A;  2B3S A;  2V2G A;  5CRH A;  3C7M A;  4MH2 A;  4FIW A;  4EDY A;  3IOS A;  5BRT A;  4O5U A;  2TIR A;  2HRF A;  4RUV A;  4G10 A;  3VWX A;  4GTU A;  3VUR A;  3C1R A;  2H01 A;  4G19 A;  3RHC A;  2LJA A;  4GRF A;  3KMO A;  5LD0 A;  1EEJ A;  3HCZ A;  4IEL A;  3M9J A;  1XWG A;  3RPN A;  3TJF A;  1KBN A;  5G30 A;  1GSF A;  3FR6 A;  2WRT A;  1Y25 A;  5J5N A;  2CA8 A;  4TXO A;  1QUW A;  4ZBA A;  4Q5R A;  2HRK B;  2EFC A;  2VOC A;  4YQM A;  2C0F A;  4EUY A;  2AV4 A;  2K6V A;  4MJB A;  2WZ9 A;  2VLT A;  2HRA A;  1A0F A;  2BMX A;  2HSN A;  3GYK A;  3A2V A;  1BQ7 A;  2H1G A;  2GZY A;  1SJ6 A;  2MMZ A;  3H8Q A;  3EUR A;  1XWB A;  2DC5 A;  2UV8 G;  4ACS A;  1MEK A;  3TGZ A;  4DSQ A;  3F3R A;  2IMD A;  3ERG A;  2A2S A;  1GTI A;  4K2D A;  2MZC A;  3F4R A;  1E6B A;  2FHE A;  2VL2 C;  2PER A;  2M80 A;  3R3E A;  3ME7 A;  3ISO A;  5J9B A;  1AUC A;  4QQ7 A;  1ZL9 A;  4IGJ A;  3EE2 A;  1NHY A;  3CSJ A;  5B6N A;  3UEM A;  1RW1 A;  1MD3 A;  2YOI A;  3ED3 A;  2Z9S A;  4PNF A;  2PGT A;  1Z7P A;  4XRA A;  2C0E A;  2P0G A;  1ZYE A;  1XWK A;  2HXK A;  5KOX A;  4NV5 A;  1QK8 A;  2XPD A;  2DJ0 A;  4GDF A;  1U87 A;  1JFU A;  2K9F A;  4O32 A;  3D22 A;  2V32 A;  5IMC A;  4FO5 A;  5G31 A;  1OAZ A;  3M1G A;  1TJD A;  2YCD A;  1SVL A;  5INY A;  1GL8 A;  1B48 A;  4NPB A;  2VKZ G;  2C0G A;  5G1L A;  4I97 A;  1PRX A;  1I9D A;  2HRN A;  5EPF A;  1Z6N A;  4MJE A;  3VI5 A;  2HRK A;  2AYT A;  3LW9 A;  2NBS A;  2H8L A;  2H74 A;  4XTS A;  2AAW A;  4Z2T A;  3N9J A;  1YF0 A;  3UBK A;  4CHS A;  5DCH A;  5A5K A;  4NV2 A;  4J56 E;  4F2I A;  2C1Y A;  2FWH A;  6GSS A;  1O7U A;  4I2T A;  1PX7 A;  1XIY A;  4G0I A;  3AY8 A;  4MJA A;  1AQX A;  4WEY A;  3P2A A;  3BJ5 A;  4V2N A;  3ZTL A;  4I8B A;  3QPM A;  2REM A;  2G2Q A;  2WB9 A;  4NHW A;  3TKS E;  4I5Q A;  4HQS A;  1UN2 A;  4GWR A;  4KA0 A;  1ERT A;  3IAS 2;  3GX8 A;  1AQW A;  4O92 A;  2GLR A;  3MDK A;  2GQL A;  3EWL A;  4MA9 A;  3ZFL A;  1S3D A;  2OAD A;  3E0U A;  1PQN A;  3RDW A;  1LJR A;  2JZR A;  2VL2 A;  4KSO A;  5IIZ A;  1XXU A;  1QXH A;  1ERW A;  3D21 A;  2LJK A;  3BBY A;  1K0A A;  1EGR A;  4K7I A;  4AKI A;  4XS6 A;  1GUH A;  2CQ9 A;  5E59 A;  4OCE A;  1WJK A;  3LXT A;  2L5L A;  3APQ A;  1ON4 A;  1FVK A;  5AIV A;  5GST A;  5AIX A;  3WYW A;  1TTZ A;  2FY6 A;  5H5S A;  4JE1 A;  1VGL A;  3O76 A;  5A1N A;  1A2L A;  1SD8 A;  2NTO A;  3LXZ A;  2OBK A;  5IMD A;  2HE3 A;  3UMA A;  2RUF A;  5G5F A;  2TRC P;  1F37 A;  4HDE A;  5L71 A;  2H1A A;  4ECJ A;  5CP1 A;  4ZBB A;  1HYU A;  3FMW A;  5D73 A;  3KD0 A;  1BG5 A;  4WF4 A;  2FGX A;  1MTC A;  2R5G A;  2V6K A;  2X49 A;  1FOH A;  3UJ1 A;  1SL2 B;  4YAV A;  5HR2 A;  2VM2 A;  1GTA A;  1GLP A;  1EOG A;  2WCI A;  2QGV A;  1H75 A;  4KX4 A;  1SU9 A;  4RQR A;  1XCC A;  5KEJ A;  1XBS A;  11GS A;  2IME A;  2DJ1 A;  5D9V A;  1W89 A;  1SJI A;  2R6K A;  5A4U A;  1GLQ A;  4IP6 A;  2ALB A;  3HVS A;  3IHG A;  5LCZ A;  2PBJ A;  3HZ4 A;  3UVH A;  4BWS A;  1ZZY A;  3L4N A;  4POK A;  4EIP A;  3EPT A;  2H72 A;  4WF5 A;  5ECM B;  4A5P A;  4XCS A;  3GKX A;  4TR1 B;  1EEM A;  9GSS A;  1G6Y A;  4XHM A;  4N3Z A;  4HEA 2;  2JZT A;  3IBH A;  1XW9 A;  2FA4 A;  4MPG A;  3SWL A;  2B7J A;  4MLY A;  4IW9 A;  3HYP A;  1SEN A;  1V2A A;  4PQI A;  2H66 A;  3TKP A;  3HJO A;  3KTL A;  2GQK A;  2IFQ B;  2GDR A;  2JSZ A;  3F8U A;  3IPZ A;  5AGY A;  1YKA A;  2OJL A;  4ECC A;  4IQA A;  3DVW A;  1TXX A;  1EP8 A;  4GQF A;  4EDZ A;  4POB A;  4F0C A;  4BVY A;  2QKE A;  5B7C A;  1KNG A;  4KB3 A;  7GSS A;  3IDV A;  3C8E A;  5G2Z A;  1H4O A;  1OC3 A;  1VRS D;  1EOH A;  1OC8 A;  2F3M A;  4O7H A;  3ZRE A;  4KGI A;  1ACV A;  1FVJ A;  2CX3 A;  4G2E A;  1OE7 A;  2K8S A;  4BL7 B;  3I43 A;  1M7T A;  2FWE A;  2MBS A;  4IVF A;  3WGX A;  4WXT A;  3HDC A;  3NZN A;  1M99 A;  2PMT A;  4OCF A;  3MYD A;  5JCU A;  2CVB A;  3M0F A;  5D9W A;  2F8A A;  5ECH B;  3BCI A;  1ZGN A;  3QMX A;  2DLX A;  4GQC A;  1RQM A;  3CXG A;  4F9Z A;  3QAV A;  3MAK A;  4IBP A;  2XHF A;  6GSX A;  1F3B A;  4XIH A;  1Q4J A;  2X99 A;  2WDU A;  1SL1 B;  2XBI A;  3KP8 A;  2C0D A;  3QFB C;  5IQY A;  2J9H A;  3A2W A;  3G9B A;  4ILF A;  5F8B A;  4TR1 A;  2WFC A;  5HR0 A;  4X1U A;  3CRU A;  3HVV A;  4X43 A;  3GMF A;  4MF7 A;  2FWG A;  5CAX A;  2X8H A;  5CRD A;  5D9T A;  4HZ4 A;  3FW2 A;  3HA9 A;  4G0L A;  1GP1 A;  5C04 A;  5KN0 A;  2L5O A;  10GS A;  3A5I A;  2IFQ A;  2JU5 A;  1MDI A;  3IK9 A;  3ZIV A;  4XS1 A;  2KUC A;  3CSH A;  2AHE A;  2KP2 A;  4CY8 A;  1YDK A;  5JCW A;  2R2J A;  2DJJ A;  3U5R E;  4GF0 A;  5J40 A;  4MZC A;  2HI7 A;  1VF3 A;  4PXO A;  2B1L A;  1GSD A;  1AC1 A;  2YPM A;  4ZL8 A;  3KM6 A;  1XPV A;  4MF5 A;  3MNG A;  2L57 A;  4JRR A;  1QGV A;  3DEX A;  1Z6M A;  2CT6 A;  3APS A;  3F0I A;  3UIW A;  4BL7 A;  4NHZ A;  1E2Y A;  1BED A;  1XWC A;  2DMM A;  4ZXG A;  2O87 A;  4EL1 A;  4F82 A;  2OKA A;  2YP6 A;  3IAM 2;  2IIY A;  2LTK A;  3IR4 A;  1XVQ A;  1A8L A;  4FYC A;  2ZCT A;  2A2R A;  4GLT A;  5B8B A;  3PGT A;  2RM5 A;  3TOU A;  3J7Y k;  3Q18 A;  2LRN A;  1VF4 A;  2PN8 A;  2PPT A;  4PNG A;  1ILO A;  3HMJ G;  2VL3 A;  4K0G A;  2HYX A;  1MDJ A;  3G7I A;  1GSS A;  2ZNM A;  5A34 B;  3H93 A;  3LFL A;  1DSB A;  2NDO A;  3DVX A;  2C3N A;  2AB6 A;  4MZW A;  1SVM A;  5F05 A;  1PGT A;  1XZO A;  4YH2 A;  3ERF A;  1K0C A;  3M3M A;  3WD6 A;  5B8A A;  1ERU A;  2WUL A;  5ECR B;  3ZL5 A;  5IO2 A;  4EE0 A;  3VWW A;  1R4W A;  3EMP A;  1F3A A;  2CZ2 A;  2XPE A;  1AIU A;  3L9V A;  2C3T A;  6GSU A;  1AXD A;  1VF2 A;  4OMV A;  6GST A;  1WIK A;  1V57 A;  2YWM A;  4I6X A;  4KAE A;  5DCG A;  4CY6 A;  3LOR A;  3FZ5 A;  3TCO A;  3ME8 A;  1TRW A;  3KH7 A;  4JU5 A;  3GFK A;  5HFG A;  2C8U A;  1HQO A;  5ABR A;  1PMT A;  4MH3 A;  5BMU A;  2DBC A;  1GTB A;  4N11 A;  1R26 A;  1X5E A;  1TRV A;  4BPY A;  1T00 A;  2NPB A;  3GH9 A;  2EFD A;  3A3T A;  1YJ6 A;  3ZRD A;  1PL1 A;  4ECB A;  4CW9 A;  1B4P A;  4MPF A;  3F4T A;  4YKG A;  3O6T A;  3ZFB A;  3GUS A;  1K0M A;  4TW5 A;  4ZB7 A;  3GIX A;  1O85 A;  1PKW A;  3IHQ A;  4TXV A;  1PKZ A;  3GH6 A;  2HSH A;  4V2L A;  4WKW A;  4CDO A;  1NSW A;  1DUG A;  13GS A;  5ECI B;  4LLR A;  4BWQ A;  3FR9 A;  4YAP A;  4MDC A;  1GH2 A;  2B5Y A;  1TU7 A;  1X9M B;  1ZYP A;  2DKH A;  5E4W A;  1X9W B;  1R7H A;  3TB2 A;  1BX9 A;  1V98 A;  3ZML A;  1PN0 A;  1V9W A;  1QQ2 A;  3PR8 A;  1YKC A;  2I3Y A;  1PD2 1;  2LV3 A;  3PH9 A;  2GSS A;  4IS0 A;  2VCV A;  2F8F A;  4G0K A;  1OYJ A;  5JCG A;  4FYB A;  2ES7 A;  3G7Y A;  1TKD B;  2VO4 A;  1WOU A;  5KN1 A;  1O8W A;  3EMX A;  3TJK A;  2VCW A;  3FR3 A;  1SYR A;  3H4K A;  1U6T A;  4JR4 A;  2VLV A;  2YWO A;  2B5X A;  4YQU A;  2L6C A;  2K18 A;  2G0F A;  1GRX A;  4O5Q A;  2LQQ A;  1BJX A;  4MMM A;  4QL9 A;  2IMK A;  1K0O A;  5FHI A;  5DAK B;  4O5R A;  5DQY A;  3H1N A;  1TDI A;  4KDY A;  4AJ8 A;  4MZB A;  5DJM A;  2N5F A;  3A5W A;  2AJQ B;  1USB A;  3RBT A;  3GNJ A;  1XW6 A;  3LGC A;  3D4T A;  2HSM B;  3DYR A;  3W8S A;  1HD2 A;  5LNK e;  2LUS A;  1U3I A;  4ZB9 A;  3C1S A;  1F2E A;  1T3B A;  3RHB A;  2H0I A;  2VLU A;  1XFL A;  1Q98 A;  2PVQ A;  3KXO A;  1DE1 A;  1BG1 A;  4Z2R A;  5F0G A;  4G01 A;  2YZU A;  1R5P A;  3H79 A;  4K5R A;  4V1A p;  4D73 B;  2PWJ A;  1SKR B;  2I4A A;  1A2M A;  3M9K A;  2HFD A;  2L59 A;  5CO3 A;  4ZB8 A;  2VCX A;  4KW6 A;  3I9V 2;  1G0T A;  4JR6 A;  3CWG A;  3HXS A;  2VCZ A;  3F63 A;  2VL9 A;  5HR3 A;  2EIQ A;  3ZVJ D;  1NW2 A;  4N30 A;  1YEP A;  4PUR A;  2D2Z A;  3SBC A;  3LJR A;  4J2F A;  2H76 A;  1GNW A;  4QL7 A;  1DBY A;  3LEF A;  2GSQ A;  3PPU A;  4AI6 A;  2VIM A;  4OFT A;  4RI6 A;  4OFM A;  2GZZ A;  3HJP A;  3P7X A;  5DAL B;  2ON5 A;  4WBJ A;  3TRP A;  3QCP A;  3JCM L;  4L5L A;  5G1K A;  5DAK A;  4Q5Q A;  3TKS A;  2HZE B;  3D4M A;  4RI7 A;  2J23 A;  1K3O A;  2OT3 A;  2B5E A;  2R0P A;  2YWN A;  4WR5 A;  4IHU A;  2F9S A;  2PVO C;  5HQP A;  3VPQ A;  2LEG A;  3C73 A;  1OE8 A;  3CSI A;  5KN3 A;  1T4Z A;  3Q19 A;  4GST A;  2C4J A;  4PUA A;  2EFH A;  1K0B A;  1TU8 A;  3BD2 A;  3HJM A;  1PSQ A;  3J7Y b;  3K8N A;  3LSZ A;  2QSI A;  3QR6 A;  2A2P A;  4K2X A;  2YZH A;  5DDL A;  3I6A A;  3UOM A;  4BVX B;  2H70 A;  2A4H A;  2HLS A;  5H5Q A;  1HNA A;  2LRT A;  4D73 A;  2OA7 A;  1HNC A;  2GTU A;  2LJR A;  1NHO A;  2IMI A;  4AKG A;  1O73 A;  3GA4 A;  3L9U A;  1WPI A;  4HQZ A;  4AJ6 A;  1SKW B;  4ZIJ A;  5B6M A;  5ECQ B;  5ID2 B;  1ZYN A;  1IYI A;  5J4U A;  1LBK A;  4USS A;  1JZO A;  1TK5 B;  4PQH A;  3P8W A;  1FW1 A;  4TRX A;  6GSY A;  1YQ1 A;  4NXI A;  3FZA A;  4EC0 A;  2EIR A;  4EIQ A;  3NIV A;  1N2A A;  1EWX A;  2O85 A;  4TOP A;  2IPA A;  5A5H B;  2IJY A;  1OVN A;  20GS A;  2FWF A;  2AUV A;  1C72 A;  5G5E A;  3TKQ A;  1AW9 A;  2M46 A;  1FAA A;  3VK9 A;  2JAD A;  3DML A;  1G7E A;  2E2M A;  3GHA A;  3VI7 A;  2H30 A;  2HQT A;  2RII A;  2VUP A;  5DAL A;  3HZ8 A;  3DXB A;  4MNN A;  2JZS A;  3DKS A;  1VF1 A;  5IOW A;  3M8N A;  5ECN B;  2QA2 A;  2HZE A;  2V1M A;  4PTS A;  3F9U A;  1UVZ A;  1MD4 A;  3IC8 A;  1B9Y C;  2LNS A;  2VCT A;  3EC3 A;  4HJ2 A;  3DRN A;  2R4V A;  5KN2 A;  1AQV A;  5IM9 A;  2OAC A;  1EP7 A;  4XS4 B;  1OKT A;  4L0W A;  4JZQ A;  4LL4 B;  1KTE A;  2OE3 A;  2VD1 A;  4XRD A;  3GTU B;  2OE1 A;  2R37 A;  4Z7X A;  4QMK A;  4BVX A;  1GUK A;  1JHB A;  2H19 A;  4ECI A;  3DIE A;  2GQM A;  2VD0 A;  2YN1 A;  4LMW A;  4LL1 B;  4FQU A;  2RM6 A;  1T4Y A;  2XBQ A;  4ZL7 A;  4DSR A;  1K3Y A;  4FH8 A;  1HNB A;  2R3X A;  4TN8 A;  3Q74 A;  1SK2 A;  5DVB A;  3V1W A;  1Y6E A;  4OO5 A;  1U3A A;  4KSM A;  2B6M A;  2H1D A;  2O8V B;  2HT9 A;  2KOK A;  1ZCP A;  3TU3 B;  1X5C A;  4WET A;  1M9A A;  3F4S A;  3RAZ A;  4OWY A;  3QAG A;  4ML1 A;  1FOV A;  2X8C A;  5CRG A;  3IK7 A;  1BF5 A;  5A5H A;  3S9F A;  3CTG A;  3KMN A;  2MYG A;  5DQS A;  5GAP D;  1GSU A;  2DML A;  4TXO B;  2MMO A;  4X0X A;  3QD9 A;  2FA8 A;  2B7K A;  5ECK B;  3TJB A;  5KOW A;  2HNL A;  2HSN B;  4GSS A;  4HI7 A;  2O7K A;  1UC7 A;  2KHP A;  3UL3 A;  1YY7 A;  3HY2 A;  4HS1 A;  3CYN A;  4NMU A;  2ON7 A;  2NVL A;  3TJJ A;  4IN0 A;  2P5R A;  2MMA A;  4K5S A;  1GUM A;  3KCM A;  1KEB A;  1ST9 A;  3QAW A;  4TKY A;  2VAF A;  2H1B A;  4Q5N A;  3TJG A;  4AKH A;  4XS4 A;  4PUF C;  5EY6 A;  1T1V A;  4AGS A;  3PIN A;  3CRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...