3M43A

Crystal structure of the mutant i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
207
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPTLRFADAAIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 75
structure length 207
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m43A00
2VFDA 3LRMA 5AHLA 1ME7A 3W07A 4GJ1A 1OG0A 3CU2A 1ICPA 4LY8A 3L68A 1I2NA 2A4AA 3QJAA 3BG5A 2VELA 5FESA 2QEZA 3AJXA 2VFIA 4RZ5A 4ZMGA 1W3NA 3NM3A 2VFGA 2DZSA 4YXGA 1GT8A 3LCFA 2PCQA 3A22A 4NVTA 2CLHA 4DO6A 3E12A 3TQ0A 2DZXA 2VEIA 2Y6ZA 3WJZA 3RFAA 1M6JA 5J5RA 4WD0A 2V0TA 3TXVA 1YYAA 3W86A 3O07A 4DF0A 4XZ9A 1NAL1 4ADSA 4JICA 1EP2A 5H91A 4ORIA 4DBEA 1YDNA 2P0OA 3DKLA 3HBLA 2DJXA 2CLMA 3QSRA 3S5YA 1W5NA 3M6YA 5LNVA 2H8ZA 3CWNA 3L5AA 3DHFA 4HPXA 3W7EA 5EPDA 1QPRA 3NZRA 1FCQA 3LHTA 3G1AA 1KLYA 3IGSA 3GK0A 3CEPA 1TJRA 2ZRZA 3H53A 5E1QA 5BRBA 2X1RA 1EWEA 1MO0A 4O1BA 4OV4A 5TBOA 1OFQA 1A5AA 1KBIA 3OEXA 3WK1A 2QCFA 1B9BA 3G22A 1L9WA 1XDLA 3M9YA 4FX8A 4FNRA 1EUNA 3GVGA 3T40A 3EX4A 4ADUA 4OQVA 4GNJA 4NJIA 3SI9A 1F6PA 3W7MA 5K3VA 4LWWA 1T96A 4Y8FA 2W0UA 3WK3A 4JTKA 2WJZA 3U6WA 2GOUA 4DXVA 3HGRA 2OZ0A 1G67A 1GYLA 3IEBA 5LHEA 4CLMA 4DPPA 1IIGA 1AL8A 1IF2A 1IXOA 1SSGA 2WSQA 2QDGA 3C0JA 4O57A 1VYPX 1XBYA 3NQDA 4ALDA 3FOKA 3GDMA 3VCRA 1EX5A 5LHFA 3BLFA 3TCEA 4RV8A 1FDZA 4HN4A 4PODA 4K36A 3A5FA 3EWBX 3PM6A 5AC6A 3PVFA 1C9DA 1TJPA 2D73A 2B0MA 3NQFA 2QR6A 5FEXA 5K4XA 4CNPA 2UV8G 2E5CA 4JTUA 3TJLA 4JTFA 3USBA 3MBDA 1K3UA 2RDUA 1KM4A 2VFHA 2ZZ3A 2ISWA 2ZZ7A 3LHYA 3O1NA 3TAOA 3TC7A 1P0KA 3QW3A 1K03A 3WJYA 3W1TA 1TPFA 1H7RA 3MYOA 4LC8A 1GPWA 5CZTA 1WXJA 3LX9A 4JTIA 1WOBA 3Q58A 5D02A 3GAYA 3CLMA 1OX6A 3C2RA 3LLDA 3HPXA 4LVBA 3TA6A 1UCWA 1XBVA 1U5JA 4CCDA 3BK0A 3HQ1A 2FPYA 5D37A 1TREA 3C6CA 1VH7A 3BG3A 4ZQNA 4GWEA 5A5WA 5G4EA 1FX6A 2DZPA 3EX6A 4PFMA 2YX0A 3UXAA 3W7QA 2X1TA 2A85A 1I2PA 3W2KA 1F76A 4FO4A 4MY8A 3KVMA 3JRKA 2VEPA 1TRIA 1W37A 3W1LA 3A5VA 4HSOA 5G1TA 4LOCA 2VC6A 2HSAA 2BXVA 2QAFA 4UTHA 1MEIA 1XI3A 2KZHA 4WJEA 5F2LA 3LTPA 1EUAA 5IM51 1QNVA 1VCGA 4IGHA 3KRUA 4CNOA 4O4WA 1JCXA 1YADA 4BFAA 2QKFA 2V2DA 1OFAA 1VZWA 1X1OA 3GXTA 1KTBA 3TK7A 4TX9A 4NU7A 1HG3A 3AO0A 3TSMA 3FA5A 1NEYA 2H90A 1FWSA 2AQWA 3HG3A 1OYBA 1EPXA 3ZR4A 1EA0A 2QUTA 2ZA3A 1LORA 1VHNA 3MP3A 3SIZA 2QUUA 2O7SA 4DELA 4AHOA 4IMGA 3M16A 4DQWA 1G69A 3IIOA 4E0CA 3HG2A 5CZ0A 3P61A 4PC8A 2AGKA 1AW2A 1TPWA 4N02A 1JCNA 4ZZ9A 2VFFA 1YDVA 3LXCA 3RMJA 2JKPA 3TC6A 2Q8ZA 3HGOA 3PBWA 3ZWSA 3DXIA 2E09A 1ZAJA 4FEZA 4L4LA 4IMFA 4K8HA 1H50A 1VPXA 3LCXA 4H3DA 3NYZA 3UWUA 3CIXA 3NQEA 3LBCA 3G3DA 4UMAA 1H62A 3G1FA 1W5QA 4O10A 1FXPA 5HWMA 1N7KA 3TXZA 1PL9A 3W74A 3MI2A 5FF2A 3P62A 3TFXA 5I3KA 3G0XA 1FWTA 1XBXA 1I8JA 4Z1BA 3OHIA 3S5OA 2FLIA 4FNUA 4P2VA 1ZFJA 1KFBA 2W6RA 5LNSA 5D2XA 5D38A 1YTKA 4M6QA 3PBVA 3M5YA 3LHVA 4IXHA 3O8AA 4UTIA 3QF0A 4IMDA 3S9YA 3DAQA 4YCOA 3PB0A 3G1SA 2XFWA 3THAA 2ZA2A 4ZQPA 3W3OA 4A3UA 1RVGA 3L66A 1R46A 3FFSA 1O95A 1H7OA 4JGDA 5HWJA 5FEWA 1EEPA 3T7VA 3P5YA 4R34A 3SR7A 1H5YA 3LDVA 4UMBA 1TV5A 3I65A 3KOFA 1KW1A 3EWXA 3MW7A 3MJYA 1A5SA 4IPIA 3S1VA 2YZRA 4XKYA 5AC8A 3N73A 3NQAA 3UWQA 2NLIA 3PG8A 2ISVA 2E5DA 4M7TA 4LU0A 4CQAA 1YXCA 3G8RA 4O15A 1SO5A 2G96A 4N9CA 4UMCA 3W7GA 1TB3A 1F74A 1LRNA 3B8DA 5KITA 1LP6A 2RKXA 1W3TA 4FHAA 2OJPA 2FIQA 5LNRA 1ICSA 4O52A 3V75A 4MYAA 3R8RA 1FCBA 3FJ6A 1LOLA 1TV8A 1G6CA 2CLLA 3CB8A 4G1KA 1T99A 5DBTA 4GC4A 3TQKA 1OFOA 2A1YA 4M6PA 4Z0JA 3NQMA 4XBKA 3GIYA 1K7EA 3O6YX 4N9EA 1Z41A 2Z2UA 3G0UA 3QM3A 5DXYA 3TDFA 3QRHA 3INPA 2Z1BA 1A5CA 1LLZA 4AH7A 4D2JA 3MO7A 4KWVA 4QIUA 4N6FA 1KM1A 1UUOA 1TQXA 3LTSA 5GVJA 1TRDA 3PS7A 2XN2A 5CKSA 3VI2A 1H7PA 3Q2DA 1FQ0A 3NG3A 3LHWA 5K9XA 2ZZ6A 1DV7A 1LTDA 3LERA 2ZRWA 1SO4A 2YW3A 4LVFA 3M5ZA 2PRMA 4I7VA 2C3ZA 1SFJA 3GR8A 3NL6A 1W54A 1AW1A 4NNBA 4JIPA 2YYUA 3N2MA 1NSJA 5G4WA 4ORMA 4HPJA 2QCDA 1B57A 5BNKA 1S5VA 3NQ2A 4UXDA 1VC4A 3TR2A 3QEZA 2WNNA 5TIMA 3IIPA 4UTKA 2I14A 4OU1A 2IQTA 4JYEA 3UWZA 4KFOA 3MP5A 1YXDA 3N9SA 4IX2A 2PE4A 3MHFA 4UNKA 4Z0SA 4RKAA 4OGZA 5F2GA 2FPTA 3BO9A 3L5LA 4A22A 4O1CA 3G1XA 3L9CA 1DJNA 4WY0A 5LKYA 4UIOA 1W5MA 1FWRA 2ZTKA 2CZDA 3MHUA 1KFKA 1TTJA 2CWNA 2V30A 3HPZA 1TTIA 1GQNA 5CGQA 1YPFA 1KV5A 3SGUA 2GVJA 1FDJA 2E6YA 4GUGA 1QPOA 1TPEA 5EYWA 1KBJA 3UY7A 4LNYA 1W0MA 5AHMA 3C2OA 4S2CA 4MJMA 4NZJA 4QSHA 1UBSA 3DI1A 2NXHA 1ME9A 3DZ1A 3NZ1A 1GVOA 3FJLA 1JQXA 4R33A 2QUVA 3TJXA 1PCWA 2C1HA 2E77A 1WBJA 4MFEA 5FEZA 2VXNA 3S5ZA 3BW2A 3A24A 1ZNNA 2RDTA 4RZ6A 2YFOA 3CPRA 1J2WA 3HIJA 3PC0A 1BKSA 4NNCA 1LBFA 1VLIA 3GXNA 1OVDA 1IGSA 2CLOA 5KZMA 3UYCA 3G1VA 1KFEA 3SSJA 4RJEA 2NX3A 1JCMP 3VNDA 1EWDA 4ICNA 1ICQA 1GWJA 4H4IA 3SGZA 3TNOA 4TO8A 1J4EA 1EP1A 3TH6A 4JY8A 2A6NA 1VGAA 1WYIA 3NM1A 4UTJA 4FIRA 1JCLA 2CZEA 4N4QA 5EL1A 3O05A 2F84A 5FF0A 1VS1A 4BR1A 3W71A 4MKNA 1MXSA 3WJSA 2C16A 3A9IA 2E68A 1V5XA 3MWAA 4MIMA 3LLFA 2EAWA 1P5BA 5FF3A 1HFBA 2Y62A 5LZLA 3M43A 2G5WA 3TIMA 4HIBA 3FLUA 5EBUA 2VEKA 4OT7A 3G24A 1R2TA 1XL9A 1G4EA 5K4ZA 1AMKA 3LGEA 3D0CA 3VE9A 4FX7A 3W1MA 3TMQA 3UPWA 3HMJG 5D2VA 2R14A 1XM3A 4X9SA 4B5NA 2HS6A 3P8JA 1FWWA 5K2ZA 1TPUA 5I3FA 3RU6A 4CCCA 4MLJA 5LSMA 4O1DA 2E1DA 4IMEA 5D05A 1FCVA 1ZAHA 4LUJA 3OIXA 3W9ZA 1BWKA 1GTHA 3BLEA 3LV5A 2HTMA 4KFNA 3W2NA 5L9FA 1JRCA 3DGRA 3K30A 1Z44A 5DCDA 4UTTA 4NXKA 1ZCOA 2JKAA 4XWUA 4EF8A 3VE7A 3IVSA 1JUKA 2ISSA 2ZZ2A 1YTEA 5D04C 3EKLA 4QAIA 1UB3A 1H7NA 4DBDA 2ZCGA 4LS0A 2TSYA 1H61A 3C61A 3V1PA 4LVDA 4LUIA 4WXYA 3GXPA 2YPIA 2Z6IA 2LLEA 1SW7A 3P7YA 1KM2A 1SZNA 3DFSA 2DZWA 4FB7A 2CZ5A 5D2WA 5KSWA 2ABBA 4O16A 3IIXA 5D03A 1LLWA 1H51A 4MZ8A 3NQCA 3VKJA 2QJHA 5DY2A 4IUOA 1PHQA 1XDMA 1HUVA 4TMBA 4UFLA 2OMAA 4OV9A 2QCDB 1NFBA 3IV3A 5CSSA 3W70A 3MI3A 1X1ZA 3ELFA 1R2RA 3MHGA 3W87A 4JX6A 3F1QA 3T55A 5D32A 1CX9A 5BOOA 5AC7A 2P10A 2BZNA 1DL3A 1TO3A 2GVGA 4FIQA 3IGXA 1H1ZA 3THQA 3C2FA 2EKCA 2WO5A 3NOEA 1QFEA 1T8XA 3EWWA 4PH6A 3ZWTA 1ALDA 3LXAA 1Z48A 3STCA 3BGGA 4RLIA 4UFHA 4XQ6A 4WY0B 2ZDRA 1ADOA 3RNDA 3QMTA 4LS1A 5CPOA 1X7FA 4HNTA 3Q94A 1OF6A 3N2XA 1TPC1 3OVRA 3TSBA 1TSIA 5HINA 1JULA 3NQ6A 1VHCA 4CQ9A 3KHJA 1Q6LA 2TRSA 1I4NA 1LYXA 1PS9A 1KV8A 4JX4A 4X2RA 3GX9A 3PSVA 3BLIA 4PL2A 4QQ3A 3NQ8A 3FS2A 4EWND 2Y7DA 4JN6A 3SW6A 5IBXA 4JS3A 4S2BA 4GUJA 3W75A 5AHFA 1LCOA 3GLCA 4UTTC 3U8GA 2ATSA 1GG0A 3LCWA 3B0VC 3DBPA 3QQ0A 1K02A 2QCNA 2B7PA 4NJGA 3GYEA 4UTWC 3LI0A 3TX9A 3E0IA 5HUOA 4K37A 5HUPA 1TMHA 4JX5A 3W85A 4JEQA 1FBAA 3EB2A 2ZRXA 5E93A 4O1AA 4WOQA 2FB2A 3E96A 4O11A 3P74A 4ZVJA 1G7UA 2ALDA 2RH9A 3O15A 1AL7A 3UXDA 3KXQA 3CC1A 5J5DA 2QDHA 1E51A 1Y0EA 3P5ZA 3LOTA 1LROA 4MY1A 2JBMA 1GZGA 1SPQA 5HULA 3W76A 3BPWA 3NA8A 6TIMA 4Q33A 1R47A 2BSLA 2YXGA 3O06A 4K8EA 5C55A 5KZDA 2WOQA 3F4NA 5KMYA 5CG7A 1GOXA 3BVJA 4FNPA 1TTQA 3UNDA 2V5BA 5CPMA 4PL1A 3O6DA 3LXBA 4JDYA 4O8RA 4LV9A 1PHWA 1X8FA 1OFDA 3CQ0A 1GVSA 4NT0A 1WBHA 1D3GA 3KVJA 3OG3A 5D30A 3L2IA 4KKXA 3RK8A 4NUWA 1QPQA 2OCZA 4BI7A 1XCFA 3CIWA 3ZFHA 1K7FA 2EPHA 1G4TA 2VOMA 5HR6A 1IIHA 3W84A 1OFEA 1DQXA 2JGYA 3M7WA 2NZLA 3ABOA 2CFFA 4YL2A 1WV2A 2E6DA 2C18A 4EF9A 1QWGA 3CEUA 4DO5A 3GDRA 2YR1A 1RQBA 4MFDA 5C54A 2Z6JA 3WK2A 4JTTA 5IBXC 3MUXA 4JXCA 4Z1CA 1KFLA 3WK0A 3RLUA 3QMSA 2BTMA 5AYYA 3T44A 1FXQA 2WNZA 1D3HA 1VCFA 2X1UA 1W8SA 3EXTA 1EIXA 1XUZA 5I3HA 2DZVA 2E5BA 3PULA 3PBYA 3MBFA 1QAPA 4A29A 2CLIA 2GPTA 2C15A 1O94A 3TW6A 1OYCA 3DFNA 3IRDA 1LBLA 4NZFA 2ZZ1A 1MEHA 1G4SA 2FDSA 4XTDA 4HNUA 1LOQA 1U83A 3P60A 3W2UA 2TMDA 5K9CA 4O12A 3ANYA 3N9RA 5C5YA 5F4SA 2NV2A 1W1ZA 1QMLA 2R8WA 3QYQA 4NX5A 3FIGA 3C8FA 1TYGA 1ZALA 2C6QA 4RXFA 1KA9F 1PV8A 3HO8A 2GJNA 3IIZA 1WDWA 4UCGA 1NVMA 4GBUA 5HWNA 3G1DA 5L6UA 1UJPA 3TSDA 4Z08A 2WV8A 4WQ6A 4ZQCA 4Y96A 1T0OA 2I1OA 3KVKA 3GAKA 1Q6RA 3M1ZA 5BMXA 4A21A 3UWVA 1LRQA 4O4VA 1L2UA 3LCIA 4LT9A 4LVGA 1WAUA 4A2RA 1NF7A 1C29A 2WSRA 5LGXA 1KM6A 3B03A 2PC4A 2A21A 3NQGA 3HG4A 2Q8LA 4ML9A 4Q4KA 2GQAA 4ZQRA 3CWOX 1I2OA 3N3MA 3JR2A 3WJXA 1XC4A 4JTJA 4UNLA 2FTPA 3LBMA 4M6VA 1ZAIA 2Y63A 1SO6A 3LRLA 3W7DA 4O17A 3W88A 1LRTA 4JYDA 1JR1A 5FF4A 4DO4A 4GFSA 2GVLA 5HR7A 1Z42A 1WQ5A 2CLFA 3EX2A 3GKFA 4XBSA 5HJLA 1RD5A 1OFBA 3PF3A 3KVLA 3W7RA 1IXPA 3MI6A 3B0UX 4RCXA 1Q6OA 2YW4A 2WQPA 3WFAA 3TV8A 5AYZA 1UUMA 4EVZA 4IOTA 1DORA 4UTLA 3OBKA 1LDCA 3SFKA 2R94A 3W83A 1A5BA 1FY6A 2Y85A 4NJKA 1TIMA 1QCWA 4WOZA 3W7CA 4K7YA 3PBUA 4DPQA 4O14A 5AYXA 2Q3OA 4LS2A 4Z1AA 3BARA 5CZJA 2ZBTA 2V81A 4S1FA 2NUWA 4OBTA 3ATZA 1XBZA 4O28A 2W79A 1LM1A 3LV6A 2OT1A 3P84A 2J24A 4AWSA 2HS8A 4XUGA 1OHLA 1JUEA 5AFDA 2JGQA 1H1YA 3TQVA 5T26A 3GDKA 3FKKA 4MZYA 3QH2A 2C19A 3W2LA 1M7OA 2J27A 3A23A 3L21A 5LNUA 3KRSA 1TPDA 2DP3A 4TMCA 3R2GA 4HNVA 1QDSA 2C13A 2NX9A 3QFEA 3PWAA 5EY5A 4ZQOA 2O7QA 3CT7A 3I7QA 2WPBA 3LCGA 3ABQA 2J6XA 3IVTA 4MYXA 4LTSA 1YXYA 3IIVA 2RFGA 3RLVA 2FFCA 1YLVA 2Y70A 4UFMA 4ZL1A 3HGSA 5AB3A 4FNSA 1K8ZA 1N8FA 4LVAA 4N9DA 3S0CA 3ABRA 1SZFA 2JKEA 4O18A 1M5WA 5FI8A 2E6AA 2YYTA 1OK4A 2Y7GA 2I9EA 1PCKA 1RQHA 3BV4A 1P1XA 1ZENA 4JNMA 2WNQA 5FF7A 1HTIA 1YDOA 3GNDA 3W2MA 3C4UA 2X1SA 2V2HA 2CLKA 1THFD 2QCEA 3SECA 1OF8A 3F03K 1VQTA 4K38A 3W1UA 3I68A 1UASA 6ALDA 3CM4A 1K8XA 4AMAA 3EWUA 1H7WA 2BWGA 3DFOA 3C56A 2FPVA 4WXZA 2Y61A 4MLRA 5F4WA 3W7HA 2CW6A 5FEPA 3IVUA 5DELA 1Q45A 3W72A 3NVTA 1F73A 1TPVA 3OA3A 2DORA 2NX1A 1IXNA 4FXSA 3SJ3A 3TW7A 3C3NA 3M47A 1L6SA 1OFPA 3R13A 3B0PA 5DCBA 1YPIA 3STFA 3PUOA 4CQ8A 2ZZ4A 1GVFA 4UFJA 3GKAA 5LNWA 2PURA 3LHZA 2EF9A 4QITA 2A6LA 2ZRVA 1SO3A 1R30A 5I3JA 4U4MA 4XKYB 3MP4A 7TIMA 3LCHA 2X30A 2OT0A 5F2IA 4C1LA 2DU2A 3FYOA 5ABTA 4YLWA 2FQIA 1SQ7A 5F1VA 4N6EA 3F4WA 3NEVA 4LRSA 1F5ZA 4AB4A 4HHPA 3UY8A 1HO1A 3NPVA 4O19A 5HMSA 4UTMA 2X16A 4MY9A 1G4PA 2Y89A 2QCCA 2A7NA 2VENA 5DXXA 5G1YA 3G18A 3B4UA 3LI1A 1W5OA 5C6MA 4W9TA 5CPNA 1SFLA 1SSDA 3B05A 4FNTA 3NPWA 4TR9A 4BWLC 3NXFA 4HSNA 2ABAA 3GDTA 2DZTA 2C0AA 4RZ4A 2PRLA 1ONRA 3CTLA 2OX1A 4CNNA 3NPUA 1W5PA 4FF7A 4QM1A 1SU5A 1Q6QA 4NX0A 3LCLA 3E49A 4R7JA 4ADTA 3DENA 3EXRA 2AAMA 5CSRA 4LV4A 4JIQA 3NL5A 4UTWA 3HG5A 4WZHA 3SY5A 3NPXA 3G3MA 5F4XA 1QOPA 4BI6A 4FX6M 1W31A 3NDOA 3OVPA 2NWSA 1FCUA 4MVAA 1KM0A 4AXKA 4I7UA 1TPH1 2QCLA 2RDWA 4BI5A 3I7SA 2A0NA 1O60A 3L67A 1L6WA 3FKRA 1JCJA 3EX3A 3M5VA 2NXGA 1BEUA 3EXSA 3NGJA 4GUFA 4PA8A 1KTNA 1NF0A 1VLWA 1OYAA 1JJKA 3VFLA 3M0ZA 1OJXA 3NR0A 4K7VA 5G5IA 2QF7A 3W7KA 3B06A 4IWWA 1CW2A 1KM5A 4JTSA 5E0KA 4E38A 2CLEA 3FEMA 4K39A 2QCMA 1VYSX 3PB2A 3W1XA 2EHHA 1GJPA 5D2YA 2QAPA 5DBUA 3G8EA 5DLCA 4AVFA 1IXQA 1FDYA 1I2RA 4H6KA 3EEGA 1XXXA 1CI1A 1FUYA 4GRSA 5D33A 3S42A 3JS3A 2ATMA 5DY3A 5MHBA 3PG9A 3O63A 3DHDA 2H3DA 5U4NA 4K6AA 1QR7A 2Y88A 4O13A 2C14A 1I45A 3PY2A 4I9AA 4MPQA 4Z1DA 3W73A 4IJBA 1M7PA 1PIIA 4Y90A 3LB0A 2Z0IA 3ABSA 1F6KA 3C52A 1O5KA 4KWWA 3PR2A 2BLEA 1RZMA 2CZFA 3W7OA 2YSWA 4HT3A 3P80A 4KFPA 4UFIA 5HNRA 1V7YA 5CPLA 4GUHA 5DN1A 3L0NA 3HGJA 1EB3A 1XKYA 4JR5A 2P1FA 3TROA 3DFQA 1OX4A 2JK2A 3TKFA 2H8XA 4M19A 4OE7A 4IX0A 4UC5A 2G95A 4CCEA 4M5PA 3FYPA 5D09A 4Q32A 3R5EA 4UUIA 2QJGA 1J5TA 1JRBA 3BGJA 2F7FA 1QOQA 5EKYA 4WUIA 1TCDA 5AOUA 1AK5A 2ZFAA 1BWLA 3M44A 5G2HA 3I6RA 1P4CA 3LTYA 2TPSA 3P8IA 4IPJA 3PUEA 3W1RA 3WJWA 4A2SA 4OWGA 2Q3RA 4UR7A 1VCVA 5AHNA 3QW4B 1AW5A 1F7BA 5F1UA 3U2OA 1K8YA 3C2VA 4JD4A 3W7JA 3QPZA 5BW6A 2H6RA 1WOAA 1GVRA 3TFCA 1K7XA 4N2YA 4BK9A 2A5HA 4JYFA 3HB9A 3LRKA 3RF9A 2PRHA 4HKPA 4XTIA 4AAJA 1DQWA 1SZGA 1KFCA 4QISA 3LHUA 4JY9A 1JVNA 3S6DA 2NV1A 2YFNA 5I3GA 4RXGA 4N4PA 4NQ1A 1HO4A 1TTPA 4WY0F 3TMLA 5BMWA 4Y6GA 4YMZA 5H2ZA 3A21A 3PAJA 1GYNA 2H3BA 3N19B 3EX1A 2E6FA 4IQLA 1LZOA 3PSWA 3S1XA 1TQJA 2VEMA 3KAOA 1ZJIA 4PTNA 5CZSA 3PUDA 3HJZA 3NL3A 2GJLA 4E2BA 5F2MA 1I2QA 1XFBA 1SW3A 2G97A 5G2IA 1F05A 2DZUA 2J9ZA 1VYRA 3QSTA 3DFTA 1RPXA 4NXSA 3NO5A 4TIMA 1P0NA 2Y7EA 2CU0A 3DI0A 3G0SA 3P81A 2VFEA 3KX6A 1B4KA 4LRTA 5C2XA 1Q3NA 1OX5A 2ZTJA 4PEKA 5DCEA 3NL2A 1MZHA 4GUIA 1GTEA 3W2JA 1DJQA 4FNQA 4QNWA 1GEQA 1WX0A 4O0KA 3W1AA 4PCFA 4AF0A 1S5WA 1DOSA 3DKJA 5D2TA 3GR7A 3NNTA 4AWUA 4QJ1A 2A2IA 3DH7A 3BG9A 3E9AA 4TU1A 3UWWA 2R91A 2YGYA 4I7WA 3YPIA 1GG1A 4DEFA 4RK8A 2VKZG 4E2DA 5TQLA 4O50A 2V5LA 1RR2A 3TAKA 1KLZA 2V82A 4N9BA 5EA9A 4LC6A 3N14A 3QQ1A 2RHGA 5AN7A 3I7RA 3S8HA 3EWYA 5AHEA 3G1YA 1A53A 3E02A 5K9DA 1DHPA 2FJKA 4JTHA 3Q37A 1GVQA 3C2EA 5EMUA 3QMRA 3CHVA 1ZY9A 3W7PA 3HPSA 4NJHA 1SUXA 4IXXA 4NNAA 4P61A 4RX0A 3H54A 5A8GA 4EIVA 3P82A 1H60A 3HF3A 3L5MA 3STEA 1A50A 3DFPA 2A7PA 4O54A 4JDBA 3TU9A 4UFKA 3KFTA 4OHQA 5I3IA 2ZZ5A 4C1KA 3GB6A 1XUUA 2GQ8A 1FWNA 2GUUA 2X2GA 3QC3A 4R53A 3W23A 1ME8A 1VJIA 1B3OA 2ZA1A 3N34A 3UD6A 4Y9AA 3KRZA 1O5XA 2Y7FA 4IMCA 5HQEA 3DU0A 3QPYA 3O6CA 4O0ZA 3L0KA 4GE8A 1OX4B 1PE1A 3HOJA 4LW7A 4AHPA 4GXMA 1QO2A 2V9DA 1DKWA 2XN0A 1TPB1 3L0GA 4NJJA 5U7SA 4J9JA 3UQNA 4O53A 1LBMA 1L6YA 3B04A 3UZ5A 3R12A 4FXRA 3O16A 3W1QA 1HL2A 3STGA 1DBTA 1OABA 3W7LA 3EKZA 2NWRA 3W1NA 2FB3A 1OK6A 1H7XA 5LGZA 1TV7A 1VRDA 2B7QA 4HNNA 1KM3A 1S5TA 3BW4A 1OFRA 2TYSA 4MZ1A 4YWIA 5KZEA 3IGUA 1H63A 4POCA 4DF1A 2QJIA 2ZRYA 2ZQ0A 1VR6A 1W56A 4ZQMA 1BTMA 4AHQA 3W22A 4M7SA 1F2JA 3NQVA 1C8VA 3NQ7A 1SW0A 1B4EA 1EP3A 3M41A 3QZEA 3T78A 4U28A 2GQ9A 4JTEA 5AHIA 2NUXA 4UR8A 2WSYA 1JCYA 3G1HA 2QCHA 5KINA 1O4UA 1KTCA 3S5NA 3L65A 3OVQA 4BWLA 4RR4A 4JTGA 3P67A 3SZ8A 2B7NA 3TE9A 4JTLA 4BF9A 2NXIA 2DJLA 3UZJA 1ML1A 2EGZA 1W3IA 3T4CA 1KFJA 3BW3A 2HMCA 3W1PA 3W7IA 3EWZA 1ZHAA 3GZ3A 3S1WA 2A7RA 5K7JA 4YCPA 2V2CA 4QNEA 2XN1A 2J9XA 1SZEA 3TUUA 4EOUA 2ZYFA 1QO5A 4X3ZA 3S1UA 3R89A 8TIMA 3W7NA 1AG1O 3MMTA 4ONVA 1PVNA 1LOSA 1WA3A 5KTLA 3ATYA 1JQVA 1X6UA 3M5XA 1YTDA 2ZRUA 2B7OA 4MUZA 4MJZA 3NAVA 1QPNA 1N55A 3UPBA 5G2WA 5SWUA 2QCGA 1R2SA 4WX2A 1SR9A 2YDAA 3LM7A 2BX7A 2B4GA 2YCEA 3UWYA 4DF2A 4L4MA 4AWTA 3GNNA 3H55A 4AF0B 2V8ZA 2WKJA 4UTUA 2J88A 3MYPA 1G7VA 1MEWA 1MSSA 4AEOA 1JUBA 3W6YA 2J9YA 1S3HA 2NUYA 1DVJA 1RQEA 4X22A 1D9EA 3ZS4A 4MOZA 3GDLA 1RV8A
chains in the Genus database with same CATH superfamily
1Z6KA 1DIDA 5JH2A 3LRMA 1VFTA 5M03A 3QFWA 4C6QA 1ICPA 2JFEX 1QPKA 1EXPA 1BFNA 3VA8A 4MNLA 3VGGA 4C6NA 2Y5SA 4GX9A 4PUNA 5FESA 3DCPA 2VFIA 1UWQA 4EAYA 3QV9A 2GOKA 1SYTA 1UH2A 5DMLA 1XPYA 3A22A 1X8CA 2BOGX 3CYJA 2J47A 2VD9A 3WEZA 4OJYA 2VEIA 3WJZA 3RFAA 2PGRA 4NZ1A 1NAL1 4ADSA 1UKPA 2PWFA 1TFVA 4MHBA 2DPEA 2VR4A 1XD1A 3DKLA 4B5SA 3OLEA 2DJXA 4BY3A 1UMYA 5LNVA 4HPXA 1VBJA 3LHTA 5T8GA 4PB3A 3GK0A 1UR1A 3CEPA 3BV7A 2ZRZA 2X1RA 1MO0A 2GJXA 4O1BA 4H9VA 5TBOA 3WK1A 3G22A 4FX8A 1K1DA 1EJSC 4GNJA 2C71A 1T96A 4CNSA 2VNCA 3QN3A 2GOUA 3K5XA 5ECVA 4FR6A 3REQB 3IEBA 4CLMA 4RE2A 4DPPA 3H21A 1T7LA 1J5SA 1IXOA 1TX2A 4ZFMA 1SSGA 2QDGA 1BGGA 3N4EA 2XM2A 3HMCA 3NQDA 1LT8A 3GDMA 3EOEA 3VCRA 3SCOA 3RILA 4LH8A 4AVNA 4PN2A 4PODA 3CBWA 2QV5A 4DRSA 1IE7C 3MMWA 4O0QA 3RRXA 1TJPA 1NDWA 3NQFA 5FEXA 5J04A 1XIIA 3DDMA 3GG7A 2VC9A 1YE4A 3USBA 1KQZA 1AZ1A 2VFHA 3W82A 3LHYA 1UR8A 3VNJA 2VX4A 3QYSA 3VD3A 2VDGA 1TPFA 4LC8A 3MYOA 3FY1A 1E3XA 3PZTA 3ZJ6A 3Q58A 3GAYA 3C2RA 2ZX6A 1RALA 1UCWA 1XBVA 3M0VA 1U5JA 4LGXA 3EOUA 3LMYA 3N11A 4ZQNA 4GCXA 4GWEA 2I57A 3EX6A 2YX0A 2A85A 1I2PA 3LPFA 4Q6JA 4FO4A 3CIVA 4DO7A 2I5QA 1TRIA 2HCVA 5HXMA 1E0XA 4NL1A 5G1TA 4U10A 2QAFA 3H4XA 4INFA 3O9NA 1NDVA 2KZHA 3UFYA 1Q2RA 5A69A 4DJDA 4OBSA 4GXPA 1QNVA 2QPXA 4DN1A 1MRQA 3KRUA 1A5LC 1MFUA 1WZKA 3TC3A 2VR2A 2VC5A 1WE5A 4D6GA 1YADA 1OT1A 1OFAA 1VZWA 4NU7A 1HG3A 4L56A 3SUSA 3VXGA 2H90A 1FWSA 2PWDA 2WMFA 3ARZA 1QHPA 1CIUA 1J11A 2Y0FA 1VFUA 4ACZB 1E0UA 3ZR4A 2YL5A 2FHCA 2QUTA 2ZA3A 3R7MA 3KDNA 2BB0A 4DELA 3BSMA 4DQWA 1E4MM 1O68A 3S1GA 1P0EA 1JCNA 4GZEA 1YDVA 2JKPA 2DW7A 2QGYA 2J7DA 2VRKA 3HGOA 3PBWA 3DXIA 2E09A 4S3GA 4IMFA 2O9OA 4HB7A 3UWUA 3SIMA 2R1MA 1EGVA 4O10A 4ERAA 5C2GA 1N7KA 4I6KA 1FVPA 1K9DA 3QPEA 3T0CA 3W74A 1EJRC 3V35A 4Y7EA 3K8LA 3P62A 3TFXA 3G0XA 1ZRQA 2V3FA 4FNUA 1IZJA 4G5DA 2XH2A 1KFBA 3NDYA 3V0UA 3KBVA 3FXGA 1UR9A 4YCOA 2QUMA 3G1SA 4KCTA 3F5LA 4IL2A 3VDHA 1MXDA 4A3UA 2YOCA 4EE9A 4RE3A 5BYWA 4FPSA 1WPCA 1H7OA 4JGDA 5HWJA 4KF1A 1HJWA 1H5YA 4DZAA 3F4CA 2G50A 3FXYA 1HKMA 1S2VA 1KW1A 3BJSA 1M3UA 1DTUA 2D23A 4B2DA 2OELA 3MJYA 4XUYA 4IPIA 2YZRA 5AC8A 1QW9A 2I7GA 1WZLA 4B16A 2ISVA 4QBXA 1IQ8A 2VO5A 2PODA 1L6FA 4N9CA 1X6LA 5HK4A 3RX2A 3AFBA 5C0QA 1M03A 3WDPP 1W1YA 5KITA 1A0DA 1EC8A 4QDPA 1JI2A 5G1MA 4Q4RA 1HJXA 5LNRA 4O52A 3V75A 1OZMA 4MYAA 1LQ0A 4RNIA 3CB8A 3WUEA 1E73M 4M6PA 4AZ5A 3NQMA 4QG8A 1V0NA 2HV5A 3O6YX 4PR4A 4N9EA 1V51A 3WDRA 1CXHA 1EXBA 3QRHA 2G3MA 3GFYA 3QVQA 4AH7A 1FHDA 3MO7A 4KWVA 4TVUA 4QIUA 1KM1A 1XLBA 5GVJA 3SADA 2XN2A 3UETA 4JKKA 1FQ0A 4C1NA 1ONXA 1R0MA 4J40A 4U33A 3BCDA 1FOBA 2ZZ6A 3II1A 5K9XA 1LTDA 2YW3A 2FTYA 3M5ZA 1V0LA 4IIEA 4MWAE 3NL6A 2I56A 1QUMA 1U1UA 5FSEC 3LMZA 4F0SA 4WKHA 4JIPA 1UWRA 2YYUA 5A6BD 1JDEA 4PMOA 3TTEA 2QCDA 4QCEA 1S5VA 4UXDA 2YB1A 3QEZA 3IIPA 3L2LA 3NOYA 1B3WA 3VILA 4OU1A 2UY2A 3H2OA 3ZM8A 3ZYZA 3UWZA 4KFOA 3A4WA 3IACA 1EO7A 2FPTA 2FVLA 3GD6A 3G1XA 3IJ6A 2BS9A 3ALGA 2ZX8A 1W5MA 2ZTKA 2CZDA 2CWNA 1KRCC 3EDDA 3HU7A 4JPGA 1W9VA 3DECA 2Z29A 5CGQA 3W53A 5REQA 1PKNA 3B9EA 1FDJA 4GUGA 1QPOA 3MKKA 5IFPA 4LNYA 5DT7A 4CNUA 1R3QA 4D6DA 4J3VA 1IGWA 3DI1A 3DZ1A 3NZ1A 2V68A 4KWOA 1JQXA 2PDWA 4ZTYA 2C1HA 2D2HA 4MFEA 2VXNA 3FW6A 1M1BA 3RCYA 4PUMA 4LYPA 4YTTA 4Q8NA 4YVXA 4ZB2A 5GJPA 2AQVA 2XWEA 3WQ6A 3AS0A 4KGJA 2NSXA 1E55A 4HVXA 4B5TA 3APTA 3THDA 1IGSA 1GKQA 5A8QA 3UYCA 2QNEA 2Q8XA 1KFEA 3BH4A 2Z26A 4RJEA 1OZQA 2NX3A 1E9YB 4QJ4B 1YMYA 5HQMA 5GPRA 4ZB0A 2PUZA 3OLGA 2AKMA 3DFYA 1QATA 1EP1A 3TH6A 3T2QA 1EBGA 3T05A 4FIRA 5EL1A 1E6PA 4JBRA 1ZJHA 1VS1A 2OQLA 4DWSA 1MXSA 2C16A 3A9IA 2E68A 3CAWA 4MIMA 3U3HA 3MKVA 4NG3A 3VGEA 4PGLA 1UH3A 3FLUA 2H9AB 4J35A 4ENLA 2VZOA 4B91A 3G24A 3M0LA 1R2TA 1AMKA 2OOGA 3LGEA 3D0CA 3HMJG 1ZBVA 4MB3A 4B5NA 2HS6A 1FWWA 1TPUA 5I3FA 1MDRA 1IEXA 1OBAA 5D05A 1TVLA 2X7WA 2V38A 4LUJA 1DWHM 3OIXA 3SN0A 4NZ5A 1BWKA 3LV5A 3W2NA 1JRCA 2DSVA 5DCDA 4NXKA 1ITXA 2PA6A 2WWCA 3U2ZA 4MJ2A 3IVSA 1DIKA 2VZVA 1JZ2A 4TQTA 4L4OA 3EKLA 4QAIA 2WZMA 3MZ2A 4LS0A 2G4FA 4XAFA 4LVDA 3GXPA 2YPIA 2W61A 1SW7A 3P7YA 1KM2A 1SZNA 3WMLA 1E6ZA 4LAOA 4FB7A 3WELA 3AYRA 4E8GA 5KSWA 4O16A 3IIXA 3WDIA 2QJHA 5DY2A 3ITGA 4IUOA 1N8WA 5A8PA 1HUVA 2OMAA 2CXEA 2W27A 3A4AA 5CSSA 3W70A 3CPUA 3AI0A 3ELFA 4IJRA 3H24A 1P7TA 5D32A 2BNJA 1RY8A 1VKFA 2R6OA 3TVAA 6ENLA 3THQA 3C2FA 1WB0A 2YBUA 3SEPA 3EWWA 4PH6A 3EDKA 1ALDA 1EC7A 3CPGA 3WNOA 1ADOA 3RNDA 4U2YA 5CPOA 4HNTA 3A13A 4HPGA 3OVRA 3TSBA 3PJTA 1TSIA 5HINA 4L1XA 1TELA 2TRSA 2GFTA 4JQ4A 1B0IA 5BXSA 1YE6A 2FMNA 1LYXA 8A3HA 3DYMA 5FJJA 1E70M 4X2RA 5HATA 1POKA 2VC7A 4C5ZA 1DE6A 4I8DA 3A3XA 6TAAA 4GD0A 2Y7DA 1WNOA 4GUJA 4HD5A 2BVDA 3W75A 1JZ7A 5AHFA 5A6LA 4PUJA 3GLCA 3LCWA 2OYMA 2XGBA 3QQ0A 2MANA 4MG4A 1PIGA 1R6WA 4J5NA 2P76A 4K37A 3KBJA 1TMHA 1LG1A 4PUDA 2VQTA 2ZRXA 5D8WA 2JIWA 4DLMA 2FB2A 2GLKA 4C6DA 1JYNA 2O9TA 2YKKA 4IIDA 3KM8A 2YA1A 2QDHA 3LOTA 4M29A 4F8XA 3TJ4A 1GZGA 1SPQA 3W76A 2Y2WA 1B90A 3A9BA 1AJZA 5DT5A 3BQ6A 2BSLA 3GW0A 3MCMA 3BVJA 4Y9NA 1K9TA 2E9MA 5DQPA 3UNDA 3N29A 3F2BA 5CPMA 1AJ0A 3O6DA 1JZ5A 3RUBL 2EXOA 1SJBA 4HPHA 4H04A 4RNJA 1F8MA 1P0DA 2VOTA 2J4GA 5D30A 3L2IA 3RK8A 4BI7A 1XCFA 4C6IA 2PAJA 3CIWA 4HA0A 4BCEA 4F79A 3OODA 3DC0A 2EPHA 4GJIA 1T8QA 2JEPA 4RPPA 3CV6A 3M7WA 3ABOA 1LQAA 3EKGA 4YL2A 3WQCA 1GHSA 3NWRA 1WV2A 2E6DA 2GJXB 4EF9A 1XCWA 1XD0A 2VHLA 4O1EA 1QHOA 3GDRA 5FAJA 2QV4A 5CXPA 4MFDA 2Z6JA 3WK2A 2QYGA 4JTTA 1M9HA 2FZMA 4MUPA 1KFLA 1NH6A 3WK0A 1FFRA 2E25A 3QMSA 1XRFA 1ZJAA 2BTMA 5FOOA 3E0WA 4QLJA 1VCFA 1W8SA 1W91A 1EIXA 1XUZA 5I3HA 2E5BA 1R8LA 3PULA 3FGCB 3A4JA 3MBFA 4TXEA 2V69A 4QCFA 1GORA 2GPTA 1O94A 3TW6A 1JGMA 4R7WA 1GZJA 1LBLA 4NZFA 4ROPA 3L23A 2E8YA 1MEHA 1G4SA 3I6TA 1TVPA 3W2UA 1ZP4A 4LAKA 3ANYA 5C5YA 3TEVA 2BY2A 1PX4A 1Q8AA 5DMNA 4IQJA 2YDRA 1VB9A 3WEOA 1ZALA 2C6QA 1TUFA 3V4BA 1PV8A 3HO8A 4K1GA 4XZIA 2GJNA 4UCGA 2PZNA 3TSDA 1E0TA 3DGBA 3BSHA 5I5RA 1T0OA 3TTOA 1ZBWA 1P0BA 1LRQA 1L2UA 4ZTXA 2WSRA 1KM6A 3NTYA 3PZUA 2PTWA 3T6CA 4PMVA 2CKSA 5I78A 5ABFB 1NM9A 3AWOA 4ML9A 2WCSA 1LL4A 5CZKA 1XLMA 4M6VA 4RL3A 4O17A 3CUZA 3L4ZA 3W88A 2DSUA 4JYDA 4GFSA 4NF7A 3FAXA 5HR7A 2JIEA 3XINA 1RD5A 3PF3A 2J7HA 1Q6OA 1UZHA 2YW4A 3MUAA 1XSJA 4EPKA 4ZBCA 1XP3A 4UTLA 5E0FA 1LDCA 4S39A 1UQZA 3M46A 1FY6A 2Y85A 4GVGA 3QV8A 3PBUA 1K8CA 1K9EA 3GTHA 4FS9A 1X7IA 3BARA 5CZJA 3VZYA 5FL1A 2ZBTA 1TZ9A 2J7FA 2NUWA 2WSKA 1VPQA 4AW7A 1ZLPA 3LV6A 5DX7A 3P84A 2J24A 1JUEA 1H1YA 1C7SA 1MUCA 2PBGA 2OODA 3W2LA 4H8HA 3L21A 1D7KA 5LNUA 4IP4A 4TMCA 2ACQA 1GOMA 1TWIA 2C13A 2YBTA 4MMWA 4ZQOA 1HKVA 3WQEA 2XSAA 3ABQA 5GJNA 3OQEA 2VL4A 4LTSA 3IIVA 1S46A 1TCMA 4GQGA 1AD1A 4LUSA 2PSNA 1QI2A 1C92A 1K8ZA 2BXZA 3IJ8A 4AMCA 3S46A 1DJGA 4N9DA 3MSYA 3ABRA 2EQDA 4O18A 1M5WA 3FYYA 3VTRA 3WL1A 3AIVA 4XD3A 2YYTA 1OK4A 2J7CA 2Y7GA 4HCHA 2HBXA 2I9EA 4H6QA 7ODCA 1W1VA 1W1B1 1ZENA 1TVNA 2WNQA 5FF7A 1RJPA 2PLKA 3C4UA 2Y8KA 2X1SA 4ATDA 5AY7A 1VQTA 4B4FA 4CKQA 3EWUA 3CB3A 2XVLA 1B54A 1C91A 5A6BA 2HPIA 3C56A 4B90A 3WY1A 3C5QA 3EOSA 2FPVA 3B40A 4ICMA 4DJFC 4MLRA 5H8MA 3S9IA 3RM4A 3W7HA 2CW6A 4EP8C 3IVUA 3DG6A 3U7VA 4LUTA 4DBUA 1Q45A 3W72A 1KR0A 2OKOA 1E1EA 5LXEA 4CEUC 4PTDA 3JW7A 2OQHA 2DORA 4CQDA 2NX1A 4JN8A 3RJYA 2YB4A 5PTDA 3SJ3A 2RDXA 4R85A 3M47A 3URBA 3VOHA 3AYVA 1OFPA 3R13A 2Z24A 5DCBA 4X63A 4YTUA 5CJMA 3MUCA 3STFA 3PUOA 4G2DA 3BMVA 1E56A 3VDCA 5I2UA 4AZ7A 3LHZA 2EF9A 4B5VA 3WUBA 1SO3A 1R7AA 4RDWA 3WF2A 2OG9A 3CO4A 2X30A 4PSRA 1DJYA 1HX0A 1UYQA 3BWWA 2D1ZA 2FQIA 1FHLA 1R3TA 3V0SA 2CLPA 4N6EA 5TD4A 4A3RA 3NEVA 4LRSA 1F5ZA 2QMKA 4AB4A 2A79A 3UY8A 4H7CA 2OOFA 5HMSA 4UTMA 3AHTA 1Q6EA 2GK1A 9XIAA 2QCCA 2FH6A 5D4YA 4M1RA 5CPNA 1REQA 4LAMA 1SSDA 4H9YA 3IAPA 4IGNA 1ONRA 3P93A 3WLSA 3TN5A 3K1DA 1O12A 2ZUNA 1Q6QA 3LCLA 2WC4A 4L6OA 2BFGA 3VKKA 4L65A 5CSRA 1TWWA 4LV4A 4DWDA 4UTWA 5IDIA 3HG5A 3TOYA 4WZHA 2VZTA 5BRPA 2VX6A 4AZCB 3U9IA 2XIIA 1JI1A 2Z1WA 3G3MA 1HT6A 4UQBA 4EX4A 1R3SA 1LL7A 1W31A 3OVPA 1SR0A 4AXKA 3U2CA 4C6CA 2QCLA 3I7SA 1O60A 3L67A 5LIKX 4HHMA 3P0WA 1BEUA 4GUFA 3SUWA 4PA8A 1KTNA 1RD6A 3AMCA 1AQHA 1RP9A 1VLWA 3FHQA 1JJKA 3VFLA 4LYQA 1OJXA 2CHOA 3N2TA 3MDUA 3RCMA 5A6SA 4V27A 1SJCA 3TJIA 3F5KA 3AHYA 4NSBA 4K39A 1VFOA 1OCJA 4ZOEA 3PB2A 2EHHA 4TX8A 5D2YA 2Z27A 3S83A 3VK5A 1IXQA 1FDYA 2EJ1A 3EEGA 2O9RA 3ITTA 1XXXA 1FUYA 4GRSA 5REQB 3CYVA 5MHBA 2ATMA 5DY3A 2HK0A 1JFHA 1GW9A 3AOFA 3ISIX 4JEJA 1JYXA 2Y4SA 5U4NA 3WYZA 1HVQA 1QR7A 1BHGA 1G9HA 3SO7A 1H41A 3W73A 1M7PA 1KWGA 1PIIA 4Z1YA 3L4YA 4D6JA 3S6TA 1QJWA 2QW5A 1V3IA 1O5KA 4KWWA 1AVAA 2CZFA 4HT3A 3P80A 4PCNA 4UFIA 1UWAA 2E28A 1V7YA 4XVDA 2Q02A 9XIMA 4JOMA 4GYPA 3R0KA 3WBWA 4JR5A 3CV2A 2JK2A 4C6EA 4DI9A 4BEQA 1XDJA 4CCEA 3BZGA 5D09A 4Q32A 3Q65A 5DF0A 2QJGA 1J5TA 4WUIA 1FP8A 1AK5A 1DJHA 4IFKA 3RJXA 4DM2A 3PUEA 4XZNX 4CN6A 3WJWA 3SAZA 4HZMA 3CMFA 2Q3RA 1VBHA 3QW4B 1AW5A 2YLLA 2O92A 1US0A 4ASTA 3W7JA 3WH9A 1W9DM 2G3NA 3TFCA 2ZE0A 2J75A 4IPPA 4JYFA 2DT2A 2PRHA 1FWIC 1HIZA 4JY9A 1UR4A 2J8GA 4WY0F 3T4WA 3VNZA 4Y6GA 1X98A 4WDXA 2PDMA 5XIMA 3PAJA 2VDHA 3EX1A 2E6FA 1ZJIA 3WF3A 5CZSA 1E6SM 1CENA 1FWFC 3NL3A 1KGXA 4IF2A 3WNKA 5E70A 4WF7A 1OGBA 3CNYA 4G8TA 1VEOA 3UXIA 2DZUA 3AICA 4QJ5B 2ACUA 1CT5A 2POTA 3NYDA 2A3BA 3AJ7A 3G0SA 3WLJA 2VFEA 4C5YA 3WG6A 1ISXA 1EIBA 2X09A 5C2XA 2P3EA 2TODA 3AXIA 3NL2A 1DJQA 1RH9A 3H2MA 2O55A 3AXMA 3W1AA 2BHYA 2W92A 1E6NA 3B8SA 4AD3A 1XJBA 3DKJA 3DESA 4KWUA 2YL8A 3A47A 1UOKA 3CQKA 3T2OA 1NU5A 2A2IA 3WF1A 1WO2A 4TU1A 3UWWA 3H7VA 3YPIA 4QQUA 2FH8A 3UA3A 4RK8A 1ELSA 4L6DA 2R1LA 1V6WA 1J6PA 3MANA 2VDIA 1S1RA 4O50A 2V5LA 2DUXA 2V82A 5EA9A 1UP3A 4XD4A 2VI0A 4H7VA 3G5EA 3H12A 3EMZA 4NASA 3S8HA 3UJSA 3ZMRA 3B0YA 4KCVA 4PTWA 3G1YA 1DHPA 4ZE4A 3SCSA 4DJEC 3Q37A 1GVQA 4UQ9A 1E40A 1UC4A 3IGHX 1DEDA 2WHLA 1ZY9A 4NYYA 3PWIA 2P8BA 4HZ7A 5A8GA 5AYIA 4EIVA 3L5MA 4F0RA 5EB8A 4LQ1A 3DFPA 2A7PA 2PDQA 4I9TA 5I3IA 1ZSXA 2AQOA 1GOIA 3WLRA 1DYSA 2DQWA 1PPIA 4DYJA 5A6JA 1ISWA 4J1OA 2GQ8A 1FWNA 3R6IA 2GVYA 1EO5A 2XWDA 3CK5A 3N34A 3SJNA 3UD6A 1OQFA 4MDOA 3MB9A 4Y9AA 3KRZA 4ZXOA 3DU0A 3O6CA 4O0ZA 1OX4B 1AZ2A 1BF6A 4LW7A 4GXMA 3AU6A 3CAKA 5HNNA 3GU9A 3IUHA 5I7GA 4IPLA 4O53A 3LG3A 1F3XA 4R9XA 3CUGA 5TF0A 3OIHA 1GGOA 1JZ8A 3R12A 2VD8A 3W1QA 3V36A 3STGA 1DBTA 3DBNA 1ISYA 1XLAA 2FB3A 1OK6A 1J0HA 2ACSA 1VRDA 2XGZA 1E4IA 3MWCA 1PWLA 4MZ1A 4POCA 4DF1A 2FVKA 2ZRYA 2HPMA 1QXLA 4C60A 3W6LA 5IOBA 4P7QA 1EP3A 3UWEA 3M41A 4I3GA 3FAWA 3T78A 2OEKA 3GR4A 5AHIA 3K2GA 3VPLA 1BPLB 1NFPA 1XYLA 4JTAA 1O4UA 1PX3A 3OVQA 4BWLA 1KC7A 1TG7A 3SZ8A 3IARA 3LSBA 1PZ0A 4WDTA 2NXIA 1CTNA 1ML1A 1OB0A 5JIWA 1KFJA 3BJFA 4GI8A 3W7IA 1ZHAA 1LLOA 2XINA 3GWQA 4U3CA 4W84A 5IFTA 4B5UA 1PTAA 2XH4A 4EOUA 4LBSA 8TIMA 1AG1O 2ADAA 3DX5A 1PVNA 2QIWA 3QKEA 3M5XA 1YTDA 3ZLFA 1Q2SA 2V67A 3NAVA 2GGIA 1MQPA 4LUYA 3H70A 1XISA 5G2WA 5SWUA 1R2SA 3N2BA 2CZVA 1HF6A 3R94A 3HTWA 1G01A 4G1NA 1LG2A 2B4GA 1D3CA 4OOZA 4ZODA 1I6NA 3RLHA 4UTUA 1MSSA 3QC0A 1UHVA 2NUYA 1DVJA 1RQEA 1UD8A 4C6LA 2VGGA 2FHFA 3KWSA 4MOZA 3TYAA 1PDYA 1MDLA 3AWNA 8XIMA 3PZ9A 3RDKA 4J3SA 1ME7A 4GJ1A 3LNMA 1OG0A 3GM8A 4LY8A 5FSDC 2A4AA 1NQKA 2DSKA 5EMYA 4ZB5A 2QJMA 5A6AA 3AJXA 3MY9A 2X40A 1GQKA 3PNUA 4ZMGA 3WF4A 2ZUTA 3MVTA 2YJQA 5E9XA 3UCCA 1QBAA 3NSXA 1JD7A 4NVTA 1BQGA 2CLHA 3N25A 1XGEA 1E4NA 1Y5VA 5I09A 4XD6A 1XIBA 4DO6A 3EB4A 2JE8A 5HPOA 2DZXA 4MWAC 2Y6ZA 3LQGA 1M6JA 2VJXA 1RLDA 3TXVA 4PCTA 3O07A 4KRZA 5FA5A 3KTXA 4GYKA 4JICA 5B7ZA 3QHOA 1HQTA 1JPKA 5FJRA 1EL3A 1PYFA 2XIMA 3HBLA 4D6HA 1GKPA 3KOWA 1W5NA 4MB5A 3M6YA 4JFVA 2H8ZA 3CWNA 3NZRA 3MO4A 3UYIA 2OQYA 2V3GA 1ENUA 4AISA 2D3LA 5LYRA 5E1QA 1K77A 1EWEA 3QY6A 1IYXA 1KBIA 3OEXA 2QCFA 1XKJA 4A8RA 3M9YA 4FNRA 3N2CA 3T40A 4ADUA 1DQUA 3SI9A 1F6PA 3W7MA 1Q7MA 3EWCA 3S2NA 1CXEA 5HMDA 3GVWA 3VIOA 1YNQA 3R1ZA 1UP0A 2GL5A 1G67A 4IIGA 3ZJKA 3CZLA 5LHEA 2PDJA 3KCLA 5EFDA 4DUOA 5DO8A 3ZSSA 3C0JA 2ZX7A 4QFUA 4LXFA 4KPLA 5GJMA 4EWJA 4ALDA 1IT0A 3FOKA 5A6TC 2E67A 4ILSA 1MYRA 1RY0A 1VPYA 3CAQA 2BGNE 4AY1A 2VX7A 3TCEA 4RV8A 2IMRA 4GO8A 4PE8A 1F3WA 4K36A 4GIAA 3GUGA 4FLOA 4LUSB 1CNVA 3GTNA 3SRKA 1GOKA 4DWSC 2OB3A 2PB1A 3VOIA 4GVHA 1O5RA 2UZ9A 2RDUA 1X6NA 4MKVA 1Q6DA 3E74A 3TAOA 1P0KA 1QBBA 2ZX5A 2WMJA 4JFTA 3GU1A 1H7RA 3BE7A 1WXJA 3EA1A 2MNRA 3LX9A 3A4XA 3CLMA 1OX6A 4LVBA 3HPXA 3TA6A 1DWJM 4Q8MA 2V3DA 4L9XA 3BK0A 9RUBA 5C9XA 5D37A 4A4AA 1TREA 2PDIA 4WSJA 4HU4A 4LBUA 1Q7ZA 4DUWA 3BG3A 5LXXA 1V6TA 2HEJA 1FX6A 4H2CA 2CBUA 1VBGA 3VOFA 1A0CA 4HU8A 1T5AA 3W2KA 3WD0A 1F76A 4MY8A 4WDUA 1O7AA 3C86A 4GNVA 1CLVA 1W37A 3N18A 1CECA 5ABGA 3LY0A 4HSOA 4S23A 2VURA 1DP0A 4PMUA 1KRMA 4WJEA 5F2LA 3LTPA 5D9MA 1F4HA 3VDAA 4AZBA 4CNOA 3CASA 3URNA 2REQA 1TUXA 2CHNA 2C91A 4HK6A 4O4WA 4HOZA 1JCXA 2DSZA 1JGIA 3W4RA 1IT7A 4TX9A 1IWAA 4FA3A 2YA0A 4X60A 1J2BA 5CBJA 1DXFA 4KS0A 2GQ3A 3NZPA 3LPOA 3E2QA 1C3FA 1EYEA 1LORA 1VHNA 1AH0A 4DXKA 4AHOA 1BYCA 1UA7A 5JBFA 2Q01A 5A8OA 2AOSA 3I6EA 3S9ZA 4GI6A 2AGKA 1AW2A 3GBEA 1LL6A 4AEFA 2INFA 1V6VA 4ZZ9A 1P6BA 3ITCA 3LXCA 3VNKA 3TC6A 2Q8ZA 1ZAJA 3PZOA 1ITUA 2W3ZA 4L4LA 2YXXA 1BXBA 1H50A 3NQEA 3LBCA 1RJRA 2YL9A 3G3DA 3G1FA 1W5QA 1ODZA 1FXPA 3K1GA 3ZJ7A 5HWMA 2J7GA 3VNYA 2EPKX 3N3TA 1UG6A 3CMGA 4PULA 5I3KA 2FZ8A 1FWTA 1XBXA 1RK5A 3OHIA 3S5OA 2FLIA 1TZ7A 4C6BA 1E72M 1OT2A 5D2XA 1YTKA 1EKOA 1TKKA 1C93A 3LHVA 4IXHA 2R9RA 1HP4A 4XZWA 5BXRA 3DAQA 3NCOA 3V5CA 3GUWA 3D6NA 3EPMA 1XSKA 1OM0A 2XG9A 3IUDA 4PRTA 4OECA 2PDUA 3KTCA 1POJA 3LYEA 1EEPA 1QW8A 2HVNA 3LLXA 2X2YA 3LDVA 3KOFA 4JFSA 3RMEA 3EWXA 2BXYA 5D9PA 3MW7A 2DGAA 3S1VA 3NQAA 2F6KA 1CGYA 4I9MA 4B3LA 1TX0A 2E5DA 1PAMA 1CXKA 5M3WA 3N12A 5AKQA 4CD8A 1TB3A 3UR8A 1I9CB 4XZBA 1TMQA 2E40A 3OPSA 4KEZA 3B8DA 1CXFA 3VM7A 4L64A 3UVIA 4HYWA 4AY8A 2WHMA 3GH5A 4GISA 2RKXA 1W3TA 4FHAA 1JYVA 2XSXA 1VFFA 3R8RA 3WSUA 1PKYA 3OGRA 4LAZA 2QZRA 1TV8A 3R4IA 3L4UA 4GC4A 1OFOA 4LBRA 1GKRA 2A1YA 4Z0JA 3BCJA 4P5UA 4XBKA 4FLQA 3GIYA 1Z41A 2HXUA 4ERGA 4FI4A 1A3HA 4WDWA 2IKJA 3TW9A 4XK2A 4QTGA 4N6FA 1O66A 1UUOA 4DNHA 2WJFA 1TRDA 3THCA 3DIPA 1YBQA 3AIWA 3BOXA 3Q2DA 3Q67A 4UQCA 3B8UA 3LHWA 3R8GA 1WDRA 2VRQA 2ALRA 3SQLA 4YHGA 1H1NA 1W54A 1OEPA 4H9MA 1VEMA 1XQKA 5G4WA 1CLKA 1JPHA 1DJXA 1B57A 4YHEA 5C9RA 1VC4A 4KGLA 3TR2A 5BOFA 1FHUA 1RUSA 3GVRA 5T91A 3BQ5A 3DOPA 3SUTA 2HE5A 3WEMA 2F8QA 2IQTA 4ML4A 4IX2A 1S5MA 4C7GA 2ZUWA 4UNKA 1CDGA 3GG1A 4RKAA 3CQIA 4CN4A 1C7TA 4FF5A 4UZUA 4TV5A 4WY0A 4C6FA 1FWRA 3IJ9A 3GNPA 1KFKA 1TTJA 3HPZA 4YU1A 1V03A 3LU2A 2J7BA 2NT1A 2ZDSA 4EXAA 3B9AA 1GOOA 2NLYA 5EYWA 5HNTA 1KBJA 3G77A 1PUDA 4S2CA 2CKRA 2NXHA 1DPMA 1TWSA 4DX3A 2YL6A 4OTKA 3TJXA 5FEZA 3S5ZA 1EJWC 3G6MA 1ZNNA 2NQZA 1B3XA 2RDTA 2VCCA 3CPRA 1J2WA 3HIJA 3PC0A 5I6SA 1M7XA 8CGTA 4F4RA 3E2VA 3CQJA 3GXNA 4L9ZA 3V18A 1OVDA 3UJ2A 4W8AA 1LWHA 1A0EA 1W2PA 4GKTA 2XZ7A 3WBEA 4R27A 3C3UA 2NSOA 1TE6A 1UJQA 1W3LA 9CGTA 1ICQA 2P8CA 3BGAA 3WF0A 1AQ0A 3CZJA 4HBKA 4WSKA 4YTRA 3WQPA 3NM1A 1JCLA 4N4QA 2Z00A 3O05A 2F84A 4MKNA 1Q4WA 3MWAA 1CXIA 1HFBA 2HJPA 3ZOAA 2HISA 2Y62A 5LZLA 4MNMA 3WDQA 3M0IA 2O56A 2F9RA 2WZTA 1US3A 1VFHA 3M6DA 1ONEA 5CC6A 3MSGA 3VE9A 2G3IA 1GVIA 5D2VA 4W93A 5E6YA 3HPAA 3MUY1 5LA1A 3P8JA 3VAVA 2QDEA 3GG0A 3VIIA 4FR1A 1E9ZB 4O1DA 1FCVA 5I3DA 1UR3M 4B3ZA 1R5YA 3EDFA 3A6OA 2HTMA 5A95A 2G3FA 4E2OA 1JFXA 3POHA 1E5NA 1DWAM 2PDLA 1J0JA 4J4KA 1ZCOA 4TTUA 4EF8A 3T07A 4Q8UA 1UH4A 1S3TC 1QT1A 3RLGA 1JUKA 3E6EA 5D04C 3TNBA 4DBDA 2ZCGA 4E6MA 4PB4A 4HYRA 2TSYA 4DUVA 4AG0A 3V1PA 5DRCA 6A3HA 3VNIA 1AQMA 3DFSA 1Z9AA 2ABBA 4AYGA 5D03A 1W9PA 4PUWA 1H49A 1PHQA 3PN8A 4UFLA 1KR1A 1YQ2A 4CD5A 4CU6A 1NFBA 3CUFA 3IV3A 5CGTA 3EPNA 3P0XA 3MHGA 4JX6A 3ME3A 3QHMA 5AC7A 2BZNA 2GVGA 3CUXA 1H1ZA 4DAIA 2WO5A 3NOEA 1WZMA 1K4HA 2W63A 3ZWTA 1KXHA 3LXAA 2OSYA 2RJHA 3QMTA 3FVDA 1X7FA 3ZZ1A 1OF6A 1TPC1 4W5ZA 4H83A 3UGVA 3NQ6A 2J13A 3SM0A 1MW2A 3KHJA 3PJXA 2FZBA 4B9YA 1V7AA 4P8UA 3BXWA 1GK8A 4QROA 3SCPA 4JX4A 3GX9A 3OZOA 1Q85A 2IPFA 4PL2A 3NQ8A 4MDPA 1RSCA 2FTWA 3S4TA 2XH7A 3L12A 3SW6A 5FL0A 1L8NA 2PTDA 1UKSA 1TR9A 2OZTA 4OFCA 3WBAA 2QCNA 3ONCA 5FJOA 7ENLA 1YX1A 3UG8A 1FH7A 4UTWC 4WGHA 3LI0A 5HUPA 1JEZA 1KGWA 3IAQA 1EHNA 2ZIDA 2WZHA 1G7UA 1V6UA 2ALDA 3WQOA 2RH9A 3O15A 2Y8VA 5JU6A 3BLDA 3N4FA 3WBYA 4MY1A 5HULA 1ZBKA 3WLHA 3LZ5A 4OUIA 3EEZA 3VCCA 4I90A 5C55A 2P53A 1JNDA 3U4FA 3RIKA 2WOQA 3F4NA 2PDNA 5CG7A 2PC8A 2QHAA 1HP5A 2VEFA 2Z2AA 1SMDA 4Z2GA 3R43A 1VFLA 4PL1A 3MCOA 3LXBA 4JDYA 4O8RA 3GIPA 4IHCA 3UP8A 1PHWA 3UU0A 1GVSA 1D3GA 3KVJA 1W1PA 4NUWA 2OX4A 1OC5A 4CGTA 2XIQA 3ZVHA 4F2TA 2YA2A 1G4TA 4OZOA 2WVVB 2NZLA 3HURA 4XO7A 4G7FA 1BWVA 2D69A 2C18A 4WJXA 1QWGA 3RM9A 3AZTA 3CEUA 2IXVA 1XFCA 3WUGA 5HMEA 2YR1A 1KNWA 3AIUA 4JNYA 5C54A 4PRRA 4Z1CA 4Q8OA 3BLKA 5AYYA 1FXQA 4GYPC 3EXTA 4PUEA 2WJEA 2EEXA 4KIEA 3RR4A 2OZ8A 3V5FA 4H8NA 2D3NA 3BL3A 4A29A 2CLIA 4H8UA 4HCLA 1OYCA 3RO6A 7TAAA 3ES8A 4Z2JA 1EA9C 3KRBA 1LOQA 4P7RA 3EMCA 4YYCA 4O12A 1QMLA 3KBNA 4NX5A 1TYGA 1PXGA 4W4QA 4RXFA 4F48A 1XCXA 1H09A 3H7RA 1WDWA 1NVMA 1YNYA 3IWPA 4Z08A 3G6LA 2WV8A 4ZQCA 3KVKA 3GAKA 3M1ZA 1NWRA 4A21A 4O4VA 2PZ0A 3LCIA 4LT9A 2VCAA 4Q4OA 1XGZA 5LGXA 4QG6A 3B3DA 2BGSA 2PC4A 2A21A 3NQGA 2GSEA 1VF8A 3QR0A 4TVDA 3CWOX 1I2OA 2PU1A 1TA3A 1BGAA 3TLLA 3GC2A 3LBMA 4Z17A 3PTKA 4REQA 3WNPA 3LRLA 5FKYA 1LRTA 1VENA 5FF4A 3RM8A 4DO4A 1Z42A 1WQ5A 2CLFA 4QE4A 3MUIA 3MI6A 2DW6A 3B0UX 3B9DA 1V3HA 1JCTA 3TV8A 5AYZA 2XFFA 1YDYA 1XYBA 4GACA 1UR0A 3V7PA 3WL0A 2D2JA 4IOTA 1AODA 1CPUA 2ANUA 5FIPA 3ECQA 2R94A 1A5BA 4Z2KA 2D0HA 4NJKA 1W1TA 2PMQA 2UY4A 1QCWA 4O14A 2Q3OA 4LS2A 1UMLA 4Z1AA 4S1FA 2NV9A 4O28A 2W79A 1SJAA 2REQB 1LM1A 1CYGA 3WQDA 2CC0A 4P7NA 2YCJA 3IV8A 3QLDA 4UTFA 4MM1A 1OHLA 4XISA 1Q6FA 2Z4GA 3GDKA 3FKKA 4XV0A 4MZYA 4QRNA 3QH2A 2C19A 4HPNA 1M7OA 3I10A 1TPDA 2DP3A 1RCXB 1QDSA 2V3EA 4DHGA 4X0VA 3ZR5A 2YCIX 5EY5A 4HN8A 3I7QA 2J6XA 3M0HA 4YNGA 2WC3A 1E1CA 1YXYA 1YLVA 2NQ5A 4ZL1A 4C90A 3WQGA 2ON3A 2BHZA 2CBIA 2E3ZA 1XLFA 4LVAA 2HK1A 3U0HA 1KGUA 2JKEA 1HNYA 3UJFA 1W1IE 1XF0A 3FCPA 3BV4A 1UUQA 2PLJA 2XSBA 4WIWA 6XIAA 2V2HA 2DY3A 2ZUSA 1KO0A 1OF8A 1HJUA 1V6XA 3W1UA 1IT8A 1K8XA 1OSEA 2ZE3A 2Y61A 3BICA 3GBDA 2OWWA 1L0PA 5FEPA 5M17A 3EA2A 3JU2A 1H3GA 1F73A 3ONBA 3HA1A 4NI8A 1EDTA 3TW7A 1L6SA 4A8NA 3B0PA 4KEVA 4NYUA 4D1IA 2J8FA 1F4AA 1PBGA 1I75A 2ZZ4A 4UFJA 5LNWA 4GA8A 3WQWA 4PSPA 1EX1A 2CNCA 4ECLA 4M56A 3S2CA 4DZIA 3O0KA 4U4MA 3LCHA 2V5CA 5F2IA 4G56A 4H6RA 4YLWA 3UF9A 1E9IA 5BWFA 4D6EA 1VBRA 2VUNA 1IEIA 2WNWA 4M80A 4M51A 4HHPA 1FH9A 2GDUA 3OB8A 2IPWA 2XJ7A 1KD0A 1LUCB 2Y89A 2NW0A 1UPPA 2PLCA 3QOMA 1N8IA 5C6MA 3AZSA 3UG3A 4QEHA 3B05A 5I07A 3NPWA 4BWLC 1W3KA 3AHXA 3NXFA 3GDTA 3GO2A 4D6CA 4ICCX 5AYBA 3B9OA 3CTLA 1NWTA 1XYAA 4JIHA 2DZBA 4J2PA 1W5PA 4FF7A 1SU5A 1VRXA 3EPOA 4HMNA 3E49A 4R7JA 3RX3A 3EXRA 2ZICA 4JIQA 1J6OA 3C2YA 1FWHC 1YBQB 3SY5A 1KXTA 1QOPA 1XLKA 3K8MA 2Z7KA 4DIAA 1HW6A 1EOMA 2NWSA 5TAOA 1K6AA 3SRHA 5C9WA 4I7UA 1TPH1 3A3WA 4FALA 4R5EA 1XV8A 1JCJA 3RAOA 3D47A 1I1WA 4FOUA 2CCRA 5HANA 3CUJA 2PDYA 1NF0A 2WMHA 1OYAA 1S5NA 5C71A 3UZWA 3KOZA 1W3JA 4B5WA 2BHUA 4K7VA 2QF7A 3W7KA 4Z2HA 3M07A 3B06A 4GNKB 1UW9A 5M1TA 1KM5A 4QSFA 5E0KA 1X38A 3FEMA 1LQ2A 2QCMA 1VYSX 3RN6A 3W1XA 2BVTA 1GJPA 4H2HA 1JPDX 3UJRA 2QAPA 2G37A 2G3JA 5HBFA 2QS8A 1CXLA 4Q8QA 5D33A 2J78A 1BF2A 3JS3A 3PG9A 3O63A 3KBWA 4UOJA 2PCEA 3H7UA 3ZT6A 3PY2A 2RGMA 3PK7A 4AZ6A 4Z1DA 4GQRA 1R3VA 5AVHA 1J12A 4HMEA 1Q66A 3C52A 3TYUA 2NQHA 3AXKA 2Z25A 2EJAA 4PCPA 4GUHA 5DN1A 3L0NA 3HGJA 4J28A 3TKFA 1RCOB 1TJ1A 2X0HA 4OE7A 3ZQ9A 4MAVA 4GGBA 4M5PA 1U2YA 3FYPA 4WKAA 1XH2A 4UUIA 4WJ8A 5CJ5A 1A5NC 5AOUA 1H5VA 1G1YA 3M44A 4U3AA 4PBGA 5CH9A 3LTYA 2TPSA 1UKQA 4O1FA 3GH7A 4A2SA 3WDHA 1VCVA 4UQDA 1NELA 1W8GA 5F1UA 3C2VA 3MV01 3VABA 1KCLA 4DJEA 5BW6A 1WOAA 1ZU8A 2OR2A 4J3UA 1MXGA 2PP1A 3H2FA 3UT0A 3D3AA 2J79A 1DQWA 1SZGA 5CEWA 2QF8A 3LHUA 3GQYA 2R1NA 3BCFA 4RE4A 2NV1A 2YFNA 1MWOA 4J3WA 4RXGA 7CGTA 4N4PA 1HO4A 2QULA 2XTKA 1YIXA 3PBMA 4GY7A 4YMZA 5H2ZA 3BMXA 4IQLA 3U2EA 3S1XA 3SCUA 3ZR6A 1G5AA 1IEVA 3VC5A 3PUDA 2R1KA 3GZAA 4Q4QA 3FK4A 3PZIA 1VYRA 2GWGA 3T81A 1K4GA 4NXSA 3NO5A 4E8DA 3FA4A 4A35A 2X0YA 2Y7EA 1IZKA 3S47A 4FXFA 1FKWA 2QVHA 1XRSA 3S3GA 2XIBA 1Q3NA 1N82A 5DCEA 3WD2A 2JEQA 1MZHA 3S2MA 1GTEA 1KRAC 2XHYA 4QNWA 4NZCA 1WX0A 3V3WA 4O0KA 1HJVA 4PCFA 2Y1HA 3W38A 1S5WA 2OEJA 4JCLA 4AC7C 1VFSA 4Y8EA 1FRBA 1EYWA 1PDZA 4AWUA 1R85A 1LWIA 1V02E 2E4TA 5HA7A 4CEXC 2ZXBA 4DEFA 3KBSA 4GZIA 4N9BA 3TTQA 3ID7A 4OOUA 4GCAA 5CAHA 4HA1A 1W6TA 4OIFA 3I7RA 4Q4SA 1TIWA 4HTYA 4WGXA 4V33A 3W0KA 1V02A 1A53A 3E02A 3SN4A 2VGBA 3RX4A 2J74A 5EMUA 3CHVA 3WLMA 1E6QM 1SUXA 4IXXA 2IQ0A 4RX0A 3H54A 1SVDA 1FWJC 3W6MA 3HF3A 3V0TA 4UOQA 3STEA 4GG9A 2QJJA 2EPOA 3BLOA 3TU9A 1V6YA 1D8WA 3KFTA 4OHQA 4CD6A 4D9PA 2OO6A 4C1KA 1ZP3A 3CMJA 1UIOA 3UBPC 1W2VA 1XUUA 5MKGA 1T40A 1A47A 2AKZA 3SDOA 4NRRA 4R53A 3W23A 1ME8A 1Z7AA 1B3OA 2ZA1A 5XINA 7REQB 5CAKA 1CB2A 1U1JA 1Z69A 5HQEA 4IGMA 3VX0A 3H26A 4IH3A 1IR1A 1DKWA 1YRRA 5U7SA 1LF1A 1L2QA 2J66A 3B8WA 4AZHA 1Q5MA 3R10A 1L6YA 4G7EA 1XH0A 3UZYA 4UQAA 4RZBA 4IQEA 4LPCA 1OABA 3W7LA 2NWRA 3WN6A 3NFUA 3PPFA 3PNZA 2GYIA 1TV7A 5I23A 4UB9A 4HNNA 3AMLA 3N9KA 1S5TA 3BW4A 2DEPA 3IGUA 1XYFA 4FAMA 1VR6A 4ZQMA 2E7FA 3W22A 3NQVA 3NQ7A 4GINA 1ADSA 4ES4A 2GQ9A 4JTEA 5CBIA 2NUXA 4UR8A 2WSYA 4HNCA 1XX1A 1XYCA 5KINA 4MWAA 4EPBC 4CVUA 3K4WA 1RBOB 3P67A 1XLDA 2AL2B 4I6VA 1F61A 4JQ3A 3H23A 2DJLA 3WKZA 1WDDA 3LSCA 2PF8A 1US2A 3BW3A 3BSGA 5LIXX 4M6UA 3S1WA 5K7JA 5CG0A 4DBWA 4YJ5A 2V2CA 4S3JA 4YIWA 1QO5A 2DVTA 3R89A 3MMTA 2DH2A 2QMJA 1LOSA 4W89A 7PTDA 3OBAA 3IANA 1JQVA 1UROA 1X6UA 2ISDA 4DVOA 2ZRUA 1S2TA 4MUZA 4MJZA 2EG6A 3QR1A 4HCDA 1QPNA 1J93A 4ZOAA 3FNDA 2BX7A 4KCUA 5FJIA 1J96A 4DYEA 3D46A 4AF0B 2V8ZA 3MUZ1 5D9OA 4GC3A 4JNZA 2J88A 3MYPA 3MVIA 4AEOA 1JUBA 2J9YA 4YPJA 4GOAA 1S3HA 1A3XA 4JZ5A 3E2RA 3ARTA 3ZS4A 1CZ1A 3GDLA 5A2AA 1RV8A 2VFDA 4E4UA 5AHLA 3PJWA 1NDYA 3KL0A 4S3CA 5IHSA 3CU2A 1I0BA 3PFRA 1I2NA 3WLQA 2IW0A 2XIOA 3MTWA 4HP5A 4JHZA 1M04A 5CSYA 2QEZA 1BQCA 3RGTA 4RZ5A 1WKYA 3NM3A 4YXGA 1MUMA 4AY7A 4ZCWA 1TE1A 1XLLA 4ACZA 6XIMA 3VNMA 4W5UA 2A3CA 3E12A 3TQ0A 4F0HA 3WNMA 3CZ8A 2VVSA 3BANA 5BU6A 1ISZA 3KE0A 2TAAA 1JZ3A 4QDMA 4NP7A 4WD0A 2INZA 3W86A 4HYVA 4XZ9A 1KCXA 2HNEA 3HV9A 1TA3B 2UY3A 3MSRA 3PHAA 1XRVA 4REQB 4DBEA 4HK7A 4OKDA 1NFGA 1YDNA 1V3MA 2P0OA 2Z1SA 1AMYA 5CPQA 4DM1A 3DHFA 3W7EA 1QPRA 2CEQA 1FCQA 3ARYA 4IIHA 4JHMA 3IGSA 1NP0A 3L7RA 3LNPA 2F2HA 3QGVA 3H53A 3KP1A 1IZCA 2D2GA 3T8QA 1B9BA 4U5IA 2IUZA 1L9WA 2ISFA 4IP5A 3LPGA 3GVGA 4TOQA 4NJIA 1LJYA 3PBGA 4YWSA 1NJJA 4LWWA 3OJGA 4Y8FA 2W0UA 3WK3A 4JTKA 4HZ8A 3QZ6A 1RA5A 2VR5A 5JH1A 3E0VA 3CHEA 2D20A 1AL8A 4AD0A 5BOEA 1IF2A 4H9XA 2ZX9A 4XZMX 1XBYA 5XIAA 3VIGA 5CJNA 1F8IA 1FWAC 3BLFA 1NTHA 1Q65A 1FDZA 4HN4A 1QHZA 2CITA 3A5FA 4CVWA 2BOFX 5AC6A 5BZAA 3SY8A 4BQ2A 2D73A 2B0MA 4HOWA 2OWXA 1JL8A 1MNZA 3EDJA 1ZJBA 2OLAA 5HQLA 4DYKA 4IQDA 3KCOA 1HVXA 3UCDA 3TJLA 4JTFA 4X9YA 3MBDA 4LB4A 2D0GA 5A94A 2Z28A 2ZZ3A 2ZZ7A 3TC7A 3QW3A 1T6MA 2JF6A 1K03A 3EOOA 4FSAA 3WJYA 3W1TA 5CZTA 1WOBA 4AU0A 4E3VA 5D02A 4N0RA 3LLDA 3C0QA 3OP2A 2FPYA 3NSNA 1F9CA 4EAMA 1VH7A 4J7RA 4LCSA 2DZPA 4PFMA 1NWUA 3TYBA 3UXAA 3L4VA 1M53A 4L80A 4S3DA 4HU0A 1EF2A 3JRKA 4PMNA 2BXVA 3DEQA 4UTHA 1MEIA 1XI3A 4ZA0A 2GUYA 1EUAA 3KS5A 4IGHA 4FOKA 1CGXA 2YXOA 5HJYA 4F0LA 3AUJA 5JQ9A 1V3LA 3BAKA 1JDAA 1DJZA 3MS8A 3MV11 4HZ6A 4WCJA 4BA0A 2V2DA 5C7VA 1X1OA 3GXTA 1KTBA 3POCA 2FZDA 3TSMA 3FA5A 4ZOBA 3UR5A 2OVLA 1UZ4A 1OYBA 3HG3A 3SN1A 2QLYA 3L2MA 4AZIA 5BRQA 3TYZA 3MP3A 1E6XM 4F0MA 4IMGA 3M16A 4JTDA 3NGFA 3IIOA 3T1GA 4C65A 3HG2A 4E0CA 1QK0A 3P61A 2BVYA 4HMDA 3FN9A 6REQA 2VFFA 3SGGA 3WFLA 4JIRA 5HNUA 3RMJA 3XISA 3ZWSA 2NQJA 1BLIA 1U5VA 2V5KA 3M7SA 1VPXA 2PDXA 3NYZA 1RPKA 3CIXA 3ARXA 4GABA 6PTDA 3UPMA 2IKIA 1PL9A 1S2AA 5A8NA 3MI2A 1DJWA 3LPPA 5FF2A 1AFSA 1J18A 4F9DA 4P2VA 1ZFJA 5LNSA 4UNIA 2VCBA 2GDVA 3PBVA 3M5YA 1A5OC 3O8AA 3IK2A 4UTIA 4CUCA 3QF0A 1PSCA 2OO0A 2XFWA 1X39A 7XIMA 2ZA2A 4ZQPA 3W3OA 1NWSA 2NVCA 3L66A 4ZO6A 3FFSA 1XIDA 1O95A 3B9NA 4HHHA 5FEWA 3T7VA 1UQYA 3P5YA 4R34A 3SR7A 4F2BA 5EBAA 4DNMA 2CIPA 3I65A 3H6OA 2AAAA 1UWUA 1IEWA 4L6HA 4B3KA 1A5SA 4H01A 5D9NA 3UWQA 2I9UA 4HNOA 3TZNA 1IEQA 4FK9A 3R79A 1B30A 4EKJA 4LU0A 4AX7A 4CQAA 1YXCA 3G8RA 3ARPA 1SO5A 2G96A 5EMKA 4UMCA 2DIEA 1F74A 3ERPA 1LRNA 3UGRA 2WPGA 3DG7A 4LJ3A 2A3AA 3CXOA 4Q8VA 4HK5A 1SMAA 4FLSA 3FX4A 4A3QA 2OJPA 2FIQA 1ICSA 5HJXA 2PTXA 1FCBA 3FJ6A 1G6CA 2CLLA 4G1KA 5DBTA 4GVFA 1O5QA 1E43A 2I5GA 3OGSA 1K7EA 5ABHA 1UC5A 1SGJA 4NZ4A 2XIJA 5DXYA 3VKCA 1A5CA 1LLZA 2QJNA 3ZXWA 4L5ZA 2XZ9A 1MW1A 3RITA 1TQXA 1ZCCA 3LTSA 4C6OA 1UIPA 5I79A 1UWTA 2J62A 3RCNA 3NG3A 1TWZA 2OFJA 3QOKA 1DV7A 3QY7A 1NOWA 4I7VA 2C3ZA 1SFJA 1ISVA 5GNZA 2B81A 4S3EA 4XD5A 3N2MA 3FHAA 2PD5A 1WDQA 1A4LA 3IUIA 5EGRA 2QT3A 2WNNA 5TIMA 1A5UA 4UTKA 3RPDA 2I14A 5H8PA 3CTTA 4I8YA 4JYEA 3VOCA 4JQ1A 2PE4A 3VU2A 4Z0SA 4OGZA 1YHTA 3L5LA 1DJNA 3M0KA 4UIOA 3H22A 1T41A 3WD3A 2VUYA 3MHUA 1E1FA 3PTMA 2V30A 4QR6A 4DY1A 3M64A 3RPTA 2DVXA 3WQFA 3ALFA 1GQNA 3TP4A 4H1ZA 1YPFA 1KV5A 3GSMA 4PMDA 2GGHA 1JDDA 2GVJA 2E6YA 1AH3A 4U2ZA 3CO8A 3UY7A 1W0MA 3VVGA 4GFIA 4AD1A 3E3HA 5FJTA 4AVOA 4NZJA 2PI6A 2V5JA 4QSHA 1UBSA 4PMRA 3H4GA 3FJLA 2ZC1A 4R33A 2QUVA 2IKHA 1E6RA 2E77A 1WBJA 2J6VA 4JTRA 5LIYX 1HKJA 3ORWA 3KZPA 4P8XA 1XWYA 3BW2A 3A24A 1XQLA 3VNLA 4RZ6A 2YFOA 1GCYA 1BKSA 4F3HA 2VT0A 4NAFA 1M41A 3IK4A 5JVLA 2CLOA 5KZMA 1W32A 1R3YA 2DZAA 1EFZA 1JCMP 3VNDA 1EWDA 2V6AA 4ICNA 3TTSA 3CS2A 1DWIM 1GWJA 3WMCA 4H4IA 3SGZA 4D8AA 3UR2A 3QQWA 3EAUA 4TO8A 2ZWZA 4JY8A 2A6NA 1WYIA 2D22A 5JMUA 2Y24A 3LK6A 2OTDA 4ATWA 3BAJA 1EF3A 5FF0A 4BR1A 4GO9A 1V5XA 1QASA 2EAWA 3HQOA 4W7VA 5FF3A 4PRWA 1BAGA 5EBUA 3RPMA 4CN1A 1YEYA 2VEKA 1NP2A 1J0ZA 4PUKA 5K4ZA 5ENLA 3UEQA 3W1MA 3UPWA 2RUSA 4X9SA 1LT7A 5K2ZA 4D72A 5MKGB 4HTBA 3RU6A 4CCCA 4MLJA 5LSMA 1C90A 2E1DA 3KLLA 4IMEA 4BJHA 1UWIA 2OU4A 2CPUA 4YVPA 3OG2A 5A1AA 2OSWA 1PYMA 4KFNA 1R38A 3DGRA 3OYZA 1Z44A 4GHRA 2JKAA 3O2LA 4G7EB 3VIHA 4L61A 2ZZ2A 1YTEA 3CL6A 1UB3A 5DMMA 3WDJA 4J2MA 3I4EA 3GS6A 4DAFA 1EEXA 4Q6XA 4C1NB 1H61A 4NKCA 1EZ2A 4WVXA 2FGZA 4W88A 4LUIA 1JPMA 2CHRA 1Q13A 3DERA 2DZWA 5KZ6A 3FGCA 2YCKX 1H51A 3QV7A 4MZ8A 2PU0A 3NQCA 3VKJA 4G6CA 1WDSA 4NZ3A 1XDMA 1H0IA 4OV9A 2QCDB 3VZZA 3E5BA 1EH9A 2L5HA 4A8LA 3MI3A 1AJ2A 1X1ZA 3LS9A 1OWQA 3W87A 3QBUA 4MWAB 3F1QA 3PWGA 4AD4A 4RV3A 4AC1X 1CX9A 1TO3A 4FIQA 4PBFA 3MPGA 4R88A 1EDQA 1ZGDA 2EKCA 4KT2A 3PP7A 1QFEA 2EPMX 3CHFA 1Z48A 3STCA 3BGGA 4RLIA 4UFHA 1GUVA 4XQ6A 3D3FA 4LS1A 3ES7A 3Q94A 5BXPA 4GX8A 3WFZA 4H9UA 1JULA 4XZHA 3UJEA 4CQ9A 4KQNA 1Q6LA 3OGVA 4GJJA 2PF0A 1I4NA 2HXTA 3WH6A 1GVEA 1W9BM 5ABFA 3TA9A 2GUBA 1IR2A 4FMVA 1PS9A 1KWKA 1QNQA 3FSUA 3BDKA 1QNOA 3PSVA 3IJLA 1G94A 4QQ3A 3T0BA 2VYOA 3FS2A 2Q6ZA 1PKMA 2WMGA 4EWND 5D8ZA 4JN6A 4HNLA 1HGYA 1QI4A 1QI3A 4UTTC 2ATSA 1GG0A 3TLQA 4EACA 3DBPA 4PZVA 2Y8UA 3H2AA 2WHJA 1PTDA 4NJGA 4ROQA 3QV6A