3M3SA

Crystal structure of sars-cov main protease asn214ala mutant with authorize n-terminus
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Dynamical Inactivation of the Catalytic Machinery of the SARS-CoV 3C-Like Protease as Triggered by the N214A Mutation on the Extra Domain
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 84
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3m3sA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3sA02
3O8DA 2QA9E 2HPQH 6GCHG 3BTWE 2D2DA 5EQQA 3RXRA 2ZI2H 1E36B 4A1XA 1BHXF 1HUTH 5CMXH 2D8WA 1GHBF 3SBKA 1BTZA 1OYTH 1H8DH 3GY6A 3ZVCA 1BHXB 2J92A 1GJ8B 1LVMA 1TPPA 1UCYE 3LH1A 2NU3E 1OYQA 3SV7A 4CR9A 1XUKA 3PTNA 1BZXE 2FM2A 4GLYA 1HAXB 4X8UH 4I8LA 1GI2A 3QTVH 2LIZA 4FXGH 3R3GB 3SNDA 1O2LA 3S9AA 1ZGVA 4IGDA 3P8FA 4ABAA 3A8DA 3A88A 1FIWA 1TWXB 3VB5A 3L33A 3B9FH 3I77A 5JYIA 1S0RA 3LKWA 2GMTB 1ZR0A 5T6DA 1QIXB 4JZEH 2ZPQA 3NK8A 2G5NA 1AQ7A 1TIOA 1TBRH 2GX4A 2ZGJA 2ZWLH 2VIDA 5EW2H 3V12A 1GDQA 2FMJA 2OCVB 4KTUA 3NUMA 8LPRA 4OGXA 2HGTH 3FP6E 1P02A 4K2YA 2QC2A 1DVAH 3BSQA 3RXEA 3TH3H 5G4BA 2LNCA 2WUBA 3LGUA 4JK6A 4AFQA 3GCHB 3ZYEA 1GMCF 1EX3A 5FCRA 1K1PA 1GBIA 4YT6H 4UFFH 4O9VA 2YNAA 3MO3A 3U8OH 1K1NA 1P05A 2FO9A 1WBGB 3OYPA 1XVMA 2QGRA 4CHAB 2Z6BD 2ZCHP 1L1NA 3P8OA 1GVZA 1ARBA 2R0KA 1V2ST 1DICA 4HFPB 7GCHG 2F9VA 1OWDA 2BDCA 1RTKA 2HOBA 4AFSA 1A4WH 3OU0A 2THFB 1O2JA 1UVOA 4NIWA 4ABFA 1RTLA 1PPEE 2VWNA 1O36A 4MLFB 2XTTB 2JETB 1ESTA 1CGIE 1MCTA 1UVUH 1E37B 1FQ3A 4B2BA 3SUGA 1PFXC 1JRSA 2VIPA 2UUKB 1BTHH 1SFIA 1LHCH 4Y11E 3RXHA 3VB4A 1CO7E 5C1XA 4ABHA 1PPCE 3FVFB 2FX4A 1EASA 3H5CB 4KTSA 5CHAB 3RLWH 4GUXA 2ODPA 1MAXA 2IN2A 2QIQA 1ZHPA 1PQ8A 2BZ6H 3RXSA 1TOCB 1ZLRA 1A0LA 2FOEA 4YLQH 1GGDB 3QDZB 1AGJA 3SU1A 2UUYA 7ESTE 1PPHE 1UJ1A 4NCYA 4OS7A 2WV5A 4AB9A 1O2RA 1A5IA 2PW8H 2ZKSA 5FPSA 1UCYH 3M7UA 3PMAB 1DWEH 1O2UA 5E0JA 3M61U 3RC4A 2H9HA 1LHEH 5HXFA 1GJDB 5C5NA 1ZTJA 3KL6A 1ELBA 1PPGE 2A7JA 1T8OA 4BTIB 4R8TB 2ZDKA 4BTTB 1G2LA 1AFEH 4Q7XA 1AZ8A 1MD7A 4AOQA 1GJ9B 1Y5AT 2A4GA 3RC5A 1H9LB 1GCTB 2FS9A 1AN1E 1RRKA 3NPSA 3V13A 1P2MA 1LDTT 3C27B 3D23A 3T2NA 4XBDA 2ZTZA 3AAUA 5GXPA 3VB7A 4R0IA 2BOKA 1QTFA 1D3TB 3HKIB 2H2ZA 4INHA 2BDBA 1SLXB 3E16B 2UWLA 1QA7A 1HAOH 2PUXB 1LKBA 1FY4A 3A7ZA 1UVSH 3EA7A 1VGCC 1Z8JB 2UUFB 4HZHA 5I25A 1TABE 2GT8A 1NFYA 4NA8A 5PTPA 2VWOA 1W3CA 1LHDH 1IQHA 1XKBC 2ILNA 2W7UA 2FOGA 4THNH 1O2TA 3TH2H 4JK5A 1TNHA 2ZGBH 1YPLH 1B0EA 2P59A 1TAWA 3V0XA 1MTNC 1TX6A 4CR5A 3V3MA 1SQTA 1T4UH 1P09A 1VJ9U 1K1IA 1RD3B 1NM6A 1GHVH 1WQVH 1F0RA 3PMBB 2J95A 1G9IE 1KIGH 1BTPA 3SOSA 2BX4A 3UNRA 1W11U 5FHTA 4K69A 5FX5A 4D7GA 1Y3UA 1EZQA 3DFJA 2JH5D 3UOUA 3UY9A 1HCGA 1OX1A 1P01A 2RG3A 2ZTYA 3QN7A 2G55A 1E34B 2VGCC 1V3XA 1NFWA 1K21H 1CU1A 3RM2H 3HK3B 2Y81A 4NWLA 1GBFA 4X6NA 2RCEA 2ANYA 4DVAU 2OC7A 1S6HA 5DP7A 2ZIQH 4JMYA 5JPMH 1C5TA 3AAVA 4FUBA 2ZEBA 4Y10E 1TLDA 2Z9KA 3TK6A 4BAKB 3GY8A 2R2WU 4IN1A 1THSH 2P93A 2BD5A 1THPB 3ZZ3A 4XBBA 1WOFA 2EI7A 2ZPRA 4O3TA 2GD4B 3S7HB 1IAUA 4X8TH 2EA3A 2BY7X 4NZLA 3VPKA 4YOJA 4A1VA 1DWCH 4X1RU 5ESTE 4OS4A 1SMFE 1H1BA 3VGCC 1A3EH 1HPGA 1G36A 1LHGH 1TA2A 1QB6A 1ZTLA 2A45B 2FOCA 3VXFH 1W12U 4UFGH 4BAOB 1Z7KA 3BTQE 2EI8A 2C93B 1TGBA 1C5ZB 2Y6TA 1RJXB 2TBSA 2QF0A 2BVRH 1F7ZA 1O5DH 2HNTF 3MH5A 3ZZCA 3FZDA 1P9UA 2BOHB 3A7XA 1GI8B 5TJXA 1A5GH 3KNXA 1BITA 2SGDE 1TQ7B 3WY8A 1F2SE 5EGMA 1U6QA 1BJUA 3A8AA 1JBUH 1NO9H 1CBWC 1LQDB 3D65E 2BQWB 2V35A 3UUZA 1IQNA 3TGJE 4B76A 1P06A 5EXNA 5L6NH 2EEKA 4WJG2 1O2VA 1FNIA 1GBCA 1TRNA 2VGCB 3QZRA 3ZVBA 4NZQA 5GCHF 3HK6B 2VU8E 3S9BA 1ETSH 5GJ4B 1L2EA 3RXFA 1SPJA 4TWYA 2Y7XA 1O3LA 5JBBS 1GG6C 4Q7YA 5LPFA 3RXKA 1JIRA 4SGBE 2STAE 1TRMA 3ZV8A 1A1RA 1C2LA 1DWBH 1MBQA 2ULLA 2F3CE 1T31A 5EW1H 3F6UH 3BEUA 2VH0A 1P04A 1XVOA 3RU4T 1NS3A 3QGNB 3UREA 1K1JA 1MMJN 3SU0A 3K6ZA 1NU9A 4I7YH 1NZQH 1XUIA 1L0ZA 1EAWA 2CHAB 3ENSB 1Z6JH 2J4IA 3LH3A 5E2OA 1P2NA 1C1RA 2OC0A 1PPZA 3GDVA 2P8OC 2BLVA 2AMPA 5IYTA 3ITIA 4X1SU 3URCA 1UTNA 1A46H 3SQHE 4B73A 2GV6A 1PPBH 3KEEA 3ZYDA 1N1LA 1CVWH 2QF3A 1L4ZA 2Z7FE 1O3OA 3GY7A 1ANEA 4JCNA 1HJ9A 5DP3A 2PGQB 1C5WB 3VEQB 1L1JA 1MCVA 5B6OA 1SHHB 2A2QH 2A7CA 1C2KA 3E0PB 3U8RH 1CE5A 2W7SA 3RXTA 1ZGIA 1D6WA 2ZDAH 1HNEE 1O2YA 2ZDLA 3FP8E 5GIBA 3SU6A 4OS5A 4NA7A 1QL8A 1TPAE 2ZFSA 2FOMB 1KXCA 5EG4A 1KLTA 2BD9A 4ABDA 4GCHF 1KXEA 1W0ZU 1ELTA 1G32B 1P12E 3P17H 4CBNA 1A2CH 4YM9A 1KY9A 1IOEA 1OP0A 4GHTA 1ELAA 1BJVA 1ZHRA 1HYLA 3SV2H 2WPJS 4FUIA 1E35B 1GJ4H 2C8XB 4AGKA 4CRAA 1JMOH 1SG8B 2QN5T 2Y82A 1ABIH 3P70B 2G4UA 2SNWA 1BTWA 2ZGHA 5T6FA 1MH0A 1ZSJA 3MU0A 1O3FA 1UTKA 1O32A 2Z9JA 5FCKA 1B7XB 2BD4A 3LJJA 1NRQH 3EBNA 3U98H 3NCLA 5C3NA 5EXLA 2JH6D 5HGGA 4AGJA 2B7DH 1MQ5A 1HB0B 1J17T 2WINI 2P16A 2TRMA 1Y3WA 2FLBH 4DIHH 3OY6U 1GL0E 1TGNA 1ANBA 4ISIH 1C5RA 1HRTH 1GJ6A 2XWBI 3ELAH 5HMAA 2KAIA 2V6NA 4X2XA 2Y5FA 5DP9A 4AG1A 1HV7A 1GMHG 2ZFPH 2GZ7A 2V3HH 3QUMP 1MKXK 1RXPA 1BMNH 1K1MA 9ESTA 1RIWB 2PHBA 3W95A 4UD9H 8GCHG 1QL7A 4Y0YE 3LGVA 1D3QB 1SR5C 3U1JB 1IQEA 2VIQA 1T32A 1ACBE 1KTSB 1YLDA 1DWDH 1O3PB 1Q31A 2FX6A 4CRGA 2BLQA 1SOZA 2FIRH 3A86A 3STJA 1ZTKA 4IN2A 4J2YB 1YM0A 3BG4C 1OWIA 3RXGA 1IQIA 3HKJB 4UDWH 4K8YA 3LOXA 1ORFA 1VITH 4INLA 4ZAEA 5GDSH 3GYMA 3DT0H 4IW4E 1N6YA 5DPAA 2QV1A 3LGWA 2OLGA 1DUEA 1G3CA 4X2YA 1EJMA 4GAWA 2FESH 3SUDA 2GCTB 3SUFA 1FY1A 1EAIA 1Z8RA 2XCFA 4X2VA 1C1VH 5K7RA 4VGCB 1EOJA 3T28A 4I8JA 1V2QT 1AO5A 1SGIB 1CA8B 1D4PB 5DP8A 3SQEE 1AVWA 1QRWA 1SHYA 5JB9S 4K1EA 1BRAA 4CHAC 5F6MA 2FP7B 1JWTA 2SFAA 1SSXA 2Y7ZA 3R0FA 1ELFA 1DT2A 1O2GH 1UTLM 3VB3A 3UNQA 1SGCA 1OOKB 4B71A 2JKHA 3F68H 1NFUA 4Z0KA 2PGBB 3LPRA 2AEIH 2R3UA 4X6MA 4DW2U 4K1SA 1CGJE 1YCPM 4H42U 1LMWB 5ETXA 1P2JA 1GMHF 2JETC 4X6OA 3ZZBA 2GVFA 2F9OA 5J4SA 3MFJA 5A0CA 3GDSA 1C2IA 1YPKH 1W7GH 8GCHF 1EP5A 4X8VH 1SGEE 2P3FH 4WH8A 4UEHH 2Q6GA 1VITF 1C1QA 1C2MA 2IJOB 2XBXA 4MPXA 4IMZA 4GSOA 5CHAC 1ZZZA 3RXLA 1HFDA 5A2MH 4CREA 1GDUA 2J9NA 2SGPE 5F8XA 1DPOA 4ZXYH 4F4OC 3BG4B 1XKAC 1BMLA 1GGDC 1J15A 4ZKSU 3UTUH 1NY22 3BEIB 2BD2A 3EYDA 2BDIA 1C2EA 3Q00A 3SJ9A 2D1JA 2GTBA 3SI4H 1PQAA 2J34A 1GI3A 2HALA 2GZ9A 1QB9A 1YPHE 3SJOA 4BXWA 1N8OB 2QXJA 6LPRA 3ZV9A 3UR9A 3T29A 2G00A 4RSPA 1EB2A 5DG6A 2RDLA 3UQVA 3SJKA 1C4Y2 1J8AA 1GCTC 4YOGA 2OQUA 1SQOA 3A7YA 3LC3A 4BTUB 2CF9H 2ZF0H 1P9SA 1BTUA 1O33A 6GCHF 1SGQE 1MKXH 2R0LA 1BBRH 1EAXA 1C4U2 3G01A 2OC8A 4MVNA 6CHAB 2ZFFH 3F9EA 5DP6A 1K2I1 1NROH 2HNTE 1SB1H 1SFQB 2BVSH 5ABWA 4B1TA 1C5NH 4BNRA 2FLRH 2F91A 4JYUH 5LH8A 1IQKA 1ZMJA 1UK3A 3ZZ6A 2WYJA 1V2UT 2YNBA 3AVZA 7KMEH 1KTTB 1O2QA 3RMLH 3W94A 2Y5GA 4YLUA 4DY7B 1D6RA 1AKSB 5EQRA 5DK1A 4FUDA 1GDNA 5E8EH 1P3EA 2V3OH 1DX5M 3GCTG 1HJAC 1UTPA 3EA8A 2W26A 2ZFTA 1BUIA 1IQFA 1B0FA 3RMOH 4O03A 4Q2KA 1O3DA 2YOLA 3KHVA 3LC5A 1C1WH 2A32A 1FDPA 2ZC9H 3CENA 3SNAA 2BY9X 2ZFQH 3P8NA 1Q3XA 1DUAA 4I31A 1C5VA 4KELA 1AU8A 1TBZH 2UWOA 2W5EA 4I8HA 3UPEA 2W3KA 1GVLA 1NRNH 4ABJA 1HAYB 3DA9B 4Y8XA 5FBEA 3ZZ8A 4AN7A 1J9CH 1O5CB 5FPYA 2Z3CA 3JZ2B 2RA3A 1KXDA 5FAHA 1ZMLA 3GDUA 4D8NA 4RKJB 3T5FH 2OP9A 1D3PB 3U69H 1TNGA 3ATKA 1GBTA 7GCHF 4F49A 3K9XB 1ANCA 2LPRA 3EAJA 3TNTA 1TOMH 3TH4H 1NN6A 2AMDA 2EC9H 1SGFG 3O8BA 4H6SB 1BTYA 3T27A 1UHBB 1EATA 1YPHC 4XOJA 4FUFA 1SQAA 3UIRA 1V6DA 3OTJE 2H6MA 4MPUA 2FS8A 3QZQA 2AERH 3HATH 1TRYA 3RMMH 5JBAS 4KGAA 1Z1IA 3RM0H 1DE7H 2HRVA 2C8ZB 1VJAU 4IBLH 1TA6A 1QHRB 4MNVA 2WPIS 3F9FA 1S84A 4YT7H 3PM3A 1BMMH 2NU4E 2IPHA 1IQGA 1MKWK 1OWHA 2G4TA 1S81A 2GCHG 1G30B 1CGHA 2HNTC 4GPGA 1HJAB 2NU1E 3EA9A 2ZGXH 3GCTF 3STIA 1ELEE 1DLKB 3RLYH 5C67A 3Q76A 1WUNH 3UR6A 2F9NA 1G3DA 1F92A 2QCYA 2BY6X 2ZU1A 2R2MB 1Z1JA 4OGYA 4WMFA 1AE5A 5GPIB 2A5KA 3D62A 4K60A 4Y7BA 1CSOE 4X1PU 7LPRA 1GMDG 2FI4E 1PPFE 1KLIH 2D26C 4TY7A 3CP7A 2ZA5A 4NFFA 2VVVA 1AE8H 3KGPA 1TBQH 3BIUH 5C2ZA 3MO6A 1QGFA 1IHTH 1RS0A 3RXBA 1QNJA 3MH7A 1ETTH 5AFZH 2ODQA 2XXLA 2C8YB 4AX9H 4HI3A 1C4V2 1O2MA 4FU7A 2BDYA 5LGOA 2R9PA 1MTWA 1NFXA 1E38B 1XXFA 1ZYOA 1O2NA 5IDKA 1A5HA 1C9TA 1T8LA 2CHAC 3UQOA 1F0UA 1QFKH 2VJ1A 3M3SA 1LPGB 4WXVA 4DURA 1CA0B 2C90B 4D7FA 1A0JA 2P94A 1NPMA 2G51A 4IS5A 1RFNA 1WYKA 1NTPA 1C2GA 1Y59T 2C4FH 2SGAA 3FZZA 4FUEA 1C5UA 1FY3A 1HXFH 2ZQ2A 4D76A 1TNKA 3BTFE 1EAUA 2BLWA 2A1DB 1AUTC 1GI4A 1T7CA 1C5OH 1NC6A 1ID5H 1VCQA 3JZ1B 3QWCH 3VXEH 4K5ZA 4ZKOU 1MU6B 2CMYA 2BDHA 2A2XH 1C5PA 2ZDVH 2GCHF 2BX3A 5JBCS 1ZMNA 3RDZA 1O2OA 2GV7A 1YGCH 1GBDA 2VIOA 1P57B 1ZHMA 1QJ6B 1HLTH 1ELVA 2BQ6B 2PKAB 1C5SA 1GBHA 1JOUB 3HPTB 1QA0A 1O2KA 4MDSA 1HDTH 4WMDA 4UE7H 1P2KA 4KP0A 1O0DH 1NESE 3MH6A 3LU9B 2WYGA 1O3EA 4IC5A 1GMDF 5LPRA 4UONA 4NWKA 3L6PA 1QJ1B 4U2WA 3SNCA 1Z8GA 1YC0A 2PKSB 3PB1E 2XRCA 2WUCA 3LONA 1XUHA 4LXBH 3PLBA 4CRDA 1THRH 1T8MA 3PLPA 1X7AC 1GHAG 2PTCE 3SGBE 3MTYA 2XWAA 1O2IA 1AWHB 4CRFA 1UTQA 4ZMAH 3E3TA 1VCWA 2VIVA 1HAGE 4JZFH 5L2ZH 4O3UA 1WU1A 3M7QA 1IQJA 2VINA 2NU0E 1XUGA 2ALPA 1LQEA 1O3JA 1QRZA 3MI4A 3TJUA 1DOJA 2H5DA 3A89A 4NSYA 4E7RG 1GBKA 2BB4A 1GJ5H 5T6GA 2XC0A 2ZTXA 4ISOA 1V2RT 4TWWA 5HM2A 3SJ8A 3SHCH 2OXSA 1EXFA 2SGEE 1RTFB 2FYQA 1GVKB 1C1NA 1RIWC 4SGAE 1P11E 2ZCKP 1GBBA 2QYIA 2XCNA 5DP5A 1O2PA 1GBMA 3BG8A 4X1NU 3ZZ9A 1FAXA 2C3SA 2BHGA 3F9HA 1W0YH 1TYNA 1P03A 1NT1A 1TMTH 2FOBA 3P6ZB 4MQAA 3KQCA 3TJOA 2HLCA 3RMNH 1KDQB 2Z9GA 4GHQA 2B8OH 3MU5A 3TIUA 2WV4A 3K2UA 2ZECA 1SVPA 4MPVA 8ESTE 1LTOA 2VWMA 2CV3A 2OC1A 3GY2A 1L1GA 1TX8A 3MU4A 3OSYA 1C2DA 1C5QA 1K9OE 5C20A 3E1XB 1W14U 4LOYH 1G37A 2ZFRH 2GCTC 1O5BB 1WAYB 1FXYA 4WVPE 3AASA 3SV6A 4VGCC 3U9AH 2PWXA 2SGQE 3P92A 4RN6A 3T62A 1J16A 1C1SA 1C2HA 4FUGA 4H4FA 3TLOA 4Q80A 2TGAA 4FVBA 1BB0B 3BTME 4DJZB 1G3BA 3BV9B 2ZU3A 4O97A 4BXSA 5EU8A 1FPCH 3PMJA 1O3NA 5BPEA 1O30A 2QXIA 2BY8X 1GI0A 1OPHB 2Z94A 3A8CA 1KYNA 3RUOA 3ZVEA 3LJOA 1WTGH 1C2FA 2NU2E 2PR3A 4K1TA 2FOHA 3ZZ4A 1Z6EA 1NU7B 2IOTA 3L3TA 3VB6A 3TGIE 3GOVB 3IITA 4E05H 2G81E 1K28D 4X8SH 4A92A 2R3YA 4OS6A 1AD8H 2GP9B 1IQLA 3P95A 4OS1A 2BXUH 3PO1C 3B8JA 1DS2E 4KTCA 3HGNA 1ESAA 2XBWA 1CHOG 3V7TA 4A7IB 3QO6A 1QURH 2GT7A 2SNVA 1O5EH 4WWYA 3M5NA 1C9PA 5LPEA 1Z71A 3M5LA 1BDAA 3UWJH 3GCNA 4ZHAA 1F5RA 2TGPZ 4H6TA 1OWKA 4LZ1H 2B9LA 2ALVA 3T25A 2C8WB 1AUJA 1F5LA 4MTBA 3M3VA 2TPIZ 2M5TA 3SNEA 3CS0A 4BAQB 1WQSA 3ATLA 1P2QA 5F8ZA 2OQ5A 1BBRE 5F03A 1TB6H 5JB8S 2CN0H 3KIDU 5BRRE 3H7TA 1XM1A 1SC8U 5EQSA 2CGAA 4Y76A 3KQEA 3SN8A 1HGTH 4ZH8A 1MZDA 4BANB 3QLPH 1G3EA 4ABIA 1HAIH 4IC6A 3EQ0H 3MHWU 1LPZB 1MTVA 1N8OC 2ZU2A 3SUEA 1CT4E 2GDDA 1FN6A 1AIXH 3RXAA 1E0FD 4MNWA 1H8IH 1LPKB 1BA8B 4U01A 1A3BH 1W13U 3M37A 2H9TH 2O9QA 1TNLA 3SO3A 3DHKH 1YPMH 2QAAA 1ZOMA 2PSXA 2P95A 2GZ8A 1O3KA 3NKKA 3E91A 1FUJA 4Y79A 1PYTC 1HXEH 5CE1A 4AG2A 4BOHA 3UFAA 6CHAC 1BQYA 1A0HB 1CHGA 1HAVB 2UUJB 4J1YA 3M5MA 2H5CA 1OP8A 2G5VA 3MOCA 4YOIA 1UCYK 1DSTA 2BY5X 3PROA 3QTOH 1TGCA 1IQMA 3PO1B 4DIIH 1TGSZ 4B74A 4Y6DA 4DOQA 1CHOF 1ZPZA 2AH4X 3RXQA 2G52A 4JZDH 2K1QA 1EB1H 3U1IB 4NIVA 3ZZDA 1ARCA 3D49H 1EJAA 1DITH 1C5XB 6ESTA 1M9UA 3URDA 1BTXA 2UWPA 4ZHMU 1S6FA 4INKA 1FV9A 1GWAA 3SORA 2ZO3H 3K65B 5JBTA 1QR3E 1JXPA 2H1UA 3EGKH 2WPKS 3E90B 5A8ZA 3ZZ7A 3ZVGA 5FPTA 4ESTE 1N6XA 1S82A 5EPYA 4DT7B 1ELGA 1V2MT 1AY6H 2XW9A 1BRCE 2ANKH 5K0HA 1FY8E 1PJPA 3U8TH 1S85A 5E2PA 4A6LA 1KSNA 1TQ0B 2PLXA 1Y3VA 3E8LA 2B0FA 5H4IB 4TYDA 2B5TB 1O2HA 4Y0ZE 2HPPH 4X0WU 4D9RA 3GICB 3C1KA 2OINA 1O3AA 3BTEE 2OD3B 4AB8A 3LT3A 1FY5A 3IWMA 1FI8A 1UVTH 1V2KT 3ZVFA 3SHAH 1OXGA 2FYRA 2A5IA 2FPZA 1UK4A 1HAVA 1YKTA 1C1PA 1AB9B 1CT2E 1XX9A 4AYVB 3FANA 2VVCA 4QT8C 1S5SA 3QX5H 1QJ7B 1P2OA 1H9HE 1BT7A 1QBOA 1LVYA 1HJ8A 1ELDE 2Q6DA 1UMAH 1UTMA 1GL1A 2AFQB 5DJ7A 5A09A 4ZHLU 2AMQA 1V2NT 1SGDE 1CQQA 3B23B 2FXRA 1UO6A 3KQDA 2ASUB 4AZ2B 3NWUA 4X2WA 2K7XA 2F83A 2ZCLP 2O8UA 5C1UA 1GBLA 1O3MA 1P2IA 1Y3XA 1XMNB 1ETRH 2G8TA 1OS8A 4MPWA 2PFEA 1ESBA 4PROA 1QCPA 1KLJH 1WCZA 4FUJA 2VH6A 1ABJH 4NSVA 1O2XA 1Q2WA 5A0BA 4CBOA 3M3TA 1UVPA 2BD8A 1GI1A 1NRPH 4Q7ZA 1O3HA 2Q6FA 2JH0D 3M35A 1TE0A 1MU8B 3RXCA 2Z3DA 1C1UH 3RXDA 4DGJA 4CRBA 2FEQH 1PYTD 1TMUH 3NZIA 4I8GA 3PWCA 1GJCB 2BVXH 1QRXA 3GCOA 1P10A 2A7HA 1HAHH 5AF9H 3LIWA 1KXFA 1BRBE 3Q3XA 3UWIA 2FTLE 1C2JA 1IHSH 1HAZB 1OKXA 2J2UA 2VIWA 3EE0B 3MU8A 4TY6A 4U32A 4UFEH 4E06H 3UOPA 4A1TA 1SLWB 1SGPE 4AORA 2PUQH 2O8LA 2BDGA 2P3TB 1TNJA 2A4RA 3OY5U 3SZNA 1QY6A 2ZDNA 1AWFH 1O5FH 3PWBA 5AHGH 1ZPBA 1UK2A 4B2AA 1C5YB 3AW1A 4XDEA 3PV4A 1ZPCA 2ZQ1A 3LGIA 5FX6A 3RXOA 1K22H 4CRCA 3VFEA 1JIMA 1YF4A 3LGTA 1W7XH 2A31A 5F8TA 3RP2A 1MAYA 4AYYB 1KXAA 2XBYA 2Z9IA 2FOFA 2AS9A 3TGKE 2Z9LA 2ZP0H 1EJNA 2DE9A 1O37A 1SOTA 1ZRBA 4Y8ZA 3KQBA 2XNIA 1TFXA 1GBAA 4YTAA 4ABGA 4XFQA 2P3UB 3MNBA 3MO9A 4MG3A 5TCCA 3T26A 4CH8B 4TPYA 1KXBA 1A61H 1LKAA 1YCPK 3M7TA 1AKSA 2AYWA 3ATMA 4XBCA 1CA0C 2FDAA 4K3JA 1V2WT 3MYWA 4UFDH 3Q3KA 5EOKA 1YLCA 1FLEE 4ISLA 3TVJB 3A82A 4HTCH 3O8RA 1QB1A 1SGYE 1SGNE 1PQ5A 1ZJKA 3PTBA 1SI5H 1OWJA 4Z6AH 4MNXA 1YPGH 1YBWA 3A85A 1C5LH 2F9PA 4NA9H 3E0NB 1FAKH 2Z3EA 1ZRKA 1C1TA 1LVBA 3MMGA 3ZZAA 2A0QB 5EXMA 1VZQH 5JDUB 3QK1A 3DD2H 2XBVA 4LK4A 3BTKE 2BMGB 1GHWH 3SI3H 1TPSA 4WF8A 4CH2B 4TPIZ 3RXPA 4HGCA 2BD3A 1TONA 4X1QU 3RU4E 3FFGA 5AFYH 4JYVH 1C5MD 3ZVDA 2BZAA 3AW0A 4FU8A 4GVUA 1QBNA 2PKSC 2AGEX 1UHBA 3M5OA 8KME2 5T3HA 1XUFA 2GGVB 2O8TA 4WXIA 4FVDA 1GJAB 1O31A 5FXLA 3S0NA 3LGYA 2GKVE 3PMHB 3TJVA 3DUXH 4ZXXH 3PLKA 2OBOA 1EPTC 4M7GA 3S7KB 4ABEA 5I46H 3GY5A 1VCPA 5GCHG 4ABBA 1GHXH 1HIAB 4DCDA 1C1MA 2W3IA 9LPRA 5DGJA 2I6SA 1O39A 4X6PA 3LDXH 1D3DB 1TALA 3A80A 1XXDA 5SGAE 2A5AA 1J14A 3RXVA 1AZZA 3MH4A 4D9QA 1BCUH 3SGQE 1QL9A 2HVXA 4YESB 3SW2B 4MNYA 3SU4A 1SBWA 1T8NA 1O3GA 1GHZA 3EDXB 2VVUA 3TPIZ 2CF8H 3BTTE 1V2PT 3A7TA 1O2WA 2VNTA 1P8VC 2TGDA 3TITA 1DFPA 4DG4A 1AI8H 4ISNA 2Y5HA 1VGCB 4I33A 1Y3YA 2FODA 2V0BA 4BAHB 5C1YA 1EKBB 1V2JT 4BAMB 2ZHEH 1OWEA 2ODYB 1VR1H 2DE8A 1DY9A 1INCA 1T4VH 1O5GH 4WMEA 1O5AB 3RXMA 2AGGX 1Y8TA 1TMBH 3DFLA 1AVXA 1GI5A 4B75A 4YO9A 1FZZA 2H9EH 3K6YA 1AHTH 3SV9A 3PYHA 3MU1A 2TIOA 5L30H 1EZSC 2ZHFH 1SL3A 1MTNB 1DDJA 3O8CA 3A8BA 1FIZA 5C5OA 1HIAA 1AVGH 3RC6A 1ANDA 1GI7B 1H4WA 1K1LA 2O8WA 3P8GA 3Q77A 2VB0A 4GCHG 4I8KA 2CXVA 1ZSLA 4FUHA 1GJBB 1GBJA 1SGFA 3MNSA 1QQUA 1EPTB 1EQ9A 1NRSH 4I32A 1V2LT 2BLOA 1YCPH 4Y8YA 1PQ7A 1GI6A 1JRTA 3H7OA 1LHFH 2BYAX 4FU9A 5ESBA 2BXTH 3KF2A 1EUFA 1F0SA 5HM9A 2OTVA 1HAPH 1BMAA 2J38A 3TNSA 4XE4A 2VWLA 1TGTA 2BD7A 3TK9A 4WH6A 1S0QA 4AFZA 2PTNA 1YYY1 1ELCA 4NGAH 5E0GA 1P3CA 1O3IA 1O3CA 1DXWA 4NG9H 1GCDA 3N7OA 3F9GA 1RGQA 3S9CA 4FUCA 1FMGA 1W2KH 4LZ4B 1QQ4A 1V2TT 1O38A 2ZDMA 1BRUP 5DKMA 2BM2A 1AFQC 1MKWH 4ZKRU 1A7SA 2WPLS 1EP6A 1SLVB 2PKAA 4Y71A 1BOQA 3BIVH 3TK5A 4ISHH 4B2CA 3SU2A 3VGCB 3SU5A 1EOLA 2WPMS 2ZU5A 3IG6B 2PV9B 1DM4B 1CT0E 5FBIA 1HBTH 2J94A 5AVDA 1W8BH 1Y5BT 3FP7E 5EODA 1WSSH 1ZSKA 3ZZ5A 2EI6A 2FZZA 3QGJA 2FTMA 4RKOB 2BDAA 2AGIX 1EPTA 1GI9B 1DY8A 3GYLB 4NFEA 2KAIB 1WV7H 1XUJA 2BQ7B 5E0HA 2QXGA 1NRRH 3E6PH 1F5KU 1TX7A 1Z8IB 1S83A 2OBQA 1CBWB 3F1SB 2DUCA 2WPHS 4OS2A 3A7WA 1WTHD 1GHAF 1V2OT 2HWLB 1GPZA 3MNXA 4U30A 1FN8A 1SGRE 5TCAA 2TGTA 1G2MA 4WY3A 1O34A 1O2ZA 1OP2A 5A8YA 5DP4A 1FPHH 3A87A 1SGTA 1AMHA 3ESTA 1GG6B 2ZG0H 5L2YH 3BTHE 2O8MA 2FI5E 2NWNA 3RXUA 3A84A 4YZUA 3A7VA 1MQ6A 3A83A 3GY4A 3KN2A 1LVOA 3A81A 3MWIU 1LO6A 4NIXA 1GJ7B 3HGPA 3OX7U 1EZUC 2RA0A 1AFQB 2ZZUH 1QBVH 1KDQA 1SLUB 3ODDA 2FOAA 3I78A 2GDEH 4K8BA 2ZNKH 3RXIA 2ZHWH 1DLEA 2F9BH 2CJIA 4ASHA 3BTDE 3S69A 2XC5A 2P8OB 4ZKNU 1F0TA 1MUEB 1O35A 2Q1JA 5J4QA 2Y80A 1V2VT 2STBE 3SV8A 1GHBG 4A5TS 5A0AE 4IMQA 2A4QA 3RU4D 1UTOA 3CS7A 1BBRK 1L4DA 2PSYA 3ATIA 3SNBA 4JYTA 3SU3A 1YPEH 2ZHQH 1DANH 4NIYA 1MZAA 1VITG 3BN9A 1GHYH 5DO4H 3NXPA 2F9UA 4E7NA 4KKDA 2ESTE 2ZU4A 1O2SA 2A4OA 2ANWA 1FONA 1W10U 3I29A 1B5GH 1MD8A 1YP9A 2ZPSA 2QXHA 3Q3YA 1OSSA 1EZXC 3TU7H 2GMTC 5A8XA 5GWZA 2I6QA 1LCYA 2OUAA 1YPJH 2ZHDA 1DXPA 2XYAA 3KCGH 3SJIA 3GISB 1MBMA 1K1OA 2AIQA 4XSKU 1AB9C 1TNIA 3GY3A 1TPOA 1O3BA 1DSUA 1MTUA 1BIOA 1H9IE 3BEFB 3BF6H 2FI3E 4Y7AA 4ZUHA 2QY0B 1GBEA 1P0SH 1FJSA 2FWWA 3MNCA 3GCHC 1GMCG 4ZROA 2XC4A 2ANMH 1C1OA 1ZJDA 3TJNA 4JZIA 4AFUA 3M36A 3ATWA 2ZGCA 2AIPA 3SGAE 2SGFE 1Y5UT 3UNSA 1D9IA 3ODFA 4JZ1A 3RXJA 3FAOA 5EPNA 5HYOA 3ZVAA 1MTSA 3BTGE 2BTCE 1UTJA
chains in the Genus database with same CATH superfamily
3O8DA 2QA9E 2HPQH 6GCHG 2LP6A 3BTWE 3F0PA 2D2DA 5EQQA 3RXRA 2ZI2H 1E36B 4A1XA 1BHXF 1HUTH 5CMXH 2D8WA 1GHBF 3SBKA 1BTZA 5HKKD 1OYTH 1H8DH 3GY6A 3ZVCA 1BHXB 2J92A 1GJ8B 1LVMA 1TPPA 1UCYE 3LH1A 2NU3E 1OYQA 3SV7A 4CR9A 1H8ED 1XUKA 3PTNA 4RT0A 3FKSD 1BZXE 2FM2A 4GLYA 1HAXB 4X8UH 4I8LA 1GI2A 3QTVH 2LIZA 4FXGH 3R3GB 3SNDA 1O2LA 3S9AA 1ZGVA 4IGDA 3P8FA 4ABAA 3A8DA 3A88A 1FIWA 1TWXB 3VB5A 3L33A 2OK5A 3B9FH 3I77A 5JYIA 1S0RA 3LKWA 2GMTB 1ZR0A 5T6DA 1QIXB 4JZEH 2ZPQA 3NK8A 2G5NA 1AQ7A 1TIOA 1TBRH 2GX4A 2ZGJA 2ZWLH 2VIDA 5EW2H 2JDID 3V12A 1GDQA 2FMJA 2OCVB 4KTUA 3NUMA 8LPRA 4OGXA 2HGTH 3FP6E 1P02A 4K2YA 2QC2A 1DVAH 3BSQA 3RXEA 3TH3H 5G4BA 2LNCA 2WUBA 3LGUA 4JK6A 4AFQA 3GCHB 3ZYEA 1GMCF 1EX3A 5FCRA 1K1PA 1GBIA 4YT6H 3W1EA 4UFFH 4O9VA 2YNAA 3MO3A 5GNDA 2XOKD 3U8OH 1K1NA 1P05A 2FO9A 1WBGB 3OYPA 1XVMA 2QGRA 4CHAB 2Z6BD 2ZCHP 1L1NA 3P8OA 1GVZA 1ARBA 2R0KA 1V2ST 1DICA 4HFPB 7GCHG 2F9VA 1OWDA 2BDCA 5FL7D 1RTKA 2HOBA 4AFSA 1A4WH 3OU0A 2THFB 1O2JA 1UVOA 4NIWA 4ABFA 1RTLA 1PPEE 2VWNA 1O36A 4MLFB 2XTTB 2JETB 1ESTA 1CGIE 1MCTA 1UVUH 1E37B 1FQ3A 4F55A 4B2BA 5C94A 3SUGA 1PFXC 1JRSA 2VIPA 2UUKB 1BTHH 1SFIA 1LHCH 4Y11E 3RXHA 3VB4A 4YXWD 1CO7E 5C1XA 4ABHA 1PPCE 3FVFB 2FX4A 1EASA 3H5CB 4KTSA 5CHAB 3RLWH 4GUXA 2ODPA 1MAXA 2IN2A 2QIQA 1ZHPA 1PQ8A 3WW7A 2BZ6H 3RXSA 1TOCB 1ZLRA 1A0LA 2FOEA 2KCPA 4YLQH 1GGDB 3QDZB 1AGJA 3SU1A 2UUYA 7ESTE 2HVYB 1PPHE 1UJ1A 4NCYA 4OS7A 2WV5A 4AB9A 1O2RA 1A5IA 2PW8H 2ZKSA 5FPSA 1UCYH 3M7UA 3PMAB 1DWEH 1O2UA 5E0JA 3M61U 3RC4A 2H9HA 1LHEH 5HXFA 1GJDB 5C5NA 1ZTJA 3KL6A 1ELBA 1PPGE 2A7JA 1E79D 3ZIAD 1T8OA 4BTIB 4R8TB 2ZDKA 4BTTB 1G2LA 1AFEH 4Q7XA 1AZ8A 1MD7A 4AOQA 1GJ9B 1Y5AT 2A4GA 3RC5A 1H9LB 1GCTB 2FS9A 3DSPA 1AN1E 1RRKA 3NPSA 3V13A 1P2MA 1LDTT 2V7QD 3C27B 4TT3D 3D23A 3T2NA 3AK5A 4XBDA 2ZTZA 3AAUA 5GXPA 3VB7A 4R0IA 2BOKA 1QTFA 1D3TB 3HKIB 2H2ZA 4INHA 2BDBA 1SLXB 3E16B 2UWLA 1QA7A 1HAOH 2PUXB 1LKBA 1FY4A 3A7ZA 1UVSH 3EA7A 1VGCC 1Z8JB 2UUFB 4HZHA 5I25A 1TABE 2GT8A 1NFYA 4NA8A 5PTPA 2VWOA 1W3CA 1LHDH 1IQHA 1XKBC 2ILNA 2W7UA 2FOGA 4THNH 1O2TA 3TH2H 4JK5A 1TNHA 2ZGBH 1YPLH 3DCLA 1B0EA 2P59A 1TAWA 3V0XA 1MTNC 1TX6A 4CR5A 3V3MA 1SQTA 1QZ8A 1T4UH 1P09A 1VJ9U 1K1IA 4ACBA 1RD3B 1NM6A 1GHVH 1WQVH 1F0RA 3PMBB 2J95A 1G9IE 1KIGH 1BTPA 3SOSA 2BX4A 3UNRA 1W11U 5FHTA 4K69A 5FX5A 4D7GA 1Y3UA 1EZQA 3DFJA 2JH5D 3UOUA 3UY9A 1HCGA 1OX1A 1P01A 2RG3A 2ZTYA 3OFND 3QN7A 2G55A 1E34B 2VGCC 1V3XA 2IJD1 1NFWA 1K21H 1CU1A 1UW7A 3RM2H 3HK3B 2Y81A 4NWLA 1GBFA 4X6NA 2RCEA 2KM0A 2ANYA 4DVAU 2OC7A 1S6HA 5DP7A 2ZIQH 4JMYA 5JPMH 1C5TA 3AAVA 4FUBA 4ACAA 2ZEBA 4Y10E 1TLDA 2Z9KA 3TK6A 4BAKB 3GY8A 2R2WU 4IN1A 1THSH 5C17A 2P93A 2BD5A 1THPB 3ZZ3A 4XBBA 1WOFA 2EI7A 2ZPRA 4O3TA 2GD4B 1SKYE 1IAUA 3S7HB 4X8TH 2EA3A 2BY7X 2K0QA 4NZLA 1EFRD 3VPKA 4YOJA 3KYFA 4A1VA 1DWCH 4X1RU 5ESTE 4OS4A 1SMFE 1H1BA 3VGCC 1A3EH 1HPGA 5KEDA 1G36A 1LHGH 1TA2A 1QB6A 1ZTLA 2A45B 2FOCA 3VXFH 1W12U 4UFGH 4BAOB 1Z7KA 3BTQE 2EI8A 2C93B 1TGBA 1C5ZB 2KZ4A 2J98A 2Y6TA 1RJXB 2TBSA 2QF0A 3KQ5A 2BVRH 1F7ZA 1O5DH 2HNTF 3MH5A 3ZZCA 3FZDA 1P9UA 2BOHB 3A7XA 1GI8B 5TJXA 1A5GH 3KNXA 1BITA 2SGDE 1TQ7B 3WY8A 1F2SE 5EGMA 1U6QA 1BJUA 3A8AA 2LELA 1JBUH 4I86A 1NO9H 1CBWC 1LQDB 3D65E 2BQWB 2JIZD 2V35A 3UUZA 1VKYA 1IQNA 3TGJE 4B76A 1P06A 5EXNA 5L6NH 2EEKA 4WJG2 1O2VA 1FNIA 1GBCA 1TRNA 2VGCB 3QZRA 3ZVBA 4NZQA 5GCHF 2IPQX 3HK6B 2VU8E 3S9BA 1ETSH 5GJ4B 1L2EA 3RXFA 1SPJA 4TWYA 2Y7XA 1O3LA 5JBBS 1GG6C 4Q7YA 5LPFA 3RXKA 1JIRA 2VBCA 4SGBE 1SQRA 2STAE 1TRMA 3ZV8A 1A1RA 1C2LA 1DWBH 1MBQA 2ULLA 2F3CE 1T31A 5EW1H 3F6UH 3BEUA 2VH0A 1P04A 1XVOA 3RU4T 1NS3A 3QGNB 3UREA 1K1JA 1MMJN 3SU0A 3K6ZA 1NU9A 4I7YH 1NZQH 1XUIA 1L0ZA 1EAWA 2CHAB 3ENSB 1Z6JH 2J4IA 3LH3A 5E2OA 1P2NA 1C1RA 2OC0A 1PPZA 3GDVA 4ZCNA 2P8OC 2BLVA 2AMPA 5IYTA 3ITIA 4X1SU 3URCA 1UTNA 1A46H 3SQHE 4B73A 3PRBA 2PP6A 2GV6A 1PPBH 3KEEA 3ZYDA 1N1LA 1CVWH 2QF3A 1L4ZA 2Z7FE 1O3OA 3GY7A 1ANEA 4JCNA 2EY4C 1HJ9A 5DP3A 2PGQB 1C5WB 3VEQB 1L1JA 1MCVA 5B6OA 1SHHB 2A2QH 2A7CA 1C2KA 3E0PB 3U8RH 1CE5A 2W7SA 3RXTA 1ZGIA 1D6WA 3SYJA 2ZDAH 1S6LA 1HNEE 1O2YA 2ZDLA 3FP8E 5GIBA 4OM9A 3SU6A 4OS5A 4NA7A 1QL8A 1TPAE 2ZFSA 2FOMB 1KXCA 5EG4A 1KLTA 2BD9A 4ABDA 4GCHF 1KXEA 2KCYA 1W0ZU 1ELTA 1G32B 1P12E 3P17H 4CBNA 1A2CH 4YM9A 1KY9A 1IOEA 1OP0A 4GHTA 1ELAA 1BJVA 1ZHRA 1HYLA 3SV2H 2WPJS 4FUIA 1E35B 1GJ4H 2C8XB 4AGKA 4CRAA 1JMOH 1SG8B 2QN5T 2Y82A 1ABIH 3P70B 2G4UA 2SNWA 1BTWA 4B6EA 2ZGHA 5T6FA 5DN6D 1MH0A 1ZSJA 3MU0A 1O3FA 1UTKA 1O32A 2Z9JA 5FCKA 1B7XB 2BD4A 3LJJA 1NRQH 3EBNA 3U98H 3NCLA 5C3NA 5EXLA 2JH6D 5HGGA 4AGJA 2B7DH 1MQ5A 1HB0B 1J17T 2WINI 2P16A 2TRMA 1Y3WA 2FLBH 4DIHH 3OY6U 1GL0E 1TGNA 1ANBA 4ISIH 1C5RA 1HRTH 1GJ6A 2XWBI 3ELAH 5HMAA 2KAIA 2V6NA 4X2XA 2Y5FA 5DP9A 4AG1A 1HV7A 1GMHG 2ZFPH 2GZ7A 2V3HH 3QUMP 1MKXK 1RXPA 1BMNH 1K1MA 9ESTA 1RIWB 4AC9A 2PHBA 3W95A 4UD9H 8GCHG 1QL7A 3KYGA 4Y0YE 3LGVA 1D3QB 1SR5C 3U1JB 1IQEA 2VIQA 1T32A 1ACBE 1KTSB 1YLDA 1DWDH 1O3PB 1Q31A 2FX6A 4CRGA 2BLQA 1SOZA 2FIRH 3A86A 3STJA 1ZTKA 4IN2A 4Q4LA 4J2YB 1YM0A 3BG4C 1OWIA 3RXGA 1IQIA 3HKJB 4UDWH 4K8YA 3LOXA 1ORFA 1VITH 4INLA 4ZAEA 5GDSH 1W0KD 3GYMA 3DT0H 4IW4E 1N6YA 5DPAA 2QV1A 3LGWA 3DSGA 2OLGA 1DUEA 1G3CA 4X2YA 1EJMA 3MQKC 4GAWA 2FESH 3SUDA 2GCTB 3SUFA 1FY1A 1EAIA 1Z8RA 2XCFA 4X2VA 1C1VH 5K7RA 4VGCB 1EOJA 3T28A 2V3MA 4I8JA 1V2QT 1AO5A 1SGIB 3VG8A 1CA8B 1D4PB 5DP8A 3SQEE 1AVWA 1QRWA 1SHYA 5JB9S 4K1EA 1BRAA 4CHAC 5F6MA 2FP7B 1JWTA 2SFAA 1SSXA 2Y7ZA 3R0FA 1ELFA 1DT2A 1O2GH 1UTLM 3VB3A 2QE7D 1SGCA 3UNQA 1OOKB 4B71A 2JKHA 3F68H 1NFUA 4Z0KA 2CK3D 2PGBB 3LPRA 2AEIH 2R3UA 4X6MA 4DW2U 4K1SA 1CGJE 1YCPM 4H42U 1LMWB 5ETXA 1P2JA 1GMHF 2JETC 4X6OA 3ZZBA 2GVFA 2F9OA 5J4SA 3MFJA 5A0CA 3GDSA 1C2IA 1YPKH 1W7GH 8GCHF 1EP5A 4X8VH 1SGEE 2P3FH 4WH8A 4UEHH 2Q6GA 1VITF 1C1QA 1C2MA 2IJOB 2XBXA 4MPXA 4IMZA 1E1QD 4GSOA 5CHAC 2WHXA 1ZZZA 3RXLA 1HFDA 5A2MH 4CREA 2JJ2D 1GDUA 2J9NA 2SGPE 5F8XA 1DPOA 4ZXYH 4F4OC 3BG4B 1XKAC 1BMLA 1GGDC 1J15A 4ZKSU 3UTUH 1NY22 3BEIB 2BD2A 3EYDA 2BDIA 1C2EA 3Q00A 3SJ9A 2D1JA 2GTBA 3SI4H 1PQAA 2J34A 1GI3A 2HALA 2GZ9A 1QB9A 1YPHE 3SJOA 4BXWA 1N8OB 2QXJA 6LPRA 3ZV9A 2KCOA 3UR9A 3T29A 2G00A 4RSPA 3PRDA 1EB2A 5DG6A 2RDLA 3UQVA 3SJKA 1C4Y2 1J8AA 1GCTC 5HIYA 4YOGA 2OQUA 1SQOA 3A7YA 3LC3A 4BTUB 2CF9H 2ZF0H 1P9SA 2WV9A 1BTUA 1O33A 6GCHF 1SGQE 1MKXH 2R0LA 1BBRH 1EAXA 1C4U2 3G01A 2OC8A 4MVNA 6CHAB 2ZFFH 3F9EA 5DP6A 1K2I1 1NROH 2HNTE 1SB1H 1SFQB 1YY3A 2BVSH 5ABWA 4B1TA 1C5NH 4BNRA 2FLRH 2F91A 4JYUH 2XNDD 5LH8A 1IQKA 1ZMJA 1UK3A 3ZZ6A 2WYJA 1V2UT 2YNBA 3AVZA 7KMEH 1KTTB 1O2QA 3RMLH 3W94A 2Y5GA 4YLUA 4DY7B 1D6RA 4B6FA 1AKSB 5EQRA 5DK1A 4FUDA 1GDNA 5E8EH 1P3EA 2V3OH 1DX5M 3GCTG 1HJAC 3EE7A 1UTPA 3EA8A 2W26A 2ZFTA 1BUIA 1IQFA 1B0FA 3RMOH 4O03A 4Q2KA 1O3DA 2YOLA 3KHVA 3LC5A 1C1WH 2A32A 1FDPA 2ZC9H 3CENA 3SNAA 2BY9X 2ZFQH 3P8NA 5DSFA 1Q3XA 1DUAA 5EJLA 4I31A 1C5VA 4KELA 1AU8A 1TBZH 2UWOA 2W5EA 4I8HA 3UPEA 2W3KA 1GVLA 1NRNH 4ABJA 1HAYB 3DA9B 4Y8XA 5FBEA 3ZZ8A 4AN7A 1J9CH 1O5CB 5FPYA 2Z3CA 3JZ2B 3U28C 2RA3A 4RI0A 1KXDA 5FAHA 1ZMLA 3GDUA 4D8NA 4RKJB 3T5FH 3F2HA 2OP9A 1D3PB 3U69H 1TNGA 3ATKA 1GBTA 7GCHF 4F49A 3K9XB 1ANCA 2LPRA 3EAJA 3TNTA 1TOMH 3TH4H 1NN6A 2AMDA 2EC9H 3CNRA 1SGFG 3O8BA 4H6SB 1BTYA 3T27A 1UHBB 1EATA 1YPHC 4XOJA 4FUFA 1SQAA 3UIRA 1V6DA 3OTJE 2H6MA 4MPUA 2FS8A 3QZQA 2AERH 3HATH 1TRYA 3RMMH 5JBAS 4KGAA 1Z1IA 3RM0H 1DE7H 2HRVA 2C8ZB 1VJAU 4IBLH 1TA6A 1QHRB 4MNVA 2WPIS 3F9FA 1S84A 4YT7H 3F2GA 3PM3A 1BMMH 2NU4E 2IPHA 1IQGA 1MKWK 1OWHA 2G4TA 1S81A 2GCHG 1G30B 1CGHA 2HNTC 4GPGA 1HJAB 2NU1E 3EA9A 2ZGXH 3GCTF 3STIA 1ELEE 1DLKB 3RLYH 5C67A 3Q76A 1WUNH 3UR6A 2F9NA 1G3DA 1OHHD 1F92A 2QCYA 2BY6X 2ZU1A 2R2MB 1Z1JA 1MABB 4OGYA 4WMFA 1AE5A 5GPIB 2A5KA 3D62A 4K60A 3OEED 4Y7BA 1CSOE 4X1PU 7LPRA 1GMDG 2FI4E 1PPFE 1KLIH 2D26C 4TY7A 3CP7A 2L6OA 2ZA5A 2K8IA 4NFFA 2VVVA 1AE8H 3KGPA 1TBQH 3BIUH 5C2ZA 3MO6A 1QGFA 1IHTH 1RS0A 3RXBA 1QNJA 3MH7A 1ETTH 5AFZH 2ODQA 2XXLA 2C8YB 4AX9H 4HI3A 1C4V2 1O2MA 4FU7A 2BDYA 5LGOA 2R9PA 1MTWA 1NFXA 1E38B 1XXFA 1ZYOA 1O2NA 5IDKA 1A5HA 1C9TA 1T8LA 2CHAC 3UQOA 1F0UA 1QFKH 2VJ1A 3M3SA 1LPGB 4WXVA 4DURA 1CA0B 2C90B 4D7FA 1A0JA 2P94A 1NPMA 2G51A 4IS5A 1RFNA 1WYKA 1NTPA 1C2GA 1Y59T 2C4FH 2SGAA 3FZZA 4FUEA 1C5UA 1FY3A 1HXFH 2ZQ2A 3N99A 4D76A 1TNKA 3BTFE 1EAUA 2BLWA 2A1DB 1AUTC 1GI4A 1T7CA 1C5OH 1NC6A 1ID5H 1VCQA 3JZ1B 3QWCH 3VXEH 4K5ZA 4ZKOU 1MU6B 2CMYA 2BDHA 3UAIC 2A2XH 1C5PA 2ZDVH 2GCHF 2BX3A 5JBCS 1ZMNA 3RDZA 1O2OA 2GV7A 1YGCH 3OAAD 1GBDA 2VIOA 1P57B 1ZHMA 1QJ6B 1HLTH 1ELVA 2BQ6B 2PKAB 3FN8A 1C5SA 1GBHA 1JOUB 3HPTB 1QA0A 1O2KA 4MDSA 1HDTH 4WMDA 4UE7H 1P2KA 4KP0A 1O0DH 1NESE 3MH6A 3LU9B 2WYGA 1O3EA 4IC5A 1GMDF 5LPRA 4UONA 4Q63A 4NWKA 3L6PA 1QJ1B 4U2WA 3SNCA 2YMSB 1Z8GA 1YC0A 2PKSB 3PB1E 2XRCA 3WWBA 2WUCA 3LONA 1XUHA 4LXBH 3PLBA 4CRDA 1THRH 1T8MA 3PLPA 1X7AC 1GHAG 1WDIA 2PTCE 3SGBE 3MTYA 2XWAA 1O2IA 1AWHB 4CRFA 1UTQA 4ZMAH 3E3TA 1VCWA 2VIVA 1HAGE 4JZFH 5L2ZH 4O3UA 1WU1A 3M7QA 1IQJA 2VINA 2NU0E 1XUGA 2ALPA 1LQEA 1O3JA 1QRZA 3MI4A 3TJUA 1DOJA 2H5DA 3A89A 4NSYA 4E7RG 1GBKA 2BB4A 1GJ5H 5T6GA 2XC0A 2ZTXA 4ISOA 5HIZA 1V2RT 4TWWA 5HM2A 3SJ8A 3SHCH 3GS9A 2OXSA 1EXFA 2SGEE 1RTFB 2FYQA 1GVKB 1C1NA 1RIWC 4SGAE 1P11E 2ZCKP 1GBBA 2QYIA 2XCNA 5DP5A 1O2PA 1GBMA 3BG8A 4X1NU 3ZZ9A 1FAXA 2C3SA 2BHGA 3F9HA 1W0YH 1TYNA 1P03A 4XRNA 1NT1A 1TMTH 2RDEA 2FOBA 3P6ZB 4MQAA 3KQCA 3TJOA 2HLCA 3RMNH 1KDQB 2Z9GA 4GHQA 2B8OH 3MU5A 3TIUA 2WV4A 3K2UA 2ZECA 1SVPA 4MPVA 8ESTE 1LTOA 2VWMA 2CV3A 2OC1A 3GY2A 1L1GA 1TX8A 3MU4A 3OSYA 1C2DA 1C5QA 1K9OE 5C20A 3E1XB 1W14U 4LOYH 1G37A 2ZFRH 2GCTC 1O5BB 1WAYB 1FXYA 4WVPE 3AASA 3SV6A 2KFWA 4VGCC 3U9AH 2PWXA 2SGQE 3P92A 4RN6A 3T62A 1J16A 4FETA 1C1SA 1C2HA 4FUGA 4H4FA 3TLOA 4Q80A 3F0OA 2TGAA 4FVBA 1BB0B 3BTME 4DJZB 1G3BA 3BV9B 2ZU3A 4O97A 4BXSA 5EU8A 1FPCH 3PMJA 1O3NA 5BPEA 1O30A 2QXIA 2BY8X 5B6LA 1GI0A 1OPHB 2Z94A 3A8CA 1KYNA 3RUOA 3ZVEA 3LJOA 1WTGH 1C2FA 2NU2E 2PR3A 4K1TA 2FOHA 3ZZ4A 1Z6EA 1NU7B 2IOTA 3L3TA 3VB6A 3TGIE 3GOVB 3IITA 4E05H 2G81E 5EJ1A 1K28D 4X8SH 4ASUD 4A92A 2R3YA 4OS6A 1AD8H 2GP9B 1IQLA 4FOUC 3P95A 4OS1A 2BXUH 3PO1C 3B8JA 1DS2E 4KTCA 3HGNA 1ESAA 2XBWA 1CHOG 3V7TA 4A7IB 3QO6A 1QURH 2GT7A 2SNVA 1O5EH 4WWYA 3M5NA 1C9PA 1K0HA 5LPEA 1Z71A 3M5LA 1BDAA 3UWJH 3GCNA 4ZHAA 1F5RA 2TGPZ 4H6TA 1OWKA 4LZ1H 4DT4A 2B9LA 2ALVA 3T25A 2C8WB 1AUJA 1F5LA 4MTBA 3M3VA 2TPIZ 2M5TA 3SNEA 3CS0A 4BAQB 1WQSA 3ATLA 1P2QA 5F8ZA 2OQ5A 1BBRE 5F03A 1TB6H 5JB8S 2CN0H 3KIDU 5BRRE 3H7TA 1XM1A 1SC8U 5EQSA 2CGAA 4Y76A 3KQEA 3SN8A 1HGTH 4ZH8A 1MZDA 3PV2A 4BANB 3QLPH 1G3EA 4ABIA 1HAIH 4IC6A 3EQ0H 3MHWU 1LPZB 1MTVA 1N8OC 2ZU2A 3SUEA 1CT4E 2GDDA 1FN6A 1AIXH 3RXAA 1E0FD 4MNWA 1H8IH 1LPKB 1BA8B 4U01A 1A3BH 1W13U 3M37A 2H9TH 2O9QA 1TNLA 3SO3A 3DHKH 1YPMH 2QAAA 1ZOMA 2PSXA 2P95A 2GZ8A 1O3KA 3NKKA 3E91A 1FUJA 4Y79A 1PYTC 1HXEH 5CE1A 4AG2A 4BOHA 3UFAA 6CHAC 1BQYA 1A0HB 1CHGA 1HAVB 2UUJB 4J1YA 3M5MA 2H5CA 1OP8A 2G5VA 3MOCA 4YOIA 1UCYK 1DSTA 2BY5X 3PROA 3QTOH 1TGCA 1IQMA 3PO1B 4DIIH 1TGSZ 4B74A 4Y6DA 1KMHB 4DOQA 1CHOF 1ZPZA 2AH4X 3RXQA 2G52A 4JZDH 2K1QA 1EB1H 5EJZA 2J5UA 4NIVA 3U1IB 3ZZDA 1ARCA 3D49H 1EJAA 1DITH 1C5XB 6ESTA 1M9UA 3URDA 1BTXA 2UWPA 4ZHMU 1S6FA 4INKA 1FV9A 1GWAA 3SORA 2ZO3H 3K65B 5JBTA 1QR3E 1JXPA 2H1UA 3EGKH 2KCAA 2WPKS 3E90B 5A8ZA 3ZZ7A 3ZVGA 5FPTA 4ESTE 1N6XA 1S82A 5EPYA 4DT7B 1ELGA 1V2MT 1AY6H 2XW9A 1BRCE 2ANKH 5K0HA 1BMFD 1FY8E 1PJPA 3U8TH 1S85A 5E2PA 4A6LA 1KSNA 1TQ0B 2PLXA 1Y3VA 3E8LA 2B0FA 5H4IB 4TYDA 2B5TB 1O2HA 4Y0ZE 2HPPH 4X0WU 4D9RA 3GICB 3C1KA 2OINA 1O3AA 3BTEE 2OD3B 4AB8A 3LT3A 1FY5A 3IWMA 1FI8A 1UVTH 1V2KT 3ZVFA 3SHAH 1OXGA 2FYRA 2A5IA 2FPZA 1UK4A 1HAVA 1YKTA 1C1PA 1AB9B 1CT2E 1XX9A 4AYVB 3FANA 2VVCA 4QT8C 1S5SA 3H09A 3QX5H 1QJ7B 1P2OA 1H9HE 1BT7A 1QBOA 1NBME 1LVYA 1HJ8A 1ELDE 2Q6DA 1UMAH 1UTMA 1GL1A 2AFQB 5DJ7A 5A09A 4ZHLU 2AMQA 1V2NT 1SGDE 1CQQA 3B23B 2FXRA 3DSOA 1UO6A 3KQDA 2ASUB 4AZ2B 3NWUA 4X2WA 2K7XA 1W0JD 2F83A 2ZCLP 2O8UA 5C1UA 1GBLA 1O3MA 1P2IA 1Y3XA 1XMNB 1ETRH 2G8TA 1OS8A 4MPWA 2PFEA 1ESBA 4PROA 1QCPA 5C0TA 1KLJH 1WCZA 4FUJA 2VH6A 1ABJH 4NSVA 1O2XA 1Q2WA 5A0BA 4CBOA 2F4LA 3M3TA 1UVPA 2BD8A 1GI1A 1NRPH 4Q7ZA 1O3HA 2Q6FA 2JH0D 3M35A 1TE0A 1MU8B 3RXCA 2Z3DA 1C1UH 3RXDA 4DGJA 4CRBA 2FEQH 1PYTD 1TMUH 3NZIA 4I8GA 3PWCA 1GJCB 2BVXH 1QRXA 2AHME 1P10A 2A7HA 3GCOA 1HAHH 5AF9H 3LIWA 1KXFA 1BRBE 3Q3XA 3UWIA 2FTLE 1C2JA 1IHSH 1HAZB 1OKXA 2J2UA 2VIWA 3EE0B 3MU8A 4TY6A 4U32A 4UFEH 4E06H 3UOPA 4A1TA 1SLWB 1SGPE 4AORA 2PUQH 2M2AA 2O8LA 2BDGA 2P3TB 1TNJA 2A4RA 3OY5U 3SZNA 1QY6A 2ZDNA 1AWFH 1O5FH 3PWBA 5AHGH 1ZPBA 1UK2A 4B2AA 1C5YB 3AW1A 4RT1A 4XDEA 3PV4A 1ZPCA 2ZQ1A 3LGIA 5FX6A 3RXOA 1K22H 4CRCA 3VFEA 1JIMA 1YF4A 3LGTA 1W7XH 2A31A 5F8TA 3RP2A 1MAYA 4AYYB 1KXAA 2XBYA 2Z9IA 2FOFA 2AS9A 3TGKE 3N7DA 2Z9LA 2KX4A 2WSSD 2QF5A 2ZP0H 1EJNA 2DE9A 1O37A 1SOTA 1ZRBA 4Y8ZA 3KQBA 3WWFA 2XNIA 1TFXA 1GBAA 4YTAA 4ABGA 4XFQA 2P3UB 3MNBA 3MO9A 4MG3A 5TCCA 3T26A 4CH8B 4TPYA 1KXBA 1A61H 1LKAA 1YCPK 3M7TA 1AKSA 2AYWA 3ATMA 4XBCA 1CA0C 2FDAA 1YWUA 4K3JA 1V2WT 3MYWA 4UFDH 3Q3KA 5EOKA 1YLCA 1FLEE 4ISLA 3TVJB 3A82A 4HTCH 3O8RA 1QB1A 1SGYE 1SGNE 1PQ5A 1ZJKA 3PTBA 1SI5H 3NRLA 1OWJA 4Z6AH 4MNXA 1YPGH 1YBWA 3A85A 1C5LH 2F9PA 4NA9H 3E0NB 1FAKH 2W6ID 2Z3EA 1ZRKA 1C1TA 1LVBA 3MMGA 3ZZAA 2A0QB 3FOAA 5EXMA 4P00A 1VZQH 4F48B 5JDUB 3QK1A 3DD2H 5C0UA 2XBVA 4LK4A 3BTKE 2BMGB 1GHWH 3SI3H 1TPSA 1WXRA 4WF8A 4CH2B 4TPIZ 3RXPA 4HGCA 2BD3A 1TONA 4X1QU 3RU4E 3FFGA 5AFYH 4JYVH 1C5MD 3ZVDA 2BZAA 3AW0A 4FU8A 4GVUA 2YMSC 1QBNA 2PKSC 2AGEX 1UHBA 3M5OA 8KME2 5T3HA 2J98B 1XUFA 2GGVB 2O8TA 4WXIA 4FVDA 1GJAB 1O31A 5FXLA 3S0NA 1E1RD 3LGYA 2GKVE 3PMHB 3TJVA 3DUXH 4ZXXH 3OTPA 3PLKA 2OBOA 1EPTC 4M7GA 3S7KB 4ABEA 5I46H 3GY5A 1VCPA 5GCHG 4ABBA 1GHXH 1HIAB 4DCDA 4XD7D 3F3BA 1C1MA 2W3IA 9LPRA 5DGJA 2I6SA 1O39A 4X6PA 3LDXH 1D3DB 1TALA 3A80A 1XXDA 5SGAE 2A5AA 1J14A 3RXVA 1AZZA 3MH4A 4D9QA 1BCUH 3SGQE 1QL9A 2HVXA 4YESB 3SW2B 4HG6A 4MNYA 3SU4A 1SBWA 5EIYA 1T8NA 1O3GA 1GHZA 3EDXB 2VVUA 2WPDD 3TPIZ 2CF8H 3BTTE 1V2PT 3A7TA 1O2WA 2VNTA 1P8VC 2TGDA 3TITA 1DFPA 4DG4A 5KGOA 1AI8H 4ISNA 2Y5HA 1VGCB 4I33A 1Y3YA 2FODA 2V0BA 4BAHB 5C1YA 1EKBB 1V2JT 4BAMB 2ZHEH 1OWEA 2ODYB 1VR1H 2DE8A 1DY9A 1INCA 1T4VH 1O5GH 4WMEA 1O5AB 3RXMA 2AGGX 1Y8TA 1TMBH 3DFLA 1AVXA 1GI5A 2GJGA 4YO9A 1FZZA 2H9EH 3K6YA 4B75A 1AHTH 3SV9A 3PYHA 1FX0B 3MU1A 2TIOA 5L30H 1EZSC 2ZHFH 1SL3A 1MTNB 1DDJA 3O8CA 3A8BA 1FIZA 5C5OA 1HIAA 1H8HD 1AVGH 3RC6A 1ANDA 1NBMD 1GI7B 1H4WA 1K1LA 2O8WA 3P8GA 3Q77A 2VB0A 4GCHG 2JJ1D 4I8KA 3FO8D 2CXVA 1ZSLA 4FUHA 1GJBB 1GBJA 1SGFA 3MNSA 1QQUA 1EPTB 1EQ9A 1NRSH 4I32A 1V2LT 2BLOA 1YCPH 4Y8YA 5CDFE 1PQ7A 1GI6A 1JRTA 3H7OA 1LHFH 2BYAX 4FU9A 5ESBA 2BXTH 3KF2A 2F43B 1EUFA 1F0SA 5HM9A 2OTVA 1HAPH 1BMAA 2J38A 3TNSA 4XE4A 2VWLA 1TGTA 2BD7A 3TK9A 4WH6A 1S0QA 4AFZA 2PTNA 1YYY1 4P02A 1ELCA 1YLNA 4NGAH 5E0GA 1P3CA 1O3IA 1O3CA 1DXWA 4NG9H 1GCDA 3N7OA 3F9GA 1RGQA 3S9CA 4FUCA 1FMGA 1W2KH 4LZ4B 1QQ4A 1V2TT 1O38A 2HLDD 2ZDMA 1BRUP 5DKMA 2YMSD 2BM2A 1AFQC 1MKWH 4ZKRU 1A7SA 2WPLS 1EP6A 1SLVB 2PKAA 4Y71A 1BOQA 3BIVH 3TK5A 4ISHH 4B2CA 3SU2A 3VGCB 3N7EA 3SU5A 1EOLA 2WPMS 2ZU5A 3IG6B 2PV9B 1DM4B 1CT0E 5FBIA 1HBTH 2J94A 5AVDA 2J97A 3SZEA 1W8BH 1Y5BT 3FP7E 5EODA 1WSSH 1ZSKA 3ZZ5A 2EI6A 2FZZA 3QGJA 2FTMA 4TSFD 4RKOB 2BDAA 2AGIX 3F2FA 4Z1MD 1EPTA 1GI9B 1DY8A 3GYLB 4NFEA 2KAIB 1WV7H 2L74A 1XUJA 2BQ7B 5E0HA 2QXGA 1NRRH 3E6PH 5KECA 3OE7D 1F5KU 1TX7A 1Z8IB 1S83A 2OBQA 1CBWB 3F1SB 2DUCA 5T1VA 2WPHS 4OS2A 3A7WA 1WTHD 2EQNA 1GHAF 1V2OT 2HWLB 1GPZA 3MNXA 4U30A 1FN8A 1SGRE 3OEHD 5F53A 3UB0A 5TCAA 2QF4A 2TGTA 1G2MA 4WY3A 1O34A 1O2ZA 1OP2A 5A8YA 5DP4A 1FPHH 3A87A 1SGTA 1AMHA 3ESTA 1GG6B 2ZG0H 4M9FA 5L2YH 3BTHE 2O8MA 5IK2D 2FI5E 2NWNA 3RXUA 3A84A 4YZUA 3A7VA 1MQ6A 3A83A 3GY4A 3KN2A 1LVOA 3A81A 3MWIU 1LO6A 4NIXA 1GJ7B 3HGPA 3OX7U 1EZUC 2RA0A 1AFQB 2ZZUH 1QBVH 1KDQA 1SLUB 3ODDA 2FOAA 3I78A 2GDEH 4K8BA 2ZNKH 3RXIA 2ZHWH 1DLEA 2F9BH 2CJIA 4ASHA 3BTDE 3S69A 2XC5A 2P8OB 4ZKNU 1F0TA 1MUEB 1O35A 2Q1JA 5J4QA 2Y80A 1V2VT 2KR7A 2STBE 3SV8A 1GHBG 4A5TS 1COWD 5A0AE 4IMQA 2A4QA 3RU4D 1UTOA 3CS7A 1BBRK 1L4DA 2PSYA 3ATIA 3SNBA 4JYTA 3SU3A 1YPEH 2ZHQH 1DANH 4NIYA 1MZAA 2RFKC 1VITG 3BN9A 1GHYH 5DO4H 3NXPA 2F9UA 4E7NA 4KKDA 2ESTE 2ZU4A 1O2SA 2A4OA 2ANWA 1FONA 1W10U 3I29A 1B5GH 1MD8A 1YP9A 2ZPSA 2W6JD 2QXHA 3Q3YA 2WZQA 1OSSA 1EZXC 3TU7H 2GMTC 5A8XA 5GWZA 2I6QA 1LCYA 2OUAA 1YPJH 2ZHDA 1DXPA 2XYAA 3KCGH 3SJIA 3GISB 1MBMA 1K1OA 2AIQA 4XSKU 1AB9C 1TNIA 3GY3A 1TPOA 1O3BA 1DSUA 1MTUA 1BIOA 1H9IE 3BEFB 3BF6H 2FI3E 4Y7AA 4ZUHA 2QY0B 1GBEA 1P0SH 1FJSA 2FWWA 5CHBA 3MNCA 3GCHC 3PV5A 1GMCG 4ZROA 2XC4A 2ANMH 1C1OA 1ZJDA 3TJNA 4JZIA 4AFUA 3M36A 3ATWA 2ZGCA 2AIPA 3SGAE 2SGFE 1Y5UT 3UNSA 1D9IA 3ODFA 4JZ1A 3RXJA 3FAOA 5EPNA 5HYOA 3ZVAA 1MTSA 3BTGE 2BTCE 1UTJA
chains in the Genus database with same CATH topology
3O8DA 2QA9E 2HPQH 6GCHG 3BTWE 2D2DA 5EQQA 3RXRA 2ZI2H 1E36B 4A1XA 1BHXF 1HUTH 5CMXH 2D8WA 1GHBF 3SBKA 1BTZA 1OYTH 1H8DH 3GY6A 3ZVCA 1BHXB 2J92A 1GJ8B 1LVMA 1TPPA 1UCYE 3LH1A 2NU3E 1OYQA 3SV7A 4CR9A 1XUKA 3PTNA 1BZXE 2FM2A 4GLYA 1HAXB 4X8UH 4I8LA 1GI2A 3QTVH 2LIZA 4FXGH 3R3GB 3SNDA 1O2LA 3S9AA 1ZGVA 4IGDA 3P8FA 4ABAA 3A8DA 3A88A 1FIWA 1TWXB 3VB5A 3L33A 3B9FH 3I77A 5JYIA 1S0RA 3LKWA 2GMTB 1ZR0A 5T6DA 1QIXB 4JZEH 2ZPQA 3NK8A 2G5NA 1AQ7A 1TIOA 1TBRH 2GX4A 2ZGJA 2ZWLH 2VIDA 5EW2H 3V12A 1GDQA 2FMJA 2OCVB 4KTUA 3NUMA 8LPRA 4OGXA 2HGTH 3FP6E 1P02A 4K2YA 2QC2A 1DVAH 3BSQA 3RXEA 3TH3H 5G4BA 2LNCA 2WUBA 3LGUA 4JK6A 4AFQA 3GCHB 3ZYEA 1GMCF 1EX3A 5FCRA 1K1PA 1GBIA 4YT6H 4UFFH 4O9VA 2YNAA 3MO3A 3U8OH 1K1NA 1P05A 2FO9A 1WBGB 3OYPA 1XVMA 2QGRA 4CHAB 2Z6BD 2ZCHP 1L1NA 3P8OA 1GVZA 1ARBA 2R0KA 1V2ST 1DICA 4HFPB 7GCHG 2F9VA 1OWDA 2BDCA 1RTKA 2HOBA 4AFSA 1A4WH 3OU0A 2THFB 1O2JA 1UVOA 4NIWA 4ABFA 1RTLA 1PPEE 2VWNA 1O36A 4MLFB 2XTTB 2JETB 1ESTA 1CGIE 1MCTA 1UVUH 1E37B 1FQ3A 4B2BA 3SUGA 1PFXC 1JRSA 2VIPA 2UUKB 1BTHH 1SFIA 1LHCH 4Y11E 3RXHA 3VB4A 1CO7E 5C1XA 4ABHA 1PPCE 3FVFB 2FX4A 1EASA 3H5CB 4KTSA 5CHAB 3RLWH 4GUXA 2ODPA 1MAXA 2IN2A 2QIQA 1ZHPA 1PQ8A 2BZ6H 3RXSA 1TOCB 1ZLRA 1A0LA 2FOEA 4YLQH 1GGDB 3QDZB 1AGJA 3SU1A 2UUYA 7ESTE 1PPHE 1UJ1A 4NCYA 4OS7A 2WV5A 4AB9A 1O2RA 1A5IA 2PW8H 2ZKSA 5FPSA 1UCYH 3M7UA 3PMAB 1DWEH 1O2UA 5E0JA 3M61U 3RC4A 2H9HA 1LHEH 5HXFA 1GJDB 5C5NA 1ZTJA 3KL6A 1ELBA 1PPGE 2A7JA 1T8OA 4BTIB 4R8TB 2ZDKA 4BTTB 1G2LA 1AFEH 4Q7XA 1AZ8A 1MD7A 4AOQA 1GJ9B 1Y5AT 2A4GA 3RC5A 1H9LB 1GCTB 2FS9A 1AN1E 1RRKA 3NPSA 3V13A 1P2MA 1LDTT 3C27B 3D23A 3T2NA 4XBDA 2ZTZA 3AAUA 5GXPA 3VB7A 4R0IA 2BOKA 1QTFA 1D3TB 3HKIB 2H2ZA 4INHA 2BDBA 1SLXB 3E16B 2UWLA 1QA7A 1HAOH 2PUXB 1LKBA 1FY4A 3A7ZA 1UVSH 3EA7A 1VGCC 1Z8JB 2UUFB 4HZHA 5I25A 1TABE 2GT8A 1NFYA 4NA8A 5PTPA 2VWOA 1W3CA 1LHDH 1IQHA 1XKBC 2ILNA 2W7UA 2FOGA 4THNH 1O2TA 3TH2H 4JK5A 1TNHA 2ZGBH 1YPLH 1B0EA 2P59A 1TAWA 3V0XA 1MTNC 1TX6A 4CR5A 3V3MA 1SQTA 1T4UH 1P09A 1VJ9U 1K1IA 1RD3B 1NM6A 1GHVH 1WQVH 1F0RA 3PMBB 2J95A 1G9IE 1KIGH 1BTPA 3SOSA 2BX4A 3UNRA 1W11U 5FHTA 4K69A 5FX5A 4D7GA 1Y3UA 1EZQA 3DFJA 2JH5D 3UOUA 3UY9A 1HCGA 1OX1A 1P01A 2RG3A 2ZTYA 3QN7A 2G55A 1E34B 2VGCC 1V3XA 1NFWA 1K21H 1CU1A 3RM2H 3HK3B 2Y81A 4NWLA 1GBFA 4X6NA 2RCEA 2ANYA 4DVAU 2OC7A 1S6HA 5DP7A 2ZIQH 4JMYA 5JPMH 1C5TA 3AAVA 4FUBA 2ZEBA 4Y10E 1TLDA 2Z9KA 3TK6A 4BAKB 3GY8A 2R2WU 4IN1A 1THSH 2P93A 2BD5A 1THPB 3ZZ3A 4XBBA 1WOFA 2EI7A 2ZPRA 4O3TA 2GD4B 3S7HB 1IAUA 4X8TH 2EA3A 2BY7X 4NZLA 3VPKA 4YOJA 4A1VA 1DWCH 4X1RU 5ESTE 4OS4A 1SMFE 1H1BA 3VGCC 1A3EH 1HPGA 1G36A 1LHGH 1TA2A 1QB6A 1ZTLA 2A45B 2FOCA 3VXFH 1W12U 4UFGH 4BAOB 1Z7KA 3BTQE 2EI8A 2C93B 1TGBA 1C5ZB 2Y6TA 1RJXB 2TBSA 2QF0A 2BVRH 1F7ZA 1O5DH 2HNTF 3MH5A 3ZZCA 3FZDA 1P9UA 2BOHB 3A7XA 1GI8B 5TJXA 1A5GH 3KNXA 1BITA 2SGDE 1TQ7B 3WY8A 1F2SE 5EGMA 1U6QA 1BJUA 3A8AA 1JBUH 1NO9H 1CBWC 1LQDB 3D65E 2BQWB 2V35A 3UUZA 1IQNA 3TGJE 4B76A 1P06A 5EXNA 5L6NH 2EEKA 4WJG2 1O2VA 1FNIA 1GBCA 1TRNA 2VGCB 3QZRA 3ZVBA 4NZQA 5GCHF 3HK6B 2VU8E 3S9BA 1ETSH 5GJ4B 1L2EA 3RXFA 1SPJA 4TWYA 2Y7XA 1O3LA 5JBBS 1GG6C 4Q7YA 5LPFA 3RXKA 1JIRA 4SGBE 2STAE 1TRMA 3ZV8A 1A1RA 1C2LA 1DWBH 1MBQA 2ULLA 2F3CE 1T31A 5EW1H 3F6UH 3BEUA 2VH0A 1P04A 1XVOA 3RU4T 1NS3A 3QGNB 3UREA 1K1JA 1MMJN 3SU0A 3K6ZA 1NU9A 4I7YH 1NZQH 1XUIA 1L0ZA 1EAWA 2CHAB 3ENSB 1Z6JH 2J4IA 3LH3A 5E2OA 1P2NA 1C1RA 2OC0A 1PPZA 3GDVA 2P8OC 2BLVA 2AMPA 5IYTA 3ITIA 4X1SU 3URCA 1UTNA 1A46H 3SQHE 4B73A 2GV6A 1PPBH 3KEEA 3ZYDA 1N1LA 1CVWH 2QF3A 1L4ZA 2Z7FE 1O3OA 3GY7A 1ANEA 4JCNA 1HJ9A 5DP3A 2PGQB 1C5WB 3VEQB 1L1JA 1MCVA 5B6OA 1SHHB 2A2QH 2A7CA 1C2KA 3E0PB 3U8RH 1CE5A 2W7SA 3RXTA 1ZGIA 1D6WA 2ZDAH 1HNEE 1O2YA 2ZDLA 3FP8E 5GIBA 3SU6A 4OS5A 4NA7A 1QL8A 1TPAE 2ZFSA 2FOMB 1KXCA 5EG4A 1KLTA 2BD9A 4ABDA 4GCHF 1KXEA 1W0ZU 1ELTA 1G32B 1P12E 3P17H 4CBNA 1A2CH 4YM9A 1KY9A 1IOEA 1OP0A 4GHTA 1ELAA 1BJVA 1ZHRA 1HYLA 3SV2H 2WPJS 4FUIA 1E35B 1GJ4H 2C8XB 4AGKA 4CRAA 1JMOH 1SG8B 2QN5T 2Y82A 1ABIH 3P70B 2G4UA 2SNWA 1BTWA 2ZGHA 5T6FA 1MH0A 1ZSJA 3MU0A 1O3FA 1UTKA 1O32A 2Z9JA 5FCKA 1B7XB 2BD4A 3LJJA 1NRQH 3EBNA 3U98H 3NCLA 5C3NA 5EXLA 2JH6D 5HGGA 4AGJA 2B7DH 1MQ5A 1HB0B 1J17T 2WINI 2P16A 2TRMA 1Y3WA 2FLBH 4DIHH 3OY6U 1GL0E 1TGNA 1ANBA 4ISIH 1C5RA 1HRTH 1GJ6A 2XWBI 3ELAH 5HMAA 2KAIA 2V6NA 4X2XA 2Y5FA 5DP9A 4AG1A 1HV7A 1GMHG 2ZFPH 2GZ7A 2V3HH 3QUMP 1MKXK 1RXPA 1BMNH 1K1MA 9ESTA 1RIWB 2PHBA 3W95A 4UD9H 8GCHG 1QL7A 4Y0YE 3LGVA 1D3QB 1SR5C 3U1JB 1IQEA 2VIQA 1T32A 1ACBE 1KTSB 1YLDA 1DWDH 1O3PB 1Q31A 2FX6A 4CRGA 2BLQA 1SOZA 2FIRH 3A86A 3STJA 1ZTKA 4IN2A 4J2YB 1YM0A 3BG4C 1OWIA 3RXGA 1IQIA 3HKJB 4UDWH 4K8YA 3LOXA 1ORFA 1VITH 4INLA 4ZAEA 5GDSH 3GYMA 3DT0H 4IW4E 1N6YA 5DPAA 2QV1A 3LGWA 2OLGA 1DUEA 1G3CA 4X2YA 1EJMA 4GAWA 2FESH 3SUDA 2GCTB 3SUFA 1FY1A 1EAIA 1Z8RA 2XCFA 4X2VA 1C1VH 5K7RA 4VGCB 1EOJA 3T28A 4I8JA 1V2QT 1AO5A 1SGIB 1CA8B 1D4PB 5DP8A 3SQEE 1AVWA 1QRWA 1SHYA 5JB9S 4K1EA 1BRAA 4CHAC 5F6MA 2FP7B 1JWTA 2SFAA 1SSXA 2Y7ZA 3R0FA 1ELFA 1DT2A 1O2GH 1UTLM 3VB3A 3UNQA 1SGCA 1OOKB 4B71A 2JKHA 3F68H 1NFUA 4Z0KA 2PGBB 3LPRA 2AEIH 2R3UA 4X6MA 4DW2U 4K1SA 1CGJE 1YCPM 4H42U 1LMWB 5ETXA 1P2JA 1GMHF 2JETC 4X6OA 3ZZBA 2GVFA 2F9OA 5J4SA 3MFJA 5A0CA 3GDSA 1C2IA 1YPKH 1W7GH 8GCHF 1EP5A 4X8VH 1SGEE 2P3FH 4WH8A 4UEHH 2Q6GA 1VITF 1C1QA 1C2MA 2IJOB 2XBXA 4MPXA 4IMZA 4GSOA 5CHAC 1ZZZA 3RXLA 1HFDA 5A2MH 4CREA 1GDUA 2J9NA 2SGPE 5F8XA 1DPOA 4ZXYH 4F4OC 3BG4B 1XKAC 1BMLA 1GGDC 1J15A 4ZKSU 3UTUH 1NY22 3BEIB 2BD2A 3EYDA 2BDIA 1C2EA 3Q00A 3SJ9A 2D1JA 2GTBA 3SI4H 1PQAA 2J34A 1GI3A 2HALA 2GZ9A 1QB9A 1YPHE 3SJOA 4BXWA 1N8OB 2QXJA 6LPRA 3ZV9A 3UR9A 3T29A 2G00A 4RSPA 1EB2A 5DG6A 2RDLA 3UQVA 3SJKA 1C4Y2 1J8AA 1GCTC 4YOGA 2OQUA 1SQOA 3A7YA 3LC3A 4BTUB 2CF9H 2ZF0H 1P9SA 1BTUA 1O33A 6GCHF 1SGQE 1MKXH 2R0LA 1BBRH 1EAXA 1C4U2 3G01A 2OC8A 4MVNA 6CHAB 2ZFFH 3F9EA 5DP6A 1K2I1 1NROH 2HNTE 1SB1H 1SFQB 2BVSH 5ABWA 4B1TA 1C5NH 4BNRA 2FLRH 2F91A 4JYUH 5LH8A 1IQKA 1ZMJA 1UK3A 3ZZ6A 2WYJA 1V2UT 2YNBA 3AVZA 7KMEH 1KTTB 1O2QA 3RMLH 3W94A 2Y5GA 4YLUA 4DY7B 1D6RA 1AKSB 5EQRA 5DK1A 4FUDA 1GDNA 5E8EH 1P3EA 2V3OH 1DX5M 3GCTG 1HJAC 1UTPA 3EA8A 2W26A 2ZFTA 1BUIA 1IQFA 1B0FA 3RMOH 4O03A 4Q2KA 1O3DA 2YOLA 3KHVA 3LC5A 1C1WH 2A32A 1FDPA 2ZC9H 3CENA 3SNAA 2BY9X 2ZFQH 3P8NA 1Q3XA 1DUAA 4I31A 1C5VA 4KELA 1AU8A 1TBZH 2UWOA 2W5EA 4I8HA 3UPEA 2W3KA 1GVLA 1NRNH 4ABJA 1HAYB 3DA9B 4Y8XA 5FBEA 3ZZ8A 4AN7A 1J9CH 1O5CB 5FPYA 2Z3CA 3JZ2B 2RA3A 1KXDA 5FAHA 1ZMLA 3GDUA 4D8NA 4RKJB 3T5FH 2OP9A 1D3PB 3U69H 1TNGA 3ATKA 1GBTA 7GCHF 4F49A 3K9XB 1ANCA 2LPRA 3EAJA 3TNTA 1TOMH 3TH4H 1NN6A 2AMDA 2EC9H 1SGFG 3O8BA 4H6SB 1BTYA 3T27A 1UHBB 1EATA 1YPHC 4XOJA 4FUFA 1SQAA 3UIRA 1V6DA 3OTJE 2H6MA 4MPUA 2FS8A 3QZQA 2AERH 3HATH 1TRYA 3RMMH 5JBAS 4KGAA 1Z1IA 3RM0H 1DE7H 2HRVA 2C8ZB 1VJAU 4IBLH 1TA6A 1QHRB 4MNVA 2WPIS 3F9FA 1S84A 4YT7H 3PM3A 1BMMH 2NU4E 2IPHA 1IQGA 1MKWK 1OWHA 2G4TA 1S81A 2GCHG 1G30B 1CGHA 2HNTC 4GPGA 1HJAB 2NU1E 3EA9A 2ZGXH 3GCTF 3STIA 1ELEE 1DLKB 3RLYH 5C67A 3Q76A 1WUNH 3UR6A 2F9NA 1G3DA 1F92A 2QCYA 2BY6X 2ZU1A 2R2MB 1Z1JA 4OGYA 4WMFA 1AE5A 5GPIB 2A5KA 3D62A 4K60A 4Y7BA 1CSOE 4X1PU 7LPRA 1GMDG 2FI4E 1PPFE 1KLIH 2D26C 4TY7A 3CP7A 2ZA5A 4NFFA 2VVVA 1AE8H 3KGPA 1TBQH 3BIUH 5C2ZA 3MO6A 1QGFA 1IHTH 1RS0A 3RXBA 1QNJA 3MH7A 1ETTH 5AFZH 2ODQA 2XXLA 2C8YB 4AX9H 4HI3A 1C4V2 1O2MA 4FU7A 2BDYA 5LGOA 2R9PA 1MTWA 1NFXA 1E38B 1XXFA 1ZYOA 1O2NA 5IDKA 1A5HA 1C9TA 1T8LA 2CHAC 3UQOA 1F0UA 1QFKH 2VJ1A 3M3SA 1LPGB 4WXVA 4DURA 1CA0B 2C90B 4D7FA 1A0JA 2P94A 1NPMA 2G51A 4IS5A 1RFNA 1WYKA 1NTPA 1C2GA 1Y59T 2C4FH 2SGAA 3FZZA 4FUEA 1C5UA 1FY3A 1HXFH 2ZQ2A 4D76A 1TNKA 3BTFE 1EAUA 2BLWA 2A1DB 1AUTC 1GI4A 1T7CA 1C5OH 1NC6A 1ID5H 1VCQA 3JZ1B 3QWCH 3VXEH 4K5ZA 4ZKOU 1MU6B 2CMYA 2BDHA 2A2XH 1C5PA 2ZDVH 2GCHF 2BX3A 5JBCS 1ZMNA 3RDZA 1O2OA 2GV7A 1YGCH 1GBDA 2VIOA 1P57B 1ZHMA 1QJ6B 1HLTH