3M3SA

Crystal structure of sars-cov main protease asn214ala mutant with authorize n-terminus
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Dynamical Inactivation of the Catalytic Machinery of the SARS-CoV 3C-Like Protease as Triggered by the N214A Mutation on the Extra Domain
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 84
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3m3sA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m3sA02
1GHWH 1YLCA 1TBZH 1CQQA 1BTHH 1CSOE 3VXEH 3UWJH 1O2JA 5HGGA 1ZTLA 4MQAA 1YCPM 3SU1A 1TX7A 1P12E 1A5IA 1CT4E 5LGOA 2WPIS 2A5IA 1CU1A 2FOEA 4RKJB 1GDUA 3HKIB 1AVGH 2F9NA 2AH4X 3ZZBA 3PMJA 1GHVH 1YCPH 1HAYB 5HYOA 1RS0A 4WXVA 1Y3WA 2M5TA 2FYRA 4E7NA 5ABWA 1VCPA 1D3TB 4TWWA 1ANBA 1B0FA 2FEQH 2P16A 3OX7U 2ANMH 3L33A 1AVXA 2FLBH 4FXGH 3HGPA 2UWOA 4AFUA 2ANYA 4K60A 1BTUA 2TBSA 1O3MA 3DA9B 2XW9A 1JWTA 1L1NA 3GCHB 1K21H 1KLJH 4BXSA 3PLBA 1XUJA 2VWMA 5FBEA 2QGRA 5EPNA 4CRFA 1A0JA 2GMTC 3RUOA 5ESTE 1HIAB 4H6TA 2FM2A 1C1NA 5GPIB 1PYTD 4HGCA 2OD3B 5FX5A 2IN2A 1J17T 3LT3A 1GMDF 1MBMA 3I78A 1SGFG 4U30A 2ZCHP 2I6SA 1P04A 1FMGA 4DVAU 2R3YA 1D3QB 1LVMA 3T25A 2VU8E 1KTSB 3E8LA 1DY8A 3RXFA 3UUZA 1O3FA 3B23B 4Y6DA 5E2PA 2ZDNA 1A2CH 1SHYA 1PJPA 1O2KA 3DUXH 2BD8A 4HZHA 4KTCA 1BTXA 3ZVGA 1DM4B 5E2OA 1QRWA 2VWOA 4RKOB 1AFQC 3MH5A 1ACBE 1SGPE 4NFEA 1AI8H 1GMDG 1ZHRA 1A0HB 1H4WA 1ZJKA 2SGFE 1YPKH 5JPMH 3M3SA 1Y5AT 2ANWA 4WMEA 1QJ1B 1ORFA 1SGIB 1PPHE 1T4VH 1FUJA 3UTUH 3RMLH 1AE5A 3SQHE 2SNWA 5GDSH 2F9PA 3D49H 4ZROA 1J8AA 2ZHDA 4LZ4B 1GI0A 5IDKA 1HIAA 1OX1A 2BVXH 3QGNB 2XC4A 1XUHA 4O3TA 1EKBB 1XKAC 3M61U 1JRTA 1KLTA 2FTLE 2ZNKH 1O3OA 4UD9H 2GCHF 1GI4A 1DWEH 2C93B 1UTMA 1GHBF 4XBDA 1O2YA 2W3IA 1EX3A 4ZXXH 1YM0A 1UTJA 4ZH8A 1GJ6A 4GHQA 5EXMA 1FIWA 2BZ6H 1D6RA 1W2KH 1C2EA 3BIVH 3NCLA 4XBBA 4FUJA 1TGNA 3SV2H 4X8SH 1N6XA 5FBIA 1A3BH 4NZQA 3A84A 3SNDA 1P2OA 1GBKA 2FPZA 1O2GH 1MTSA 1P2JA 2ZTYA 1GI2A 1NZQH 1W12U 2OLGA 4A5TS 1JXPA 1OS8A 1AFQB 4Y71A 2BOHB 3EE0B 1TWXB 1YPHE 3MYWA 1WSSH 3SU5A 3ATIA 2DUCA 2GDEH 3FVFB 1MKWH 1G2MA 2FOFA 2YNBA 4U32A 3UOPA 4MNYA 2ZI2H 1O31A 1ZYOA 3V7TA 2F9UA 3O8BA 4BAMB 2XBXA 4X1RU 3VGCB 4DCDA 5JDUB 1OOKB 2VJ1A 4DT7B 3ZZ7A 3W94A 4AB8A 4CH2B 1MTWA 1TBRH 5A8XA 1HNEE 3VB6A 2ODYB 3F68H 1MD8A 5C67A 4IMQA 1HJAC 5G4BA 1CGIE 2ZC9H 1FY8E 1T4UH 2H1UA 1KLIH 3LONA 1C1MA 3SI3H 1CGHA 1E35B 4Q7YA 2PKSB 3IITA 1XUKA 3NZIA 4JYVH 3SU2A 3KNXA 3H5CB 5T3HA 1QJ7B 3LPRA 3MO9A 4FUFA 2BQ6B 5I46H 1K2I1 1AVWA 2Y81A 2TGDA 1SB1H 4LZ1H 1DWDH 2PUQH 3UOUA 1W0ZU 1FNIA 2A4OA 4F49A 2A31A 3PYHA 4I8LA 1MCVA 1L1GA 3RXMA 4NFFA 1KIGH 1SGYE 5F8TA 1GHAF 3RP2A 1MKWK 3QX5H 4CR5A 2FS8A 5DP8A 1TX6A 1O3CA 1C1VH 3T26A 3BTGE 2OCVB 2CF8H 6CHAC 1TGSZ 1QQ4A 1P2IA 2BDIA 3MU8A 4GVUA 4A6LA 1K1OA 1GL1A 1UTLM 4B2CA 3V13A 1KXBA 4MNVA 2Y5FA 2VGCC 3F9EA 4CR9A 3AVZA 3Q77A 1V2RT 1BMLA 5HMAA 5F8XA 1TLDA 1XUGA 2Q1JA 2W7UA 5SGAE 2A32A 2HVXA 1HJAB 1TGBA 1B0EA 1MTNB 1SSXA 1HRTH 2BY7X 1C5OH 1QB6A 5LH8A 1UK3A 1QIXB 4NSVA 2RA0A 1BRCE 4WMDA 2FIRH 1OWDA 2TGPZ 3NWUA 1FAXA 2A1DB 1BRBE 1W14U 1XXFA 2GVFA 2ZGCA 4U01A 2VWNA 2WPJS 4HTCH 1ID5H 2PSXA 3D62A 4JK6A 5FX6A 2ZFFH 1TGTA 2ZHWH 4J2YB 1HLTH 2WPKS 1C2DA 3ZZ8A 1AFEH 1IQMA 1LVYA 1ANEA 5CHAC 1V2KT 2AERH 4ISHH 1RJXB 1SPJA 1C5ZB 1ESBA 1QBNA 1JIRA 3SJKA 3ZVBA 3E0NB 2RCEA 3VB4A 1EB1H 3SQEE 3T29A 2BDCA 5CE1A 4IC5A 3CP7A 3DFJA 6GCHG 2J38A 1C2FA 3BTDE 4B2BA 2OUAA 1AQ7A 2WPHS 3MU0A 1OP2A 4INKA 1F0UA 2K1QA 4VGCB 2P59A 4WH6A 1ZSLA 4XSKU 1GVZA 2AIQA 3TPIZ 3FZDA 3F1SB 1ZHPA 4OS1A 2ZHFH 5C1UA 3A86A 2QCYA 2BD3A 3A7ZA 3M35A 1TRMA 3A80A 3NKKA 4BTTB 5DGJA 5E8EH 1Z1JA 3ZZCA 2A4GA 1A4WH 3PWCA 1DSTA 1O3NA 1L2EA 1W7GH 2C4FH 3SJIA 4FUCA 1TOMH 1ZPCA 4GLYA 1LKBA 2PTNA 1IAUA 4X2VA 1G3BA 1IHSH 4X8TH 4A1XA 3K6YA 1QR3E 1O2OA 2CGAA 3SNAA 3IWMA 3H7OA 1HAOH 2FTMA 2G51A 2FDAA 5EODA 2BY5X 1ESTA 3SO3A 4CRBA 1Q2WA 1YGCH 3MFJA 1AO5A 9ESTA 1UHBB 4DY7B 1SGFA 3MI4A 4IN1A 1NRQH 5EQQA 1WBGB 3QLPH 3S9AA 1E37B 2G00A 1UCYH 4X6PA 2XWBI 1OYQA 4XBCA 1TALA 4MPWA 1ZMLA 4OS5A 3B9FH 1FN6A 2ZPRA 2ZFPH 4Q7XA 1GI9B 5A0BA 1ZSKA 1UTNA 3ESTA 4KTUA 3MOCA 1F7ZA 4O97A 2SGQE 3QDZB 1PPCE 1TNKA 5EXLA 4B74A 1JIMA 1FLEE 3DT0H 3M7UA 1O3JA 1AE8H 2PR3A 3ODDA 4MPXA 1E34B 1HDTH 2C8YB 2GX4A 1E38B 2GT7A 1MQ5A 1SGTA 3OTJE 1CE5A 1ELBA 3OY5U 1Q3XA 1PQ8A 2P3TB 3RXIA 2AMDA 1XX9A 4H42U 1BJUA 3OYPA 3M3TA 1HJ9A 2CHAC 2A0QB 4YLQH 1TQ7B 4AYYB 3P8GA 2W3KA 3BG4C 1V6DA 1AUTC 4ABDA 1BJVA 1YYY1 1GVLA 2BY9X 2PLXA 1A61H 4X6MA 3T27A 2AYWA 1W8BH 3GYMA 4BOHA 2GZ8A 1UHBA 1C1OA 3VFEA 1MQ6A 3MWIU 2ZDLA 1DS2E 1DANH 1CVWH 1GJ7B 2BTCE 1TNIA 1O2SA 4NA9H 2OBQA 2C8ZB 1ANDA 3RXUA 1EUFA 3ATLA 4AFZA 3ENSB 1GJBB 6ESTA 1GBDA 4Y11E 1TAWA 2PTCE 1O3KA 3LOXA 4ABEA 1J9CH 1V2LT 2FOCA 1O2ZA 4ZKNU 4AORA 1G3DA 3BTEE 2VIWA 4K5ZA 1QCPA 3S0NA 4INHA 1JRSA 1HJ8A 3K65B 4X8VH 4YLUA 2P94A 4D7GA 1FY5A 4UFEH 5FHTA 1OYTH 3GY7A 3L3TA 2PGBB 1YP9A 3V3MA 4YOIA 4WF8A 3RXJA 4JCNA 1C5MD 1CT2E 3TLOA 2NU2E 3MH7A 3KN2A 2BLWA 1AHTH 2B7DH 2CHAB 1SFIA 1C5QA 3DFLA 3BTHE 1FONA 1ZOMA 3BG4B 4B75A 1J15A 3MO6A 3PB1E 2AFQB 1S85A 3SV6A 1TE0A 1FI8A 4HFPB 4IMZA 5JBTA 3BF6H 1O33A 4MTBA 1OPHB 2WYGA 1FY1A 3TK9A 1QRXA 3UNRA 4GSOA 1KYNA 3SHCH 1TIOA 5DP4A 4CBNA 1DUAA 1TPOA 2CV3A 2W5EA 1O5EH 2G55A 2UUKB 5JB8S 4XFQA 2NWNA 4YTAA 3FZZA 5J4QA 4HI3A 1ARCA 2JH5D 1GJCB 1IQGA 1M9UA 2GV6A 2FOHA 1O3PB 1O2TA 2A5KA 1WU1A 4MNXA 4JZEH 1BIOA 1SQOA 3RXPA 1G3EA 3P8NA 3AW0A 1SI5H 1A5HA 1LTOA 1IQLA 2XCFA 5GCHG 2PV9B 3PM3A 1C2HA 2G5NA 5AF9H 3NPSA 9LPRA 4TY7A 4K69A 4DIIH 1C2MA 1EAIA 2Z9IA 1Y3UA 1MAYA 4FUIA 2P3FH 1P2QA 4WMFA 1K22H 2V0BA 3VEQB 5GIBA 1G32B 2BD4A 4RSPA 1ZZZA 3E90B 4K8BA 1O2MA 3F9HA 3BTQE 2GGVB 1GBCA 1L1JA 4R8TB 5I25A 1G36A 1V2JT 2HNTC 3JZ1B 1EOLA 2K7XA 1TPAE 2A7JA 4TWYA 2UUJB 1QHRB 1XM1A 3QO6A 1THPB 1AWHB 1EQ9A 1DXPA 2PFEA 3A7YA 1PPGE 2SGDE 4LK4A 1P02A 1IOEA 1UVPA 2OXSA 1C5RA 1D3PB 1WUNH 2J95A 3CS0A 1QURH 4E05H 5C1YA 1P05A 1OP0A 4Y76A 1IQIA 2BX4A 1NFUA 2W26A 3EYDA 1C5UA 1GL0E 2BD2A 3PTNA 2LPRA 1F0RA 4PROA 3MO3A 4NCYA 3MNCA 1HAVB 4MG3A 3KQBA 1TONA 2PHBA 5L30H 3ZVAA 1O2RA 1G3CA 1OWIA 3B8JA 5C5OA 2KAIB 4SGAE 2QV1A 4TPYA 1LVOA 3GICB 1K1NA 4Q7ZA 1DLKB 2THFB 1WQVH 1TB6H 2CMYA 3R0FA 3AASA 3GOVB 5C1XA 2R0LA 4YZUA 1GJ9B 3I29A 3AAVA 1D9IA 4ZUHA 2O8LA 5TJXA 3VB5A 3TJNA 2CXVA 3RC5A 1SR5C 2ZQ1A 1JBUH 3KGPA 3QTOH 2G5VA 3BIUH 4FU8A 3MNBA 1QB9A 4K1TA 2XXLA 1EP6A 2BY8X 2F9OA 1PPBH 1SGNE 2ZG0H 1YCPK 1OWKA 3HGNA 2ZFSA 3OY6U 3Q3KA 4ZMAH 1LMWB 4GHTA 1O32A 1EAWA 1ANCA 1S5SA 1A1RA 2GZ9A 1BHXF 1DFPA 1O3HA 1GI7B 3UQOA 1KXDA 4I8KA 4I7YH 1ZPBA 3MH6A 1W0YH 2FODA 3EAJA 1C2JA 2ZFTA 4LXBH 2VVVA 3PTBA 1W13U 1HAVA 1SVPA 1RIWC 1FDPA 1SLVB 4ZXYH 1CA8B 2KAIA 2Z3CA 3E91A 1LHEH 1UK2A 2CN0H 4LOYH 3VGCC 1AWFH 1GI1A 3O8CA 1ELFA 1WTHD 1K28D 1WV7H 1ZSJA 1BCUH 2J92A 5A09A 8GCHF 2ILNA 3SNEA 3P95A 2AGEX 3TH4H 1C4V2 1IHTH 1DSUA 2ZFRH 4ASHA 4CRAA 1AU8A 4X1QU 1O3EA 3A82A 5DO4H 1JMOH 2D26C 2A4RA 3JZ2B 2PKSC 5EXNA 1AUJA 3EGKH 1E0FD 5DP3A 3A8BA 1QFKH 1QTFA 2BDBA 1ELGA 4D7FA 2TRMA 4X1NU 1LPZB 3I77A 4FU9A 8GCHG 3STJA 5FPYA 2WV4A 1NPMA 2Y80A 2VH0A 4FUDA 2FO9A 2GCHG 3EDXB 2XTTB 1XVOA 5T6DA 1GHBG 3MTYA 4CRDA 1O2QA 2UUYA 4NZLA 5C20A 1XUFA 3BEFB 2SGEE 1RIWB 5DG6A 1DICA 5HM2A 3LIWA 5J4SA 2OC8A 1UVSH 1LO6A 5EOKA 3SV9A 1UVTH 1YC0A 1K1JA 1AD8H 2W7SA 3RXQA 2Z7FE 2Z94A 4TY6A 8KME2 1O2UA 1N1LA 1GDNA 3MU5A 2HNTE 1W10U 4FU7A 2P8OC 1S84A 2WYJA 2HLCA 3ZVFA 3SU0A 4ZHAA 1L4DA 3RM2H 3SUFA 1MTNC 3T28A 4ZHLU 2V3HH 2EI7A 1P9UA 1FY4A 3BTME 5CMXH 5A8YA 2A5AA 1KY9A 1WYKA 1EAXA 1TGCA 2HWLB 4F4OC 1FJSA 2A7HA 2GV7A 4NSYA 4FUBA 2Q6DA 1LKAA 3D23A 2OC7A 2VVUA 4Y10E 4AFQA 5AFZH 2O8UA 2ZF0H 1UK4A 3Q3YA 1SGCA 2PWXA 2AS9A 2Z9KA 1BMNH 3RC6A 5DP9A 1BB0B 3FAOA 1IQJA 2WV5A 2Y6TA 4X2YA 2F91A 2FS9A 4A1TA 4ZAEA 1X7AC 3U9AH 1BBRE 1UO6A 2SGAA 4I8JA 1Y5BT 1A5GH 2TPIZ 4XDEA 1Z71A 2GCTB 1BZXE 2R9PA 1BDAA 2PW8H 2F3CE 4VGCC 1O5GH 1ELTA 3BTKE 3RXHA 4X1SU 1C9PA 2AEIH 1KXAA 2BVRH 3KQEA 1TOCB 3LJOA 1C5YB 1EXFA 2ZPSA 3A89A 1C2LA 1GGDB 1GHAG 2OTVA 2P8OB 2QY0B 2A4QA 1L0ZA 3MU4A 3U8TH 4FUGA 3VPKA 3M5MA 3QGJA 4NIVA 2ULLA 1Z8IB 1W11U 2GP9B 1UMAH 1JOUB 1RTKA 1KXFA 1KXCA 2Y82A 1RGQA 3SGQE 3QTVH 1EJMA 2ALPA 4Y8XA 3ELAH 4BANB 1EP5A 2ZECA 4OS6A 4X0WU 2R2MB 2QXIA 1EJAA 2Z6BD 1MUEB 2ODQA 1BOQA 2WUCA 2GKVE 1WQSA 1O3BA 3GY4A 1SMFE 1NY22 2ZKSA 1UVOA 2FWWA 1EAUA 3GY6A 2ZWLH 2C8XB 3ATWA 3P92A 1TNGA 4ABAA 3LGIA 1TMUH 2BD7A 2F83A 1XMNB 4YO9A 1EZUC 3SNBA 2VIQA 1CHOF 1SLUB 3T62A 1LHFH 1VITH 1GDQA 3A8DA 4Y0ZE 2QYIA 4O03A 1LCYA 2A45B 1GBJA 2ZGHA 2BM2A 1AGJA 1SGEE 1ARBA 2AGIX 4AZ2B 1O2PA 4WY3A 2QAAA 2QA9E 5EQRA 1RFNA 4AGJA 4WXIA 1BTZA 1MKXH 2J34A 2GT8A 4THNH 2Z3EA 1C1RA 1EJNA 1NRRH 2BDAA 1ZTJA 2XWAA 1C1QA 1E36B 5T6GA 1O2VA 2H9EH 5LPEA 2HPPH 2DE8A 2O8TA 3P17H 3ZZDA 2J94A 2JH6D 1YPEH 3GY5A 3WY8A 1ZGVA 1C5VA 1K1LA 4BAOB 1OSSA 1W7XH 1QBVH 3FP6E 1SHHB 3LJJA 4M7GA 2D8WA 3ZZAA 2ZZUH 2G81E 1XXDA 2TGTA 2QN5T 3BEUA 4CHAB 1GJ5H 1BTWA 4D9RA 1QJ6B 2P3UB 2ZGJA 1EZQA 3CENA 1V2TT 1Z8JB 3A8AA 2FP7B 1TFXA 3SJOA 2AIPA 2BQ7B 1DOJA 3SHAH 2ZA5A 4B73A 1NROH 3C27B 1TABE 2VIVA 2O8WA 2PSYA 1QL8A 1THSH 5IYTA 5TCCA 1G30B 3S7KB 3RXKA 1GJDB 2ZIQH 2WINI 5ETXA 5JBAS 1MKXK 2C90B 1NS3A 3RU4D 1MH0A 4AB9A 3BTFE 1RD3B 3ATKA 4ABGA 1EPTC 3TJOA 1V2PT 3LGVA 2QC2A 3KCGH 4Q2KA 1J16A 3ZZ5A 4NWLA 1LPGB 3ODFA 3UWIA 1V3XA 1SFQB 4ISLA 1HAHH 3HK6B 3Q3XA 2BX3A 5DP6A 1LQEA 1SGQE 4O3UA 1HXFH 1O38A 1W3CA 3ZZ9A 1O3AA 3EA9A 4BAHB 3RMOH 4AYVB 2GTBA 2XC5A 5C2ZA 3TK5A 3S9BA 2A7CA 1GI6A 3ZZ6A 3GY8A 3F9GA 1LDTT 5B6OA 3SU6A 4A1VA 4GCHF 4ISIH 1MU8B 3KL6A 1BTYA 1C5SA 1OWHA 1UCYK 2JETC 4NA7A 1T8MA 3EQ0H 1HXEH 1NTPA 1V2MT 3EA7A 5EQSA 3RLWH 2BLVA 3PLPA 5DPAA 2XBWA 3K6ZA 1P8VC 1Y8TA 3TNTA 1WOFA 1NFWA 3RU4E 3PMAB 2ZTXA 1NFXA 1XUIA 1GMHF 2Q6GA 1AY6H 2EC9H 1PQ5A 3SJ9A 3RXGA 3ZV8A 1TYNA 1Z6JH 1UTQA 1EPTB 1O2IA 1DWCH 1Y5UT 1NO9H 1O3DA 1P06A 3ZVEA 4Y79A 4ABJA 3GCTF 2V35A 2BVSH 1SQAA 4ISOA 1P10A 2EA3A 3ZVCA 2BDHA 1HAXB 1O2WA 3UNQA 4A92A 3V12A 1TRNA 4B1TA 5L2ZH 1YPLH 4I31A 2Z9JA 2FOGA 1CGJE 3ZYDA 3AW1A 3RXSA 2BD9A 3S7HB 3RXLA 4FUHA 1NRPH 1LVBA 2G8TA 5A0CA 1YLDA 1QB1A 4H4FA 1DVAH 3M7TA 5BRRE 4NG9H 1C5LH 1F5LA 3M36A 1GWAA 2FESH 1FQ3A 2BQWB 2JETB 2Y7XA 1Z8GA 4UFDH 2R2WU 5TCAA 1EB2A 2EI6A 1ELVA 2ZHEH 3BG8A 3W95A 1CA0B 1O5CB 5A0AE 1EASA 3TK6A 3MU1A 3NUMA 3FP8E 2CF9H 1ZJDA 3BN9A 3M3VA 2NU0E 1ZTKA 1GI5A 1GBEA 1GI3A 1GG6C 4Y7BA 4BAQB 1EPTA 2HOBA 1O39A 3O8DA 1FY3A 4AOQA 2XC0A 4IW4E 4AX9H 4DW2U 1FN8A 3T2NA 4JZFH 1CBWC 1T8LA 2VNTA 3SGBE 3M7QA 3S9CA 1MCTA 2EEKA 2ZCKP 2NU1E 1F5KU 1O36A 3TGJE 1GMCF 1BUIA 1HPGA 3U69H 1DWBH 2OP9A 3LC3A 2ZQ2A 1MMJN 5JYIA 1QNJA 2ZDVH 1RTLA 2WPMS 3C1KA 3TITA 2H9TH 1NRNH 1ELEE 2H5DA 3UR6A 1O30A 3CS7A 2VH6A 3HPTB 1T7CA 3TGIE 3RDZA 2G4UA 4AN7A 1P03A 4MDSA 1D4PB 2F9BH 3SZNA 3TH2H 2NU4E 4NWKA 1GBHA 1N8OC 1F2SE 3LKWA 1T8NA 4NGAH 2BMGB 4ABFA 5AVDA 1LHDH 2ODPA 5HM9A 5EPYA 5FXLA 1C2IA 3A83A 3D65E 3HKJB 3UREA 4CREA 4JK5A 1H9HE 2RG3A 1V2WT 3R3GB 1NN6A 1V2UT 5FCRA 2BB4A 4K1SA 4K1EA 4YOJA 1QA7A 1GG6B 4J1YA 2UWLA 1EOJA 5K0HA 5K7RA 1SQTA 3U1JB 7KMEH 3UR9A 3GDUA 1DUEA 1QRZA 1CBWB 5GWZA 2Y7ZA 2GZ7A 3EBNA 2BDYA 3PO1B 1BMMH 1LPKB 5F6MA 4B2AA 3QWCH 3KHVA 1GJ8B 1TQ0B 3M37A 3ATMA 1GHYH 1T31A 1O2NA 4JZIA 3RLYH 4I8HA 2P95A 3GY3A 3HATH 2D2DA 5JBBS 1GBAA 5C3NA 3L6PA 3IG6B 4ZKOU 2C3SA 3MNXA 2BYAX 2XBYA 1ZGIA 2OC1A 1P01A 1ABIH 2ZU2A 4BNRA 1C2KA 1S83A 1O2XA 1P2MA 4JYUH 1N8OB 3E3TA 3SOSA 1H8IH 3Q76A 2H2ZA 4OS2A 3OSYA 1GCTC 3AAUA 1XVMA 1FV9A 3UIRA 2RA3A 2ZEBA 3ZZ4A 6LPRA 1DDJA 3E0PB 3MHWU 3M5NA 3TNSA 1VJAU 2Z9LA 2WUBA 1P57B 4DIHH 2TGAA 3PWBA 2AGGX 2IOTA 4E06H 1MAXA 1P2KA 1H8DH 1BBRH 4NIXA 1UTPA 1SG8B 4X1PU 1TRYA 4TYDA 2LNCA 1INCA 3QZQA 5DP7A 2WPLS 4UFFH 1O5FH 3MNSA 2G4TA 1Y59T 3LGYA 4FVDA 1D3DB 2Y5GA 1VITF 3BEIB 1C1SA 1T32A 2J4IA 2B9LA 1TPPA 2H9HA 3N7OA 1DT2A 2ANKH 2QF0A 2FI4E 2O9QA 3QK1A 4ABHA 3TJUA 1GBTA 4K3JA 5E0JA 5DJ7A 1LHCH 1NT1A 1VITG 1SGDE 1EATA 1O34A 3SUDA 2ZGXH 1ETRH 4XOJA 3URCA 1O3GA 3TU7H 1IQKA 5DKMA 1GCTB 2B8OH 3HK3B 1O5AB 4GPGA 3BTTE 3UFAA 1TNJA 1Q31A 4YESB 2GMTB 3PROA 1BBRK 4Q80A 1QL9A 3KEEA 1Y3VA 1C1PA 1ETSH 3NXPA 3RXTA 4YOGA 1HAZB 4BAKB 3RXRA 1RXPA 2BD5A 3E16B 3SU4A 3ZV9A 4JMYA 3SNCA 2SNVA 1ETTH 4B71A 4KTSA 5FPTA 1DY9A 1GBIA 3A7VA 3RXBA 1BQYA 3FANA 1HAPH 2GCTC 1OWJA 1VJ9U 5L6NH 2BY6X 4WWYA 1UJ1A 1C1WH 2B0FA 1YPMH 1YPGH 1GGDC 1Y3YA 4X8UH 3DD2H 1C5WB 2QXJA 3H7TA 1AZZA 3F6UH 4JZDH 4NIYA 1EZXC 4Y8ZA 2QXGA 5ESBA 4ZKRU 4KKDA 3U98H 2D1JA 1ZHMA 2OC0A 2UUFB 4DGJA 5EW1H 5DK1A 4JZ1A 2TIOA 1S0RA 2PUXB 3VB7A 1VCWA 1DLEA 3GDSA 2XBVA 1OP8A 1CT0E 3RXVA 4Y8YA 1TA2A 5F03A 2BHGA 2Y5HA 4D9QA 1ZR0A 1AN1E 1F92A 1GPZA 4WVPE 3S69A 1GHZA 1NC6A 1FIZA 1VR1H 1VCQA 3K2UA 1CHGA 5E0HA 4ISNA 2SGPE 4YT7H 1C1UH 3QZRA 1NFYA 2NU3E 1ZPZA 1KDQB 2HRVA 1FPCH 4I33A 2FI5E 5GXPA 1ZRKA 3LC5A 4IS5A 3TIUA 2HALA 1O3IA 1Z1IA 4AFSA 1G9IE 4Y0YE 1PFXC 4CH8B 3GCNA 1AZ8A 4D8NA 4TPIZ 1SGRE 2QXHA 3KQDA 2RDLA 1K1MA 1AB9C 3LH3A 2ZDMA 1LHGH 3SN8A 4ABBA 4B76A 1ELCA 2VIDA 1P11E 4CRCA 3LDXH 3URDA 2I6QA 1HAGE 4WJG2 2V6NA 1KTTB 3GDVA 3SW2B 4D76A 1BA8B 1F0TA 4GAWA 5JB9S 1HAIH 1HFDA 1V2QT 1FZZA 4DOQA 1A3EH 4E7RG 2UWPA 3TJVA 1TMBH 4FUEA 1AMHA 2G52A 1GJ4H 2C8WB 1ZLRA 3M5OA 4Z6AH 2XNIA 1ELDE 4R0IA 4I8GA 3FFGA 3RC4A 1NU7B 4CHAC 1S0QA 5BPEA 1S6FA 1QQUA 2YNAA 3BTWE 4YT6H 1SL3A 2ZP0H 1O0DH 3UNSA 3LGTA 3RXEA 1DX5M 1KDQA 1OWEA 4I32A 4BTIB 5FPSA 1IQNA 6GCHF 1ESAA 2FX4A 3SJ8A 5PTPA 2BXTH 7ESTE 2SFAA 1C9TA 3A7WA 1MZAA 3LU9B 3TGKE 3QN7A 1P3EA 1PPEE 3SV8A 2AMQA 2HPQH 2STAE 4ZHMU 2VINA 2A2XH 4FVBA 1C5XB 5L2YH 1MU6B 1S6HA 2ZDAH 5E0GA 1TBQH 5F8ZA 1IQHA 1SOZA 4AG1A 1WTGH 1PQAA 2ZO3H 1AB9B 3QUMP 5JBCS 3V0XA 1P9SA 1O3LA 3A7TA 1HB0B 1QY6A 3RMNH 5A8ZA 4IN2A 1BITA 6CHAB 1FXYA 1BMAA 2FX6A 4MPUA 1RRKA 4OS7A 2J9NA 4YM9A 1CHOG 1VGCC 3STIA 5AHGH 2VGCB 1J14A 1KSNA 4WH8A 3A87A 3SBKA 2VIPA 1GVKB 7LPRA 7GCHF 3KF2A 4O9VA 1C5TA 1YF4A 1DPOA 3P8FA 4INLA 3ZVDA 1MBQA 2Q6FA 3LH1A 5GJ4B 1P2NA 1EZSC 1BHXB 2ZFQH 4JYTA 4Z0KA 2H6MA 1SLWB 2OINA 4MVNA 3RMMH 2ZTZA 1DITH 1YPJH 8LPRA 2FZZA 1SOTA 2BLQA 4K2YA 1WCZA 3EA8A 3GCOA 4X2XA 4ESTE 2ALVA 3VB3A 1QGFA 1QL7A 2XRCA 3LGWA 4IBLH 1O2LA 1BRUP 2R3UA 7GCHG 3KQCA 1C5NH 2IJOB 2OQ5A 1HYLA 1TA6A 1ELAA 1FAKH 1NM6A 1HGTH 3DHKH 5T6FA 1GCDA 1GHXH 2XCNA 1HUTH 4H6SB 1MTVA 5CHAB 2VWLA 2Z9GA 3Q00A 1C4Y2 2VVCA 2QF3A 4NA8A 1H9IE 3F9FA 1B5GH 2VIOA 3UY9A 4ABIA 3K9XB 1Z7KA 4XE4A 1Z8RA 1TNLA 1RTFB 2HNTF 3U8OH 4X2WA 4RN6A 3SUEA 1TNHA 1GBFA 8ESTE 1VGCB 5FCKA 3ZZ3A 1A46H 4SGBE 2GDDA 3SV7A 1HV7A 1LQDB 3SI4H 3SUGA 5H4IB 4Y7AA 1AKSB 1DXWA 1C1TA 2BZAA 5EU8A 3BSQA 2ZCLP 1OKXA 3VXFH 3M5LA 3P70B 2AMPA 5FAHA 3GISB 4BXWA 2QIQA 1BRAA 4UONA 1P3CA 2P93A 2OQUA 1MTUA 1PPZA 1F0SA 1MZDA 4DURA 1O5BB 1Y3XA 4DJZB 2LIZA 2GD4B 5A2MH 3E1XB 4X6NA 3GYLB 2HGTH 1H1BA 5C5NA 2JH0D 1HBTH 1DE7H 1C5PA 1A7SA 3OU0A 1CA0C 5AFYH 4CRGA 5HXFA 1K9OE 2ZDKA 2A2QH 1P09A 1NESE 1SBWA 4AGKA 2OBOA 2FMJA 3ZYEA 3A85A 4K8YA 3A88A 4OGYA 4UFGH 3LGUA 4GCHG 1V2OT 2BXUH 1GI8B 1O5DH 1MD7A 2FXRA 1G2LA 3KIDU 1QBOA 4UDWH 1P0SH 1KXEA 1K1PA 4MPVA 1A0LA 2ZU5A 3SORA 3A8CA 5EW2H 3G01A 5EG4A 2IPHA 1GJAB 1G37A 1C2GA 4UE7H 1FPHH 1TMTH 1AKSA 3PMHB 1O2HA 1GMHG 4U2WA 2FOBA 2BOKA 2VB0A 1TX8A 1VZQH 4BTUB 4NIWA 3E6PH 1IQFA 1NU9A 1O35A 2BLOA 2FOMB 4AG2A 4X6OA 3T5FH 2PKAB 3MH4A 3P6ZB 1PQ7A 4A7IB 2ESTE 1V2NT 2ZU1A 4IGDA 1UTKA 2FLRH 1V2VT 3A7XA 2FOAA 2Z3DA 2BDGA 5DP5A 1T8OA 2ZHQH 1HCGA 2EI8A 4CBOA 3GCTG 4DG4A 1TPSA 2B5TB 1GBBA 3SU3A 1BT7A 1L4ZA 3RXAA 3RM0H 1SLXB 2V3OH 1SC8U 1PPFE 3MMGA 2H5CA 1GBLA 2F9VA 4MNWA 3ITIA 2FYQA 5EGMA 3U8RH 3O8RA 2YOLA 4IC6A 1PYTC 1ABJH 5LPRA 3RXDA 1C4U2 3UQVA 5GCHF 3RXOA 1UTOA 1AIXH 2JKHA 3PO1C 1BTPA 3P8OA 1NRSH 3RU4T 1UVUH 2J2UA 1WAYB 2R0KA 1Z6EA 4KP0A 3SGAE 3TVJB 4UEHH 1UCYE 4KELA 1ZRBA 3UPEA 4OS4A 2ZGBH 3TH3H 1GBMA 1QA0A 2ASUB 3PMBB 1CO7E 2DE9A 3GY2A 3NK8A 2ZU3A 2PKAA 1S81A 2FI3E 1D6WA 1IQEA 3RXCA 3PV4A 2STBE 2ZPQA 2PGQB 1S82A 4OGXA 4KGAA 3U1IB 1U6QA 3BV9B 1OXGA 4QT8C 1B7XB 1V2ST 1ZMJA 4MLFB 1GMCG 3GCHC 1YKTA 3FP7E 1YBWA 5LPFA 1THRH 1YPHC 4GUXA 2ZU4A 1ZMNA 1XKBC 2CJIA 1K1IA 3A81A 2O8MA 1O37A 4ZKSU 1N6YA 3PLKA 1H9LB 1F5RA 2XYAA
chains in the Genus database with same CATH superfamily
1GHWH 1YLCA 1TBZH 1CQQA 1BTHH 1CSOE 3VXEH 3UWJH 3UAIC 1O2JA 5HGGA 1ZTLA 4MQAA 1YCPM 3SU1A 1TX7A 1P12E 1A5IA 1CT4E 5LGOA 2WPIS 2A5IA 1CU1A 2FOEA 4RKJB 1GDUA 3HKIB 1AVGH 2F9NA 2AH4X 3ZZBA 3PMJA 1GHVH 2V7QD 1YCPH 1HAYB 5HYOA 1RS0A 4WXVA 1Y3WA 2M5TA 2FYRA 4E7NA 5ABWA 1VCPA 1D3TB 4ASUD 4TWWA 1ANBA 1B0FA 2FEQH 3DSOA 2P16A 3OX7U 2ANMH 3L33A 1AVXA 2FLBH 4FXGH 3HGPA 2UWOA 4AFUA 2ANYA 4K60A 1BTUA 2TBSA 1O3MA 3DA9B 5EIYA 2XW9A 1JWTA 1L1NA 3GCHB 1K21H 1KLJH 4BXSA 3PLBA 1XUJA 2VWMA 5FBEA 2QGRA 5EPNA 4CRFA 1A0JA 2GMTC 3RUOA 5ESTE 1HIAB 4H6TA 2FM2A 1C1NA 2QE7D 5GPIB 1PYTD 4HGCA 2OD3B 5FX5A 2IN2A 1J17T 3LT3A 1GMDF 1MBMA 3I78A 1SGFG 4U30A 2ZCHP 2I6SA 1P04A 1FMGA 4DVAU 2R3YA 1D3QB 1LVMA 1BMFD 2VU8E 3T25A 1KTSB 3E8LA 1DY8A 3RXFA 3UUZA 1O3FA 3B23B 4Y6DA 1H8HD 5E2PA 2ZDNA 1A2CH 1SHYA 1PJPA 1O2KA 2J5UA 3DUXH 2BD8A 4HZHA 4KTCA 1BTXA 3ZVGA 1DM4B 5E2OA 1QRWA 2VWOA 4RKOB 1AFQC 3MH5A 1ACBE 1SGPE 4NFEA 1AI8H 1GMDG 1ZHRA 1A0HB 1H4WA 1ZJKA 2SGFE 1YPKH 5JPMH 3M3SA 1Y5AT 2ANWA 4WMEA 1QJ1B 1ORFA 1SGIB 1YLNA 1PPHE 1T4VH 1FUJA 3UTUH 3RMLH 1AE5A 3SQHE 2SNWA 5GDSH 2F9PA 3D49H 4ZROA 1J8AA 2ZHDA 4LZ4B 1GI0A 5IDKA 1HIAA 1OX1A 2BVXH 3QGNB 2XC4A 1XUHA 4O3TA 2WHXA 1EKBB 1XKAC 3M61U 1JRTA 1KLTA 2FTLE 2ZNKH 1O3OA 4UD9H 2GCHF 1GI4A 1DWEH 2C93B 1UTMA 1GHBF 4XBDA 1O2YA 2WV9A 2W3IA 1EX3A 4ZXXH 1YM0A 1UTJA 4ZH8A 1GJ6A 4GHQA 5EXMA 5C0TA 1FIWA 2BZ6H 1D6RA 1W2KH 1C2EA 3BIVH 3NCLA 4TT3D 4XBBA 4FUJA 1TGNA 3SV2H 4X8SH 1N6XA 5FBIA 1A3BH 3N99A 4NZQA 2F4LA 3A84A 3SNDA 1P2OA 1GBKA 2FPZA 1O2GH 1MTSA 1P2JA 2ZTYA 1GI2A 1NZQH 1W12U 2OLGA 4A5TS 1JXPA 1OS8A 1AFQB 4Y71A 2BOHB 3EE0B 1TWXB 1YPHE 3MYWA 1WSSH 3SU5A 3ATIA 2DUCA 2GDEH 3FVFB 1MKWH 1G2MA 2FOFA 2YNBA 4U32A 3UOPA 4MNYA 2ZI2H 1O31A 1ZYOA 3V7TA 3OEHD 2F9UA 3O8BA 4BAMB 2XBXA 4X1RU 3VGCB 4DCDA 5JDUB 1OOKB 2VJ1A 4DT7B 3ZZ7A 3PRDA 3W94A 4AB8A 4CH2B 1MTWA 1TBRH 5A8XA 4RI0A 1HNEE 3VB6A 2ODYB 3F68H 1MD8A 5C67A 4IMQA 1HJAC 5G4BA 1CGIE 2ZC9H 1FY8E 1T4UH 2H1UA 1KLIH 3LONA 1C1MA 3SI3H 1CGHA 1E35B 4Q7YA 2KCPA 2PKSB 3IITA 1XUKA 3NZIA 4JYVH 3SU2A 3KNXA 3H5CB 5T3HA 1QJ7B 3LPRA 3MO9A 4FUFA 2BQ6B 5I46H 1K2I1 1AVWA 2Y81A 2TGDA 1SB1H 4LZ1H 1DWDH 2PUQH 2WPDD 3UOUA 1W0ZU 1FNIA 2A4OA 4F49A 2A31A 3PYHA 4I8LA 1MCVA 1L1GA 5HIZA 4NFFA 3RXMA 1KIGH 1SGYE 5F8TA 1GHAF 3RP2A 1MKWK 3QX5H 4CR5A 2FS8A 5DP8A 1TX6A 1O3CA 1C1VH 3T26A 3BTGE 2OCVB 2CF8H 6CHAC 1TGSZ 1QQ4A 1P2IA 2BDIA 2KZ4A 3MU8A 4GVUA 4A6LA 1K1OA 1GL1A 1UTLM 4M9FA 4B2CA 3V13A 1KXBA 4MNVA 2Y5FA 2VGCC 3F9EA 4CR9A 3AVZA 3Q77A 1V2RT 1BMLA 5HMAA 5F8XA 1TLDA 1XUGA 2J97A 2Q1JA 2W7UA 2GJGA 5SGAE 2A32A 2HVXA 1HJAB 1TGBA 1B0EA 1MTNB 1SSXA 1HRTH 3OAAD 2BY7X 1C5OH 1QB6A 3F0OA 5LH8A 1UK3A 1QIXB 4NSVA 2RA0A 1BRCE 4WMDA 2FIRH 1OWDA 2TGPZ 3NWUA 1FAXA 2A1DB 1BRBE 4ACAA 1W14U 1XXFA 2GVFA 2ZGCA 4U01A 2VWNA 2WPJS 4HTCH 1ID5H 2PSXA 3D62A 4JK6A 5FX6A 2ZFFH 1TGTA 2ZHWH 4J2YB 1HLTH 2WPKS 1C2DA 3ZZ8A 1AFEH 1IQMA 1LVYA 1ANEA 5CHAC 1V2KT 2AERH 4ISHH 1RJXB 1SPJA 3DSGA 1C5ZB 1ESBA 1QBNA 1JIRA 3SJKA 3ZVBA 3E0NB 2RCEA 3AK5A 3VB4A 1EB1H 3SQEE 3T29A 2BDCA 5CE1A 4IC5A 3CP7A 3DFJA 6GCHG 2J38A 1C2FA 3BTDE 4B2BA 2OUAA 1AQ7A 2WPHS 3MU0A 1OP2A 4INKA 1F0UA 2K1QA 4VGCB 2P59A 4WH6A 1ZSLA 4XSKU 1GVZA 2AIQA 3TPIZ 3FZDA 3F1SB 1ZHPA 4OS1A 2ZHFH 5C1UA 3A86A 2QCYA 2BD3A 3A7ZA 3M35A 1TRMA 3A80A 3NKKA 4BTTB 5DGJA 5E8EH 1Z1JA 3ZZCA 2A4GA 1A4WH 3PWCA 1DSTA 1O3NA 1L2EA 1W7GH 2C4FH 3SJIA 4FUCA 3PRBA 1TOMH 4OM9A 1ZPCA 4GLYA 1LKBA 2PTNA 1IAUA 4X2VA 1G3BA 1IHSH 4X8TH 4A1XA 3K6YA 1QR3E 1O2OA 2CGAA 3SNAA 3OE7D 4Q4LA 3IWMA 3H7OA 1HAOH 2FTMA 2G51A 2FDAA 5EODA 2BY5X 1ESTA 3SO3A 4CRBA 1Q2WA 1YGCH 3MFJA 1AO5A 9ESTA 1UHBB 4DY7B 1SGFA 3MI4A 4IN1A 1NRQH 5EQQA 1WBGB 3QLPH 3S9AA 1E37B 5C94A 2G00A 1UCYH 4X6PA 2XWBI 1OYQA 4XBCA 1TALA 4MPWA 1ZMLA 4OS5A 3B9FH 1FN6A 2ZPRA 2ZFPH 4Q7XA 1GI9B 5A0BA 1ZSKA 1UTNA 3ESTA 5C17A 5F53A 4KTUA 3MOCA 1F7ZA 4O97A 2SGQE 2YMSC 1PPCE 1TNKA 3QDZB 5EXLA 4B74A 1JIMA 1FLEE 3DT0H 3M7UA 1O3JA 1AE8H 2PR3A 3ODDA 4MPXA 1E34B 1HDTH 4RT0A 2C8YB 2GX4A 1E38B 2GT7A 1MQ5A 1SGTA 3OTJE 1CE5A 1ELBA 3OY5U 3PV5A 1Q3XA 1PQ8A 2P3TB 3RXIA 2AMDA 1XX9A 4H42U 1BJUA 3OYPA 3M3TA 1HJ9A 2CHAC 2A0QB 4YLQH 1TQ7B 4AYYB 3P8GA 2W3KA 3BG4C 1V6DA 1AUTC 4ABDA 1BJVA 1YYY1 1GVLA 2BY9X 4ACBA 2PLXA 1A61H 4X6MA 3T27A 2AYWA 1W8BH 3GYMA 4BOHA 2GZ8A 1UHBA 1C1OA 5T1VA 3VFEA 1MQ6A 3MWIU 2ZDLA 1DS2E 2JJ1D 1DANH 1CVWH 1GJ7B 2BTCE 1TNIA 1O2SA 4NA9H 2OBQA 2C8ZB 1ANDA 3RXUA 1EUFA 3ATLA 4AFZA 3ENSB 3F0PA 1GJBB 6ESTA 1GBDA 4B6EA 4Y11E 1TAWA 2PTCE 1O3KA 3LOXA 4ABEA 1J9CH 1V2LT 2FOCA 1O2ZA 4ZKNU 4AORA 1G3DA 3BTEE 2VIWA 4K5ZA 1QCPA 3S0NA 4INHA 1JRSA 1HJ8A 3K65B 4X8VH 4YLUA 2P94A 4D7GA 1FY5A 4UFEH 5FHTA 1OYTH 3GY7A 3L3TA 2PGBB 1YP9A 3V3MA 4YOIA 4WF8A 3RXJA 4JCNA 1C5MD 1CT2E 3TLOA 2NU2E 3MH7A 3KN2A 2BLWA 1AHTH 2B7DH 2CHAB 1SFIA 1C5QA 3DFLA 3BTHE 1FONA 1ZOMA 3BG4B 4B75A 1J15A 3MO6A 1W0KD 3PB1E 2AFQB 1S85A 2LP6A 3SV6A 1TE0A 1FI8A 4HFPB 4IMZA 5JBTA 3BF6H 1O33A 4MTBA 1OPHB 2WYGA 1FY1A 3TK9A 1QRXA 3UNRA 4GSOA 1KYNA 3SHCH 1TIOA 5DP4A 4CBNA 1DUAA 1TPOA 2CV3A 2W5EA 1O5EH 2G55A 2UUKB 5JB8S 4XFQA 3NRLA 2NWNA 4YTAA 3FZZA 5J4QA 4HI3A 1ARCA 2JH5D 2YMSD 1GJCB 1IQGA 1M9UA 2GV6A 5FL7D 2HVYB 2FOHA 1O3PB 1O2TA 2A5KA 1WU1A 4RT1A 4MNXA 4JZEH 1BIOA 1SQOA 3RXPA 1G3EA 3P8NA 3AW0A 1SI5H 1A5HA 1LTOA 1IQLA 2XCFA 5GCHG 2PV9B 2W6ID 3PM3A 1C2HA 2G5NA 5AF9H 3NPSA 9LPRA 4TY7A 4K69A 3OEED 4DIIH 1C2MA 1EAIA 3U28C 2Z9IA 1Y3UA 1MAYA 4FUIA 2P3FH 1P2QA 4WMFA 1K22H 2V0BA 3VEQB 5GIBA 1G32B 2BD4A 4RSPA 1ZZZA 3E90B 4K8BA 1O2MA 3F9HA 3BTQE 2GGVB 1GBCA 2JDID 1L1JA 4R8TB 5I25A 1G36A 1V2JT 2HNTC 3JZ1B 1EOLA 2K7XA 1TPAE 2A7JA 3KQ5A 4TWYA 2UUJB 1QHRB 1XM1A 1YY3A 1THPB 3QO6A 1AWHB 1EQ9A 1DXPA 2PFEA 3A7YA 1PPGE 2SGDE 4LK4A 1P02A 1IOEA 1UVPA 2OXSA 1C5RA 1D3PB 1WUNH 2J95A 3CS0A 1QURH 4E05H 5C1YA 2EQNA 1P05A 1OP0A 4Y76A 1IQIA 2BX4A 1NFUA 2W26A 3EYDA 1C5UA 1GL0E 2BD2A 3PTNA 2LPRA 1F0RA 4PROA 3MO3A 4NCYA 3MNCA 1HAVB 4MG3A 3KQBA 1TONA 2PHBA 5L30H 3ZVAA 1O2RA 1G3CA 1OWIA 3B8JA 5C5OA 2KAIB 4SGAE 2QV1A 4TPYA 1LVOA 3GICB 1K1NA 4Q7ZA 1DLKB 2THFB 1WQVH 1TB6H 2CMYA 3R0FA 3AASA 3GOVB 5C1XA 2R0LA 4YZUA 2OK5A 1GJ9B 3I29A 3AAVA 1D9IA 4ZUHA 2O8LA 5TJXA 3VB5A 3TJNA 2CXVA 3RC5A 1SR5C 2ZQ1A 1JBUH 3KGPA 3QTOH 2G5VA 3BIUH 4FU8A 3MNBA 1QB9A 4K1TA 2XXLA 1EP6A 2BY8X 2F9OA 3MQKC 1PPBH 4XD7D 4B6FA 1SGNE 2ZG0H 1YCPK 2WZQA 1OWKA 3HGNA 2ZFSA 3OY6U 3Q3KA 4ZMAH 1LMWB 4GHTA 1O32A 1EAWA 1ANCA 1S5SA 1A1RA 2GZ9A 1BHXF 1DFPA 1O3HA 1GI7B 3UQOA 1KXDA 4I8KA 4I7YH 1ZPBA 1NBMD 3MH6A 1W0YH 2FODA 3EAJA 1C2JA 2ZFTA 4LXBH 2VVVA 3PTBA 1W13U 1HAVA 1SVPA 1RIWC 1FDPA 1SLVB 4ZXYH 1CA8B 2KAIA 3N7DA 2Z3CA 3E91A 1LHEH 1UK2A 2CN0H 4LOYH 3VGCC 5KECA 1AWFH 5HKKD 1GI1A 3O8CA 1ELFA 1WTHD 1K28D 1WV7H 1ZSJA 1BCUH 2J92A 5A09A 8GCHF 2ILNA 3SNEA 3P95A 2AGEX 3TH4H 1C4V2 1IHTH 1DSUA 2ZFRH 4ASHA 4CRAA 1AU8A 1SQRA 4X1QU 1O3EA 3A82A 4TSFD 1JMOH 2D26C 2A4RA 5DO4H 3JZ2B 2PKSC 5EXNA 1AUJA 3EGKH 1E0FD 5DP3A 3A8BA 1QFKH 1QTFA 2BDBA 1ELGA 4D7FA 2TRMA 4X1NU 1NBME 1LPZB 3I77A 4FU9A 8GCHG 3STJA 5FPYA 2WV4A 1NPMA 2Y80A 2VH0A 4FUDA 2FO9A 2GCHG 3EDXB 2XTTB 1XVOA 5T6DA 1GHBG 3MTYA 4CRDA 1O2QA 2UUYA 4NZLA 5C20A 1XUFA 3BEFB 2SGEE 1RIWB 5DG6A 1DICA 5HM2A 3LIWA 5J4SA 2OC8A 1UVSH 1LO6A 5EOKA 3SV9A 1UVTH 1YC0A 1K1JA 1AD8H 2W7SA 3RXQA 2Z7FE 2Z94A 4TY6A 8KME2 1O2UA 1N1LA 1GDNA 3MU5A 2HNTE 1W10U 4FU7A 2P8OC 1S84A 2WYJA 2HLCA 3ZVFA 3SU0A 4ZHAA 1L4DA 3RM2H 3SUFA 1MTNC 3T28A 4ZHLU 2V3HH 2EI7A 1P9UA 1FY4A 3BTME 5CMXH 5A8YA 2A5AA 1KY9A 1WYKA 1EAXA 1TGCA 2HWLB 4F4OC 1FJSA 2A7HA 2GV7A 4NSYA 4FUBA 2Q6DA 1LKAA 3D23A 2OC7A 2VVUA 4Y10E 4AFQA 5AFZH 2O8UA 2ZF0H 1UK4A 3Q3YA 1SGCA 2PWXA 2AS9A 2Z9KA 1BMNH 2CK3D 3RC6A 1YWUA 5DP9A 1BB0B 3FAOA 1IQJA 2WV5A 2Y6TA 4X2YA 2F91A 5IK2D 2FS9A 4A1TA 4ZAEA 1X7AC 3U9AH 1BBRE 1UO6A 2SGAA 4I8JA 1Y5BT 1A5GH 2TPIZ 4FOUC 4XDEA 1Z71A 2GCTB 1BZXE 2R9PA 1BDAA 2PW8H 2F3CE 4VGCC 1O5GH 1ELTA 3BTKE 3RXHA 4X1SU 1C9PA 2AEIH 1KXAA 2BVRH 3KQEA 1TOCB 3LJOA 1C5YB 1EXFA 2ZPSA 3A89A 1C2LA 1GGDB 1GHAG 2OTVA 2P8OB 2QY0B 2A4QA 1L0ZA 3MU4A 3U8TH 4FUGA 3VPKA 3M5MA 2IJD1 3QGJA 4NIVA 2ULLA 1Z8IB 2PP6A 1W11U 1JOUB 1UMAH 1RTKA 2GP9B 1KXFA 1KXCA 2Y82A 1RGQA 3SGQE 3QTVH 1EJMA 2ALPA 4Y8XA 3ELAH 4BANB 1EP5A 1W0JD 2ZECA 4OS6A 4X0WU 2R2MB 2QXIA 1EJAA 2Z6BD 1MUEB 2ODQA 1BOQA 2WUCA 2L6OA 2KCYA 2GKVE 1WQSA 1O3BA 3GY4A 1SMFE 2K0QA 1MABB 1NY22 2ZKSA 1UVOA 2FWWA 1EAUA 2KCOA 2ZWLH 3GY6A 2C8XB 3ATWA 3WWFA 3P92A 1TNGA 4ABAA 3LGIA 1TMUH 2BD7A 2F83A 1XMNB 4YO9A 1EZUC 3SNBA 3OFND 2VIQA 1CHOF 1SLUB 3T62A 1LHFH 1VITH 1GDQA 3F3BA 3A8DA 4Y0ZE 2QYIA 4O03A 1LCYA 2A45B 5KGOA 1GBJA 2ZGHA 2BM2A 1AGJA 1SGEE 1ARBA 2AGIX 4AZ2B 1O2PA 4WY3A 2QAAA 2QA9E 5EQRA 1RFNA 4AGJA 4WXIA 1BTZA 1MKXH 2J34A 2GT8A 4THNH 2Z3EA 1C1RA 1EJNA 1NRRH 2BDAA 1ZTJA 2XWAA 1C1QA 1E36B 5T6GA 1O2VA 2H9EH 5LPEA 2HPPH 2DE8A 2O8TA 3P17H 3ZZDA 2J94A 2JH6D 1YPEH 3GY5A 3WY8A 1ZGVA 5CHBA 1C5VA 1K1LA 4BAOB 1OSSA 1W7XH 1QBVH 3FP6E 1SHHB 3LJJA 4M7GA 2D8WA 3ZZAA 2ZZUH 2G81E 2KFWA 1XXDA 2TGTA 2QN5T 3BEUA 4CHAB 1GJ5H 1BTWA 4D9RA 1QJ6B 2P3UB 2ZGJA 1EZQA 3CENA 1V2TT 1Z8JB 3A8AA 2FP7B 1TFXA 3SJOA 2AIPA 2BQ7B 1DOJA 3SHAH 2ZA5A 4B73A 1NROH 3C27B 1TABE 2VIVA 2O8WA 2PSYA 1QL8A 1THSH 5IYTA 5TCCA 1G30B 3S7KB 3RXKA 1GJDB 2ZIQH 2WINI 5ETXA 5JBAS 1MKXK 2C90B 1NS3A 3RU4D 1MH0A 4AB9A 3BTFE 4P02A 1RD3B 2M2AA 3ATKA 4ABGA 1EPTC 5EJZA 3TJOA 1V2PT 3LGVA 2QC2A 3KCGH 4Q2KA 1J16A 3ZZ5A 4NWLA 1LPGB 3CNRA 3ODFA 3UWIA 1V3XA 1SFQB 4ISLA 1HAHH 3HK6B 3Q3XA 2BX3A 5DP6A 1LQEA 1SGQE 4O3UA 1HXFH 1O38A 1W3CA 3ZZ9A 1O3AA 3EA9A 4BAHB 3RMOH 4AYVB 2GTBA 2XC5A 5C2ZA 3TK5A 3S9BA 2A7CA 1GI6A 4XRNA 3ZZ6A 3GY8A 3F9GA 1LDTT 2KX4A 5B6OA 3SU6A 4A1VA 4GCHF 4ISIH 1MU8B 3KL6A 1BTYA 1C5SA 1OWHA 1UCYK 1COWD 2JETC 4NA7A 1T8MA 3EQ0H 1HXEH 1NTPA 1V2MT 3EA7A 5EQSA 3RLWH 2BLVA 3PLPA 5DPAA 2XBWA 3K6ZA 1P8VC 1Y8TA 3TNTA 1WOFA 2QF5A 1NFWA 3RU4E 3PMAB 2ZTXA 1NFXA 3SYJA 1XUIA 1GMHF 2Q6GA 1AY6H 2EC9H 1PQ5A 3SJ9A 3RXGA 3ZV8A 1TYNA 1Z6JH 1UTQA 1EPTB 1O2IA 1DWCH 1Y5UT 1NO9H 1O3DA 1P06A 3ZVEA 4Y79A 5GNDA 3GCTF 2V35A 2BVSH 4ABJA 1SQAA 4ISOA 1P10A 2EA3A 3F2HA 3ZVCA 2BDHA 1HAXB 3GS9A 1O2WA 3UNQA 3UB0A 4A92A 3V12A 1TRNA 4B1TA 5L2ZH 1YPLH 4I31A 2Z9JA 2FOGA 1CGJE 3ZYDA 3AW1A 3RXSA 2BD9A 3S7HB 3RXLA 4FUHA 1NRPH 1LVBA 2G8TA 5HIYA 5A0CA 1YLDA 1QB1A 4H4FA 1DVAH 3M7TA 5BRRE 4NG9H 1C5LH 1F5LA 3M36A 1GWAA 2FESH 1FQ3A 2BQWB 2JETB 2Y7XA 1Z8GA 4UFDH 2R2WU 5TCAA 1EB2A 2EI6A 3FOAA 1ELVA 2ZHEH 3BG8A 3W95A 1CA0B 2RFKC 1O5CB 5A0AE 1EASA 3TK6A 3MU1A 3NUMA 3FP8E 2RDEA 2CF9H 1ZJDA 3BN9A 3M3VA 2NU0E 2VBCA 1ZTKA 1GI5A 1GBEA 1GI3A 1GG6C 4Y7BA 4BAQB 1EPTA 2HOBA 1O39A 1E79D 1FY3A 3O8DA 4AOQA 2XC0A 4IW4E 4AX9H 4DW2U 1FN8A 3T2NA 4JZFH 1CBWC 1T8LA 2VNTA 3SGBE 2J98B 3M7QA 3S9CA 1MCTA 2EEKA 2ZCKP 2NU1E 1F5KU 1O36A 3TGJE 5C0UA 1GMCF 1BUIA 1HPGA 3U69H 1DWBH 2OP9A 3LC3A 3F2FA 2ZQ2A 1MMJN 5JYIA 1QNJA 2ZDVH 4I86A 1RTLA 2WPMS 3C1KA 2XOKD 3TITA 2H9TH 3DSPA 1NRNH 1ELEE 2H5DA 3UR6A 1O30A 3CS7A 2VH6A 3HPTB 1T7CA 3TGIE 3RDZA 2G4UA 4AN7A 4P00A 1P03A 4MDSA 1D4PB 2F9BH 3SZNA 3TH2H 2NU4E 4NWKA 1GBHA 1N8OC 1F2SE 5EJ1A 3LKWA 1T8NA 4NGAH 2BMGB 4ABFA 5AVDA 1LHDH 2ODPA 5HM9A 5EPYA 5FXLA 1C2IA 3A83A 3D65E 3HKJB 3UREA 1S6LA 4CREA 4JK5A 1H9HE 2RG3A 1V2WT 5KEDA 3R3GB 1NN6A 1V2UT 5FCRA 2BB4A 4K1SA 4K1EA 4YOJA 1QA7A 1GG6B 4J1YA 2UWLA 4ZCNA 1EOJA 5K0HA 5K7RA 1SQTA 3U1JB 7KMEH 2J98A 3UR9A 3GDUA 1DUEA 1QRZA 1CBWB 5GWZA 2Y7ZA 2GZ7A 3EBNA 2BDYA 3PO1B 1BMMH 1LPKB 5F6MA 4B2AA 3QWCH 3KHVA 1GJ8B 1TQ0B 3M37A 3ATMA 1GHYH 1T31A 1O2NA 4JZIA 3RLYH 4I8HA 2P95A 3GY3A 3HATH 2D2DA 2AHME 5JBBS 2W6JD 1GBAA 5C3NA 3L6PA 3IG6B 4ZKOU 2C3SA 3MNXA 2BYAX 2XBYA 1ZGIA 2OC1A 1P01A 1ABIH 2ZU2A 4BNRA 1C2KA 1S83A 1O2XA 1P2MA 4JYUH 1N8OB 3E3TA 3SOSA 1H8IH 3Q76A 2H2ZA 4OS2A 3OSYA 1GCTC 3AAUA 1XVMA 1FV9A 3UIRA 2RA3A 2ZEBA 3ZZ4A 6LPRA 1DDJA 3E0PB 3MHWU 3M5NA 3TNSA 1VJAU 2Z9LA 2WUBA 1P57B 3PV2A 4DIHH 2TGAA 3PWBA 2AGGX 2IOTA 4E06H 1MAXA 1P2KA 3W1EA 1H8DH 1BBRH 4NIXA 1UTPA 1SG8B 2K8IA 4X1PU 1TRYA 2LELA 4TYDA 2LNCA 1INCA 3QZQA 5DP7A 2WPLS 4UFFH 1O5FH 3MNSA 2G4TA 1Y59T 3LGYA 4FVDA 1D3DB 2Y5GA 1VITF 3BEIB 1C1SA 2F43B 1T32A 3SZEA 2J4IA 2B9LA 1TPPA 2H9HA 3N7OA 2KM0A 3WWBA 1DT2A 2ANKH 1FX0B 2QF0A 1EFRD 2FI4E 3ZIAD 2O9QA 3QK1A 4ABHA 1WXRA 3OTPA 2HLDD 3TJUA 1GBTA 4K3JA 5E0JA 5DJ7A 5CDFE 1LHCH 1NT1A 1VITG 1SGDE 1EATA 1O34A 3SUDA 1K0HA 2ZGXH 1ETRH 4XOJA 3URCA 1O3GA 3TU7H 1IQKA 5DKMA 1GCTB 2B8OH 3HK3B 1O5AB 2EY4C 4GPGA 3BTTE 3UFAA 1TNJA 1Q31A 4YESB 2GMTB 3PROA 1BBRK 4Q80A 1QL9A 3KEEA 1Y3VA 1C1PA 2JIZD 1ETSH 3NXPA 3RXTA 4YOGA 1HAZB 4BAKB 3RXRA 1RXPA 2BD5A 3E16B 3SU4A 3ZV9A 4JMYA 2KR7A 3SNCA 2SNVA 1ETTH 4B71A 4KTSA 5FPTA 1DY9A 1GBIA 3A7VA 3RXBA 1BQYA 3FANA 2L74A 1HAPH 2GCTC 1OWJA 1VJ9U 5L6NH 2BY6X 4WWYA 1UJ1A 1C1WH 2B0FA 1YPMH 1YPGH 1GGDC 1Y3YA 4X8UH 3DD2H 1C5WB 2QXJA 3H7TA 1AZZA 3F6UH 4JZDH 4NIYA 3KYFA 1EZXC 4Y8ZA 2QXGA 5ESBA 4ZKRU 4KKDA 3U98H 4AC9A 2D1JA 1ZHMA 2OC0A 2UUFB 4DGJA 5EW1H 5DK1A 2JJ2D 4JZ1A 2TIOA 1S0RA 2PUXB 3VB7A 1VCWA 1DLEA 3GDSA 2XBVA 1OP8A 1CT0E 3RXVA 4Y8YA 1TA2A 2QF4A 3EE7A 2BHGA 2Y5HA 5F03A 1ZR0A 1AN1E 4HG6A 4D9QA 1F92A 1GPZA 4WVPE 5DSFA 3S69A 1GHZA 1NC6A 1FIZA 1VR1H 1VCQA 3K2UA 1CHGA 5E0HA 4ISNA 2SGPE 4YT7H 1C1UH 3QZRA 1NFYA 2NU3E 1ZPZA 1KDQB 2HRVA 1FPCH 4I33A 2FI5E 5GXPA 1ZRKA 3LC5A 1E1RD 4IS5A 3TIUA 2HALA 1O3IA 1Z1IA 4AFSA 1G9IE 4DT4A 4Y0YE 1PFXC 4CH8B 3GCNA 1AZ8A 4D8NA 4TPIZ 1SGRE 2QXHA 3KQDA 2RDLA 1K1MA 1AB9C 3LH3A 2ZDMA 1LHGH 3WW7A 3SN8A 4ABBA 4B76A 1ELCA 2VIDA 5DN6D 1P11E 4CRCA 3LDXH 3URDA 2I6QA 1HAGE 4WJG2 2V6NA 1KTTB 3GDVA 3SW2B 4D76A 1BA8B 1F0TA 3FO8D 4GAWA 5JB9S 1QZ8A 1HAIH 1HFDA 1V2QT 1FZZA 4DOQA 1A3EH 4E7RG 2UWPA 3TJVA 1TMBH 4FUEA 1AMHA 2G52A 1GJ4H 2C8WB 1ZLRA 3M5OA 4Z6AH 2XNIA 1ELDE 4R0IA 4I8GA 3FFGA 3RC4A 1NU7B 4CHAC 1S0QA 5BPEA 1S6FA 1QQUA 2YNAA 3BTWE 4YT6H 1SL3A 2ZP0H 2XNDD 1O0DH 3UNSA 3LGTA 3RXEA 1DX5M 1KDQA 1OWEA 1UW7A 4I32A 4BTIB 5FPSA 1IQNA 6GCHF 1ESAA 2FX4A 3SJ8A 5PTPA 2BXTH 7ESTE 2SFAA 1C9TA 3A7WA 1MZAA 3LU9B 3TGKE 3QN7A 1P3EA 1PPEE 3SV8A 2AMQA 2HPQH 2STAE 4ZHMU 2VINA 2A2XH 4FVBA 1C5XB 5L2YH 1MU6B 1S6HA 2ZDAH 5E0GA 1TBQH 5F8ZA 1IQHA 1SOZA 4AG1A 1WTGH 1PQAA 2ZO3H 1AB9B 3QUMP 1KMHB 5JBCS 3V0XA 1P9SA 1O3LA 3A7TA 1HB0B 1QY6A 3RMNH 5A8ZA 4IN2A 1BITA 6CHAB 1FXYA 1BMAA 2FX6A 4MPUA 1RRKA 4OS7A 2J9NA 4YM9A 1CHOG 1VGCC 3STIA 5AHGH 2VGCB 1J14A 1KSNA 4WH8A 3A87A 3SBKA 2VIPA 1GVKB 7LPRA 7GCHF 3KF2A 4O9VA 1C5TA 1YF4A 1DPOA 3P8FA 4INLA 3ZVDA 1MBQA 2Q6FA 3LH1A 2KCAA 5GJ4B 1P2NA 1EZSC 1BHXB 2ZFQH 4JYTA 4Z0KA 2H6MA 1SLWB 2OINA 2V3MA 4MVNA 2ZTZA 1DITH 3RMMH 5B6LA 1YPJH 8LPRA 2FZZA 1SOTA 2BLQA 4K2YA 1WCZA 3EA8A 3GCOA 1SKYE 4X2XA 4ESTE 2ALVA 3VB3A 1QGFA 1QL7A 2XRCA 3LGWA 4IBLH 1O2LA 1BRUP 2R3UA 3DCLA 3KQCA 4F55A 1C5NH 2IJOB 2OQ5A 7GCHG 1HYLA 1TA6A 2WSSD 1ELAA 1FAKH 1NM6A 1HGTH 3DHKH 5T6FA 1GCDA 1GHXH 2XCNA 1HUTH 4H6SB 1MTVA 5CHAB 2VWLA 2Z9GA 3Q00A 1C4Y2 2VVCA 2QF3A 4NA8A 1H9IE 3F9FA 1B5GH 2VIOA 3UY9A 4ABIA 3K9XB 1Z7KA 4XE4A 1Z8RA 1TNLA 1RTFB 2HNTF 3FKSD 3U8OH 4X2WA 4RN6A 3SUEA 1TNHA 1GBFA 8ESTE 1VGCB 5FCKA 3ZZ3A 1A46H 4SGBE 2GDDA 3SV7A 1HV7A 1LQDB 3SI4H 3SUGA 5H4IB 4Y7AA 1AKSB 1DXWA 1C1TA 2BZAA 5EU8A 3BSQA 2ZCLP 1OKXA 3VXFH 3M5LA 3P70B 2AMPA 5FAHA 3GISB 4BXWA 2QIQA 1BRAA 4UONA 2IPQX 5EJLA 1P3CA 2P93A 2OQUA 1MTUA 1PPZA 1OHHD 1F0SA 1MZDA 4DURA 1O5BB 1Y3XA 4DJZB 2LIZA 2GD4B 5A2MH 3E1XB 4X6NA 3GYLB 2HGTH 1H1BA 5C5NA 2JH0D 1HBTH 1DE7H 1C5PA 1A7SA 3OU0A 1CA0C 5AFYH 4CRGA 5HXFA 1K9OE 2ZDKA 1H8ED 1P09A 1NESE 1SBWA 2A2QH 4AGKA 2OBOA 2FMJA 3ZYEA 3A85A 4K8YA 3FN8A 3A88A 4OGYA 3H09A 4UFGH 3LGUA 4GCHG 1V2OT 3N7EA 2BXUH 1GI8B 1O5DH 1MD7A 2FXRA 1G2LA 3KIDU 1QBOA 4UDWH 1P0SH 1KXEA 1K1PA 4MPVA 1A0LA 2ZU5A 3SORA 3A8CA 5EW2H 3G01A 5EG4A 2IPHA 1GJAB 1G37A 1C2GA 3KYGA 4UE7H 3VG8A 1FPHH 1TMTH 1AKSA 3PMHB 1O2HA 1GMHG 4Q63A 4U2WA 2FOBA 2BOKA 2VB0A 1TX8A 1VZQH 4BTUB 4NIWA 3E6PH 1IQFA 1NU9A 1O35A 2BLOA 2YMSB 2FOMB 4AG2A 4X6OA 3T5FH 2PKAB 3MH4A 4YXWD 3P6ZB 1PQ7A 4A7IB 2ESTE 1V2NT 2ZU1A 4IGDA 1UTKA 2FLRH 1V2VT 3A7XA 2FOAA 3F2GA 4FETA 2Z3DA 2BDGA 5DP5A 1T8OA 2ZHQH 1HCGA 2EI8A 4CBOA 3GCTG 4DG4A 1TPSA 2B5TB 1GBBA 3SU3A 1BT7A 1L4ZA 3RXAA 3RM0H 1SLXB 1WDIA 2V3OH 1SC8U 1PPFE 3MMGA 2H5CA 1GBLA 2F9VA 4MNWA 3ITIA 2FYQA 5EGMA 3U8RH 3O8RA 2YOLA 4IC6A 1PYTC 1ABJH 4F48B 5LPRA 3RXDA 1C4U2 3UQVA 5GCHF 3RXOA 1UTOA 1AIXH 2JKHA 3PO1C 1BTPA 3P8OA 1VKYA 1NRSH 3RU4T 1UVUH 2J2UA 1WAYB 2R0KA 1Z6EA 4KP0A 3SGAE 3TVJB 4UEHH 1UCYE 4KELA 1ZRBA 3UPEA 4OS4A 2ZGBH 3TH3H 1GBMA 1QA0A 2ASUB 1E1QD 1CO7E 2DE9A 3PMBB 3GY2A 3NK8A 2ZU3A 2PKAA 1S81A 2FI3E 1D6WA 1IQEA 3RXCA 3PV4A 2STBE 2ZPQA 4Z1MD 2PGQB 1S82A 4OGXA 4KGAA 3U1IB 1U6QA 3BV9B 1OXGA 4QT8C 1B7XB 1V2ST 1ZMJA 4MLFB 1GMCG 3GCHC 1YKTA 3FP7E 1YBWA 5LPFA 1THRH 1YPHC 4GUXA 2ZU4A 1ZMNA 1XKBC 2CJIA 1K1IA 3A81A 2O8MA 1O37A 4ZKSU 1N6YA 3PLKA 1H9LB 1F5RA 2XYAA
chains in the Genus database with same CATH topology
1GHWH 1YLCA 1TBZH 1CQQA 1BTHH 1CSOE 3VXEH 3UWJH 1O2JA 5HGGA 1ZTLA 4MQAA 1YCPM 3SU1A 1TX7A 1P12E 1A5IA 1CT4E 5LGOA 2WPIS 2A5IA 1CU1A 2FOEA 4RKJB 1GDUA 3HKIB 1AVGH 2F9NA 2AH4X 3ZZBA 3PMJA 1GHVH 1YCPH 1HAYB 5HYOA 1RS0A 4WXVA 1Y3WA 2M5TA 2FYRA 4E7NA 5ABWA 1VCPA 1D3TB 4TWWA 1ANBA 1B0FA 2FEQH 2P16A 3OX7U 2ANMH 3L33A 1AVXA 2FLBH 4FXGH 3HGPA 2UWOA 4AFUA 2ANYA 4K60A 1BTUA 2TBSA 1O3MA 3DA9B 2XW9A 1JWTA 1L1NA 3GCHB 1K21H 1KLJH 4BXSA 3PLBA 1XUJA 2VWMA 5FBEA 2QGRA 5EPNA 4CRFA 1A0JA 2GMTC 3RUOA 5ESTE 1HIAB 4H6TA 2FM2A 1C1NA 5GPIB 1PYTD 4HGCA 2OD3B 5FX5A 2IN2A 1J17T 3LT3A 1GMDF 1MBMA 3I78A 1SGFG 4U30A 2ZCHP 2I6SA 1P04A 1FMGA 4DVAU 2R3YA 1D3QB 1LVMA 3T25A 2VU8E 1KTSB 3E8LA 1DY8A 3RXFA 3UUZA 1O3FA 3B23B 4Y6DA 5E2PA 2ZDNA 1A2CH 1SHYA 1PJPA 1O2KA 3DUXH 2BD8A 4HZHA 4KTCA 1BTXA 3ZVGA 1DM4B 5E2OA 1QRWA 2VWOA 4RKOB 1AFQC 3MH5A 1ACBE 1SGPE 4NFEA 1AI8H 1GMDG 1ZHRA 1A0HB 1H4WA 1ZJKA 2SGFE 1YPKH 5JPMH 3M3SA 1Y5AT 2ANWA 4WMEA 1QJ1B 1ORFA 1SGIB 1PPHE 1T4VH 1FUJA 3UTUH 3RMLH 1AE5A 3SQHE 2SNWA 5GDSH 2F9PA 3D49H 4ZROA 1J8AA 2ZHDA 4LZ4B 1GI0A 5IDKA 1HIAA 1OX1A 2BVXH 3QGNB 2XC4A 1XUHA 4O3TA 1EKBB 1XKAC 3M61U 1JRTA 1KLTA 2FTLE 2ZNKH 1O3OA 4UD9H 2GCHF 1GI4A 1DWEH 2C93B 1UTMA 1GHBF 4XBDA 1O2YA 2W3IA 1EX3A 4ZXXH 1YM0A 1UTJA 4ZH8A 1GJ6A 4GHQA 5EXMA 1FIWA 2BZ6H 1D6RA 1W2KH 1C2EA 3BIVH 3NCLA 4XBBA 4FUJA 1TGNA 3SV2H 4X8SH 1N6XA 5FBIA 1A3BH 4NZQA 3A84A 3SNDA 1P2OA 1GBKA 2FPZA 1O2GH 1MTSA 1P2JA 2ZTYA 1GI2A 1NZQH 1W12U 2OLGA 4A5TS 1JXPA 1OS8A 1AFQB 4Y71A 2BOHB 3EE0B 1TWXB 1YPHE 3MYWA 1WSSH 3SU5A 3ATIA 2DUCA 2GDEH 3FVFB 1MKWH 1G2MA 2FOFA 2YNBA 4U32A 3UOPA 4MNYA 2ZI2H 1O31A 1ZYOA 3V7TA 2F9UA 3O8BA 4BAMB 2XBXA 4X1RU 3VGCB 4DCDA 5JDUB 1OOKB 2VJ1A 4DT7B 3ZZ7A 3W94A 4AB8A 4CH2B 1MTWA 1TBRH 5A8XA 1HNEE 3VB6A 2ODYB 3F68H 1MD8A 5C67A 4IMQA 1HJAC 5G4BA 1CGIE 2ZC9H 1FY8E 1T4UH 2H1UA 1KLIH 3LONA 1C1MA 3SI3H 1CGHA 1E35B 4Q7YA 2PKSB 3IITA 1XUKA 3NZIA 4JYVH 3SU2A 3KNXA 3H5CB 5T3HA 1QJ7B 3LPRA 3MO9A 4FUFA 2BQ6B 5I46H 1K2I1 1AVWA 2Y81A 2TGDA 1SB1H 4LZ1H 1DWDH 2PUQH 3UOUA 1W0ZU 1FNIA 2A4OA 4F49A 2A31A 3PYHA 4I8LA 1MCVA 1L1GA 3RXMA 4NFFA 1KIGH 1SGYE 5F8TA 1GHAF 3RP2A 1MKWK 3QX5H 4CR5A 2FS8A 5DP8A 1TX6A 1O3CA 1C1VH 3T26A 3BTGE 2OCVB 2CF8H 6CHAC 1TGSZ 1QQ4A 1P2IA 2BDIA 3MU8A 4GVUA 4A6LA 1K1OA 1GL1A 1UTLM 4B2CA 3V13A 1KXBA 4MNVA 2Y5FA 2VGCC 3F9EA 4CR9A 3AVZA 3Q77A 1V2RT 1BMLA 5HMAA 5F8XA 1TLDA 1XUGA 2Q1JA 2W7UA 5SGAE 2A32A 2HVXA 1HJAB 1TGBA 1B0EA 1MTNB 1SSXA 1HRTH 2BY7X 1C5OH 1QB6A 5LH8A 1UK3A 1QIXB 4NSVA 2RA0A 1BRCE 4WMDA 2FIRH 1OWDA 2TGPZ 3NWUA 1FAXA 2A1DB 1BRBE 1W14U 1XXFA 2GVFA 2ZGCA 4U01A 2VWNA 2WPJS 4HTCH 1ID5H 2PSXA 3D62A 4JK6A 5FX6A 2ZFFH 1TGTA 2ZHWH 4J2YB 1HLTH 2WPKS 1C2DA 3ZZ8A 1AFEH 1IQMA 1LVYA 1ANEA 5CHAC 1V2KT 2AERH 4ISHH 1RJXB 1SPJA 1C5ZB 1ESBA 1QBNA 1JIRA 3SJKA 3ZVBA 3E0NB 2RCEA 3VB4A 1EB1H 3SQEE 3T29A 2BDCA 5CE1A 4IC5A 3CP7A 3DFJA 6GCHG 2J38A 1C2FA 3BTDE 4B2BA 2OUAA 1AQ7A 2WPHS 3MU0A 1OP2A 4INKA 1F0UA 2K1QA 4VGCB 2P59A 4WH6A 1ZSLA 4XSKU 1GVZA 2AIQA 3TPIZ 3FZDA 3F1SB 1ZHPA 4OS1A 2ZHFH 5C1UA 3A86A 2QCYA 2BD3A 3A7ZA 3M35A 1TRMA 3A80A 3NKKA 4BTTB 5DGJA 5E8EH 1Z1JA 3ZZCA 2A4GA 1A4WH 3PWCA 1DSTA 1O3NA 1L2EA 1W7GH 2C4FH 3SJIA 4FUCA 1TOMH 1ZPCA 4GLYA 1LKBA 2PTNA 1IAUA 4X2VA 1G3BA 1IHSH 4X8TH 4A1XA 3K6YA 1QR3E 1O2OA 2CGAA 3SNAA 3IWMA 3H7OA 1HAOH 2FTMA 2G51A 2FDAA 5EODA 2BY5X 1ESTA 3SO3A 4CRBA 1Q2WA 1YGCH 3MFJA 1AO5A 9ESTA 1UHBB 4DY7B 1SGFA 3MI4A 4IN1A 1NRQH 5EQQA 1WBGB 3QLPH 3S9AA 1E37B 2G00A 1UCYH 4X6PA 2XWBI 1OYQA 4XBCA 1TALA 4MPWA 1ZMLA 4OS5A 3B9FH 1FN6A 2ZPRA 2ZFPH 4Q7XA 1GI9B 5A0BA 1ZSKA 1UTNA 3ESTA 4KTUA 3MOCA 1F7ZA 4O97A 2SGQE 3QDZB 1PPCE 1TNKA 5EXLA 4B74A 1JIMA 1FLEE 3DT0H 3M7UA 1O3JA 1AE8H 2PR3A 3ODDA 4MPXA 1E34B 1HDTH 2C8YB 2GX4A 1E38B 2GT7A 1MQ5A 1SGTA 3OTJE 1CE5A 1ELBA 3OY5U 1Q3XA 1PQ8A 2P3TB 3RXIA 2AMDA 1XX9A 4H42U 1BJUA 3OYPA 3M3TA 1HJ9A 2CHAC 2A0QB 4YLQH 1TQ7B 4AYYB 3P8GA 2W3KA 3BG4C 1V6DA 1AUTC 4ABDA 1BJVA 1YYY1 1GVLA 2BY9X 2PLXA 1A61H 4X6MA 3T27A 2AYWA 1W8BH 3GYMA 4BOHA 2GZ8A 1UHBA 1C1OA 3VFEA 1MQ6A 3MWIU 2ZDLA 1DS2E 1DANH 1CVWH 1GJ7B 2BTCE 1TNIA 1O2SA 4NA9H 2OBQA 2C8ZB 1ANDA 3RXUA 1EUFA 3ATLA 4AFZA 3ENSB 1GJBB 6ESTA 1GBDA 4Y11E 1TAWA 2PTCE 1O3KA 3LOXA 4ABEA 1J9CH 1V2LT 2FOCA 1O2ZA 4ZKNU 4AORA 1G3DA 3BTEE 2VIWA 4K5ZA 1QCPA 3S0NA 4INHA 1JRSA 1HJ8A 3K65B 4X8VH 4YLUA 2P94A 4D7GA 1FY5A 4UFEH 5FHTA 1OYTH 3GY7A 3L3TA 2PGBB 1YP9A 3V3MA 4YOIA 4WF8A 3RXJA 4JCNA 1C5MD 1CT2E 3TLOA 2NU2E 3MH7A 3KN2A 2BLWA 1AHTH 2B7DH 2CHAB 1SFIA 1C5QA 3DFLA 3BTHE 1FONA 1ZOMA 3BG4B 4B75A 1J15A 3MO6A 3PB1E 2AFQB 1S85A 3SV6A 1TE0A 1FI8A 4HFPB 4IMZA 5JBTA 3BF6H 1O33A 4MTBA 1OPHB 2WYGA 1FY1A 3TK9A 1QRXA 3UNRA 4GSOA 1KYNA 3SHCH 1TIOA 5DP4A 4CBNA 1DUAA 1TPOA 2CV3A 2W5EA 1O5EH 2G55A 2UUKB 5JB8S 4XFQA 2NWNA 4YTAA 3FZZA 5J4QA 4HI3A 1ARCA 2JH5D 1GJCB 1IQGA 1M9UA 2GV6A 2FOHA 1O3PB 1O2TA 2A5KA 1WU1A 4MNXA 4JZEH 1BIOA 1SQOA 3RXPA 1G3EA 3P8NA 3AW0A 1SI5H 1A5HA 1LTOA 1IQLA 2XCFA 5GCHG 2PV9B 3PM3A 1C2HA 2G5NA 5AF9H 3NPSA 9LPRA 4TY7A 4K69A 4DIIH 1C2MA 1EAIA 2Z9IA 1Y3UA 1MAYA 4FUIA 2P3FH 1P2QA 4WMFA 1K22H 2V0BA 3VEQB 5GIBA 1G32B 2BD4A 4RSPA 1ZZZA 3E90B 4K8BA 1O2MA 3F9HA 3BTQE 2GGVB 1GBCA 1L1JA 4R8TB 5I25A 1G36A 1V2JT 2HNTC 3JZ1B 1EOLA 2K7XA 1TPAE 2A7JA 4TWYA 2UUJB 1QHRB 1XM1A 3QO6A 1THPB 1AWHB 1EQ9A 1DXPA 2PFEA 3A7YA 1PPGE 2SGDE 4LK4A 1P02A 1IOEA 1UVPA 2OXSA 1C5RA 1D3PB 1WUNH 2J95A 3CS0A 1QURH 4E05H 5C1YA 1P05A 1OP0A 4Y76A 1IQIA 2BX4A 1NFUA 2W26A 3EYDA 1C5UA 1GL0E 2BD2A 3PTNA 2LPRA 1F0RA 4PROA 3MO3A 4NCYA 3MNCA 1HAVB 4MG3A 3KQBA 1TONA 2PHBA 5L30H 3ZVAA 1O2RA 1G3CA 1OWIA 3B8JA 5C5OA 2KAIB 4SGAE 2QV1A 4TPYA 1LVOA 3GICB 1K1NA 4Q7ZA 1DLKB 2THFB 1WQVH 1TB6H 2CMYA 3R0FA 3AASA 3GOVB 5C1XA 2R0LA 4YZUA 1GJ9B 3I29A 3AAVA 1D9IA 4ZUHA 2O8LA 5TJXA 3VB5A 3TJNA 2CXVA 3RC5A 1SR5C 2ZQ1A 1JBUH 3KGPA 3QTOH 2G5VA 3BIUH 4FU8A 3MNBA 1QB9A 4K1TA 2XXLA 1EP6A 2BY8X 2F9OA 1PPBH 1SGNE 2ZG0H 1YCPK 1OWKA 3HGNA 2ZFSA 3OY6U 3Q3KA 4ZMAH 1LMWB 4GHTA 1O32A 1EAWA 1ANCA 1S5SA 1A1RA 2GZ9A 1BHXF 1DFPA 1O3HA 1GI7B 3UQOA 1KXDA 4I8KA 4I7YH 1ZPBA 3MH6A 1W0YH 2FODA 3EAJA 1C2JA 2ZFTA 4LXBH 2VVVA 3PTBA 1W13U 1HAVA 1SVPA 1RIWC 1FDPA 1SLVB 4ZXYH 1CA8B 2KAIA 2Z3CA 3E91A 1LHEH 1UK2A 2CN0H 4LOYH 3VGCC 1AWFH 1GI1A 3O8CA 1ELFA 1WTHD 1K28D 1WV7H 1ZSJA 1BCUH 2J92A 5A09A 8GCHF 2ILNA 3SNEA 3P95A 2AGEX 3TH4H 1C4V2 1IHTH 1DSUA 2ZFRH 4ASHA 4CRAA 1AU8A 4X1QU 1O3EA 3A82A 5DO4H 1JMOH 2D26C 2A4RA 3JZ2B 2PKSC 5EXNA 1AUJA 3EGKH 1E0FD 5DP3A 3A8BA 1QFKH 1QTFA 2BDBA 1ELGA 4D7FA 2TRMA 4X1NU 1LPZB 3I77A 4FU9A 8GCHG 3STJA 5FPYA 2WV4A 1NPMA 2Y80A 2VH0A 4FUDA 2FO9A 2GCHG 3EDXB 2XTTB 1XVOA 5T6DA 1GHBG 3MTYA 4CRDA 1O2QA 2UUYA 4NZLA 5C20A 1XUFA 3BEFB 2SGEE 1RIWB 5DG6A 1DICA 5HM2A 3LIWA 5J4SA 2OC8A 1UVSH 1LO6A 5EOKA 3SV9A 1UVTH 1YC0A 1K1JA 1AD8H 2W7SA 3RXQA 2Z7FE 2Z94A 4TY6A 8KME2 1O2UA 1N1LA 1GDNA 3MU5A 2HNTE 1W10U 4FU7A 2P8OC 1S84A 2WYJA 2HLCA 3ZVFA 3SU0A 4ZHAA 1L4DA 3RM2H 3SUFA 1MTNC 3T28A 4ZHLU 2V3HH 2EI7A 1P9UA 1FY4A 3BTME 5CMXH 5A8YA 2A5AA 1KY9A 1WYKA 1EAXA 1TGCA 2HWLB 4F4OC 1FJSA 2A7HA 2GV7A 4NSYA 4FUBA 2Q6DA 1LKAA 3D23A 2OC7A 2VVUA 4Y10E 4AFQA 5AFZH 2O8UA 2ZF0H 1UK4A 3Q3YA 1SGCA 2PWXA 2AS9A 2Z9KA 1BMNH 3RC6A 5DP9A 1BB0B 3FAOA 1IQJA 2WV5A 2Y6TA 4X2YA 2F91A 2FS9A 4A1TA 4ZAEA 1X7AC 3U9AH 1BBRE 1UO6A 2SGAA 4I8JA 1Y5BT 1A5GH 2TPIZ 4XDEA 1Z71A 2GCTB 1BZXE 2R9PA 1BDAA 2PW8H 2F3CE 4VGCC 1O5GH 1ELTA 3BTKE 3RXHA 4X1SU 1C9PA 2AEIH 1KXAA 2BVRH 3KQEA 1TOCB 3LJOA 1C5YB 1EXFA 2ZPSA 3A89A 1C2LA 1GGDB 1GHAG 2OTVA 2P8OB 2QY0B 2A4QA 1L0ZA 3MU4A 3U8TH 4FUGA 3VPKA 3M5MA 3QGJA 4NIVA 2ULLA 1Z8IB 1W11U 2GP9B 1UMAH 1JOUB 1RTKA 1KXFA 1KXCA 2Y82A 1RGQA 3SGQE 3QTVH 1EJMA 2ALPA 4Y8XA 3ELAH 4BANB 1EP5A 2ZECA 4OS6A 4X0WU 2R2MB 2QXIA 1EJAA 2Z6BD 1MUEB 2ODQA 1BOQA 2WUCA 2GKVE 1WQSA 1O3BA 3GY4A 1SMFE 1NY22 2ZKSA 1UVOA 2FWWA 1EAUA 3GY6A 2ZWLH 2C8XB 3ATWA 3P92A 1TNGA 4ABAA 3LGIA 1TMUH 2BD7A 2F83A 1XMNB