3M3PA

Crystal structure of glutamine amido transferase from methylobacillus flagellatus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
249
structure length
249
Chain Sequence
SLKPVMIIQFSASEGPGHFGDFLAGEHIPFQVLRMDRSDPLPAEIRDCSGLAMMGGPMSANDDLPWMPTLLALIRDAVAQRVPVIGHCLGGQLLAKAMGGEVTDSPHAEIGWVRAWPQHVPQALEWLGTWDELELFEWHYQTFSIPPGAVHILRSEHCANQAYVLDDLHIGFQCHIEMQAHMVREWCSISPEELKGGAEADPAQPMVQSAVEILRDLDVRIATLNRWAEHVYARWIKGLQREGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glutamine amido transferase from Methylobacillus Flagellatus
rcsb
source organism Methylobacillus flagellatus
molecule tags Transferase
molecule keywords Glutamine amido transferase
total genus 69
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3m3pA00
2WJZB 1T36B 3CNEA 2A9VA 1Q7RA 4B7AA 2YWCA 3MGKA 4AUNA 4ENRA 4RKWA 4ENPA 3L3BA 1QDLB 4OIFA 3MIIA 4R7GA 3TTSA 2IUFA 4UZSA 3RHTA 1PE0A 4N12A 2VDJA 1SY7A 4OJYA 2NV0A 4B5KA 2R1VA 3SF8B 4QYXA 4P35A 1I7SB 1FY2A 4BTEA 2RK4A 3EN0A 4P2GA 5JZOA 4Y1EA 1QVWA 2FEXA 4RKYA 1VHQA 4ENUA 1BXRB 2R1TA 2ZUSA 1UCFA 3D54D 3TTWA 1R9GA 2R1TB 1QWSA 1PDVA 4XLLA 4P36A 1A9XB 2W7TA 3P9PA 4I4NA 3OT1B 3F71A 4JQSA 4P34A 3R76A 3OT1A 4OGFA 2RK6A 3EWNA 1U9CA 1OX4A 1KXJA 3TTXA 3ZR4B 4I2NA 5SY6A 4GUDA 3VU3A 2ZUUA 3R74A 1I1QB 1VCMA 3R75A 1N57A 4N0MA 2RK3A 4ZDIA 1PV2A 3EJ6A 3P9SA 4UOQA 4MGHA 3TTTA 4E5VA 4ZDKA 3UMMA 4WINA 5K4AA 2OR3A 3CYFA 4I46A 3NVAA 3BWEA 3NOOA 2NV2B 3NORA 1GGEA 3UK7A 4K2HA 4ENVA 1QF7A 4UOZA 3EZGA 3EFEA 4ADSG 2YWJA 4B2YA 1IZYA 1J42A 3CY6A 1K9VF 1CS0B 3L4EA 3UGJA 2GK3A 4B31A 3B3AA 3PQ7A 3CZ9A 2VKTA 5SY4A 5LIRA 4WXYB 3F5DA 1VCNA 3PQ2A 3PQ4A 4L8YA 1IZZA 1OX4B 4ENTA 2YWDA 4L7QA 1JDBC 1P81A 2YWBA 3TTUA 3B36A 1C3OB 4LRUA 1PDWA 4OGGA 4AULA 4L8FA 3L18A 1KWKA 4LGYA 5SYAA 2XF2A 4L78A 3GRAA 1GGJA 3UOWA 2ZUWA 4MNTA 4AJ9A 5JZMA 1G2IA 3M3PA 4OFWA 4OQ4A 3PQ8A 4QYTA 4S0ZA 1KEEB 4Y1RB 2V4UA 1GGKA 3PQ5A 1FYEA 4Y1RA 2VXOA 3TTYA 2ZUVA 3CZAA 4UNIA 5BV2P 1O1YA 1P7ZA 1Q2UA 4UCFA 2GHRA 3ZJ5A 4AUMA 1I7QB 4AUEA 4B40A 4ZGGA 1CF9A 3SOZA 3NONA 1ONSA 4L95C 4ENQA 1T3TA 2H2WA 2LXNA 3KKLA 5E9AA 4BIMA 1GG9A 4Y1GA 2ZUTA 2D7JA 1P5FA 4D1YA 2R1UA 1M6VB 1IPHA 1QVZA 1T0BA 4Y0NA 4P5PA 4L8WB 4ENWA 1JVNA 3B38A 3BHNA 3P9RA 4BFLA 3UJNA 1OY1A 1OX5A 2AB0A 1KA9H 4MTCA 4ENSA 3L7NA 1GPMA 1GPWB 1S1MA 5DFAA 1GGFA 2ABWA 2VRNA 3FIJA 1KWGA 1SOAA 3FSEA 2ISSD 1OX6A 2VPIA 3TQIA 4PXYA 1CE8B 1P7YA 4GE3A 2AD5A 1L9XA 3PQ6A 4Y1FA 1P80A 2R1VB 5SY9A 1WL8A 3SF8A 4E08A 1OI4A 3ER6A 3NOVA 4HCJA 1VCOA 4GE0A 5IP5A 3ZJ4A 1C30B 3PQ3A 3N7TA 3TTVA 3P9QA 3WFZA 1GGHA 3NOQA 1QVVA 4ZDJA
chains in the Genus database with same CATH superfamily
1EBFA 2C8LA 4BGEA 4F7WA 1OVGA 3MSXA 1U9IC 3GLGB 4NPCA 1FVFA 2DH6A 2Q3BA 4GOMD 5HA5A 2HN9A 1TYDE 1SXQA 4CV2A 5LZ4A 2JGDA 4YJFA 2MOKA 3G2KA 1B43A 2YR0A 3W5BA 1SBTA 3RYFB 2D62A 3PEFA 3PPXA 5FPPA 1A0OA 3BMXA 1VZ2A 2AXEA 3PIDA 3ZPXA 4DC9A 1UKAA 2HLPA 1Y3DE 3LM8A 4JBHA 4B5LA 4L4SA 3TR6A 1Y8CA 4PSKA 2JVKA 1HOTA 5IEJA 5FEMA 1W1IA 2IX9A 1RM0A 3P5SA 4BX2A 1ID8A 4HH3C 4XM1A 3HFGA 3OLWA 1RLIA 3SJAA 4BUJA 1E7WA 2EFJA 3A70A 5HQTA 1EDDA 1RXIA 4O4IF 1J7KA 4JUCA 1QV6A 3O1IC 1KDRA 2AOUA 5FPYA 5I4CA 1GJRA 4RC9A 4B3GA 3DEAA 5EUCA 4ZOQI 3ZDEA 1H6AA 2X5NA 3LC2O 5DTIA 4GKKB 4X7MA 2EGUA 4Q7JB 4TV8A 3RDPA 2DUJA 2I2FA 1JHYA 3ABSB 2QHXA 3IO5A 3KZMA 1TL7C 5EMHA 4OUKX 4S35A 3L1JA 3HYNA 4PZAA 1UBRS 2BFWA 5DIZA 4MYTA 1KZ7B 1QAMA 1S8FA 5J1TB 4EGFA 1B14A 2PGJA 4RE5A 3ZIAA 4YV0A 1G63A 4Y9TA 2ZDGA 3H3XA 5CD9A 4XUEA 3CUYA 2IYUA 1LSOA 4RVSA 1L7BA 4DB2A 3QU4A 3I6QA 3A11A 5B7GA 1Y4SA 2GZAA 5E1DA 1L1QA 5CUQA 4W5RA 1KJZA 3RM3A 4QPNA 5IG2A 2QN9A 4RVOA 4KLZA 2GTIA 2ZG6A 3ENKA 4L0CA 4GXRA 5FTWA 3U3XA 3WGJA 5I51A 1YFLA 2GM5A 1KWKA 2XXAA 3MINA 3TEMA 3H4IA 1U8AA 4MUJA 4H0NA 4IJUA 3BC1A 4L78A 4CCWA 3C39A 3H5RA 2WOOA 1YK0A 4KQEA 4EB0A 1C8LA 4IVRA 4IIJF 1U63A 3IO3A 4MV0A 1LPPA 1QH1B 4D42A 3W9BA 1KI7A 2HMYB 4BBPA 2FY8A 1L8OA 3NB0A 1LTKA 1QQ5A 4REQB 1MX3A 4DR4B 1T5SA 4QNMA 3VJMA 3T3NA 2A9RA 4UBKA 3BT7A 4MIYA 2QZZA 4HNAA 3OTOB 4RVDA 1VKOA 1IULA 1BRTA 4TWZA 3VR3A 3ZKWA 3AEYA 3N8NA 3AGQA 4YMHA 3P20A 2OAEA 1T0UA 1ES9A 1M6VB 4AZSA 5B1EA 2IS4A 2HK9A 4L22A 3D6HA 2WG1A 4P38A 4EH1A 4LCJA 1K8XB 3R7LA 3T3HA 3R3ZA 2VSOA 2ZRAA 4X8HA 3H11A 4OXRA 4ZT3A 3UMVA 3ZE8A 1KQFA 2AYXA 4Q3NA 2AS0A 3F9RA 1KP2A 1U7OA 2J3HA 2WVGA 3ELWA 3JQQA 1KTIA 4LYAA 1EWKA 1HPLA 2BFAA 2Q9UA 4EUHA 1YR7A 4RVHA 4NBVA 1SUIA 2AE2A 1K75A 5CTJA 3GLFA 1JA1A 1E3WA 1JIUA 4FYYA 4N3AA 4UU1A 5IN5A 3A9SA 5KNBA 1FFXB 1D9XA 2GSWA 2I29A 2MU1A 2RIRA 1I94B 1DBQA 4RVCA 4Z53A 1N92A 1FU7A 2D3TA 2EU8A 1XQ1A 1UOQA 1Z5PA 3EMBA 1RPJA 1PO7A 3CKLA 4QPZA 3RPEA 4MLCA 1T9CA 3KWMA 5SZJA 2VTBB 3A2MA 3DE5X 1EFAA 3A6JA 3OPQA 4JBIA 3RRMA 3HJAA 4FDAA 4PS0A 3R7NA 3EG5A 1CEYA 2APJA 3ILXA 4F5ZA 2GF9A 3R3VA 2H4YA 1GCUA 2Q62A 1L5SA 3CRRA 4GI3A 2YHUA 4CKXA 1EIWA 1M2VB 4Q21A 1D6NA 1R9GA 2WJ3A 1NVBA 1SK8A 4R3WA 4EWLA 2FR0A 4QU5A 5CM8B 1XZLA 2E0IA 3F90A 5F5NA 3ZWQA 5AQ1A 1IEVA 1XNJA 2IYZA 3BAZA 1AHNA 3FHTA 2NZ2A 1FFAA 4LW8A 2HC9A 3H4TA 3DVRX 3A3PA 1A8QA 3KEFA 4OHFA 4UHHA 4URHA 2YBEA 4PC2A 4DMRA 1QHYA 1JAYA 2FPGA 1MJFA 2EQ5A 1GHTA 1QOQB 1RM3A 2OFOA 4V2UA 5EJ8A 2BGWA 4J6FA 2OO3A 4E46A 4P33A 4E70A 3HXPA 4EYSA 4HWGA 3BIFA 4GMHA 1RRMA 4MVJG 1KIMA 2WIBA 1J23A 3NJ8A 4NNPA 2J9RA 1HDRA 1KVUA 2V7VA 4DE5A 2C5BA 1D2CA 1SRRA 4A0GA 6ABPA 2G08A 1WO8A 2H2FA 1FC0A 1YQEA 3QXHA 4DM7A 1TOAA 3HVJA 3EXIB 2GPBA 1KKLA 4JWKA 4YRKA 2RGEA 2YINC 2Z98A 4I1YA 2Q1WA 4OGGA 2IOYA 1IZ0A 3T7TA 4V0OA 5KDOA 3I52A 1QP7A 4K2AA 4LHWA 5KU1A 5H3LA 1DBWA 2JZNA 4PG4A 1QH8A 3MMXA 1Z5UA 4QBKA 5JD6A 4IHKA 3UMCA 2PH7A 2FPPB 2XI4A 4TV8F 3X44A 4C4ZA 3I76A 1MG0A 1SC4A 3PXCX 1VL2A 3TECE 4B3MB 4FQ5A 4YDSA 3IIJA 3MMNA 1O1YA 2WTNA 2X2OA 3BL5A 5ECWA 1LLCA 2ZZKA 3ZCPA 4EGQA 4F4FA 4RVUA 1XALA 4RDXA 1DWOA 2P6MA 4UEJA 4M0PA 4CT4B 1VBNA 4M0FA 3GY0A 3WGMA 2I7CA 4JHLA 1PW5A 1DDIA 1Z0FA 4G0NA 4PHTA 1H2ZA 4UM8B 5TEVA 3S1AB 1EM8A 4C08A 5TMDA 5KQRA 4YV1A 2KI5A 3CCBA 1JQAA 3CX6A 1KQOA 4UZEA 1LTQA 4G2NA 4M49A 3QFTA 4M6WA 4ZKDA 1Q0UA 1BCSB 4ISBA 2YNMD 2RAFA 3NPMA 1Q14A 4KAAA 1SOAA 2ZI3A 3B2QA 3BXEA 3OAAD 1CJMA 1EJ6A 4RPHA 1JHAA 4J4BA 4WN3A 3V34A 4YYEA 3G8DA 3MW8A 1XU7A 3P4XA 3ZHZA 4BKUA 3WYAA 2WK1A 4EPXA 4WBXC 2XRYA 3HY4A 4XB2A 3MRTA 3FHOA 2HO5A 2XWPA 4WUTA 3FDZB 2AFIE 3O0TA 4IYJA 1QR6A 4NMWA 1X77A 3GWGA 4B2IA 2JIPA 4DVGA 4X3CA 3VFDA 1FLVA 4YGYA 1D5CA 2GZ3A 1YB6A 4I4CA 4C21A 2G7MC 4YMVA 1P44A 1HDOA 2QG6A 3DO8A 2JGDB 3UC9A 2AJTA 1A8HA 1SGWA 2NVBA 1DC5A 3C5CA 2OQRA 4L57A 1GUFA 2KM1A 2YXDA 3S2EA 2J0VA 1NN3A 1OYWA 4ESOA 4W5HA 3WA7A 3N2GB 4O5OA 1U2SA 3OY7A 4BV9A 2CMGA 2ODTX 2ACEA 3DKKA 1FVHA 3Q5EA 3TR5A 5A62A 4O4HF 2JARA 1KQPA 3AHGA 3EN0A 5AJHA 4HD8A 3SQOA 4Q7QA 3ANMA 2IY9A 2FG5A 1CUWA 2B0JA 3N05A 1LZKA 4MQ5A 3TBHA 1KDPA 1XWWA 2QLFA 4FYPA 4NMXB 5E4FA 3WHPA 5AXDA 3SYKA 3GD5A 4OXQA 4YK7A 4KR7A 1MFPA 2VOJA 4AUKA 4BFVA 1D1SA 2D0DA 4HEHA 2I9PA 3A6ZA 2JBHA 3C3YA 4I1IA 3ZI4A 2Q8QA 4YIHA 2OC4A 3CH4B 1CUJA 3GHYA 2B4TO 1LJ8A 1C9MA 1J49A 3HEBA 3UICA 5JJLA 4MCHA 3DEIA 3AKYA 3NVAA 4BQFA 4ZYUA 3ONVA 3TEFA 4H6PA 4ZVQA 1J0XO 5FV7A 4ENSA 3ANXA 3L4BA 2HTEA 1UAYA 2R79A 3EFEA 3REQB 2ZPAA 4BC1A 2NPFA 3WXMA 2ZPUA 7MDHA 4XSHA 2ZDHA 1EXNA 4L75A 4Y6LA 3RC8A 1GL7A 3QEKA 1JDJA 3T4XA 5B7QA 2XDYA 2B35A 3WA6A 4X7BA 3O8OB 4A6XA 2CUTA 4HPXB 3EG9B 5HQ3B 2AG6A 1O0SA 3E53A 1E4VA 4P53A 4X85A 1U3UA 5KCMA 3SSNA 1C3OB 1E6CA 1PIWA 4JOQA 4P7GA 4QUBA 1FNNA 4ER3A 2RH8A 3N0XA 3OU7A 3PWSA 1RBZA 4KZKA 1Z5ZA 3AH8A 3RHZA 3S4YA 2QIOA 3BFVA 3K0BA 1E62A 2Q6IA 3H9CA 4LE0A 5IEBA 1XX6A 2B4QA 2W9XA 2UZ1A 1P73A 4L5AA 4LJ7A 3T94A 2FFAA 2B36A 3HXLA 1U2PA 2GX6A 1EP1B 4M9CA 2VDOB 3KJQA 3L0YA 3OHPA 1PQ4A 2WNIA 4MHTA 2G76A 2ZS8A 5BN5A 1J5PA 5HBGA 2QR3A 2WNSA 4X93A 4EMBA 3F4BA 1K6XA 4CNBA 4QQNA 2R8OA 3QE9Y 2D5AA 4JOSA 3NEPX 4LQDA 4L0MA 2XQKA 4PVDA 4A8JA 4CV0A 5AJXA 4GM0A 3OX3A 1VRWA 3OQ6A 2CN1A 4EHKA 1FFDA 1V41E 2JFPA 4KQJA 4N0EA 4F84A 1IB6A 2OZEA 2BSAA 3KSDO 2VWHA 4JOBA 2FVXA 2QRNA 3AG5A 4AMUA 3BAFA 5MHTA 1UBTS 1XUOA 3DVSX 2YQ5A 4JXJA 2RI6A 2OECA 4MA5A 3E4CA 3V2UA 1IBSA 4H17A 3KZKA 3VR4A 3KTAB 5A7GA 1WY5A 5GADl 3LWDA 2BFEA 3GLFB 3AG6A 2R00C 2YNMA 3NNSA 4MVJI 4GE0A 1HNNA 2FTKE 1Z8HA 2J31A 2XLCA 3BB1A 3COSA 2V7EA 3REQA 4DIDA 2XVYA 1A8PA 2OKCA 3OPXA 4OBBA 5CNIA 3RKUA 1Y8ZA 4BJ5A 1NASA 4L16A 2NUBA 1G8PA 1JSRA 1O54A 4RKWA 2WBLC 4XJTA 3SC6A 3HXQA 3C1UA 2PZMA 5REQB 4MW4A 4PQRA 2FLVA 3BFJA 5H83A 5IXJA 2GPSA 1JPNA 4E07A 2NTJA 3CKMA 5ALUA 2I34A 4BZWA 3ZDQA 1XC7A 5GIPE 3F3SA 2EX4A 4IV0A 2YKGA 3QE3A 4BLTA 2A5LA 2AFHA 5KTTA 4QXOA 1DO8A 2G9RA 2RK4A 3I01A 1ZH8A 1WSDA 3L8HA 4F2WA 1KI6B 4X20A 1YTLA 5KKAA 3VKGA 4JSYA 3BGWA 4KODA 1CTQA 2J0EA 3Q7IA 4FR5A 4GR5A 4LDQA 5EL0A 2UZ3A 1PX0A 5C31A 2H2DA 3H3FA 4YLGA 2HCTA 3MINB 3IDFA 2VHWA 2YY7A 1L5WA 1T3HA 3P71T 5A0FA 4EG6A 3CWCA 3OU6A 4AK9A 2BTEA 3TW4A 2HW8A 1TMOA 2XYPA 1CR4A 1LA2A 4NPHA 3I1FA 1CJKC 1H1LA 1BW9A 5TR9A 1YRAA 1E0AA 2CMFA 1FP4A 3M6LA 4A92A 3L6BA 2DTXA 3LU1A 5A5DA 1JLHA 1Z6GA 2EYQA 2PBRA 2XWQA 3EDRA 5KIAA 5DTJA 1AXGA 1H0SA 2W6ZA 1YQTA 2PFGA 4EEZA 3LDHA 3LSYA 1J2YA 3MBKA 5JPDA 5K8IA 1NMYA 1DHRA 1DXQA 2WDPA 1KEWA 4GO1A 1NW3A 3B5IA 4IR7A 4V0QA 3QHAA 1JTEA 4HQLA 2P91A 1KOGA 2WD9A 1U8TA 1VA4A 4QICA 4BLPA 1XRQA 5AKYA 4O4IA 3DP7A 1B0AA 2W5UA 3H9UA 3OJXA 4L8YA 2FLWA 1ZMTA 2EBFX 5IJ9B 3K1AA 4LWPA 5COQA 5BMVB 3HO1A 3KTAA 4IJVA 4U02A 4HNUA 4NBSA 1VSVA 4AN0A 4CM8A 2GESA 2BH9A 2JATA 4OB8A 3IODA 1UUFA 1BOOA 1E7RA 2J09A 4TV9F 4AAYA 4Q66C 5BR8B 2CXSA 1U0EA 1XHFA 2BDUA 3BH0A 5GJCA 2EP5A 2XUJA 1LKZA 4KV7A 2PN1A 5C4GB 1LVUA 2PS0A 3KTDA 5AK5A 1QF6A 1Z5NA 1EUDA 2WOJA 4WY2A 5TEWA 4DIOA 2BAGA 4NCJA 2IK8A 1NZDA 1V6SA 1WLYA 1M2HA 3GP5A 2XNHA 2VUTA 1ZGAA 5B1DA 5JFOA 3ADCA 1C7FA 3E9RA 1CF9A 1KBOA 1YZFA 3DMNA 2G9QA 5ALQA 1BCRB 1R74A 2PSJA 3DXZA 3ZE1B 1TVCA 2B4KA 4D4LA 3W3ZB 4W5QA 1T6YA 2JZOA 3H8SA 4EW6A 4QEDA 3LS2A 1SOVA 1XYGA 2HCFA 1TTPB 4FSHA 5BNIA 3VV3A 4UBJA 3G8CA 4HOYA 2R7AA 3NH6A 1HDGO 1UBUS 3UQZA 3O7WA 1BMTA 3IDOA 2WAOA 3P2YA 4J0IA 3F46A 1PNTA 13PKA 1WXIA 5IJXA 3HKCB 3WHIA 1JRLA 4E5YA 4YLYA 2O3RA 4WTOA 3ESBA 3WOVA 5ICEA 3UG7A 2VG8A 1W46A 2WWTA 3L41A 1JEEA 1LDMA 5CPBA 5ARCA 4IS2A 3IYLW 4L5BA 3PGMA 1VJDA 4PPYA 2VUIB 4IDEA 2ZJ7A 4LDNA 1R10A 1X15A 2QL6A 5D3QA 2ZTSA 2X8BA 4OCZA 3I9MA 4JCOA 3DBOB 4K8RB 1L8QA 3BH6A 2SKDA 1G7TA 4LQ4A 2WABA 3RK0A 4KR3A 2GJ8A 3COWA 2TMGA 3QLUC 3B9RA 4N6OA 1RYYA 3CM0A 1BAPA 4KJXA 5K0FA 3H6HA 5AKZA 2EJUA 3FPFA 4HAWA 5G3ZA 4AIIA 1XP5A 2JJQA 2PKCA 4IPTA 1UZMA 3S81A 3DFIA 5FFFA 4R8RA 4DNFA 1P2DA 1P77A 1U1CA 1JECA 1VA5A 2WT9A 3BXHA 3GH3A 4HAOA 2AQIA 1NDUA 3EISA 3ZYZA 2VHVA 2BGGA 5BUQA 1DQRA 3FA2A 4HDMA 5AK4A 5F2NA 2RAPA 1NJ8A 4ZEVA 1JW9B 2HM7A 3TIFA 1KVRA 5KREA 2R5WA 1E94E 2WJJA 1ULTA 4D4GA 2V3VA 1PCXA 3RF6A 2QMEA 3CO0S 1Y81A 4LYEA 1KDZA 1PV2A 1XL1A 4ECAA 3RUPA 3Q98A 4R0VA 2IEYA 4RIHA 1COWD 1ZXXA 4CF4A 4BE7B 1RYBA 4E6PA 4DILA 1D4OA 4PHFA 2UUOA 3WP1B 1DQYA 1J9GA 4UUMA 2B6NA 2DJIA 1UZNA 1GVHA 2UAGA 1JEDA 3M9LA 4AJOA 1SUBA 3DZDA 4OP1A 4Z0HO 4BZQA 4Z1OA 1PFKA 2IEGA 3PGA1 1OIVA 4EJ6A 3SHVA 1P18A 5EP1A 4ZAYA 2XF8A 1NBEA 3FLBA 2UXDB 2O8BA 3KSMA 2O1XA 1FRQA 1AGRA 3F74A 3OUTA 5JS6A 4G36A 5JYBA 4WLNA 3EG9A 5HQ3A 4FOTA 1X38A 4E14A 1E79A 1CYDA 3HVIA 3P27A 4CMAA 4FDLA 1BX1A 3K2QA 3FCCA 3K9BA 4OJKA 2I65A 2W11A 3MTJA 3AFNA 1JU9A 3RSZA 3SVLA 1J0AA 3AFOA 3QX3A 5BT8A 5K8UA 1GL3A 1KZ6A 2KS6A 1M7GA 3QUSA 4HNGA 1NXQA 4Q7KA 3LCVB 3MCWA 4TRMA 3F6PA 3HV0A 3OG9A 1PJ3A 3RK1A 1E3DA 4C14A 5A03A 4Y1RA 2WUGA 3OTIA 5CG2A 2B4AA 2YX1A 3O2JA 3MYRA 4GX1A 3JAKA 2IEIA 5DMHA 3WYGA 4ZGGA 3ZE6A 1C1YA 2RBEA 1AKEA 3CX7A 4L6IA 2H2IA 3KJZA 4P83A 4ZRMA 3VSAA 2B8NA 5JW6A 3LBYA 3P7MA 4NPAA 5E9AA 2VJBA 4MVJP 2OZLA 5LC1A 3DV0A 4NOJA 4O4LB 1EFKA 4IJMA 2J6HA 3ZKWB 1M2OA 1TZMA 2Z09A 4TMTA 3WGUA 3NP9A 4LJ8A 1W52X 1C1DA 4J7XA 3SHOA 4DJTA 2FJUA 2GMWA 2DR3A 1RI1A 3PXDA 1OZFA 2CXPA 3Q1KA 2NUAA 1EINA 1ODLA 4INPA 2R6FA 4KP7A 4PY2A 3VR1A 3LCJA 1C7EA 4Q9JA 3WV4A 1ZJ4A 4N48A 3A1TA 4A8JC 2IUUA 4BRZA 4S1OA 1Q92A 4OJQA 3DLTA 4FHFA 2FE1A 5ULLA 4B6SA 4NAHA 2FUG6 4O4HA 4LIPD 5K3AA 3TOCA 3VC7A 5DISB 1LSUA 1L4YA 2DUNA 1G5RA 5BW8A 1NPDA 4DLZA 4I50F 1UAGA 4YMTA 2DR2A 4K9KA 3TOVA 2P2NA 4AL4A 1BWRA 3SYMA 2DWQA 3RRNA 1AH2A 2Y0PA 4MYCA 2TMDA 5AW5A 5BQOA 5C53B 3I1YA 2XH8A 5IDVA 3ICVA 3M9XA 1J2JA 2CFIA 2ONYA 3PRHA 4FGUA 1DT3A 1EGAA 4FZ3A 1PE0A 4P4SB 3GLIB 4XWTA 5TPWB 1JUDA 5I7OA 4OA8A 2O8DA 4PSAA 3CMCO 3KB6A 1JG1A 2YJGA 1JXQA 5B57C 2AI2A 3A4TA 3G5AA 1I5EA 4O2BB 1MZPA 2J3MA 3SQXA 2D74A 2CLDX 3FAKA 3K96A 5KHOC 4ND5A 5KZMB 1DXOA 3OETA 4MQEB 2C9OA 2MDTA 2PTHA 3JQAA 2EKZA 4HQOA 5DNWA 5I6DA 2CLMB 2HMTA 1ZBDA 1TA4A 1JA0A 2F9FA 3KKQA 4Q1CA 3ZCXA 4DCPA 4F9GA 5F52A 1SPBS 4PNZA 2ZI6A 5GVSA 1ZD1A 4E2WA 1NA5A 3DDOA 3F49S 5LMNB 1SIOA 3PI6A 3QP9A 5AKKA 4MP3A 5T6MA 1J8YF 2D0OB 2H3HA 4DEYA 3UK6A 1QONA 2DFTA 3EJ6A 2B7BA 5DCLA 1IK6A 3OC0A 4QUDA 1VIMA 5ITZA 1KY5A 4I55B 1N2SA 4HXEB 2DULA 3B52X 3H9EO 1M1ZA 2NV2B 5CFOA 5TQ2A 1A4RA 4OK6A 4J75A 4G0PA 3UAGA 1T3ZA 4X1KA 1ZMOA 2VYVD 4NMMA 3MWYW 5H80A 2IHNA 3DT6A 1WTCA 4WZAE 4YIKA 5JS1A 1XRSB 3BA6A 4XRRA 4Z4HA 4P5DA 4L4XA 5G41A 4F60A 1RPTA 2GWHA 4BKRA 4MZDA 2XTMA 1MMFB 2CMDA 2E3JA 4X41A 1RLMA 2I4LA 3C3WA 2D2EA 3I6ZA 4NFSA 1SXHA 5F3DA 4JLOA 5JAHA 4B3FX 3THXA 4RA6B 4JI3B 1X1QA 2Y1WA 2C29D 4OHZA 4WBNF 2GZ1A 5GWXA 3VX4A 1HG1A 2L69A 3PE6A 1W19A 2XGOA 4E5PA 3NHZA 4OM8A 4MVJH 5F51A 2ZRLA 4B3IA 1JIKA 3EHDA 4N01A 4EHBA 4TYNA 3WL7A 2NU6A 3VC2A 4GUAA 1G21A 1RABA 2BKXA 3CN7A 4R2LA 4F4JA 5H8WA 1YL6A 4BMYA 1GM5A 4BGVA 1OSNA 5BVHB 4IZ6A 4JYZA 1NGSA 5KHLB 4MAMA 4FK8A 1Q91A 2MR6A 4LF8B 1EX1A 3G59A 3G0CA 1FFHA 2HSEA 2ZI4A 4R9RA 2BFMA 4D46A 3H05A 3BE6A 2N46A 1HO3A 2W2VA 3WOHA 4LE2A 4NENB 4HQKA 2IPOA 3T5PA 4NATA 4NG4A 2CNWA 3Q7PA 4RACA 1P0FA 4URXR 4RTSA 1NVVR 1PL6A 3FUUA 4C5CA 5AOBA 3RNLA 5DTQA 4JP1A 1J90A 5CBPA 3D0OA 2QTHA 4U7GA 4CV3A 1GPWB 1ORDA 3GFOA 1XAJA 4NJMA 1ZCBA 2R4QA 3OY2A 4QYIA 1GFZA 2GCPA 1ECCA 1VIVA 1IHPA 1Z5OA 3LK6A 3PJEA 4KH0A 5DF1A 4Z2YA 4F04A 3IHKA 1SKYE 3LOQA 1CVRA 4OLFA 1NT4A 1SOUA 3D3KA 3UOGA 2DWPA 3AJ9A 3CX4A 1VL8A 2MT9A 3OZCA 5LA6A 3RIMA 2BBTA 4J16A 1Z2CA 3M4XA 1RP7A 3C3JA 4KIFA 5L51A 2QRJA 3AFGA 4Q6WA 4BRWA 4YJHA 4UTVA 2OO7A 1TKAA 1S9DA 1ACLA 2HBRA 1E1MA 3L46A 3HJTA 1RAHA 5KKCA 2QAJA 3M6AA 2ZJOA 4FD2A 4MEBA 3U60B 2CXXA 3N74A 2OYRA 2IYQA 1NJSA 2O48X 3DB1A 4YJ3B 3C5WP 4R9NA 3HACA 1GVNB 5INTA 3THWA 2Q6TA 1OXTA 4BV2A 2EQBA 3HP4A 3IPRA 1K2WA 1C7IA 5G53C 8GPBA 5ADHA 4BB0A 3QLTA 2ROQA 2H1RA 5BYJA 1WPRA 3V4FA 1E9AA 1RI4A 4H16A 5AJWA 1A3CA 1EWTA 2HPHA 3FIUA 4I9FA 1Z15A 1MNAA 1XXHE 3RVPA 4BX3A 4NR0A 1DIGA 3Q9UA 1QWOA 4U2FA 1QIKA 1KE2A 3RIGA 3K72B 2V55B 3UB4A 3WI7A 3EDMA 1ZAKA 5C1OA 4B3TB 3FR7A 4I9GA 3AOGA 3JY6A 2C1EA 4XAQA 3KELA 5JLJA 4I4LA 1V37A 3QKTA 4OHKA 4LVUA 4A5SA 4CM7A 1N57A 3H8JA 2Q7XA 4JI7B 4X65B 1QFMA 1XTPA 3ONNA 4LK3A 1F6BA 1OLUA 1JHMA 2PVCA 2ZYTX 3WLAA 3CNLA 2FV8A 1G0OA 1GAJA 3OOJA 3EC7A 4WN9B 2PEYA 2NU8B 5ERGB 3Q8MA 1B6GA 3FUXA 1HKUA 3PQ7A 3OZ7A 1WZ2A 1BROA 2QLNA 1WXDA 4KYVA 1P3JA 5DW3A 5ICFA 1HDEA 2R7LA 3KTOA 1LBTA 1LPNA 1TO2E 4KFSA 4ENTA 2B2CA 4OP2A 4OFZA 4WE3A 5FHQA 3WGVA 4UOEA 3R20A 5ITZB 1BS1A 1U3WA 3A9CA 3HKCA 4TYQA 5IVIA 4FC6A 3WGKA 4D02A 3ZLVA 4ML3A 4B9AA 5K6RA 1ZJ5A 4KRXA 4R1UA 1WCYA 4IKPA 2Y27A 1S4QA 3ZX4A 4X1KB 2A78A 2AMYA 4CETA 1Y6JA 1GZUA 1NW4A 3W8FA 4MNTA 4RHUA 4J0DA 4XIFA 3QLEA 1GCIA 3ASUA 2H5JA 3OCJA 1CJSA 1WA5A 4KDFA 2XMGA 3CE6A 1ZP6A 2QWXA 4KQ1A 1ND6A 5B6PA 1G5HA 1T8SA 1TF2A 2HIGA 3IP3A 2QJWA 3KOMA 3WGOA 4B40A 2V3CC 1J9ZA 1QHXA 1QLWA 1BJKA 2BM1A 4DDUA 4V39A 4WI1A 3GFBA 3FPSA 3T7CA 5JROA 3K0CA 3GRZA 4OOEA 3AOEA 4B7ZA 2VBIA 4Q3OA 4PO3X 4US0R 4WVFA 4ER5A 4Q3EA 1RKBA 4YJ3F 1D2GA 2TYSB 2OXRA 3QUCA 3BWVA 3IMGA 3O1JC 2GRAA 4LNHA 2P4QA 2AN4A 2J08A 3E8XA 1QUFA 3L79A 2QRMA 4LHZA 3KS9A 4OX9Y 3ZW9A 4BMZA 1VZ3A 4JOCA 1QXSA 2JJ2A 4MWSA 5EE9A 1S3FA 3F2VA 5AM4A 1KA9H 2BEVB 3HNPA 4DT1A 1FZQA 2AOUB 4RYDA 1Y3BE 1KJNA 4II3A 3U49A 5IMSA 1XVAA 4HDKA 1U2DA 4UU8A 2GM3A 5EP2A 5TDHA 5I3CA 3ZVMA 3A4NA 2O8FA 3IC5A 4CM6A 4H60A 5CJPA 4BXOB 1YDFA 1YSCA 4OAQA 1PNQA 1QYWA 1XCJA 4M21A 5A5FA 1OI4A 1V16A 1GFSA 4ZT2A 2Y4NA 1RHKA 1XCLA 3PQ3A 3OJEA 3GLHB 5CB4F 1I8TA 3QKSA 3GGSA 3WWZA 3QOYA 1M1YB 1TECE 1SXIA 3DKIA 4RZQA 2RJOA 2X7HA 1CZOA 1QFYA 2HD4A 1Q7RA 3PE4A 1RC1A 1PSZA 3IVGA 4PXAA 1UK8A 3ZH9B 3KWJA 4Z1MD 2NADA 1SBCA 3BGVA 4MPDA 4ENPA 2HX1A 3NDBB 1SCIA 3VTFA 5G0TA 1V9CA 3GNSA 4FBLA 4DC1A 4LY3A 4PQFA 4D99A 1UWVA 2QGZA 3K09A 4C0AC 2JLAA 3JWHA 2CJWA 4ND6A 3E22A 4W9NA 1E2HA 3BKXA 5ECGC 4PR3A 4DSZA 4UNRA 3PTLA 4RHXA 3WC4A 4HTFA 1GZ5A 3GT4A 4ZCQA 2JLXA 3S68A 2GZSA 2RH4A 5JCJA 3LQFA 1E5XA 1L1RA 1JLLA 4N5DA 4B17A 1UJ2A 1VSTA 1K63A 1YRWA 3IVAA 2VR1A 3CG0A 3P9PA 4J90A 2NXEA 3Q88A 2ZB4A 4R1NA 1EB8A 3CRNA 3LBAA 2TECE 2EF0A 2LRHA 3BTOA 3GUHA 3L6CA 3ANNA 4MKFA 3D3WB 5GOTA 2IP2A 3TTXA 2O8EA 2EDCA 2AEMA 5JZVA 2V98A 5LYJF 2P0AA 4C3OB 1W4LA 1YZVA 3ROTA 1WZIA 3W6OA 2AFIB 3CYFA 1MT3A 1B3RA 5C1IA 4RTQA 4NX2A 2FW1A 3DDNA 2OORC 1OWMA 2YICA 4FCWA 1TEZA 2V0NA 4HS4A 3KAQA 3IAHA 5G0WA 3MWKA 4B2YA 1IZYA 1UZAA 4B9EA 4YY3B 3UJHA 5AM3A 1CS0B 1D9ZA 1TB4A 1UMBA 3IQIX 2BT4A 2A86A 4MCJA 4X61A 5AKEA 4DT1B 1T0IA 1PJLA 3IE1A 5EVCA 4F5EA 4IGKA 3FMGA 4XYMA 1HI9A 4RYLA 3WNQA 5CLHA 3B13B 5G1OA 1QTNA 4LSZA 3EVTA 5EWMB 2JKVA 4PYKA 3PHLA 1SQGA 1FS5A 1V95A 3STVA 2P3SA 4FE4A 1PYDA 3IQXA 3L8FA 4LRUA 3TD6A 4D0NA 2G9VA 3ESZA 5BV0A 1A77A 1CUXA 1AHHA 1J8VA 5LL6P 1Z63A 4AJ9A 4FJ0A 4NBRA 1OB2A 2Z3WA 3RVSA 4MDEA 2ZRMA 2IH5A 4A73A 4COOA 4ILEA 1SK9A 1QNFA 3WVNA 1ST3A 4PGGA 5CX1A 5KWIA 3MFQA 5LOVF 1BC5A 2E21A 4JQZA 5L3RA 2DX7A 2X0KA 1JI0A 3OZGA 2QUAA 4RABA 2MSEB 5FPHA 3NC4A 4DA8A 2J4CA 1GAXA 2Z0MA 1XWFA 3HU5A 4LXQA 4J9VA 1GSHA 2PGXA 4IJQA 4ZOLB 1UMCB 3KALA 1ZKMA 4CG1A 4URVR 3UYKA 2R96A 4FYMA 1YDEA 1P75A 1AO0A 3VDMA 3O4VA 1I2AA 3BHNA 1XRJA 3C1OA 2PHZA 3ZXUB 4EDHA 2X22A 4N9QA 1D09A 3FMPB 4C89A 4H35A 5HKOA 5ADUS 3E70C 1TRKA 3NYIA 1XRPA 3WL8A 3AU9A 3EXHA 1Q7EA 4GIBA 2J3EA 4P3XA 4MUBA 4WOCA 2WF7A 1LBEA 2PE5A 4R69A 4XWAA 1CULC 3UXHA 3CJQA 4ERXA 1R0RE 4BE9A 1GZHB 4YECA 3ETNA 4YRTA 3DJYA 3UQYS 3GUZA 4P3OA 4DM3A 5EA2A 4ENRA 4I9NA 4ZT6A 4FDVA 2ZRKA 2CD9A 1XDBA 3ICOA 3OT4A 3F5SA 3QENA 4LUCA 2I5PO 1CW2B 2YHBA 3JQ8A 3QU7A 2BR3A 4RH1A 2EHJA 4N12A 4E11A 5E6RB 4YRBA 3SX2A 3FYHA 4PRLA 5CLFA 5MFPA 1M6WA 1U1IA 1Z2PX 3PIRA 1OLSA 3LC7O 3N8KA 5ALHA 1OXBB 3TPCA 4BASA 3A1SA 4QYSA 1USWA 3AWIA 4GMKA 3OI7A 1H22A 4A03A 2JAWA 3OZUA 1X1BA 2QMYA 3CRZA 4FMDB 3IP6A 3GVHA 4LJ6A 5FWAA 3WIOA 4CW7A 4M60A 4ZRNA 2QAGA 1ZONA 1JMYA 4RD6A 4ESHA 5DB4A 3CUTA 1DAOA 5KPDA 3PX2A 4EYEA 2AHRA 4EUNA 4G5HA 1P8AA 3LNTA 4N6GA 5FT9A 4IXMA 1Z82A 3FNFA 1NSYA 1WUYA 2LIPA 2IV7A 5A3VA 1LW7A 2DHCA 2F6RA 5I9TA 4CQMA 1TFUA 1CZRA 1LZLA 3DVQX 4GC9A 3CT4A 5IM5A 1N9ZA 5DI3B 3AF6A 2BCJQ 3PPIA 1CWUA 1WXHA 2VBGA 2VO1A 3CW2A 4PQGA 4UHKA 3ZHOA 2H11A 1DWPA 3BCSA 4GX5A 1M2KA 3E27A 4HC4A 2I66A 3AUSA 3L4EA 1PYGA 1RKUA 2E4VA 4WXRA 3NWJA 2X5KO 1H4QA 3T3GA 3FROA 2HGZA 2DFLA 2QL7A 3A1DA 4E3WA 4EA9A 1U0SY 4Y9UA 1RKQA 1Q7CA 4CLEA 2O2SA 4GLOA 2CHQA 2YZ7A 5E2AA 5CBPB 5AM2A 2OXCA 4PTYA 1KORA 1L5FA 1Z4QA 3K70D 1MV5A 1E0DA 1JE0A 2V6GA 3NBXX 2FZVA 1FTYA 1JR3D 4NZ9A 2AW3A 3H5WA 3ZDZB 2QTZA 4ZV4A 1JJ7A 4YQEA 1ZC4A 1QHFA 3FOCA 4WIAA 3EXG1 5DGHA 1W4BA 1PEKE 2JHCA 1K98A 2XZTA 4JVLA 3BBPA 2WP8J 3VC3A 2R4TA 1DKOA 1TT7A 3CPSA 2X0RA 3DHEA 4BX9A 1RACA 1O9GA 1CQIA 4PFQA 1U2QA 3Q6NA 3K70C 1OLSB 3X2EA 2OHOA 1PW7A 4G84A 2XNJA 4AWAA 1CJUC 3H5NA 2QE7D 5F2EA 1HRKA 1S2NA 3QVGA 5AI4A 5G0VA 3DWGA 3JRWA 1VLVA 2BFBA 3FKQA 3P2OA 1JHVA 3ZOZA 1FX1A 4M7WA 4DLYA 4C07A 3C41J 4R1PA 4B4WA 3KQUA 3QVSA 1K8YB 1MP0A 1WVMA 3DV9A 5JSFA 1KH1A 4RTOA 2JCSA 2N75A 2ZAOA 4YCMA 1WRBA 3RT1A 1IRIA 2PJZA 1MEEA 3UWOA 2H52A 4BQOA 1GPMA 3DO5A 3JWEA 2NO1A 4FFPA 4Y98A 3NTXA 3F3KA 3MQ2A 3LDFA 2GD0A 2W90A 1S0UA 1YJXA 5EJAA 2ZUCA 3T4PA 2VSQA 3VV2A 3PC7A 4Y30A 2PS1A 1Y6FA 3DZBA 4FOSA 3BXFA 4KN6A 5IH3A 3CONA 3VAZA 3RVBA 4K81B 2GK6A 1SH7A 3I4CA 4ARZA 4HK4A 5K5EA 4YA6A 1SWVA 2HYDA 4M46A 4DQVA 2XSZD 5HOEA 1GNTA 1ULSA 4QU9A 4BNDA 2HWKA 5GGXA 4XB1A 2C9ZA 4E94A 2PUCA 1E2DA 2D4AA 1NJ2A 2WT4A 3H2KA 3NFYA 1GQFA 3GPBA 1L5QA 1DKRA 4KNVA 1GLGA 1UF9A 3C6KA 3WB1A 5C18A 3FDZA 3ZN2A 2CLSA 1VKRA 3GLFE 1GA1A 3H5IA 8OHMA 4RELA 5E95A 2F9MA 5J23A 4LXGA 3Q3GE 1F2DA 4A16A 1YOBA 2X1LA 2YVLA 2Q3CA 3ZK9A 3ZTYA 1SPXA 4UE3S 1WHSB 4C7XA 5IDXA 1MHPA 1VHDA 1Y5RA 2ZYRA 4PYOA 2WLTA 4QTZA 3R76A 5ALKA 3ZGXA 2VJKA 1AF7A 3DCJA 4RGYA 5IULC 1X80A 3L1KA 4OKNA 1E1CB 2BRUC 5LQJA 1KYZA 2NT3A 3BICA 2FWPA 5CNMA 2QRQA 3A3NA 2BTOA 2ZBGA 4R81A 3RIHA 4HGYA 2H0AA 4J94A 3T95A 1BOFA 4AJEA 1E5TA 1G55A 2VXCA 2RCNA 3DDSA 4FLMA 4OHVA 5C3UA 1KHHA 5L7WA 5LP6A 1E1RD 1JB1A 3IRUA 3WMEA 3C98A 4QTXA 4HX2A 3RH0A 4ME6A 3KYJB 1J42A 4BBAA 3N2KA 3CGGA 1X9GA 5BVGB 4JP2A 3DOEA 2VC2B 2WICA 4GDFA 3IBYA 1Z6YA 3N2IA 5E4YA 4CF6A 4YHHB 3NGMA 1PT6A 3NIGB 4C0SA 16PKA 2QNRA 1M1UA 3FJOA 3LLSA 2QTRA 3HM9A 4DV7B 2C8JA 3B6KA 3H11B 3AUTA 1CJBA 4HYTA 2ECQA 2ERXA 4J0FA 3KG2A 3VYUB 1Z4IA 2EJCA 1Z75A 4BB6A 2WP0A 3OE5A 4D0LB 1C7JA 2FETA 3I8SA 3QBDA 3T38A 1CIJA 3MT8A 2FYTA 1CR1A 2JJ1D 3DE2X 4LQLA 4N7JA 5HM6A 1Z7YA 2Y67A 2I9KA 2X6QA 3HM2A 4B0OA 4WA8A 4L02A 4YP1A 1X9HA 2OC9A 1ZICA 1GPYA 3RUHA 3ZQ6A 4RE6A 4I9HA 2VEDA 3MCVA 3ZJ5A 2QJRA 4I4IA 1WXEA 3LW7A 1EDZA 2NO5A 1IM8A 1H69A 1WEHA 3FB1A 4I50A 3NU1A 3ZEIA 2E4XA 4I6JA 4PC3A 4IXDA 1OLOA 1F2VA 3AVPA 3DFMA 3MCTA 3TJZA 4TTJA 2P40A 4DDKA 2XUFA 4IQ0A 5JXIA 4Z3KA 4KEAA 5JQWA 4TTQA 4FJ2A 1EZZA 1ML3A 3TQRA 5DHAA 4OH1A 5JZSA 3NHYA 1G8SA 1A82A 5C52B 1AN9A 2C4WA 5GONB 1OFGA 2CNKA 3LXXA 4N65A 1QIHA 4FHGA 1MIOA 1PGJA 2BSXA 3DFUA 1NSTA 2WYWA 3ZIUA 2E4ZA 1X86B 2BMFA 4LRSB 4O59O 4DWVA 4F3YA 5D5HA 4L0QA 5B53A 3TDNA 3B8HA 2FMKA 5ALZA 1P6XA 1TM3E 4QLBA 1OH7A 1QRRA 4HUJA 1P9LA 2R47A 3PEYA 3USCS 1QVAA 2VF4X 3E48A 4FMCB 2O7VA 2VT6A 3OKAA 1TLTA 3I6MA 1JQJC 1A9PA 2IRWA 3B1XA 4QUKA 4ZKEA 3AERA 3I05A 5AI5A 3OKFA 2HRCA 1Y82A 4WOKA 3I4FA 1J39A 1EA7A 2NV6A 5H68A 5E9QA 2ZR0A 3DA8A 4WV3A 3FCEA 2UZIR 4X8OA 5JYCA 1N6HA 2WWFA 3ZQUA 1A72A 5KQMA 5K1ZA 3RFCA 1BVRA 1EUZA 1UL1X 4BNJA 4BMSA 2WE8A 3PHJA 1LBSA 2DY0A 4OSOA 1REQA 1OB5A 2UXCB 5E3IA 5E1MA 3K30A 3OJLA 1TEVA 3WWCA 2ZSEA 1RI5A 3H84A 3K53A 4M1QA 5FI5A 4BATA 1OLXA 1RD4A 1SVOA 4WCFC 3PXGA 1JEQA 1BXRB 4YRNA 5KPJA 1UCFA 2IW3A 4RPJA 1ISJA 2PLAA 1BKSB 2XUHA 1C0IA 2JD2A 2OSBA 2ZRQA 3CX8A 5EHGA 3W2FA 1VDZA 4B3RB 4CUZA 1IXKA 1E3JA 3A06A 4JQSA 3Q2OA 3DAFA 1ZVJA 4U8HA 4C0JA 2WPDA 3KZVA 3H2BA 3C97A 2G9UA 1DKQA 2CFCA 7AT1A 4F38A 1K86A 1R6TA 5B64A 2PXCA 1LGYA 3A4MA 2IS2A 1FNBA 2IYWA 3K0EA 1QPGA 4A0RA 1GG8A 2JVJA 3CEPB 2G04A 2EXXA 4MVYA 3EFOB 4Q9KA 4XYBA 3AVUA 2Q1SA 1S5PA 2I8CA 1CXZA 1T36A 2XGMA 3EXFB 3P97A 3QXSA 1DS6A 3SE0A 5KX5A 2DFVA 1Y6QA 2AL7A 4OQXA 1JDUA 7REQA 3CY6A 5E9WA 4ZODA 4KPUB 4ZEMA 2G1PA 4KPGA 5I4BA 1B0PA 3QW4B 1ZGJA 3U4CA 2GASA 2Q41A 1M7HA 2EFHB 2GPAA 1IN1A 4BNKA 3SX0A 3HYLA 1F8UA 5IYZA 1Y6GA 2YC2C 1BDHA 3X2FA 1COZA 1FW6A 3ROMA 5LOVA 4CCSA 3RRZA 3E81A 1UJMA 3ZV4A 3EXEA 4M0UA 5DBFA 4OI2A 5AP9A 3EAGA 2RGNA 2FPUA 3GC6A 4GPEA 4IIHA 4J76A 5ECYA 4HL6A 4B33A 2FWJA 5JMOA 3JR7A 1ZWKA 1L1EA 4QAJA 5DNAA 1SCBA 1GQRA 1W1UA 2C4MA 4JXKA 1S4MA 4ZVTA 3ZYCA 4N5NA 1U8CB 3P4UA 1POWA 1X7DA 4ZT5A 5BVGA 2D1YA 1EMDA 3PICA 2O2JA 4C6HA 3X1KA 1UPBA 1Y4ZA 1A50B 2D0PB 1GPH1 5FO0A 3CN9A 5KJCA 4W63A 2A92A 3SZOA 2XDQA 1HDXA 3PCRB 4HZIA 4UDXX 4BUCA 2I55A 2X0FA 4UTZA 4MLPA 1S2IA 4BRSA 4BOYA 4IHAA 1SR8A 3EWIA 3KDSE 4QO8A 3T9BA 3I2HA 2OO5C 1NATA 5DWQA 5TQ0B 3BVPA 1YS4A 3ZWAA 1S8AA 2IDKA 5IKMA 2WFLA 2ZUTA 4D26A 2H17A 3PUWA 4IOJA 5FFMA 2PUGA 1L5ZA 2ENWA 1RJGA 2XUZA 3CRMA 3MTEA 4M1EA 5EZSA 3M5WA 2JLBA 2QRVB 3MWFA 1SC3A 5IC5A 3FDXA 3M83A 1E2KA 1Q0HA 1BVYF 1G4UR 1SHJA 1S1MA 2DPLA 3QXGA 4WKNA 1A9SA 3MJ4A 1MB0A 1TZCA 2AOTA 2QN2A 4OBEA 4UASA 2CK3A 2W22A 2JIZA 3ABIA 5JNSA 2QN1A 4U2BA 1RW4A 2NNLD 2XV1A 3ETLA 1FUUA 1XVTA 2K87A 2Q3HA 3KIPA 4Q3CA 1U7ZA 1Z2EA 3GBPA 2GAJA 1D2NA 3INTA 4BCDA 2B1IA 3FCOA 3FZNA 3C1AA 3LE8A 3STXA 2PANA 5CA0A 4C22A 3DVLA 3MGKA 1FXWF 1T8RA 5D01A 4EB6B 4FOOA 2OHXA 5EE0A 1EQUA 3VVMA 3EH1A 4D5GA 3A31A 1I4WA 4D57A 4QGBA 3L7MA 3F6RA 4QECA 2NV0A 1UPTA 4P08A 4Z0PA 2QAIA 4RDHA 5K0BA 2NX2A 3O8OA 1NF3A 1RMQA 4KUEA 4TS3A 5KYXA 5HUHA 3URKA 2Y3IA 2IYAA 4M8KA 2VDWB 4K9PA 1VIDA 3HA3A 4L76A 4V3CA 1PAUA 4EA7A 3D54D 1AB6A 2IXDA 1M6VA 1XBTA 3DJFA 3HCEA 2J7PD 4C3ZA 1R37A 5EY5B 4R3UC 4B3BA 1FJHA 2JA2A 1J97A 2AJLI 4RV9A 4KR9A 1N7HA 3DMHA 3OE7D 1GSAA 1VCMA 5AO9A 4BMNA 2CL5A 2RK3A 1W1WA 1R9JA 2R7NA 3FTFA 2FPMA 4CDMA 1E1LA 4WJLA 2EL9A 2QVBA 3FVRA 3TOSA 3KU1A 5ITSA 4NU8X 4OTZA 3ZDDA 3LT0A 3QNMA 2OMKA 1TTTA 4LTNA 1QH0A 7GPBA 2WWYA 5DNVA 3IEXA 1P1BA 4TRJA 3QYPA 3LJKA 2R86A 4EG3A 3KSAC 1C4KA 2D2FA 4RLSA 1UMBB 1TU0A 2XMPA 3HCWA 4FZVA 1Y1KE 4KQFA 1UJNA 2O57A 3AY3A 1YKSA 3A7EA 3L7KA 4N5MA 1IHDA 5GVRA 1CQJB 2PMWB 3N2ZB 1E2QA 1V5WA 2HA3A 3AVXA 5A0TA 1ZD8A 2EBWA 4WA7A 3HUDA 2QVGA 1TAGA 3MBOA 4GQAA 5AHOA 2PH5A 3ILYA 2BFEB 5F73A 3FYCA 1YL5A 4ALMA 2J67A 4XQ0A 1X7ZB 4NZMA 2NO9A 3E7XA 1Z5GA 1YASA 3GA5A 3P52A 4FP9A 4WKCA 2W4QA 5F1PA 1G2IA 4I08A 5DSTA 1VSBA 5TLSA 1T2CA 4Q01A 3OZEA 1EAMA 1NN1A 5KTYA 1SKQA 3ID6C 2VT7A 2NTEA 2OUKA 3IMEA 4H08A 2B8JA 1PWZA 4KWIA 1P61B 4YP5A 1KVSA 4J43A 3QQ5A 2YOGA 2WB2A 2IS6A 4C2BA 4FCTA 2UYCA 1ZH4A 4TT8A 3DLBA 3M6IA 3SC2B 2WI8A 1X0VA 4UW9A 2O05A 1PR4A 2W2XA 3GV0A 3HJUA 3INYA 4ALIA 1ISGA 4OXKA 4C7JA 1OKKD 2FPOA 3MXTA 3AR6A 4WEQA 4P7JA 3NFRA 2OYSA 4D9FA 1B7GO 1LJUA 1YI1A 5AOVA 2NQ8A 1FOEB 2C83A 1NBMA 3QOXA 3LQYA 3I4LA 3Q8WA 2ZSKA 4QFBA 5M34A 2OOKA 1F8FA 1NDQA 4I1UA 2OLKA 2O3TA 3OD1A 5JSZA 1POXA 2GEJA 4CDNA 1KU6A 2WVHA 4MUYA 2A5JA 3PC2A 4CMIA 4F4HA 3HEAA 1A7KA 2QMHA 2V9PA 3LUJA 1BS9A 4FOPA 4BVFA 2FW7A 3B82A 3CZPA 1W25A 3F8TA 1E9BA 2VP3A 4CEHB 3HBFA 1E20A 4HAYA 4CHTA 5A9SB 3PE3A 2WJHA 4P9NA 1QR2A 1X3SA 2RD2A 1SD5A 2XOKA 1FQJA 2J4FA 2A0FA 3HCRA 2C42A 1ADJA 1OOEA 3CNNA 1ABEA 4H0FA 1K3FA 1V96A 4MQFA 2WHXA 4EAAA 3LP5A 3KSUA 3KJIA 4L9SA 4LF5B 4JQOA 4KPYA 4BQRA 1G291 4ZWNA 4DA4A 1L4MA 1QYIA 2OXEA 3QVJA 4UEWA 4BMXA 2IYRA 5JC1A 4YBRA 4AMZA 3KOWA 1N2GA 1JEQB 1MV8A 3COJA 1H9AA 2BM0A 3OUZA 3W34A 1VIYA 1AU9A 3P9CA 3K32A 4L6AA 3FBTA 2A9KA 4UHBA 3VNSA 2I6SA 1B1CA 2V97A 4HWRA 4Q9NA 2PMCA 2ZYSA 1DELA 4EB6A 3T1HB 3MG9A 4P3KA 3F71A 3L05A 3L4BC 4FFNA 1VLMA 4NAVA 4LN1A 5ELXA 2YS6A 1DEXA 5ALTA 5DLQC 5AVXA 1W581 2YZ2A 4FFRA 4Q4JA 1A04A 2ZWPA 1SOWA 4RQTA 2FEAA 4W9MC 3M6MD 4D0GA 1HDIA 4EF5A 2L17A 3AESA 4N39A 5JBNA 1UEJA 2P4SA 3DM5A 1P1FA 3CG4A 3E58A 4IY1A 3UANA 3ZGLA 3JARB 1DQZA 1CSEE 2H4HA 3W2IA 1WQ4A 3QJYA 5AVTA 1U65A 1QF7A 1IRXA 1HT2E 3W77A 4WJZA 3A4LA 5DM0A 4R98A 5KMGB 4KPEC 4UNPA 2DWOA 5G02A 4P7KA 1FX0A 2H4JA 4P0PB 1G9TA 1THZA 3MWJA 1Y8RA 4F0JA 2BD0A 4YJ3A 3D2CA 1IHYA 2NZXA 2J33A 1Y4DE 4QM6A 3TBFA 1ACJA 1ANKA 1R8QA 4ARUA 3NUGA 4LF4B 4IHJA 3GEIA 3KXIA 2ZE5A 2WSBA 2CY0A 2VZEA 3GD7A 3ORSA 4RMHA 2JW5A 5F9HA 3EY4A 2IE0A 3D8TA 3VU0A 4WESB 5E1BA 4BEWA 1E4EA 4KW7A 1XPRA 3BRWD 3KKKA 1KI4A 2JCBA 4OSPA 5A1JA 3CTMA 4ZZIA 1MC5A 2OZVA 2CB0A 1G42A 3NWOA 4ONEA 3RKRA 3QY0A 5CDFA 5TGDA 1NC3A 1KO5A 2X4GA 3WNZA 3ZE2B 4LY0A 4U6QA 3SVZA 5FYDA 3ENZA 1SG6A 4JI2B 1E63A 3G2PA 2B2XA 4YRIA 5B55A 1QRDA 1RWVA 2FQWA 1MVNA 1OBCA 4QARA 1I7PA 5FA5A 4HEQA 2IITA 4BP3A 3NETA 1EP2B 4EPTA 5K8JB 2WYUA 3BORA 1P5FA 5ARDA 3JRXA 1YUBA 3D6AA 1E64A 2ATXA 2DAPA 1RE1A 2MMCA 4G97A 1GFWA 4UBMA 2OZKA 2QY6A 1M0TA 2GO1A 5JEDA 4FBMA 2GEVA 4M88A 4L08A 3ODGA 5DX1A 3UJNA 4PNPA 1C3JA 3KQKA 1JDSA 3CLKA 2HBQA 3QUQA 4FS3A 2BGIA 1UFOA 1N78A 3EIFA 4CKEA 1L4GA 4QDUA 2QTFA 2EG9A 4MUAA 1MC1A 1W88B 2YZGA 3A6HA 3QVMA 4NJEB 1GV1A 1I33A 3D6UA 2EC5A 2XRZA 2OCLA 3FXAA 4JU9A 2UUAB 2QRKA 4PTLA 4UTOA 5ALYA 2RHBA 3ZQKA 2PSFA 2CWDA 2EEPA 1LI5A 2WKPA 1WW2A 2X23A 2ZATA 1JKJB 2FRXA 4N8DA 3JQBA 3ETHA 3FPLA 2OD9A 2DC1A 3EHEA 4XQGA 2O50A 5JD4A 2X0NA 5ICSA 1EZ1A 4YAOA 1L8LA 3GN1A 3QKRA 1DXYA 2GAOA 4RLQA 3SMQA 1TYCA 1V7ZA 4LOAA 1KP9A 3HU1A 4LYJA 2VYND 3FY4A 2W2QA 2W6JD 4RESA 3KXLA 3IAM1 1MG5A 3K3PA 4CM4B 4CF7A 4GZ6A 1NMQA 1TA0A 3ND6A 4RA9B 3ZIAD 4AVYA 4CTKA 1AN0A 1M0WA 3PFNA 5B3KA 1YZGA 3LH5A 1GTSA 1R0XA 1FRZA 5E0OA 3LY9A 1LK7A 2ZB2A 5F1YA 3NWEA 3OOHA 1W5AA 4W5JA 3G02A 4O0LA 1CS0A 4LISA 2ZTMA 3PPVA 2I2BA 2GN4A 3B51X 3WHKA 4BU0A 3NDJA 5IARA 3BTSA 2H5EA 5BNWA 3I34X 1R3UA 3JD2A 1NW8A 3JQ8B 1GUYA 3LNCA 1PD1A 1LDNA 1TX4B 3WNBA 5KTSA 2C7PA 3FNQA 3VH3A 5K4HA 4X44A 1L7VC 2QSZA 2XDQB 3TQSA 3BM5A 2X76A 4XM0A 1E5VA 1SIWA 4RJ2A 3SEAA 5AW8A 4UXHA 3BCHA 1VYUA 2PO7A 3NO4A 3R6LA 4MVWA 4TUYF 3IV7A 4EG4A 5MN4A 6LDHA 1VJ1A 3DWIA 4OLHA 3TDMA 4L2IB 5J59A 3IPYA 4DR3B 5TXGA 2VJMB 4HFMA 1YCDA 1C9JA 2A3NA 3NAQA 3FTEA 4KYUA 3NBKA 1JALA 1JMKC 1FJXA 3HZRA 1RVDA 3M6XA 2ZJ5A 3FCSB 3D9QX 3DULA 2EKPA 3O92A 4BFSA 1U0JA 2GILA 1MJHA 2Y2VA 1GTG1 2J5KA 3FMFA 1VE9A 1Z06A 3GT3A 3TIIA 2F59A 3IMKA 3L8MA 1L1FA 4H7DA 4ZHQB 3UXEA 3CE9A 1YUNA 4M76B 2ZW9A 1JLSA 3PRJA 4ZIRA 5D1NA 3GVCA 5AKIA 1KNQA 2A33A 4ZVLA 3ER8A 3O84A 1UJ5A 2QK4A 2X2FA 2YVAA 3LT2A 1F0YA 2VNSA 4BV8A 4RJKA 1UJ6A 2VDRB 4RTLA 5KNDA 3GJ4A 2QG9A 3D4OA 3G7UA 1QAQA 4V0LA 1ZK1A 1DQSA 5HS6A 3G2NA 1TXGA 4X5OA 4KB5A 3C3DA 2IDZA 2QX8A 1JKXA 4B09A 1Z4OA 5CFNA 4EB8A 3K8QA 2YL2A 3KHKA 2V58A 2OOSA 1E8NA 1KC3A 1BGVA 2FHSA 4B3XA 1XJWA 3L1IA 4RA9A 2BFPA 5J4YA 1NNEA 2BGKA 1QJ4A 1ZI6A 1T6XA 4DRZA 2GEKA 2O3UA 3K9LA 2ZIVB 1RFGE 2BKVA 2ZIAA 3CVUA 2ZIXB 2X4DA 2ET6A 1CERA 2DRIA 2X6TA 1FXWA 1M9NA 4M36A 3PX7A 5FPSA 2CL6X 1I5OA 1O77A 2W43A 1DMSA 3RSGA 4LYDA 2B20A 4DZTA 3VR4H 5U4XA 4YONB 5BWOA 1LI4A 4QIHA 1KO1A 4GKBA 5DU2A 3KJGA 1QKIA 3JQ7A 1E66A 4FQ7A 4D4MA 1FFYA 4QX6A 3TI7A 4FMBB 1P19A 1EE9A 3HCOA 1V8OA 1WCV1 4WL0A 2R6CA 1IC6A 4U5XA 1OWNA 4IIXA 4W8HA 5AM1A 3N5CA 2QAGB 2VATA 2YXEA 3HA5A 3VO2A 5JI3E 4I1RA 1DCKA 1QHHA 2JCVA 2QXTA 2ATIA 2XDAA 3KAPA 1YBHA 3RVOA 1QO9A 1JWAB 1TCUA 3FWNA 3MJTA 3WAJA 1F12A 1ESZA 1LLUA 1PL7A 1B6RA 3EGDA 2XZPA 4J4TA 3T1NA 2WIFA 4B5KA 2C57A 4DREA 3HEMA 3DAOA 2O6HA 3DYBA 1UJCA 3G2OA 3UH0A 1KZ4A 2WUDA 1DAKA 5I9MA 1UDCA 3QSGA 4HEA6 5DI3A 2VYVA 4MJLA 2Q5HA 2C99A 2WTMA 3IBGA 1YJAA 4A0FA 4AKIA 4FINA 1BD4A 3MRXA 3P2JA 1Z56C 5IVKA 3LVBA 2ZYHA 1MPTA 1OCEA 2JCYA 2PCJA 3HA2A 3ZY2A 4DF3A 4S0XA 4X9XA 5KQSA 5CA0F 3ZTWA 4AKTA 2R7MA 3H1PA 3DTTA 5K3EA 2VZ0A 1T26A 4XEHA 2IZ6A 2ZSIA 1AC5A 1OUMA 3IOEA 4YP9A 3W5HA 2E89A 3A6FA 2HDOA 3R5TA 4ZDIA 4F2PA 1W30A 3OZIA 1TJ5A 2XHEA 1QX4A 4XDHA 1JIJA 1LD3A 1LDEA 2E49A 4LJ9A 3TIXB 3K4HA 1CZKA 4IQGA 4C01A 4ZZ0A 1KAOA 1C7QA 3HTXA 1Z6AA 4NI5A 5IHPA 1Q83A 3EVGA 3JQAD 1P3Y1 4J6EA 2XIJA 2MTBA 3MOGA 4X62B 2OXFA 3FLMA 1YS2X 1GUBA 2IEZA 1GU0A 3TZQA 2IZOA 2P5UA 2DB3A 3AO0B 1E1RA 3PC3A 4U0JA 3SMVA 3DVAA 5JCXA 3QUAA 4YMLA 1MABA 2WQ6A 2AYYA 1M3SA 1NVUQ 4Q3LA 2GYWA 4YV7A 1FVXA 3KPYA 2GXSA 5DYWA 1CNFA 1X7WA 4AXXA 3AFMA 2I78A 5C7LO 1IXZA 3Q11A 4LRQA 1H3EA 4TOIA 3TVTA 2EZ9A 4UAGA 4ZAFA 3TQTA 1CUIA 4IHJB 5F1KA 5HDBB 1H2YA 2XNKA 3TYXA 3OCZA 3S2IA 1R3DA 1OMOA 1A2BA 4A2QA 2Y1LA 3C7TA 4MO2A 5KOJB 4Z4QA 3DXXA 1D03A 5DWDA 1K0UA 2O3SA 4EHIA 1XZ8A 1PWHA 4CNQA 5D51S 3NDIA 5L4NA 3UMBA 3NXSA 3UV3A 4JT8A 4E0BA 1YHNA 4XKJA 4FT2A 4TWIA 3TSYA 3UK1A 4RQUA 2PFKA 2FAXA 3A7DA 1UANA 1NVWQ 1T9GR 1AM4D 3K6JA 4PX2A 4FDTA 4RD2A 1RFLA 3UAZA 1XZIA 2ACWA 1F6WA 1FSGA 1GNQA 2IY7A 3IESA 4UE6A 2CSXA 1OIWA 3E35A 2QTWB 3EGCA 3PSHA 4INOA 2VPTA 3C8UA 3RU9A 5BWNA 1K7YA 1VP9A 3DUWA 5JPCA 3AONB 1YI0A 1PBNA 3C45A 1I0IA 1IOLA 1IQ0A 1JR3E 3LL7A 2HQRA 2WAAA 3N53A 3SICE 1MEJA 4B3CA 5CXQA 5JIBA 3QPWA 4BFCA 4QJBA 1U81A 4BO7A 3V46A 4B3SB 3KT8A 3SZLA 2ONCA 4K9LA 2FF7A 4JC0A 5FNVB 4KLNA 4AO8A 3HHEA 3CUKA 2FXIA 2I99A 3S2UA 3ZWOA 3PA8A 1LFDB 2X8WA 1Y1TA 4Z54A 3GMDA 3L0DA 3SE7A 2PT5A 3B70A 1X7YB 3RS4A 5A4JA 1RWNA 1YO6A 4GG1A 1SXPA 1XKXA 1VG0B 3R7WB 4Z7JA 3TL3A 3R5XA 1EAYA 3AI3A 2R8XA 5JNRA 1D1TA 1J56A 2QI9F 4KO3S 4EUKA 2I6GA 3SK0A 5IWCA 5KNLA 2XYRA 4F71A 2VDJA 1DAFA 3F73A 5A9TA 5K51A 2R66A 1PGPA 1HBJA 1U6JA 2PV0A 5JUWA 3ONFA 2ZRCA 4Z0NA 3HYTA 1M34E 5BSKA 2WM9B 2I4TA 4FYKA 3B1JA 3A1CA 2CLFB 1SCDA 3WDKA 3ML1A 1PDVA 1OFHA 4CFYA 1QC5A 1R5BA 1EQAA 1FA9A 4DR5B 1G20E 1ZOPA 2JLSA 2ZJBA 5KDDA 4FWTA 3HWRA 1JT2A 2P9YA 3KOXA 4PW0A 2QPLA 1DCFA 1KU0A 3PIIA 5TMPA 1C0EA 2OV6A 3LPNA 4R9VA 1FW8A 3DDCA 3V1MA 2P2LA 2XITA 3TUJC 1HURA 4XARA 1YDHA 3AUYA 1SVUA 4FX5A 3TTTA 1N75A 3CZRA 1HQDA 3IT1A 4MGZR 1NOIA 4M2LA 4XFKA 4AKGA 2R44A 3SBXA 3Q7QA 2ZVJA 4B6EA 1HSZA 4WKBA 2IWRA 1ZA2A 3KZNA 5K0CA 1OFUX 2CVPA 3KB2A 1BA2A 1BXKA 1L6IA 1OF1A 2ZYIA 3V1UA 3WRWA 5JDIA 2J9GA 2M2IA 4L3WA 4ZQCB 3GRVA 4UQOA 2VKTA 4HFNA 1I2DA 3DSRA 4AB1A 2QBYB 4DLXA 1P8JA 1BG6A 1LK0A 4XWGA 4YP0A 3U3ZA 4QJIA 5GPBA 3H7IA 2H2HA 4UPVA 3AT1A 3G9ZA 4LDPA 2BEVA 1S89A 1YR1A 2WA2A 3L06A 4HQ6A 4EEXA 4JUDX 4JEHA 3A28A 2UXBB 1K6EA 3WLPA 1ORHA 1DV1A 2A57A 2H1LA 1H66A 2IYVA 1IN5A 4HLNA 3B1YA 3GZNA 4R5MA 3L93A 4RK6A 2VHTA 3OPYI 4OJNA 4OJTA 5BUZA 4P3PA 3QMWA 4BZPA 2P0YA 3NVDA 1SXJA 3NHMA 5BURA 4QDZA 4QKQA 1X6VA 2Q2OA 5J2TF 2TMYA 1JT9A 3J80A 5ICMA 4RSHA 3DL7A 3WWYA 2P5YA 2PYZA 3MUFA 5TPZA 3IQWA 4IIYA 4PXSA 3RI3A 2ZM5A 1G8AA 1RT9A 2BF7A 3KQMA 4AYXA 1G64A 4UD6A 5JCJD 2LE0A 2VTKA 3OLXA 3FWPA 1KDVA 3RU2A 1NNI1 1KS2A 1L7MA 5DOZA 4J9UE 1VB3A 5EMKA 4DXDA 3WYEA 2FEOA 4R68A 3HNRA 1JHOA 1BQ3A 5JAUA 3MZ0A 4AJLA 5FOUA 3U4QB 2A14A 1C1DB 1H1TA 4F5YA 3RU3A 1D0IA 3VHXA 2CVQA 3VU1A 3EIHA 1MX1A 1Z4PX 2G28A 3L7NA 4PICA 4RM2A 2XQGA 4ZP1A 1TEHA 2IT1A 2X8JA 5CR9A 2M9MA 1ZK2A 3E05A 2FG6C 4S1PA 2ISQA 3M2PA 3UNXA 3JQFA 3AINA 2F3QA 4KX5A 1Q20A 4ACBA 1Z26A 2A5YB 3OAAA 3SF8A 3IL2A 1N5KA 3GFQA 2FWRA 2QYSA 3CA8A 3P9QA 1JH9A 1GNVA 4RETA 2JGFA 5B1HA 1JFLA 1DIOB 3CC8A 2JD1A 3ONWA 4CF3A 1GAQA 1T10A 2D0IA 2ZXUA 1E2IA 2BGRA 2Y0EA 1WMAA 2IU6A 5KSYA 4TMXA 4C0WA 4H7FA 4IILA 4FLFA 4RULA 1JWLA 4GF5A 2HWXA 2PKQO 4E4YA 3HKDB 2XCTB 2CJXA 1MENA 4JBWA 4UBNA 1NIPA 3EF1A 3GX1A 4CL8A 5CDFE 3MVEA 3OP4A 1CQWA 1G6OA 1UC8A 4QXRA 1YQDA 2VTEA 3PR2B 3QHPA 2WU8A 1CJCA 4IIVA 3R3UA 1VPTA 4RFSB 3SN6A 1VHQA 4ZZ2A 4C7MA 4PAMA 4GMFA 4AM8A 4DUZB 2C2WA 3AHCA 3HP7A 1HA3A 1ESEA 1FFBA 2HY7A 3PC4A 1UMDB 2RGNC 2XGSA 3I01M 3N8HA 1H8HA 1R5JA 1W85A 4EMUA 4DAEA 1ZNYA 2DTEA 2A67A 4NL4H 1B42A 3BD6A 3COYA 3IT2A 3M1IA 1MGPA 3A4IA 2IF2A 4P4SA 3MMSA 3T8YA 1U7UA 4MUMA 5DT9A 4H1UA 1JZQA 1CQZA 4HNRA 3A9TA 1ZHFA 2WG2A 2PUWA 3U3MA 4DMHA 1QK5A 2J5RA 1TW2A 2GEBA 3M4NA 2C7OA 4AY2A 3ES9A 5AK6A 5HKLA 3UXMA 3FETA 4MLZA 3U3KA 5CDYA 3WZMA 1H2RS 1UBSB 2PBLA 4O08A 5EXSA 4MGYR 3HRHA 4ZCSA 3PDJA 1D7OA 1U9ZA 2GARA 4ZVRA 1X13A 3G68A 1QBKC 2QD1A 4FZ5A 2QMZA 4WZAB 5FBHA 2GAIA 2P68A 2V1UA 1X80B 4JL5A 5E7QA 5AVYA 4BJ1A 1EUYA 1Q77A 2XNSA 5A2GA 4XJVA 2IYFA 1E3SA 3OE4A 1CVLA 1O87A 1RJFA 2G71A 2RGAA 4UUOA 3RROA 3IBCA 3HADA 4CIAA 1FXUA 1E98A 1N2CA 2PMBA 3M34A 4MV5A 3AY0A 2WSIA 3L7CA 3E15A 4LI3X 3HABA 4FWBA 2N47A 3G2JA 1YZTA 1ZD3A 3E4DA 1J07A 3ZDRA 4E12A 9LDTA 3W7BA 3TGLA 1ZAYA 1M2GA 4R54A 4QFMA 1NN0A 4PZDA 2DYKA 4MSUA 4C2AA 3CZAA 5BV2P 3QMVA 2E55A 3R0IA 4EZEA 5L6LB 2AV6A 3CEMA 1A4IA 5CT4A 4KGVA 4WLEA 5CW1A 3RRJA 3V7NA 1JZTA 4C2UA 3MLAA 3ZGVA 4FXPA 1C9EA 3NW9A 4S12A 4ENQA 1MD9A 3MUEA 2B0CA 4RK0A 4WX2B 1AQUA 3ZGOA 4UM5A 1RI3A 1D3AA 3AIOA 2JFVA 4YRMA 2PBFA 2KJQA 1W29A 2WSYB 3U16A 2AUTA 1P0IA 4JLBA 2Z56A 5BO5A 4E7OA 4PX3A 1X7XA 3WMRA 1O6FA 1NBAA 4WCDA 4HN4B 2QTLA 1LB1B 3EASA 3MJHA 3K20A 2HLDD 4D9CA 3ITKA 1ZPDA 1GGFA 3TX6A 4MWGA 5FBQB 3TXYA 1NP3A 3OT5A 2CBGA 4K9MA 1QGOA 2I6UA 4HKTA 2JEZA 1PUJA 4KXVA 1EXWA 3H2JA 3BMNA 3I3SR 4BVJA 3I28A 4H4EA 3SIWA 1V5FA 1T2VA 2B94A 4RKEA 1RXUA 3UJ8A 2BPOA 2XADA 3ORFA 4YJGA 3ZGYA 4EUEA 4J3NA 4AICA 3FKSA 1M1NB 1Q1NA 1IBLB 4HQFA 2IUSA 4MIEA 3OCYA 2WSSD 4PIVA 3Q41A 3KQLA 3ZDBA 4RK7A 4OIFA 4TSFD 2BV3A 2IIQA 2Z08A 3PHIA 1T8PA 1UXIA 4GKAA 3OCUA 2A94A 2B4RO 1G21E 3D4NA 3ZTTA 5DHRA 4E21A 1R6UA 1E9FA 1WU8A 3OKCA 1T1EA 1NV8A 1YC2A 2H29A 3B6ZA 4PPQA 3PNKA 3ERCA 1YFJA 2BFCA 2Q3DA 2JI4A 3E3OA 3RAEC 1RU3A 4EFKA 4I4TF 3K73O 5FADA 5KYYA 1A9XB 3V97A 3LA6A 1BWPA 1V8ZA 1UBOS 3BULA 3LHFA 3OFJA 1WF3A 4PAQA 4QASA 2OILA 1YGPA 4D97A 4IKOA 3HK2A 2HRDA 5FUYA 2G17A 1ATIA 1SHZA 5K3SA 3GMIA 1B0ZA 1CQJA 3P9IA 4GUDA 5CFZA 4IQ4A 4LRXA 2YYZA 4WCFB 3U3DA 2P6NA 4NZPA 4WFIA 3SC3A 1LLQA 2REXB 5CHYA 3DMYA 5K8TA 4GP9A 4YUWA 1E2UA 1I10A 4N0QA 5B7NA 1NVAA 1TTHA 2IPLA 1V1MB 1FDSA 2ANCA 2D8MA 3KAKA 4DDWA 1XMQB 4XSVA 5L7TA 1X7XB 2DT8A 2ZWVA 3E9CA 3FW1A 1KYXA 3VMMA 5IF9A 9ABPA 1N3IA 2AZXA 4GBJA 3T5TA 3ESXA 3PFFA 1DIRA 1RSZA 3OZAA 4G0ZA 4QLOA 4IWNA 1VKHA 3BFXA 3LQQA 4ZQHA 2XBLA 3P19A 4I8IA 1J21A 1DVRA 4QHYA 4TXHA 2CVHA 1RZRD 2FEPA 1WE2A 3O94A 4LVNA 2R6JA 3CH6A 4NXMB 1JGTA 4FXOA 3FTNA 1V39A 2Q8NA 3VYSB 2A1UB 3D59A 2ZSJA 3CR8A 4JFAA 5TF4A 1YAJA 5MGBA 2AKEA 5ENZA 2F64A 3A26A 1BXGA 3D8RA 1JVBA 3QFHA 4QYTA 5KYGA 4Q4LA 3X1XA 4CTMA 2WUEA 4BLVA 2VP9A 4ODIA 3BKWA 2PD6A 1UOEA 4BP9A 2WE7A 2AJDA 1SFRA 4MLDA 3GPLA 2Q49A 5EXXA 4C30A 2O8EB 1II8A 3OP1A 2QVCA 5F5XA 2CFRA 3TKLA 4MQ6A 1J70A 5HF5A 3SZMA 1YBFA 3UO8B 4CCYB 5JSHA 4ZHQF 4CG0A 3PHHA 1PS9A 3O4HA 4EGSA 3U7IA 5JU6A 1GUDA 2O5EA 1PD0A 2JAPA 1TM7E 2FZWA 3CSUA 4XX1A 2AQKA 4Y7CA 3TD2A 3UUGA 3PUYA 2JJYA 5ES4B 2CKMA 2OD7A 1V8BA 4JB0A 1WLSA 1E6LA 3O9VA 3RB8A 2ID7A 2V7QD 4DMUB 2Z83A 2AFVA 3QQPA 2B3TA 5CT8A 4LX8A 4HDKB 4KGZA 5EKDA 3QE2A 4G1UC 2CBZA 1ZLXA 1HEIA 2AC2A 1Z8FA 1NOKA 10MHA 3D7KA 4TXJA 2JAUA 4B87A 3T5CA 4DV0B 1ZGBA 3O95A 4HWOA 1RQNA 4TSRA 4AURA 4Q3KA 2P9ZA 1EDBA 1FTGA 1NVFA 3BTVA 3GNQA 4L7VA 4TUYB 3K8OE 4Z6KA 5FUQA 4R1QA 1U2DC 2Y1DA 3DE1X 3E3NA 3H4VA 4ISCA 4PGAA 1UQUA 4YRGA 1XLTC 4EY4A 3A8TA 4CIDA 1GPAA 4DW8A 1EWQA 1C0PA 3ENQA 4KLCA 1PTJA 3QU9A 4EITA 2FUCA 5A4KA 2JGIA 4BNYA 1KFJB 5FUMA 1XQXA 3N2LA 1ZD2P 3LOPA 2EBUA 2PUFA 3K15A 2VYFA 2DLNA 1KGDA 4JB3A 3KVVA 4OAPA 4POAA 5IK2A 3GI1A 5KINB 4QVIA 1WG8A 1W5FA 1HYEA 2P79A 4YO8A 5T8KC 3TRIA 4BE4A 5HSGA 1N1DA 1RXCA 3FKJA 5TVKA 3QIVA 3OMLA 1O95D 4I5EA 3PNQA 4BVKA 1Q21A 4AWBA 5BSUA 5EWJB 5CLIA 3KKNA 4V3BA 1UWKA 2G82A 3GB9A 4QTYA 4XGKA 1JQDA 3OT1B 4BX8A 1QGZA 3ZOKA 2OT3B 1RDFA 5I45A 2P9BA 4PBRA 2W2TA 2NAFA 1IZ8A 2GEFA 3Q9SA 5AW0A 2VWGA 1GR1A 4N03A 3H1GA 3KXKA 4OQPA 2WM2A 1E58A 5AK0A 2VAPA 2KYRA 2VF2A 1VKNA 3W4JA 3VZBA 3PUKA 3OSZA 1QV9A 3SC2A 5A2QA 3GDOA 4TN1A 4DSOA 2C0CA 3R3YA 1MH1A 1XMXA 3P1JA 2RAVA 3L07A 3OZXA 3MT7A 4NH0A 1IBMB 1VJRA 1AUPA 2JAQA 3CZ9A 4LZJA 3HXOA 3TAXA 2OZPA 4DYVA 5B58T 3C1TA 3S3TA 4DXAA 1KK0A 1KYIA 2VP6A 4UCQA 1N7JA 1Y98A 4UXIA 1P91A 1HM5A 4JGIA 4NFYA 2Q28A 4AF7A 3FCXA 3ICPA 3FPGA 3U7JA 5EPUA 4DLBA 4KPFC 3QMPA 4BVHA 3DF7A 3NV7A 2Q3FA 2FWAA 4BO6A 3W5VA 2E5LB 2CLHB 1GKKA 2R4UA 1DRWA 5CLLA 4BY9E 2IHKA 2ZREA 1QPBA 1BD3A 1GRCA 1EH5A 1E18A 2JIQA 3UV7A 2IH2A 2JGAA 3EZXA 1FSSA 3SYTA 3IMFA 4CLRA 2ODBA 3JYHA 3K0FA 5HUJA 4EQ6B 3QITA 4KRGA 5FWXB 4OX9B 3P9KA 4YCBA 2NSJA 4LZZA 5FKJA 1F3OA 4LY9A 3O75A 1NQWA 1UXKA 1X1TA 3B3FA 5JALA 1OYYA 1ECPA 3QKSB 2YYYA 1LC3A 1YKGA 2DERA 2ASVA 1JSXA 3K2EA 3HJFA 2JIMA 4TTPA 2HHAA 4D3FA 5LNK6 2AF3C 3DNFA 2PY6A 3B1ZA 2E82A 2JI8A 1MEOA 5J2TA 1AV7A 3B78A 1PR2A 4HLUC 4MITA 2GR9A 4PV7A 1W85B 1JH8A 2A4MA 1XHLA 2XUOA 3OLQA 2BGJA 1A9ZA 1EIZA 2J0UB 2QNIA 3ASYA 3TQIA 4C6TB 4W6ZA 1N1GA 2R1ZA 4CM4A 2Z2KA 2OA0A 4BP1A 4R05A 1SVMA 5KTNA 2CHVA 2NU7B 5FWDA 1GYRA 3G5MA 3JARA 2GVDC 1PJ4A 1F9AA 2ZT6A 3W8DA 1KKUA 3WX0A 1Z07A 1GAEO 2XE6A 4DV6B 3I53A 1N2XA 1GGHA 4LRYA 4MQLA 4DHEA 1U5AA 3D7NA 3ELYA 1U02A 1T36B 1DC8A 2QMQA 2YW9A 2QD4A 2NPIA 3VPHA 4AMYA 3WJ1A 1MF7A 2C2KA 3ANYB 4JMLA 4OHXA 2HF8A 3QF4B 3DAHA 3K9CA 3OA2A 4KRYA 4O4IB 1DIHA 2IC5A 2C2BA 3CBGA 3LWNA 3VTKA 4QE3A 1XF9A 4HRAA 3OQBA 3V8NA 3H1FA 1CQIB 4DYDA 4DA7A 4CMIB 2D7DA 1RR6A 3KWLA 4KMRA 1DFIA 1IIRA 2IHJA 2WWHA 2YWRA 3O74A 1Z7EA 3NHRA 3CHYA 1GU7A 3DDZX 3PUVA 1MR3F 4FKBA 1T2EA 3TDKA 1YQWA 2VJMA 4YLEA 4PONA 1NKVA 5CTAA 2FPWA 4BNZA 4DQ0A 1RYZA 2JCXA 4IIUA 3DOFA 5LZ8A 3S28A 3SIRA 4B35A 4JT9A 3QNUA 3DMTC 2ALJA 2LGJA 4MUXA 3PEVA 2Z04A 4WCFA 1N6LA 1N5JA 1OW3B 1WPGA 4LDJA 3AV0B 1QHIA 3EA0A 1ZI9A 4E5VA 2F17A 1QYDA 4HDSA 1ZOOA 3KBBA 4DJDC 1ISRA 3KPJA 2OR3A 4DWOA 2RGYA 3GGDA 1S2DA 2Z4SA 1M8GA 5GV8A 1V1MA 3ZDXB 1ZU4A 1TT5A 1XDZA 4MEAA 4Q1AA 1P0CA 3OCCA 1RWOA 1BN7A 2BE9A 1CUHA 2HI0A 1YS7A 2J9ZB 4F6LA 5IDWA 8AT1A 4YPVA 3PDWA 2XUDA 1PSWA 3SBEA 1LBHA 1WDLA 5K3FB 1JHDA 1YDWA 2W8BB 4UZFA 4P86A 1P2SA 3DE0X 4FCCA 4M0EA 5EIAA 1PLLA 1O8BA 3DT9A 3C3KA 4DKXA 4K0KB 1FRVA 2PS9A 1NQTA 5AJTA 4DUGD 1A76A 1KK3A 3TJMA 2QZSA 3QXCA 1XTRA 4OREX 2VSNA 3GNTA 4O4JB 3SWWA 1I6MA 1PJQA 4NZOA 5AW4A 3H5VA 5CX4A 1HC7A 4F9TA 2EKDA 1X7GA 3ZU6A 3MC1A 4A36A 1NNUA 5LLDA 2XXBA 4EABA 1M1YE 3HUEA 3FUVA 3IV9A 3VNRA 3CVWA 3SM9A 2D1TA 1TJ4A 2NIPA 4CLDA 1XQVA 5KVCA 3DHNA 3JVUA 1HLPA 3DVAB 1O9HA 4UHJA 4YAIA 3VH1A 4NU0A 4ZVUA 3VKUA 4NV3A 3D2LA 3G85A 4AUMA 1UBMS 1PWEA 2A2ZA 3PFKA 4W5OA 5B4VA 4TWRA 4IZIA 1KAGA 3UW3A 5M04A 4CWAA 1NE7A 2PZFA 1KFCB 4S1VA 1XOIA 2VHEA 3X1ZA 1N5RA 1T4DA 4ZCRA 1ZMXA 2XJ9A 4FIZA 4B7XA 5CDHA 1YCHA 1IZ9A 1JPUA 2WIAA 5A4MS 2CT8A 1NVKA 1RIIA 2GF2A 1M2OB 1D04A 2V5AA 5CVUA 3STWA 1GO2A 2RIPA 3V2HA 1C2YA 2VK4A 2AN9A 2NYUA 2SKCA 1BJRE 1SCJA 3GLHE 3GVPA 1RAIA 2GZHA 3W7VA 1JG2A 4G5GA 3ZY3A 1J09A 4BBJA 4OUDB 5EEGA 5EHNA 2EFCB 4ANFA 2V03A 2WYOA 1T35A 2IGTA 2IYEA 2OTCA 3FCAA 2QLBA 1SC9A 3FSEA 2PZBA 3ZJYA 1P0PA 4PXYA 4CT5A 4DCOA 4HDSB 3F7NA 3JVVA 4RV4A 2X0EA 3OLVA 2AR0A 2XVMA 4IDPA 2JJ1A 4PSDA 3L6EA 1P4JA 2EZUA 2H31A 2O2DA 2ZWMA 4ZT4A 4KHPB 3VKVA 3IPXA 5AR1A