3M44A

Crystal structure of the mutant v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
207
Chain Sequence
b'RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPTLRFADAIIAGRSIYLADNPAAAAAGIIESI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 76
structure length 207
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m44A00
3QPYA 2YPIA 3CU2A 3LDVA 4WOZA 4Z1AA 1RZMA 5KINA 3BV4A 4BI6A 1TMHA 3GR8A 1M5WA 2ABBA 4H4IA 3A5VA 3RLUA 2ATMA 3YPIA 1JRBA 3M43A 3KX6A 4IXXA 4JNMA 1UCWA 2DZSA 3PUDA 3KOFA 4M7TA 5BRBA 3LCWA 4Y9AA 3FKKA 5LNSA 1TRIA 1H7PA 4MJZA 1NSJA 4G1KA 1LLWA 4RK8A 5CKSA 4AWSA 4QJ1A 5K3VA 1RQHA 2V5BA 3CWNA 1QWGA 3PY2A 4JX5A 4UNLA 3L2IA 1FCVA 5CZTA 4UR8A 1GZGA 3NQ6A 2H3BA 4NU7A 3EWWA 1K8ZA 1TPFA 1EWDA 2VFHA 1JCXA 2E5BA 3G1HA 1ZAJA 3FEMA 4HPJA 4XBKA 2V0TA 4AHQA 2Y70A 2BLEA 1RQBA 2Y7DA 3WJYA 3FYPA 4AB4A 3PSVA 1JCMP 4DO5A 2EKCA 3DFOA 2AQWA 4IMCA 2JGYA 1SQ7A 2DZUA 3I7RA 3S42A 4MYAA 3ATYA 3W23A 5D02A 3DI1A 3C8FA 3MP3A 4PC8A 4WXZA 3LBMA 4XWUA 2VKZG 3AJXA 1GYLA 6TIMA 5D2XA 3HGOA 5F4SA 4UFKA 3IVTA 3E49A 3A22A 4WX2A 3HGSA 3C2EA 1W5OA 1S5WA 5LNUA 3RNDA 2ZA1A 3Q94A 3A24A 4WY0B 3BW2A 1CI1A 4XUGA 4QNWA 5AN7A 2QKFA 4BR1A 4WZHA 4IUOA 1TJPA 3LTSA 3LV5A 5G2HA 1JQVA 5J5DA 2Y7FA 3TQ0A 2Z1BA 4O1DA 4A22A 3WK2A 1GPWA 3T78A 3ELFA 4O4VA 3KRSA 2ISWA 3N19B 4LRSA 3OVPA 1XUUA 3NO5A 1OFOA 5FF0A 3EX4A 4OQVA 3HOJA 1DVJA 1K3UA 2TYSA 2Y6ZA 4S2BA 3LOTA 3PBUA 3ZWSA 3LCGA 3DFSA 1K8YA 1VYPX 3QRHA 3O6YX 1ZY9A 4CCDA 3HGRA 3CC1A 3B04A 3NL3A 4FNRA 2C6QA 4X9SA 3W84A 1LBLA 1FWTA 4MKNA 2WOQA 3IGXA 3P5ZA 1NVMA 2NV2A 3NQGA 3FYOA 4PL2A 4ZQNA 4HIBA 2NXGA 1ZCOA 3QM3A 3TQKA 3UZ5A 4UFIA 3LRMA 4ZMGA 4O17A 3G18A 4LT9A 5HUOA 5D04C 3G3MA 1VRDA 3W74A 5CPNA 2A6NA 3G1FA 4NX5A 2VEIA 3W22A 1W5NA 3NR0A 5LNVA 3USBA 1H61A 2YSWA 4AF0A 5K2ZA 1GVSA 2ZBTA 3UD6A 3QSTA 3O05A 4O4WA 1K03A 2V2CA 3FS2A 1JUEA 3TMLA 3W3OA 3PULA 1EUNA 4DO4A 4WD0A 4MPQA 3IIOA 4LV9A 2E1DA 5CGQA 3T44A 5EMUA 3HG4A 3A9IA 3C0JA 3W72A 1TPVA 2HMCA 4EVZA 1QPOA 1DQWA 2YGYA 1SUXA 1H62A 1JULA 5L6UA 1G4EA 1KTNA 4KFPA 4JX6A 4JY8A 3W88A 1A53A 1I2RA 2ZZ3A 1X1ZA 1OF8A 1SW7A 3L68A 4OHQA 4LUJA 4O52A 3W7MA 3NPVA 4JTFA 2WPBA 3G1DA 3M47A 5AHFA 4K38A 4CQ9A 5C54A 4L4LA 4GNJA 2DJLA 4ZVJA 2J9ZA 4NJGA 5IM51 2QCEA 4K8HA 4FNQA 1BWLA 4FO4A 5A5WA 4NQ1A 3GZ3A 4LV4A 1H50A 3PM6A 2OX1A 2NX3A 3L66A 2J88A 4BK9A 3PUEA 4JYDA 1GQNA 3HPXA 3H53A 1KM5A 5AYZA 1JVNA 4NUWA 2A7PA 3QMSA 1DOSA 3ABOA 1F6KA 2TRSA 2ZRZA 1F2JA 4OU1A 1OX5A 2WNZA 8TIMA 1OFDA 3G3DA 4K6AA 5HINA 3RF9A 1NFBA 4XQ6A 2WO5A 3CIWA 1Q45A 3NQMA 1A5CA 3DKJA 2CLKA 4IX2A 1WAUA 1VYSX 4DQWA 4PFMA 2V5LA 1VGAA 1UB3A 2ISVA 1KFJA 3Q2DA 4UTWC 4EOUA 3TE9A 3IGSA 4JY9A 1Z48A 2XFWA 5EYWA 3STFA 2I1OA 3SECA 1KM4A 4MLRA 3PB2A 3B8DA 3BLIA 3N3MA 3PSWA 1G4PA 1VHNA 3BGGA 3TCEA 4RZ5A 3S1VA 3WJXA 2Q3OA 1Z44A 2O7QA 2JBMA 3R12A 3S5YA 1O4UA 2ZA3A 4JD4A 1UJPA 4UMAA 5KZDA 1SW3A 3PAJA 3UY7A 2VEMA 3QJAA 5AC6A 4WY0A 1M7PA 3L9CA 2QCMA 3W7QA 1TTQA 3HG2A 3K30A 4Z08A 1WYIA 2GVLA 3SGUA 2WSQA 3U8GA 5G1YA 3LHYA 4MYXA 1UASA 1OABA 5G4EA 3NQ2A 5U7SA 3KVMA 3NQDA 4Y96A 2FLIA 4UTLA 1K7EA 3N2MA 2HS6A 3G1XA 4K7VA 3UWVA 3VE7A 2PCQA 2YYUA 2CLOA 3S1XA 3PWAA 3NPXA 3B4UA 1GVRA 4LS0A 2BWGA 2JGQA 2QAPA 4YMZA 1TQJA 4FEZA 4YWIA 3S6DA 4WY0F 3TROA 3NA8A 2JK2A 3U6WA 3VCRA 4ZZ9A 4TU1A 2NWSA 3P8IA 4UMBA 3KVLA 3CTLA 4NNAA 4MZ8A 2QCLA 3UXAA 1W3IA 1WXJA 4UFHA 3S5ZA 4LU0A 3L0KA 2V30A 3DBPA 3W83A 1L9WA 4NZFA 3ABQA 5EKYA 3E0IA 3KFTA 2VFIA 1FBAA 1V5XA 2XN1A 3P5YA 5KZMA 3GYEA 1X7FA 1GWJA 3LCFA 3W1MA 1GVFA 3O06A 1H63A 4UNKA 2WJZA 3MWAA 4OV9A 1TV8A 3LV6A 4JTEA 3OVQA 2QUUA 3IRDA 3W2MA 2NXIA 5FF7A 5SWUA 3DAQA 2A4AA 1FDJA 4RV8A 1DJQA 2ZRVA 3SIZA 4HHPA 1OX4B 5AFDA 4RKAA 1EIXA 2WQPA 1R47A 3N9RA 1QPNA 3BVJA 3GXNA 5K4XA 4Z0SA 3W7EA 4NVTA 4JXCA 1NF7A 1EUAA 2AAMA 1KM1A 3W70A 2F84A 4O12A 1TPDA 5K4ZA 5BNKA 2RDTA 3RMJA 3GDMA 3NNTA 2CW6A 3GKFA 5FEXA 1FWSA 3NQCA 3QW4B 4H6KA 5AHMA 4YLWA 1B3OA 1O94A 4JICA 1P4CA 2RKXA 3P82A 1R46A 1ZAIA 3Q58A 4MZYA 2CZFA 1XC4A 4TMCA 1IXOA 1ML1A 3W1NA 4I7UA 4R7JA 5HJLA 1KTCA 4M6PA 3VNDA 1RD5A 1ME8A 2WV8A 1M6JA 3NAVA 1JCJA 4LVAA 5I3JA 3UY8A 3LBCA 3C4UA 2FIQA 4JN6A 5D33A 1CW2A 1DQXA 4ADTA 4DPQA 3ABRA 2RDUA 1SO3A 2DORA 3M5VA 3CIXA 2CLIA 1TPC1 1H7XA 3MI2A 2H3DA 2NUWA 4E2DA 4Y6GA 1ZFJA 4GE8A 2X16A 4UTHA 4XTDA 4N9BA 2C16A 3QSRA 2OJPA 1Z42A 2B7QA 3T40A 3G22A 1L6WA 2G96A 2V9DA 1Z41A 2NLIA 3R13A 1LM1A 2RDWA 2TMDA 5C55A 2YYTA 5EY5A 3U2OA 3S1UA 3OG3A 5DXXA 3FJ6A 3UWUA 1O5KA 3HG3A 2FFCA 1RR2A 2E5DA 4AVFA 2WNQA 1SZEA 5MHBA 1B57A 1W3TA 1G69A 3P7YA 4YCPA 4MVAA 1XL9A 3MHUA 4FNUA 2E09A 3R2GA 5DLCA 3L5LA 1BKSA 1TREA 2GVGA 2E68A 2V81A 2VELA 4QNEA 5I3GA 4JIPA 1PHQA 3T7VA 2A85A 3TX9A 2ZQ0A 2ZZ7A 2D73A 3BLFA 4CNPA 1SO6A 4AEOA 2C13A 3BG3A 1A50A 1OF6A 3E9AA 4RZ4A 2QCGA 3NGJA 2GJLA 3QFEA 1J2WA 2Q8ZA 4DPPA 1QFEA 1AW1A 4ZQCA 1ZHAA 4K39A 1P5BA 1W3NA 4GRSA 2XN2A 1HG3A 1TJRA 5LHEA 3C2RA 5F2MA 5F2IA 4QQ3A 1MZHA 5DXYA 1OFAA 1TPH1 1JUKA 3HIJA 3NQEA 5HWJA 1PIIA 1WA3A 3INPA 3FIGA 3CPRA 1MO0A 4GBUA 4Q32A 3HQ1A 5K9XA 5LNRA 3TIMA 5D03A 4FXRA 1XBXA 1DJNA 5F4XA 1R30A 4C1LA 1EB3A 3W1QA 1XBYA 4ADSA 1I2PA 1XBVA 2ZFAA 2P0OA 3CT7A 4CLMA 3KRUA 3L67A 2C3ZA 3TUUA 3WJSA 3W7HA 3NEVA 4O11A 4Y8FA 2GOUA 4O15A 5D32A 4BFAA 1C9DA 2E77A 1EWEA 5D2TA 1BWKA 4OE7A 3DGRA 4PEKA 1XDMA 3CQ0A 4GWEA 1I8JA 4MY8A 1YDVA 5CPMA 3L21A 2EF9A 3EB2A 1OX4A 4ZQRA 1ONRA 4KKXA 1BTMA 3PR2A 2ZRXA 4B5NA 4J9JA 1KFEA 2FPTA 1OHLA 2J9YA 4WOQA 4P2VA 5F1VA 4PODA 2P10A 3PS7A 1ALDA 5AC7A 5KTLA 1KFBA 3LRKA 2QCCA 4GUIA 2Z0IA 3FA5A 3TNOA 3WFAA 2GVJA 2VC6A 5AHEA 5EL1A 2TSYA 3L5MA 1AK5A 4FB7A 4K7YA 3GDKA 4N9EA 3TSBA 2ZDRA 4AAJA 4XZ9A 3O6CA 3MBFA 5CZ0A 2DZPA 4N9DA 1HO1A 5TIMA 5F2LA 2TPSA 1TTPA 3NQVA 5FI8A 1IXPA 3I68A 1F74A 2DZWA 2FPYA 4CNNA 4O18A 5FEWA 2W79A 2V82A 1I2OA 1TPWA 3P74A 5TQLA 3PVFA 1EP3A 3G24A 4MZ1A 3W1TA 2YFOA 4NJHA 1OJXA 1YLVA 3EWXA 1T0OA 4UUIA 2WSRA 2QDGA 1VCVA 4XBSA 4Z1BA 4N9CA 5K9CA 4S1FA 1JRCA 3H54A 1ME7A 4AHPA 1JR1A 4C1KA 2GJNA 2RFGA 1X6UA 4EIVA 3KVJA 1I2QA 2ZZ4A 4ONVA 3W9ZA 3C61A 3V1PA 1SU5A 1JCNA 4N4QA 1I45A 3CEPA 3L0GA 4M6VA 1YYAA 1TO3A 3MYOA 3STGA 5DN1A 1K7FA 1EA0A 4UTUA 1G67A 4NNCA 3W75A 1EX5A 1LRQA 4EWND 3ZS4A 3M44A 3WK1A 5F2GA 1F05A 5D2WA 2DZXA 1VLWA 4WQ6A 4FIRA 2CU0A 5HQEA 3DFNA 5I3FA 4OT7A 4TO8A 3WJZA 1D3HA 4JTKA 4YCOA 3DFQA 3E12A 1O5XA 5A8GA 4MY1A 1X1OA 1XUZA 3UYCA 2AGKA 2B7OA 3EXSA 4O10A 3L0NA 1W1ZA 4YL2A 1T99A 4TMBA 1MEWA 3VE9A 1FY6A 1N8FA 3M1ZA 3LXBA 4R34A 4N4PA 3SSJA 4O28A 3DH7A 4HNNA 4CCEA 4UMCA 2PRHA 4MFDA 1ZJIA 3FLUA 4O16A 1WBJA 3LLFA 1AW5A 4M6QA 3HG5A 3PF3A 1H60A 3SGZA 4GXMA 2ZZ2A 3M9YA 4IMGA 1YTKA 3TA6A 4W9TA 4PL1A 1H7OA 2DZVA 5D2YA 2B7PA 4JDBA 2C18A 4A2RA 3NQ7A 4UTWA 1QOPA 3W7IA 2PRMA 3W76A 2X2GA 5G1TA 2R91A 2J6XA 1KV8A 3PUOA 4M5PA 1TB3A 1YPFA 1CX9A 1OX6A 3DU0A 1OFEA 4O0KA 2G97A 3W85A 1LOSA 2YFNA 1C8VA 3A5FA 3W2KA 3C3NA 2ZA2A 1ZENA 2CLMA 1LRTA 3W7PA 1G4SA 3S0CA 2VOMA 1GVOA 4FX6M 5I3HA 1KTBA 3PC0A 2B0MA 4ORIA 4O53A 2NXHA 1RPXA 3G1YA 3Q37A 2NX1A 3O16A 1PCWA 4AMAA 3UWWA 1YTDA 5K9DA 3P8JA 3LHWA 4I9AA 3TFCA 4P61A 2ZYFA 2NWRA 3EX1A 5L9FA 4HT3A 1G6CA 4IMEA 5FEZA 1XDLA 2C14A 2FTPA 1QPQA 2NUYA 3TKFA 4Z0JA 4GUJA 4JTGA 2NUXA 4IX0A 1L2UA 1XBZA 5AYXA 3NZRA 4UFLA 3QYQA 3RLVA 1DKWA 3SZ8A 3MBDA 5LNWA 3FJLA 2X1RA 3T55A 2BXVA 4LUIA 3MMTA 1GOXA 3W86A 5HR7A 4NJJA 5H91A 3EX2A 3G0SA 1HFBA 3DKLA 3BK0A 1WV2A 4E0CA 1EPXA 2PC4A 2FPVA 3LM7A 5CSSA 4ZQOA 1OYAA 1XCFA 4DO6A 1QO5A 4JTIA 3ZR4A 3GLCA 4ZQPA 3LTPA 3M0ZA 4ICNA 3SJ3A 2I14A 2Y62A 2Z2UA 4H3DA 4KWWA 3GKAA 3NL6A 1W54A 2G5WA 4I7VA 1SR9A 2ATSA 1JQXA 3LHZA 4A21A 1M7OA 3TU9A 1D9EA 1HUVA 3C56A 5E1QA 2EPHA 4JDYA 2PURA 3TR2A 2QJHA 3DHDA 3NYZA 1FDYA 2EHHA 3WJWA 3CLMA 2X1SA 3QZEA 3DENA 2ZRYA 3T4CA 1OFBA 2QCDB 1AW2A 2W6RA 3EWUA 3GDTA 3TC7A 3EXTA 2VEPA 2OT0A 4KFOA 5G5IA 2G95A 3BW4A 3C52A 1P0NA 1UUMA 2ZRWA 4HSNA 3TXVA 3PBVA 2A6LA 3A23A 3MUXA 3JR2A 4XKYB 1QPRA 4CNOA 4Q33A 3HPZA 5FEPA 3BLEA 1NAL1 3LERA 3SW6A 3BO9A 2NX9A 1BEUA 4YXGA 2Y85A 3TQVA 3SI9A 3TJXA 3W1UA 4OGZA 3N73A 5G2IA 3W2LA 3EX6A 1FWNA 1WOBA 2CLHA 1S5VA 1SO5A 1Q6QA 3UWZA 2PE4A 3R89A 1JCYA 1MSSA 4QIUA 1LBMA 3P67A 2J27A 1KW1A 1QR7A 1B4KA 1F73A 2A7RA 2Y7GA 4O54A 4LS1A 1KM6A 3OVRA 4IXHA 4DBEA 2H6RA 1WQ5A 4QISA 2HSAA 1IIHA 3TAKA 2Y63A 1TPEA 3EKLA 4N02A 4LTSA 1AL8A 1KA9F 1KFKA 3B0VC 3TH6A 4Y90A 3LI1A 4ADUA 4FIQA 4S2CA 3S9YA 3LGEA 2RHGA 3TJLA 1T8XA 1LLZA 1J5TA 3DFPA 3JRKA 2ZTKA 1KLYA 3VFLA 3CM4A 4IPIA 1GTEA 5CG7A 3SFKA 5DCBA 2YW3A 1GG0A 3W7NA 3MHFA 5I3KA 3QQ1A 1O95A 2QF7A 3AO0A 3IVSA 1OFQA 4Q4KA 1H51A 5HWNA 3ATZA 5D37A 2I9EA 3W07A 4UXDA 3QC3A 3VI2A 4DELA 2V2HA 3W7DA 2CLEA 4U4MA 5DELA 1H1YA 1YXYA 5FF4A 1AL7A 1TPUA 5DY2A 1GVQA 4N6FA 3S5NA 1RVGA 4LC8A 3FFSA 1TPB1 4LVDA 4RXFA 1EEPA 4MJMA 4M7SA 1VS1A 4TR9A 3CB8A 3IIVA 1ZAHA 1VHCA 5U4NA 3O15A 5BMWA 2BZNA 2YX0A 2HTMA 1QCWA 4JX4A 3UQNA 3BW3A 1OG0A 5C2XA 2QCNA 3NPUA 3HJZA 1VPXA 3QF0A 4M19A 4X2RA 1YXCA 2X1UA 4IJBA 3WK3A 4POCA 3IEBA 3LHUA 3DXIA 2DP3A 1SFLA 2A1YA 4UTTC 2DZTA 4NNBA 2YXGA 3NM3A 3RU6A 3G8EA 3O8AA 3THQA 1FWRA 3R5EA 1W31A 1QO2A 3GAYA 1GEQA 2XN0A 3W71A 4UC5A 3QMRA 1AMKA 3GIYA 3W1XA 1MEHA 3GVGA 2YDAA 1QDSA 1OYBA 4FNSA 3PBWA 4MFEA 1HTIA 4DXVA 3ZWTA 1FDZA 2JKPA 1VC4A 1SZGA 2CLLA 4Z1DA 4FNPA 3P80A 1LZOA 1VZWA 3OEXA 2ZZ1A 3I7QA 3LCLA 3N14A 5I3IA 1U5JA 2VEKA 5AYYA 1IXQA 5D2VA 1AG1O 4QITA 2ALDA 5CSRA 1OYCA 4BWLA 3UNDA 4A2SA 2QUVA 1PL9A 1V7YA 4K37A 4BF9A 3MI6A 4HN4A 4PH6A 3M41A 3MP5A 1T96A 2X30A 5J5RA 2BX7A 3C2FA 3GXPA 4LVFA 4JTHA 2Q8LA 3P84A 1GTHA 2QCDA 3DZ1A 3LRLA 3B06A 1LOQA 2UV8G 3W7JA 3TW7A 2VFFA 2GQ8A 1SSGA 3O63A 1YADA 2CFFA 3IVUA 3W7OA 5AHNA 4XKYA 1ICSA 1W37A 2CZ5A 3F03K 4U28A 3OA3A 4OWGA 4CQAA 2R94A 4JTSA 3UPWA 1VLIA 2Y61A 1I2NA 3GR7A 2QDHA 5ABTA 5LHFA 3FKRA 5CZJA 4BWLC 1KM0A 4JGDA 4DBDA 1S5TA 5D30A 4MUZA 2A7NA 5EA9A 1F5ZA 5BW6A 2C1HA 1FCBA 4LVGA 3D0CA 1F7BA 5FF3A 1I4NA 3UZJA 2W0UA 1DHPA 5AHIA 5KZEA 4R53A 1OK4A 5HR6A 1L6SA 4WJEA 4XTIA 2BSLA 1SPQA 3O6DA 5H2ZA 2YCEA 5G2WA 1MXSA 2CLFA 3HB9A 3STCA 1A5AA 4R33A 2QR6A 5LSMA 3LXCA 5F4WA 4N2YA 7TIMA 4OV4A 3HGJA 5G4WA 4MLJA 5F1UA 2QUTA 3TDFA 1W5QA 1VCGA 3IIXA 3W7LA 2CZEA 3H55A 4MOZA 1GJPA 1SFJA 5EPDA 1LP6A 2EAWA 2GQAA 1WOAA 2B4GA 4UTKA 1PHWA 1IXNA 1LROA 1R2TA 4I7WA 1LOLA 5HNRA 2R14A 1KFCA 4LY8A 3NDOA 3PG8A 3G8RA 4CQ8A 3UWQA 3PG9A 2WNNA 3P81A 2Y89A 1Y0EA 4HNUA 1N7KA 2VXNA 2E6FA 2QAFA 3TFXA 1LDCA 4HKPA 4MY9A 2Z6JA 3DHFA 1SW0A 3G1VA 3W7RA 3EEGA 1G7UA 3V75A 1TTJA 3GX9A 3RK8A 1YDOA 3LLDA 1TCDA 2V8ZA 3LHTA 4LC6A 1H1ZA 1Q3NA 1VYRA 4AWTA 2ZZ5A 4GUGA 3WK0A 1EP2A 4PA8A 3ZFHA 4GFSA 2E6AA 1J4EA 5C5YA 3GDLA 4WUIA 1LTDA 2CZDA 2H90A 4AWUA 1EP1A 2VFDA 4IPJA 4NXSA 4HSOA 3B05A 4EF9A 4LVBA 4O1CA 4JR5A 4UIOA 4FF7A 3IV3A 1FUYA 3P61A 4E2BA 1PV8A 2X1TA 2Z6IA 3DI0A 3QH2A 4TIMA 3QQ0A 2NV1A 3W1PA 1MEIA 1Q6OA 2ZCGA 4AXKA 2A2IA 3PBYA 3TMQA 1OFRA 1VH7A 4QM1A 3QPZA 2E6YA 2KZHA 4O19A 3NL5A 4O1BA 1GYNA 1K7XA 3NQAA 2QJGA 4FXSA 3STEA 1S3HA 3W7CA 1W5PA 3W2UA 3ABSA 4O0ZA 1W56A 2Y88A 1JJKA 3CEUA 3M6YA 1A5SA 1PCKA 1FQ0A 2A0NA 3NVTA 3W1RA 3W1LA 5LZLA 1R2SA 1F6PA 5DBTA 1OK6A 2GQ9A 1L6YA 1X8FA 3GDRA 3SR7A 2E5CA 2C19A 2P1FA 3FOKA 3MYPA 3DFTA 4ML9A 3W7GA 1PS9A 4IQLA 2GPTA 1ZNNA 3HO8A 1IF2A 2DU2A 1B4EA 3LX9A 1LBFA 3S5OA 3MHGA 1UUOA 4JIQA 2CWNA 1O60A 1TQXA 1ICPA 3R8RA 3W87A 1SZFA 1UBSA 1TYGA 4NX0A 3TAOA 3TSMA 2BTMA 3S8HA 1LCOA 1KM2A 2VFEA 4NJKA 5AC8A 2V2DA 3LTYA 3EKZA 3LCIA 1IGSA 1G4TA 3QW3A 1H7NA 1W8SA 3MI3A 3GAKA 5HWMA 2QCHA 4PCFA 4IMFA 1HL2A 3M5XA 1QNVA 5KSWA 1QAPA 2YZRA 3TW6A 3UXDA 5D09A 4JTLA 1RV8A 4UTIA 4ZQMA 1VJIA 2A21A 3F4NA 1G7VA 4QAIA 3OHIA 1XKYA 1JUBA 3TSDA 1KFLA 5E93A 4RX0A 3S1WA 1D3GA 1FCQA 5DBUA 4N6EA 1TTIA 3JS3A 4O13A 1E51A 5FESA 1TV5A 3N34A 2FB3A 2Y7EA 4FHAA 5TBOA 1QOQA 1YPIA 1TRDA 4UCGA 4NT0A 2GUUA 1H7RA 3THAA 4GC4A 4JYFA 4HNVA 4JYEA 5HUPA 4KWVA 1KV5A 4K8EA 5T26A 2H8XA 5KMYA 1P1XA 3ANYA 3E96A 2WSYA 3UPBA 3W6YA 3BGJA 1SSDA 5D38A 4LS2A 1GT8A 2J24A 3W2JA 5D05A 2QEZA 4JS3A 5CZSA 3W73A 4RR4A 1VR6A 2OCZA 2Q3RA 2YR1A 3NZ1A 1KBIA 3C2VA 4JTTA 3N9SA 2NZLA 4NXKA 3C2OA 4IGHA 5AHLA 3OBKA 4LW7A 4E38A 3GNDA 3KAOA 1SO4A 3GB6A 1PE1A 4RCXA 1U83A 5BOOA 3SY5A 3MP4A 3EXRA 4A3UA 3TXZA 1XM3A 3IGUA 1DORA 3LCHA 3BG5A 4K36A 5KITA 1ME9A 1VQTA 1DL3A 3W2NA 1TV7A 3IIPA 4O8RA 4A29A 1HO4A 2C0AA 3G1AA 3MJYA 3G0XA 3GK0A 5E0KA 3TC6A 5AOUA 3F1QA 1IIGA 4UFMA 1B9BA 3I65A 4PTNA 4JEQA 1VCFA 1KLZA 1YTEA 5CPLA 5BMXA 4JTUA 3L5AA 4O14A 3EWZA 2O7SA 5IBXA 1Q6LA 5C6MA 3E02A 1WX0A 3GNNA 3KXQA 1OFPA 1P0KA 4OBTA 3BARA 3B03A 4LNYA 5LKYA 1NEYA 5AB3A 3KRZA 3EX3A 2DJXA 1A5BA 2OMAA 1WDWA 3EWBX 4KFNA 3M5ZA 1ICQA 3TV8A 4ZL1A 2H8ZA 1Q6RA 1H5YA 1R2RA 3LXAA 1XXXA 4UTMA 4FX7A 4JTJA 4AH7A 3B0UX 4IMDA 3CHVA 4RXGA 4ALDA 4O1AA 6ALDA 4Z1CA 1DBTA 5LGZA 1W5MA 4UR7A 3NOEA 3NM1A 3EWYA 2ZTJA 1FXPA 1XI3A 3LI0A 3VKJA 1K02A 3UWYA 3O1NA 1OVDA 1JCLA 3MW7A 4CCCA 2R8WA 2LLEA 1ADOA 3N2XA 4UTTA 3B0PA 4FNTA 3KVKA 5IBXC 5K7JA 4LRTA 3LB0A 3MO7A 3LHVA 5HMSA 3HBLA 5HULA 4O50A 4UTJA 1C29A 2E6DA 3RFAA 3GXTA 4EF8A 2J9XA 4DEFA 3BG9A 3NPWA 4GUFA 3HF3A 4BI5A 2ZZ6A 1TIMA 1THFD 1GG1A 3W1AA 4FX8A 3P62A 2FDSA 4D2JA 2HS8A 1K8XA 4DF1A 4LWWA 3P60A 5DY3A 4AHOA 4IOTA 2FB2A 3BPWA 4ORMA 3A21A 1N55A 1YDNA 2RH9A 4IWWA 3QMTA 2VENA 3TK7A 1LORA 3M5YA 3NG3A 3I6RA 3M7WA 3KHJA 5GVJA 5DCEA 4LOCA 2OZ0A 3O07A 1ZALA 4GUHA 4RZ6A 4WXYA 4UFJA 4X22A 4BI7A 3HMJG 1DV7A 3NXFA 3W7KA 1YXDA 4RJEA 2ABAA 1WBHA 1W0MA 2FQIA 4HPXA 3F4WA 3G1SA 4O57A 1NF0A 1F76A 4MIMA 3I7SA 4L4MA 2ZRUA 1FX6A 1FCUA 1RQEA 2EGZA 1SZNA 1XFBA 2OT1A 1FXQA 2FJKA 2YW4A 2A5HA 4TX9A 3L65A 4HNTA 1H7WA 3HPSA 3CWOX 1KBJA 2JKAA 2QCFA 4RLIA 2IQTA 2F7FA 4QSHA 2VFGA 1TSIA 3LCXA 4DF2A 1FWWA 2WKJA 3PB0A 4AF0B 2PRLA 3IIZA 5LGXA 4NZJA 5DCDA 2B7NA 1LRNA 3G0UA 1KM3A 2QJIA 3NQ8A 2ISSA 3NQFA 4GJ1A 3OIXA 1QMLA 4X3ZA 3NL2A 4NJIA 3M16A 4DF0A 1LYXA 5CPOA 1PVNA 3C6CA 5FF2A 5EBUA 2JKEA 2C15A 3QEZA
chains in the Genus database with same CATH superfamily
2GGGA 3CU2A 2WYSA 2BY0A 4CVWA 3KHDA 4BI6A 5IOBA 2ABBA 3A5VA 4OUEA 4IXXA 4JNMA 4N7QA 4K3ZA 3KOFA 5BRBA 3BWWA 3LCWA 4Y9AA 3OZPA 1H7PA 4MJZA 1LLWA 3CAQA 4HP5A 3QY6A 3CWNA 2XZ7A 3UG3A 3NQ6A 3A47A 3T08A 1Y5WA 3OA5A 2VFHA 1JCXA 3SDOA 3G1HA 4FAMA 4R9OA 3SGGA 4AHQA 1YDYA 3WIJA 1FWCC 4AB4A 2FTYA 3OU8A 3GHRA 4PCTA 2AQWA 3LMYA 2OGYA 2DZUA 4KS0A 4GQ0A 4MYAA 3O7UA 9XIMA 3ATYA 4D6EA 1F61A 3MP3A 4JHOA 4HN8A 3AJXA 6TIMA 3HGOA 4UFKA 4HGXA 4KIRA 1JG9A 3IVTA 2PU0A 3A22A 2VC7A 4GINA 5LNUA 3RG6A 1UIOA 3LTSA 2FH6A 1JQVA 3PTDA 5J5DA 2Z1BA 3IJLA 1PKYA 1S2TA 3T78A 2ISWA 1EJVC 3M7SA 4PUKA 1QI5A 4DBUA 3NO5A 5FF0A 4OQVA 4H8VA 3HOJA 4AIEA 4GOAA 2YBTA 3TOYA 3LOTA 3ZWSA 1NDYA 4ZO6A 3DFSA 1K8YA 1VYPX 3QRHA 1E4LA 3V4BA 4D72A 2HPMA 4GYJA 5I5RA 4TVUA 1UMYA 3B04A 5J04A 2C6QA 4X9SA 4AD1A 4ZB2A 2PD9A 4S3GA 1NVMA 2NV2A 4QS6A 3FYOA 3E0LA 4HIBA 3RCYA 2CETA 1JEZA 1ZCOA 2E67A 3L23A 5DEZA 3PPFA 4AZ5A 1VBJA 3TQKA 3LRMA 3G3MA 1VRDA 3GRIA 2D0HA 3GVVA 2GUYA 2OGJA 2VI0A 4GYKA 3SCQA 1DIDA 1DTNA 1FP8A 2QV5A 3A12A 1W5NA 3W22A 3F2DA 2VEGA 4C6IA 1XSIA 1H1NA 3AFBA 5H8MA 1GVSA 2ZBTA 1CDGA 4FLQA 2V2CA 3WLOA 1XD0A 1EZWA 2PB1A 4BF5A 4DO4A 1JDFA 4Q4MA 3T44A 3BGAA 3M0XA 2QJNA 1EDGA 1U1JA 3A9IA 1TPVA 3LEPA 4C5ZA 3S83A 4F0RA 1XYBA 2XVLA 2ON3A 3N4AA 4HNOA 2AKZA 1SUXA 3N18A 4Y8EA 3ZIZA 1YNYA 3CV7A 1X1ZA 1OF8A 1SW7A 1EYEA 4OHQA 4DX3A 2CBVA 2PLKA 4O52A 3W7MA 3W38A 4K38A 2DQWA 3TWBA 3V0UA 4NASA 1K1DA 4GNJA 2DJLA 4NJGA 2QCEA 4FNQA 1WDSA 3T9PA 1J93A 2V6AA 2B31A 5GJNA 5A5WA 4NQ1A 3NCOA 3DYOA 1FH9A 1WKDA 1JDEA 2PGRA 1UG6A 1KO0A 3W82A 3FA3A 4HU0A 1A3XA 2HNHA 2Z7KA 4W93A 2R1KA 1IE7C 4UZUA 4JBRA 1F2JA 1PZ3A 5CJNA 3A4XA 8TIMA 1OFDA 3G3DA 2PBOA 1DXFA 2WO5A 4H6QA 3NQMA 3MDWA 1HGWA 4DQWA 1J6PA 1D8CA 5CAHA 4U10A 2ISVA 3QPEA 2Z1WA 4HHHA 3WNNA 4UTWC 4LBUA 1W91A 3H2FA 3IGSA 3NSXA 3RM9A 4UWMA 1Z48A 5EYWA 1UKTA 2PTYA 2I1OA 4MWAE 3SECA 4MLRA 1QNSA 1R0MA 1E71M 4JTRA 3PSWA 3VO0A 4X0VA 2YA1A 2Q3OA 2A3HA 2OX4A 2HE8A 5I02A 1PYMA 1AZ1A 1UJPA 3A13A 3PZUA 2E9LA 5KZDA 1UWAA 3CT2A 5JH2A 1WDRA 2MUCA 2VVSA 3L9CA 2ZXBA 3U8GA 2XFFA 4EK7A 1OADA 1UASA 4GI8A 4Y96A 1XICA 2FLIA 4Z42C 1EX1A 3VE7A 3AHTA 2PCQA 2YXOA 2YYUA 1FHUA 1FVPA 3FVDA 3E2RA 1MQPA 3NPXA 3QY8A 4B5VA 1M53A 2HEJA 2YDQA 2JGQA 2QAPA 2G3FA 4FEZA 4AYGA 2ZC1A 1XLLA 3AISA 5AVHA 2WC7A 3JU2A 4NI8A 4ZZ9A 4UMBA 2EPKX 4NNAA 1TWWA 4MZ8A 2NQ9A 4GXWA 1WXJA 3L12A 1MW3A 1MW1A 4DJFD 3K1DA 2O56A 1IEWA 3DBPA 3DYPA 3W83A 3SN0A 4NZFA 4IZGA 4ASTA 5EKYA 3KL3A 3PBGA 1TIWA 1V5XA 2XN1A 4QCEA 1BVZA 3P5YA 5KZMA 1GWJA 3LCFA 4E2VA 4PBGA 3F7JA 4UNKA 1N82A 2W91A 4DJFA 2WMIA 3TONA 3VFCA 1DE6A 2DT2A 3C0SA 2QUMA 1F3EA 1V03A 1OZMA 3UT0A 4LY4A 3IAQA 4NIRA 3L4TA 1JCTA 3GNOA 3TYCA 4F79A 3OO2A 3CZLA 4HHPA 1F3XA 2FJUB 4RE2A 2WQPA 3CHEA 1FWIC 4DYJA 2NVDA 1EO7A 3GXNA 4MDOA 1S5NA 4Z0SA 3W7EA 3GG8A 4NVTA 5TF0A 1NF7A 4KT2A 2AAMA 1E40A 1PTGA 1WAWA 1BRLB 2QNEA 3GDMA 1VENA 2AGTA 3ENLA 1RA0A 5AHMA 4YLWA 1P4CA 2RKXA 3Q58A 4JIEA 6REQB 4IFRA 4HK5A 2I9UA 1TWZA 1HX0A 4R7JA 1O1HA 3GW3A 3CZ8A 3NUKA 4L6HA 1EPVA 1ME8A 2WV8A 4Q6JA 1XLIA 1JCJA 3UY8A 2FIQA 2GFTA 3GE7A 3ABRA 3VOIA 2RDUA 2DORA 3VNIA 2WMJA 2CLIA 3GH7A 3N9KA 4HK6A 5I78A 5LA2A 4I9MA 2NUWA 4EX4A 4CQCA 3AS0A 2G37A 1U5HA 4N9BA 1LWIA 1V7AA 3JUGA 3AZSA 3CL7A 2XGBA 3D5HA 5EY5A 3WDPP 3S1UA 4WSKA 2E5DA 4AVFA 2WNQA 3TN5A 1W3TA 1G69A 1JNEA 4YCPA 2DUZA 3W37A 4MVAA 4FNUA 1DEDA 2HBVA 2VELA 5I3GA 4QS5A 2BDQA 4P7NA 1PHQA 3T7VA 2A85A 3H7VA 3ZXWA 4HOWA 3GQYA 3APTA 3BG3A 1OF6A 3OVGA 1BG9A 3B4YA 1AD1A 4AIUA 2D0GA 3BAYA 1Z89A 2DIJA 4D6CA 2G4JA 1QI0A 4KWOA 4WKAA 3I4KA 3R94A 1EYWA 1P1MA 4DIAA 4C65A 4K39A 1JDCA 2BP1A 4F0KA 1TPH1 1JUKA 3H4GA 4QE1A 4H83A 3NQEA 4QLKA 5JBFA 1PIIA 3INPA 1WZKA 3EMCA 4GBUA 5K9XA 5E9XA 1C8XA 1PKMA 3T2OA 1EB3A 3FHAA 4IICA 1T7LA 4ADSA 1DTUA 1XBVA 3OODA 2OWXA 2C3ZA 2ZVIA 2PBGA 1P7TB 2ACQA 2J4GA 4IP5A 5DT5A 4PSPA 5D2TA 3KCLA 4MAZA 4MY8A 5CPMA 4B16A 1XLMA 2EF9A 2WNWA 3PR2A 3OTRA 2V68A 1G9HA 2EG8A 4J9JA 5F1VA 2P10A 2J7HA 2NLYA 4ZOEA 3S9ZA 3OIHA 1KFBA 1FHDA 1XCXA 3TNOA 1E6ZA 5EFFA 3VUPA 2YA2A 3CV1A 3VIIA 5I2UA 1S1PA 1AK5A 3ZR6A 4K7YA 1ESWA 3TSBA 2ZDRA 1NELA 5CC3A 2QF8A 3GHSA 2DZPA 3QTGA 2YB4A 3KRBA 3VOCA 2TPSA 4WF7A 1TTPA 1IXPA 1F74A 4L64A 1J18A 2V82A 1PKLA 2G3NA 3SUUA 1CGVA 4C5YA 3EWXA 1V77A 4WGHA 5C9XA 4LCRA 5CBIA 4GCAA 4N9CA 2HNEA 4JQ1A 1V0LA 3GXMA 2OSYA 2YB1A 4TQTA 3KVJA 2IKHA 2ZZ4A 3GTHA 2F6KA 3NSMA 3W9ZA 3V1PA 1FH8A 1U1HA 1V3IA 1ZP4A 4N4QA 3IK2A 3E38A 3CEPA 1UC4A 4ZTXA 1OEPA 5E70A 5DN1A 1K7FA 3ANUA 3ES8A 1LRQA 1R3VA 1N8WA 4BEQA 2OO0A 3NXLA 3T2PA 1JF5A 5F2GA 3CH0A 1F05A 5D2WA 3ZVHA 4FIRA 2CU0A 5HQEA 1JZ7A 4MNJA 4OT7A 4AISA 4JTKA 1R9ZA 2PLCA 2WJDA 3S4TA 5HQLA 2PU1A 1UD6A 3EXSA 4O10A 4XO6A 4NAEA 3MWCA 2DVTA 2VCCA 3A4WA 1ONWA 4S3DA 2X7VA 4QAWA 3W02A 1RCXB 1MEWA 3VE9A 3NO3A 3PN8A 2O0TA 3M1ZA 1MW2A 3LXBA 3AWOA 4DBSA 3SSJA 3DH7A 1VEPA 2POTA 4CCEA 3WLKX 1OWQA 2I57A 2OG9A 4HZ7A 4QROA 3PF3A 1H60A 3SGZA 2ZZ2A 3M9YA 4Q8PA 2WQDA 3ARVA 2DZVA 5D2YA 4JDBA 3T6CA 3FXYA 4E3VA 3W7IA 1P0DA 3W76A 5G1TA 3PUOA 1CEOA 3GH4A 1C92A 3OYZA 5JU6A 3AMGA 1TB3A 3NYDA 3VNLA 4AX7A 1YPFA 1CX9A 1OX6A 4QHRA 4TX8A 1OFEA 5LIYX 4O0KA 1KC7A 2C71A 1C8VA 3RO6A 2ZA2A 1ISYA 2YL5A 1DIEA 3K1GA 3VDGA 1LRTA 2WVSA 3N17A 2VOMA 4CU6A 1KTBA 3DEQA 3WZ0E 3ALGA 3QXBA 1PB0A 4BKNA 2CESA 1PCWA 1YTDA 4QG8A 4I9AA 1GNXA 2ZYFA 3KTSA 3T0BA 1G6CA 3UZZA 4IMEA 3TJ4A 4NRSA 2HVMA 4DI8A 4XD6A 3LGDA 5EMMA 4DBWA 4HA1A 5FJIA 3GG7A 1UWIA 4GUJA 1FWAC 4IX0A 2R1MA 1LUCA 5AYXA 3B0YA 4UFLA 2ZOXA 1DKWA 2X0YA 3FJ4A 2W66A 1GOXA 3TC3A 4NJJA 3EX2A 3G0SA 2XIMA 3DKLA 3WL0A 2ZC8A 2ZX8A 3WQ8A 2IXVA 3WQCA 4LH8A 3H2MA 2AMGA 1ITUA 4ZQOA 1XGDA 4WDWA 3QOKA 3ITOA 3AHXA 3ZR4A 4WVXA 4J3VA 3LTPA 1A4LA 2ZWZA 3NL6A 2G5WA 4I7VA 1SR9A 1XIEA 1D9EA 4GMEA 1GONA 2C8NA 4UCFA 3APYA 3EOUA 1OGBA 2JF7A 3Q4DA 2QJHA 3DHDA 2R1LA 2G3MA 4WEVX 2GJPA 3T4CA 2QCDB 1AW2A 2DSWA 2E4TA 3JZEA 3VNKA 5CPSA 1SFTA 2OT0A 3ZR5A 5G5IA 3BW4A 1P0NA 4X61A 1QU4A 3WFZA 1MXDA 1UUMA 2ZRWA 4HSNA 3TXVA 3PBVA 2GSEA 3A23A 4G7EB 4XKYB 4GGHA 4B5TA 2E0PA 3EAUA 1M65A 1RJQA 3LG3A 2NX9A 4YXGA 1CXIA 3TJXA 5BOFA 1JI2A 4FOJA 3W2LA 1RBAA 3EX6A 1R3TA 3KW3A 1FWNA 1FHVA 3BAIA 2CLHA 1Q6QA 4Q8VA 4AZCB 3CQIA 1QASA 1M41A 4AIOA 1F73A 4GISA 4ICMA 3QR0A 4LS1A 4DBEA 2H6RA 4X63A 4FR1A 3LU2A 1S38A 1TPEA 4ZODA 1JZ2A 4YVVA 1AL8A 1KA9F 3B0VC 1TA3A 2WCSA 1US0A 3BAXA 3GC4A 2CCRA 1J5TA 2DSVA 1Q63A 1DYSA 3M64A 5DCBA 1KQZA 2YW3A 3ABXA 3AJ7A 1PBGA 3W7NA 1Q8AA 3AO0A 2PZNA 1OCBA 4AYSA 3ATZA 1Q2SA 1TWIA 1UH2A 2I9EA 3EB3A 1EHNA 5T9BG 2ZXAA 4JQ2A 1XR2A 5I6SA 4U4MA 3WNOA 1H1YA 3UA3A 3XIMA 5BROA 3FFSA 5MKGB 3AMCA 1EEPA 4GQBA 1QBAA 1KGUA 4PEEA 2HTMA 2ZICA 4DI9A 4REQB 2OOGA 2QCNA 3AU2A 4GVFA 1WKYA 7PTDA 2P76A 3GWQA 1ECQA 2GZXA 3FVMA 4IJBA 1YBQA 5D9NA 2Y24A 3IWPA 2DP3A 4LYRA 3HZ3A 2VM8A 3P3BA 1MFVA 2YXGA 3M6DA 3VKDA 3CH9A 3O8AA 3THQA 1FWRA 4RNHA 1KCLA 3R5EA 4HYRA 2WVTA 4ZOBA 4TX6A 3W71A 2VTFA 1AMKA 3ES7A 1W9VA 2HZGA 4Q6XA 2YDAA 3CMJA 1OYBA 3ARRA 1FDZA 2JKPA 2BB0A 4FNPA 1XDJA 3UEQA 3OEXA 4US5D 3E2VA 3NSNA 1E56A 3L2LA 3R1ZA 2OU4A 1IXQA 2BVDA 3RO8A 5D2VA 5C0QA 4QITA 9XIAA 3FXGA 5CSRA 1OYCA 2CKSA 4GVIA 1K77A 1O68A 2BNJA 5HK4A 1V7YA 4PH6A 5JVLA 1E6QM 2QMJA 4US5A 3WEOA 5M2FX 3DZ1A 4BZYA 5CBJA 2VFFA 4JN8A 3POHA 1K9FA 3V36A 3MO4A 3O63A 1YADA 4J2MA 3BXWA 3FN9A 3W7OA 4DM2A 1ICSA 3OA3A 2GK1B 1CGUA 4U33A 1B3WA 2O9OA 4CNSA 3L2MA 5H6HA 2E40A 2Y61A 1A49A 4DZAA 2PGEA 4V27A 5ABTA 3FKRA 1WP6A 1XH1A 3BJFA 4LALA 1EO5A 3IJ8A 1UC5A 4EKJA 3KM8A 2A7NA 2PDWA 5CH9A 1E6PA 5BW6A 1FCBA 5CC7A 4LVGA 3D0CA 3RITA 5FF3A 4JL2A 4MNMA 1DHPA 5AHIA 2XWDA 4HQVA 4R53A 2NSXA 2Z29A 5HR6A 4W7UA 2D2GA 3KOYA 3PPHA 1HJQA 5A2AA 2ZUUA 1XIHA 2X41A 1O5RA 3UETA 3U57A 3MUCA 4UNIA 2QR6A 5LSMA 5M5DA 1FKWA 4N42A 3WQ5A 4MLJA 3KZPA 2QUTA 3EPOA 3W7LA 4LBRA 4MOZA 3VNJA 3VIFA 3VOJA 1IXNA 3GIPA 1R2TA 1LOLA 2XGIA 1TE1A 1KFCA 3NDOA 6CGTA 3UWQA 1EQCA 3LQLA 3P81A 2QAFA 1LDCA 2WM0A 2AL2B 1V3JA 5IHRA 3G1VA 3IRSA 3WF2A 2EPLX 5XIMA 3V75A 1TTJA 1TJ1A 1AQHA 2RUSA 3IK4A 2POZA 4C6CA 2V8ZA 2VR5A 1Q3NA 1VYRA 4IGSA 2OYMA 1TFVA 1Q6EA 1WUFA 4S39A 1J4EA 5C5YA 4WUIA 2CZDA 4OBRA 2H90A 4XZNX 4IPJA 4GXPA 4AEEA 1F6YA 5EMLA 1M68A 4GHRA 3WBYA 2HJPA 5LIKX 2OQLA 4JR5A 2BY2A 5CAKA 1UR0A 3P61A 1PV8A 3VGBA 2VGFA 2X1TA 3QH2A 4TIMA 2REQA 3AXXA 2P8CA 2XIBA 4ATDA 1JL8A 3MKKA 4QSFA 1F8IA 2A2IA 1CGTA 3PBYA 1CPUA 1VH7A 3WDRA 1KR1A 2NW0A 2E6YA 8XIAA 3NQAA 2QJGA 1GOOA 3ITCA 1B30A 2DV0A 4FK9A 1S3HA 3W7CA 1R8LA 1YRRA 2HDJA 3QHOA 4D6FA 2PTWA 4RNFA 1A5SA 1PCKA 1FQ0A 2YKKA 1QBBA 2XVPA 2XDFA 1F6PA 1OK6A 4ZXOA 1X8FA 1X7IA 3V7PA 1GVIA 3CZEA 3FOKA 1OCQA 3DFTA 1J10A 3W7GA 2GVEA 1IF2A 1LBFA 3S5OA 4UOZA 1UUOA 4JIQA 3WLMA 1O60A 3E2QA 2CEQA 3R8RA 4EPDC 1EA9C 1NDVA 3DCPA 4CQBA 3RYSA 2BTMA 3TWAA 2P50A 1LCOA 4GABA 2J7DA 5AC8A 1A5UA 2V2DA 3LTYA 2V5CA 5DANA 1W8SA 3GAKA 5HWMA 4PCFA 3EOSA 1QAPA 3U5UA 4EP8C 2D24A 4V2XA 4ZQMA 4O1EA 1XIBA 3URNA 4QAIA 1XKYA 5FJTA 3TSDA 1XFCA 2VWTA 3V18A 7ENLA 1EJRC 3RLHA 3GFYA 2E3ZA 2WLZA 3RPDA 2I16A 3PANA 4N6EA 1R3QA 4QJ4B 5LXXA 1E51A 1W2VA 2Y7EA 4D8AA 1W6TA 1W3LA 5A2CA 2GUUA 4JFTA 1H7RA 3THAA 4HCLA 4JYEA 3VTRA 3K2GA 4D8ZA 2ZADA 3E96A 2WSYA 1B5TA 4IF2A 2TAAA 3J7HA 1Y7VA 1GT8A 3QYSA 1GZ1A 4JS3A 5CZSA 3AUOA 1E6SM 4YVXA 2OCZA 4Y9PA 1KBIA 4D9PA 2BVTA 3NWRA 3GNDA 3KAOA 1SO4A 3GB6A 2PDPA 2Z4GA 2XJ7A 4J28A 1U83A 2J74A 3UXKA 1ITXA 5BOOA 3MP4A 4H8UA 3PZIA 3TXZA 1Z6KA 3LCHA 4ZOAA 1ME9A 1UJQA 3IIPA 5CSYA 1KXVA 4MB5A 2C0AA 3DESA 3G0XA 2Z27A 1IIGA 2DVUA 1IWPA 5FAGA 4GY7A 1BWVA 1XYFA 1YTEA 3WG6A 5CPLA 5BMXA 1CGWA 3DIPA 4FI4A 4O14A 5IBXA 4CU7A 4LYPA 1Q6LA 3MSYA 5FL1A 4IPLA 5AB3A 3EX3A 4CEUC 1VFOA 1DXIA 2BGSA 3QHNA 1ZZMA 4ZL1A 1Q6RA 4ATLA 1CB7B 1R2RA 1EQPA 1XIGA 4GACA 1UD8A 1H5VA 4ZE5A 4Q4SA 4H9YA 3LENA 4ALDA 6ALDA 4Z1CA 2DDXA 2PP1A 3QV9A 5HAOA 2D0FA 3QLDA 1UHVA 4S3FA 3EWYA 1BTCA 2O9RA 4MB4A 3A4AA 4HPHA 3LI0A 1JXKA 4HCDA 3UWYA 3WLRA 4M81A 2X8RA 4PUUA 3N2XA 1RLCL 4UTTA 1W9DM 4FNTA 2X1IA 1XRFA 5H8PA 1HVQA 2D2JA 1GW1A 1UROA 2ZVRA 3MO7A 1X98A 3B97A 1KCZA 1OD0A 4DJFC 2DT1A 4JTCA 4HBKA 2E6DA 3SQLA 1PEZA 2J9XA 3BG9A 2DW7A 1Y8BA 1SMAA 4C6QA 4MWAD 4A8NA 1FWFC 2WHMA 3PPGA 1PZ1A 3MUZ1 4L7ZA 1X97A 3DN5A 4LCQA 4XAPA 1GG1A 4FX8A 4YYCA 4DF1A 4IJRA 4IOTA 1TMLA 3BPWA 5CEWA 3AS1A 2VENA 3TK7A 5CC5A 4MWAA 3M7WA 5GVJA 3K8MA 3ZOAA 3WFLA 4B4FA 4LOCA 4QE5A 2PDXA 5KZ6A 3H4WA 3UBPC 4UFJA 4BI7A 1ZTVA 4I5XA 4P7RA 3HMJG 1DV7A 3NXFA 4UOJA 5CBBA 3PFMA 4PMXA 3N1AA 4NF7A 1WBHA 2FQIA 1AVAA 3WY1A 3ZSTA 3ITTA 2OLHA 7CGTA 1NF0A 1HKWA 1ZGDA 1UBPC 2ZRUA 1FX6A 1GCYA 1UKSA 1H09A 1FXQA 5DT7A 2A5HA 5BRPA 1MUCA 1KBJA 4PUJA 4LANA 2VFGA 3GC5A 4PN2A 3PB0A 2HROA 3VNZA 3EDDA 2PRLA 1LF1A 4DM1A 1BVNP 1GVYA 3CYVA 4UQDA 3RHGA 1V51A 4C6OA 4PUEA 3NQ8A 2EKGA 4HVXA 2Q02A 4NSBA 1WXYA 3VKAA 4XZIA 2ZE0A 3AUJA 3NL2A 1XYCA 4CUCA 4DF0A 4DNMA 1PVNA 2W62A 5FF2A 2JKEA 4RW3A 3TN6A 2YPIA 3UZYA 5KINA 3VGHA 4AD5A 3BV4A 5HMDA 2CITA 2BXZA 4H9UA 3TA9A 4H4IA 4W88A 3RLUA 1JRBA 1XIIA 1UCWA 1ECEA 3RJXA 1OQFA 3FKKA 5LNSA 2P5NA 4FLRA 1TRIA 1XP3A 1NSJA 4G1KA 1JD7A 5CKSA 3VMNA 2YCKX 2W27A 3RU8X 3H24A 3KL0A 1GZGA 4PGLA 3EWWA 2QVHA 3FAXA 4UBPC 1EWDA 3TP4A 4XAGA 4XBKA 4R7OA 2JALA 2V0TA 3E2SA 2INFA 4QG6A 2BLEA 1Q4WA 3WJYA 2Y7DA 3PSVA 2BOGX 3W28A 4ZOCA 2JGYA 3N4EA 3CAKA 3I7RA 2P0IA 3OLIA 1R38A 4D6HA 1W1B1 2X05A 5D02A 3DI1A 4HMNA 3LBMA 3O6AA 4L1XA 4LSBA 5E09A 1GYLA 3WENA 4H8HA 3E49A 3AQUA 3WLIA 3HGSA 4L9ZA 2VCBA 5DRCA 3QGVA 1WPCA 3Q94A 3G1RA 5AN7A 1PIFA 1QHPA 4IUOA 3CAWA 4MKSA 4EANA 5G2HA 3VDHA 3R10A 1BVWA 3K8LA 3CZKA 1XF0A 5LA1A 1JPKA 3ELFA 4O4VA 4Z2GA 3A64A 3KRSA 2J79A 3OVPA 3CUHA 2OZTA 1OFOA 3OYXA 3T2QA 3EX4A 4URIA 4HA3A 4A3RA 4S2BA 3PBUA 3CXOA 3LCGA 4J1OA 1KQYA 3O6YX 2BGQA 1ZY9A 4CCDA 5C9ZA 1RK5A 1NP2A 4PMZA 1UQZA 1LBLA 1FWTA 4PCSA 3IGXA 3B8UA 2PS2A 3WNMA 1D3CA 4ZQNA 4PMYA 3QM3A 3OOQA 1AUSL 1EJTC 2QDDA 4UFIA 3M0MA 4ZMGA 3G18A 1TZ9A 4LT9A 5HUOA 5D04C 2VMFA 5CPNA 3GU2A 1EL3A 2A6NA 1ZBKA 4JQ4A 4E4UA 1R87A 2WMIB 2YSWA 1UWUA 4AF0A 5LA0A 5ABHA 2J6VA 3F2CA 5DMMA 3O05A 3CUIA 1VFSA 4FOKA 3FS2A 3TMLA 3PULA 1EUNA 3ARTA 3N15A 1EF2A 3GVRA 3IIOA 1FFQA 4AQLA 1Z69A 4QEEA 4I3GA 2HMCA 2R6OA 2XFYA 1QPOA 4EXAA 1B3YA 4MPKA 1QVBA 3CHFA 1H62A 3A6OA 4EXBA 4KFPA 3W88A 1A53A 2ZZ3A 2IKJA 3L68A 2YBVA 2QGHA 3LK6A 3NPVA 4AZ7A 1IR2A 4JTFA 3G1DA 3RGTA 1R5YA 5AHFA 3ANVA 4JZ5A 4L4LA 1A4MA 2Y4SA 3ZLGA 4ZVJA 5AYIA 3QV7A 1GW9A 1BWLA 3SQSA 3GZ3A 1AH4A 1RP9A 3R4IA 1UKOA 3PBMA 4P8UA 3KUMA 1NWTA 3PUEA 2YLAA 4FXJA 5AYZA 4IPPA 4NUWA 3MC5A 3EB4A 2A7PA 3QMSA 4D6IA 1G94A 4MM1A 2J7BA 4OU1A 2ADAA 1OX5A 1TVPA 5HINA 4F40A 1P7TA 1NFBA 4D8LA 3CIWA 4JIIX 1KD0A 4UZSA 4PMQA 1W9UA 3A3HA 4C6JA 3WQOA 1V3LA 4EOUA 2INEA 3WUGA 1EXPA 4W8LA 4JFUA 4IIEA 5A6SA 3EDEA 4Q4RA 2WJFA 3PB2A 3B8DA 2F2HA 4BJHA 1SYTA 3TCEA 4ROPA 1Z44A 2XZ9A 2JBMA 4GNVA 2ZA3A 1XLJA 5I3DA 1D8WA 4C6FA 2PWUA 2QGYA 1SW3A 2F38A 3PAJA 3AMDA 3QJAA 5AC6A 1L6FA 1ITQA 2G41A 5I06A 2DFAA 2QCMA 3W7QA 4Z08A 3PTKA 3SGUA 4DZIA 3D46A 5G1YA 3LHYA 4FLOA 1XYMA 3H21A 3KVMA 1E4NA 3F5JA 1M03A 2HS6A 3G1XA 4K7VA 3COTA 1M3UA 4F2UA 2BS9A 3PWAA 4AG0A 5XIAA 1DWAM 1TQJA 1UWTA 3M0IA 3OHMB 4Y7EA 1WUEA 3URQA 3R0DA 1Q7MA 4UQBA 4L4PA 3ZLHA 2JK2A 2Q8XA 3BLDA 1UW9A 2EXOA 3VCRA 2W3ZA 3P8IA 3PZNA 2PTDA 2QCLA 1W1YA 3UXAA 2RGLA 1W3IA 3S5ZA 3CAVA 2V30A 1PWLA 1LQ2A 3DC0A 3ARZA 3USZA 1LL4A 4KCTA 2Q09A 1EDQA 2OKTA 1GVEA 1X7FA 1QW7A 4C6KA 4LF1A 1GVFA 3O06A 1ZRQA 2WJZA 4LAKA 3VIKA 2QJMA 5EU9A 1YX1A 1D2KA 2QUUA 3IRDA 3KS5A 3W2MA 1HP5A 2NXIA 3WH6A 1MDRA 4RV8A 4RDWA 1Q65A 3T0CA 1P6WA 4PYSA 3T81A 1EIXA 1PX4A 1GQKA 1R47A 3C8NA 3FX4A 1QOXA 1ELSA 5I23A 4GVHA 4O12A 2J7EA 1WZLA 2Y8VA 2RDTA 3RMJA 2C91A 4FS9A 3A3WA 5FEXA 3LQGA 3MU7A 4GO9A 3QW4B 3B8WA 4JICA 3WQPA 1R46A 1ZAIA 1TUFA 4DZHA 4IIHA 4RPQA 3VNMA 3W1NA 4I7UA 3VVGA 4ZFMA 2ZUWA 3VNDA 2GSJA 1M6JA 3NAVA 3BLPX 4YU1A 3LBCA 3C4UA 3MUIA 4JN6A 2HVNA 5D33A 2AQVA 3UR5A 3UG5A 3M5VA 1KXTA 3VOGA 1TPC1 4FZIA 3QQWA 3NZPA 1M7XA 3MI2A 3N2TA 4FP1A 5CZKA 2WHLA 1FFRA 3GZAA 1HF6A 1HKKA 4E2DA 4Q8QA 3RRAA 4UTHA 1OINA 1V0NA 4X0NA 2DY3A 2JEPA 3QSRA 1Z42A 3T40A 4IIBA 4XD4A 2VDIA 1L6WA 1LM1A 4M24A 3ZVHB 3OG3A 3GTNA 2PDLA 3HG3A 2FFCA 1RR2A 2P53A 1SZEA 2WMGA 3S3GA 5MHBA 1B57A 4GI9A 4AZ6A 3AYRA 3MHUA 3FSTA 3ZO9A 3R2GA 3R7MA 2IS7A 3N6HA 4NAEB 3SQMA 1BKSA 5IDIA 1ZLPA 1A5KC 1YKWA 4AWEA 4GD0A 4W86A 2ZQ0A 4WGXA 2VP8A 4LF2A 4AEOA 1EDTA 4DNHA 1XLEA 3QFWA 5CPQA 4JFSA 2QCGA 3NGJA 2WHJA 6TAAA 5A6KA 2Q8ZA 4TV5A 3T0TA 4M1RA 1OCNA 1R86A 3VIPA 1ZHAA 1N2VA 4Y2WA 3EBVA 3TTSA 1W3NA 2QW5A 2PWGA 2XN2A 1HG3A 1TJRA 4Z17A 3ZJ6A 5LHEA 1GKQA 1OB0A 3UWEA 3LZ3A 1R9XA 2DQXA 1WA3A 1JPMA 3FIGA 3MV01 3H26A 5D03A 2XFRA 1XYLA 1XBXA 3MMWA 1WE5A 4C1LA 4PSRA 1XBYA 1VBUA 2FHFA 2XM1A 5CLTA 4B4HA 4KW2A 3UGRA 1QK0A 4PEKA 3A3XA 4JPGA 1XDMA 4GWEA 1I8JA 1CZ1A 3CPUA 1MNZA 1XKJA 1LJYA 1OX4A 1E0TA 1ONRA 1N8IA 3H7UA 4B5NA 2FPTA 2FHCA 1MWOA 5B7YA 4WOQA 3PS7A 2UY3A 4TUFA 2NVCA 4MF4A 1ALDA 5AC7A 4ILSA 1K9EA 4GUIA 2XH0A 1LUCB 3MZNA 3NZGA 4PULA 2GVJA 1GYMA 5AHEA 1JIBA 2TSYA 2UY5A 3L5MA 3GDKA 1XLKA 1VF8A 4AVNA 4A3YA 1GKRA 3K8KA 3MBFA 2IQ0A 5CZ0A 3VOFA 3OJGA 4P7QA 3H22A 5TIMA 4JQ3A 5FI8A 4CNNA 2DZWA 3BAWA 4D1IA 1AJZA 3TW9A 3SCRA 3D3FA 1TPWA 4DRSA 1EP3A 2G3JA 3G24A 4LQ1A 2YFOA 4NJHA 2E7FA 2IUZA 1K70A 3SADA 2OVLA 2OB3A 1TR9A 4Z1BA 4S1FA 3OZMA 1ME7A 2F6UA 3WEMA 1JR1A 1HIZA 4KGJA 2GJNA 1C7SA 4GJIA 1X6UA 4KEZA 3WD0A 3PJUA 4TVDA 1SU5A 4GH1A 1JCNA 3DECA 1I45A 3L0GA 2PGWA 1TO3A 3MYOA 3STGA 4NKCA 1VEMA 4NNCA 3PNZA 4UQAA 3FYYA 1JGIA 2NV9A 3DERA 1AJ0A 3WK1A 4PUDA 1VLWA 1M9HA 4DN1A 1AQMA 4W89A 3ITXA 4TO8A 2VX4A 1D3HA 3M0JA 2FMNA 3DFQA 2XSBA 1O5XA 5A8GA 1XUZA 1NWSA 5GNYA 1YE6A 3BJSA 4HMCA 2AGKA 2DIKA 2PF8A 3L0NA 4U5KA 2ACRA 1XLDA 4PBFA 3CHCA 4R27A 4TMBA 1TV3A 5IHSA 3RJYA 5FD0A 1FY6A 2DH2A 1N8FA 4PFHA 1PKNA 3TLQA 3IPWA 5IXEA 3GU9A 4ZTYA 2Z24A 4FLSA 1I1XA 1WBJA 3LLFA 1JDDA 1VRXA 1XIDA 3GYCA 1YTKA 3UCQA 3TYDA 4CNTA 1ISWA 2GJRA 1H7OA 1XGEA 3KEHA 3AWNA 1Q5MA 3F2BA 4X2PA 1QOPA 1TA3B 2X2GA 1IEVA 5T9CE 2WZTA 5LYRA 5G1MA 2C7FA 1CLKA 4M5PA 1FWEC 3HN3A 5BU9A 1HQTA 3W85A 4F4RA 4TV6A 4U5IA 5AC5A 3LPGA 3WUEA 2PDHA 2CLMA 3W7PA 1RY8A 1JYNA 5HJYA 3S0CA 3SCSA 4FX6M 1UR1A 1J12A 2B0MA 2NXHA 3LA4A 4UQCA 3WMLA 2DT3A 3O16A 4B92A 2YIHA 3UWWA 2PFHA 3WH5A 4M82A 2J7FA 2NWRA 4PZVA 1HKIA 1F3TA 3EX1A 3I3EA 5L9FA 1E1CA 2CPUA 3KBSA 1E3XA 1GUVA 2C14A 1DWJM 2FTPA 3M4HA 2HWGA 3H8AA 3LLXA 1CXKA 1YBQB 4E5TA 1SJAA 4ZENA 3NZRA 3SZ8A 4B9ZA 2F6XA 3MBDA 3T55A 2X1RA 1EJWC 2BXVA 3UG4A 4TVCA 2HXTA 1H2JA 2WZHA 2XH7A 5HR7A 4YN5A 4KERA 2OWCA 1HFBA 1KNWA 3BK0A 2HISA 1WV2A 2PC4A 3P6LA 5ABFA 2UBPC 2FPVA 5CSSA 3VPLA 3CS2A 4DO6A 1GOIA 1X38A 6XIMA 3PHAA 3GLCA 4MSSA 4ZGYA 1EJXC 3M0ZA 3LBOA 2IQDA 1JQXA 3LHZA 4A21A 4CN1A 4PB5A 1M7OA 3LNPA 1H0IA 4J35A 3VC5A 4AFYA 4S3BA 1DIKA 4GYFA 4OBSA 2WVUA 2ZRYA 2Z1XA 1Q13A 1HVXA 1WXZA 2W6RA 3EWUA 3TC7A 4K1GA 2VEPA 4LCSA 4PRTA 2PWEA 1XQKA 3POCA 1CXEA 2O9PA 3TYAA 4B5WA 1R3SA 4CNUA 5E5CA 2GWGA 2CERA 4Q33A 3HPZA 1E0UA 4Y9MA 1DJHA 3ZJKA 2Q01A 3IUDA 1LT8A 2FYMA 3BO9A 1BEUA 4JIHA 2Y85A 2ALRA 3AAMA 3TQVA 3ZQ9A 4RW5A 1TJ0A 1PTDA 1EBGA 2JE8A 3C0QA 4QR6A 4Y9NA 1SO5A 5FJJA 1KW1A 1QR7A 4NZ4A 3BQ6A 4E8GA 1B4KA 1PZ0A 1UZDA 3MB9A 4NI3A 1IT0A 1WQ5A 2HSAA 4G7FA 1R6WA 2GYIA 3WMCA 1P0BA 2Y8UA 4LTSA 5A69A 1KFKA 2FVKA 4Y90A 1CGYA 3VDCA 4FIQA 4S2CA 3LGEA 4OECA 3TJLA 4LUSA 2XTKA 5HA7A 3DFPA 3TCSA 3JRKA 2Z2AA 4B5SA 3VFLA 3CM4A 4KWUA 3AIRA 1GTEA 3M0LA 2QT3A 5A3HA 1MQQA 4GX8A 4IG2A 2PEVA 3MHFA 5I3KA 4YTUA 3NZQA 3IVSA 4Q4KA 1H51A 5HWNA 5D37A 3W4RA 3LPFA 4Q8TA 3MV11 3E5PA 4UXDA 3QC3A 3VI2A 2PWDA 4ICCX 4PUNA 4DELA 3C2YA 2NT0A 4WR3A 2QYGA 5DELA 1YXYA 1AL7A 2OO6A 2WB5A 3TZFA 5M17A 2PWVA 3S47A 1W2PA 3MY9A 4M7SA 1VS1A 1S1RA 4TR9A 2YBUA 1ZAHA 4H7CA 4S3KA 3KP1A 4WKHA 2Z00A 4I8YA 3O3RA 5U4NA 2FHBA 3WDJA 2X09A 5FJPA 3OB8A 2J47A 4BQ3A 3BW3A 1OG0A 5ECUA 5DX7A 1QW9A 1V8EA 4QTGA 1EGVA 4M19A 4XAYA 3WK3A 3IEBA 1JPIA 1SFLA 1NFPA 2DZTA 3CHDA 4NNBA 4UTTC 3LM3A 1U2YA 2DGAA 4C60A 2OODA 1JI1A 1UYQA 5T8GA 1W31A 3EKGA 3GAYA 1Y5VA 1B1YA 1DHKA 5HQMA 3B8VA 2F61A 1SFSA 2AAAA 1HTIA 3DFHA 4U2ZA 4YS1A 1GJWA 4GY0A 1CWYA 3AXMA 1GHSA 2ZZ1A 2REQB 3LCLA 1U5JA 5AYYA 2NQZA 5AZ0A 3UNDA 3WEZA 2E28A 3ONCA 4MWAC 4K37A 4G5DA 4Q8NA 3MI6A 3GR4A 4HN4A 1TZZA 3M41A 3MP5A 4DVOA 2X30A 1JFHA 4F9DA 3MPGA 3VGFA 3GXPA 5CLWA 2AQOA 3EOOA 1JGMA 2RJGA 3WKZA 5FL0A 3LRLA 2XIOA 5BXRA 4ZSUA 3TW7A 3RR4A 3ZMRA 3U2ZA 1CYGA 4IH3A 2PDQA 2WC4A 1QWKA 1W37A 2OZ8A 5EMYA 3EGJA 1T8QA 3F03K 4CQAA 3VZZA 2R94A 3HTWA 1PWMA 5E6ZA 5BXSA 3TNBA 1EHAA 3LY0A 3RAOA 3GR7A 2FZ9A 2WHKA 3MKCA 1TELA 3V5OA 1HZYA 3PFRA 1W3HA 4BWLC 2HE5A 1KM0A 3VD9A 4HK7A 1BG4A 3SY8A 2CIPA 2BXYA 4MUZA 2BFGA 5EA9A 5ECVA 3UJRA 3EDJA 1MDLA 5EB8A 3GFXA 1F7BA 3WMBA 1I4NA 3UZJA 2W0UA 1J0HA 3CIVA 3RM4A 4YTRA 5I07A 1J9YA 2QDEA 4NZ1A 5J8LA 3O6DA 1E1EA 5G2WA 4J3XA 5FJOA 3HB9A 4NILA 3WLJA 4R33A 3LXCA 1E9IA 3U7BA 3VA8A 5D9OA 1YEYA 3AS2A 4EPKA 3FA4A 1VCGA 2AKMA 1GJUA 5FACA 3M07A 1GJPA 1LP6A 4UTKA 3VILA 4OVXA 1LROA 4S3AA 4MB3A 1IEQA 1JPDX 4GY1A 2R14A 4LY8A 3N2CA 1F4AA 2YCJA 3PG9A 5C2CA 4XK2A 2OYLA 5FOOA 1NP0A 2HXUA 5EFDA 2WSKA 3CZGA 4CD5A 4GVGA 3GU1A 4HKPA 5DMYA 3DHFA 1E72M 4DUXA 4K2SA 2PZ0A 4UOQA 1XINA 4RE4A 3RLGA 3EEGA 1EJUC 3XISA 4BF7A 4W5ZA 3KLKA 1HJVA 1OT1A 1YDOA 4W7VA 2YLLA 3LLDA 3WQVA 4KGLA 3LHTA 3NIYA 1XC6A 4AWTA 1SM9A 1V08A 3VM7A 4PA8A 4GG9A 1CXLA 4PMNA 2NQJA 1NQKA 1ZJAA 3TLLA 2BVWA 3GDLA 4LAOA 5BOEA 3KBWA 5TD4A 4P8WA 5CCZA 3IV3A 1FUYA 3QLLA 3PJTA 3R58A 3DI0A 2C1GA 1JZ8A 3U3HA 3OZYA 1AQ0A 1WDDA 4FALA 1EEXA 1V3HA 3N6JA 2ZCGA 4IFOA 2YDRA 3TMQA 1T41A 1OFRA 2DH3A 4QM1A 3CASA 3BANA 1J0ZA 5E6YA 4O19A 4RNIA 4O1BA 3UXLA 3V0SA 1K7XA 4PTVA 3M46A 1W5PA 1E9LA 4O0ZA 1W56A 2J66A 3M6YA 2HRWA 4XSLA 4OOZA 1PJ9A 3W1RA 1R2SA 1HL8A 5DBTA 5GNXA 1L6YA 1KCKA 3SR7A 5D8ZA 1OC6A 2C19A 3SSZA 4KEVA 1US3A 1KBLA 3GHTA 2D3LA 2WJEA 1W9BM 4IQLA 1KFWA 1X1NA 1IV8A 1ZNNA 4F2BA 1O7AA 1B4EA 3LX9A 3AIEA 4IHCA 1PIGA 4PTDA 1ICPA 4M3PA 3W87A 1TYGA 2YL9A 4PB3A 1KM2A 2VFEA 3EKZA 3LCIA 1IGSA 1G4TA 4P5UA 1US2A 5A6BD 1U1UA 1FP9A 2OKOA 3E3HA 3VAVA 3CGTA 2YZRA 4MWAB 5D09A 4JTLA 1RV8A 3AICA 3O2LA 1VJIA 2A21A 3CBWA 1JUBA 2DW6A 2G0WA 1QTWA 1D3GA 4U3CA 5A6BA 4J3UA 1O12A 5DBUA 3UJFA 1OGSA 4EWJA 5FESA 4EAYA 3N34A 2FB3A 2WK2A 4XSMA 3G77A 3QGAC 1KKRA 2BY1A 4NT0A 5E0CA 2GGJA 4JYFA 4HNVA 4B15A 1X6NA 4KWVA 1UKPA 4XISA 5ABEA 4K8EA 2H8XA 1P1XA 3ANYA 2ZUNA 3UPBA 4AD4A 3BGJA 2R24A 5D38A 1X96A 4W87A 3W2JA 2J24A 1MUMA 3GXIA 1QPKA 4IMAA 3W73A 1J0IA 4CD7A 1J0YA 2YR1A 1ITCA 5HNUA 3AIBA 3LS9A 4YJ5A 3WLHA 4LBSA 4HMDA 5AHLA 4E38A 2X7WA 1PE1A 2VRQA 5DMNA 4KCWA 2VO5A 2J7CA 5CXPA 3SY5A 1DORA 5KITA 1UH4A 3W2NA 1TVNA 4F8XA 4Q3MA 4A29A 2JIWA 4ACZA 3F1QA 4UFMA 3I65A 4PTNA 4JEQA 4O1FA 4B3KA 1KLZA 3WD1A 1JZ3A 4S3JA 1T40A 2PDCA 3ARWA 2ZUTA 4ZE4A 1EC7A 2O7SA 2QV4A 4WDTA 3MCMA 1KRAC 3ZT7A 4H01A 1OFPA 3OGVA 4LXFA 3WL1A 1PX8A 2X2YA 5HNTA 5LKYA 1NEYA 4CVUA 4GBDA 3II1A 2FTWA 3U4FA 4IJCA 1ICQA 3HM7A 3TV8A 3UJ2A 3FDGA 5M3WA 2OXNA 4UTMA 1GOWA 4AH7A 3MUY1 3GFZA 1V02E 3KZSA 3CHVA 1RK6A 4O1AA 2GVYA 2PDYA 4LAZA 4B3LA 4KRZA 3U0HA 5ABGA 1DBTA 2R82A 1DXEA 3CL8A 1FXPA 1Q66A 2FKPA 3VKJA 1K02A 2PP3A 5FCZA 2R8WA 4WJXA 4HD5A 1ADOA 3KVKA 2XIJA 5K7JA 3W25A 1S2VA 3LB0A 3UP8A 3ICJA 5HULA 1C7TA 4O50A 4UTJA 3QY7A 2ZDSA 2BG5A 5C70A 4XZHA 4I9JA 3NPWA 3E0WA 4GI4A 4BI5A 2ZZ6A 1TIMA 4Y9OA 2GOKA 2QULA 3W1AA 1BKHA 4AC1X 3P62A 2GUBA 3RX4A 1I75A 2Y5EA 1K8XA 3R11A 1A3WA 3TQPA 4ORMA 2FZ8A 4XZMX 3OQEA 2RH9A 4ECLA 4FF5A 1XD1A 4Q8OA 2VDHA 3I6RA 1XPYA 1VBGA 1A80A 4DWSC 3OPSA 1UD5A 4IQDA 3WD3A 1W3JA 2VGBA 3TTQA 1V6TA 4XZWA 3I6EA 4X9YA 3F4WA 4O57A 3AI0A 2J8GA 4MIMA 3PP7A 1QI2A 4HHLA 3NGFA 1RQEA 2EGZA 4Q4PA 4JL1A 2OT1A 2YW4A 1VP5A 4HNTA 3NJ3A 2QCFA 2JKAA 4G8TA 2BOEX 3LCXA 4UTFA 1AD4A 2WKJA 8A3HA 1V79A 4AF0B 4H19A 2HK1A 3IIZA 6PTDA 5LGXA 3OBEA 4J3TA 5F7UA 4C90A 3G0UA 1KM3A 4EE9A 2QJIA 3M0YA 4GJ1A 1NWRA 1R3RA 1XIJA 2OELA 4D71A 6ENLA 4X3ZA 1VBRA 4NJIA 3URBA 1JZ4A 3URAA 4U2YA 1F8MA 1GK8A 3C6CA 4DXKA 5EBUA 1B54A 1BYCA 2C15A 2I5GA 1VIWA 3RM8A 1KCXA 1ZP3A 3LDVA 2F9RA 4Z1AA 1RZMA 5FJRA 3MA8A 2XSAA 1TMHA 3GR8A 2OZ3A 1C9WA 3GNPA 3BCDA 1SVDA 2ATMA 3YPIA 2IPJA 3VKBA 3KDOA 4E3TA 2NQHA 3WQGA 3HMCA 1QXLA 3DYMA 4QJ1A 1P0EA 1GQJA 5K3VA 1RQHA 1A0CA 2V5BA 3PY2A 1HGYA 1QWGA 4JX5A 1FCVA 2WPGA 3AXHA 2H3BA 3OGRA 4NU7A 1K8ZA 1TPFA 2XUCA 3VM5A 3WSUA 2O92A 1I9CB 2E5BA 1G0CA 3CUFA 3B9AA 3FEMA 4HPJA 3S1GA 4QGCA 2J78A 3DFOA 5I79A 1SQ7A 4ZO9A 4R7WA 3S42A 3SN4A 5FKYA 4IFKA 4Q4OA 3C8FA 3I3BA 4WXZA 3IUIA 4XWUA 1KBKA 2WKGA 5C9RA 5F4SA 2PD5A 4KIEA 1QT1A 1FWBC 1CLXA 4P8XA 4WX2A 4TTGA 1PDZA 4OKDA 3ONBA 1S5WA 3RNDA 2ZA1A 2EO7A 4Q8MA 4WZHA 3AIVA 3A4JA 3LV5A 3BZJA 3U48A 4C6LA 2VC9A 5A8OA 3MZ2A 2CBJA 4H9MA 2D69A 4INFA 4A22A 1GPWA 5BCAA 3WBWA 1UWRA 4LRSA 1XUUA 3UJSA 1UOKA 2UWFA 3T42A 2VGIA 1GPFA 2Y6ZA 1ZBVA 1HKJA 1XLFA 4RUBA 3V0TA 4HYVA 2NVAA 4FA3A 4CD4A 2KAUC 2OEJA 2X42A 1XISA 3SRDA 2VURA 4NZCA 3NQGA 2NXGA 3IANA 3VX1A 4C6EA 3UZ5A 3WD4A 3RUBL 4U3AA 2QHAA 3W74A 2CHOA 3T1GA 1DJGA 1XLGA 4NX5A 3GUGA 1HP4A 3USBA 4DJDC 3TYZA 3EWDA 3N12A 3UR2A 2GDUA 9RUBA 1ZU8A 4O4WA 3WH8A 2E1WA 3W3OA 3ABZA 3G6MA 1CTNA 1J2BA 1A5NC 4LV9A 3LPPA 4HPGA 5EMUA 3HG4A 3C0JA 1TR1A 1NH6A 5DO8A 4DY1A 3ERPA 4FR6A 4EVZA 3WMSA 1ZUAX 2YGYA 4FPSA 4W8BA 4I5UA 4YWSA 4JX6A 1CNVA 2QLYA 3H2AA 1MI3A 2ZX5A 3STPA 1BQCA 4A6GA 1LQ0A 1BF2A 4HJFA 4W84A 4QE4A 3DGBA 3GM8A 5C54A 3L4ZA 4PE8A 2J9ZA 1H50A 3PM6A 3Q67A 4MNLA 2OX1A 2ONEA 3K5XA 3L66A 4BK9A 4JYDA 1J11A 3HPXA 3H53A 1FWHC 3JW7A 3BLKA 4G1NA 1TCMA 1IEIA 1DOSA 3ABOA 2TRSA 1VJZA 1T6MA 2PDGA 3VGDA 2WNZA 1Q6CA 4FXFA 4MNKA 5BXPA 1MUWA 3I6TA 2AL1A 1WAUA 1VYSX 2OWWA 2V5LA 2VZTA 1P48A 4L61A 2VVNA 4GJJA 1F07A 4L9XA 3TE9A 1SGJA 2J62A 5JQ9A 4JY9A 2VEFA 2XFWA 1E3ZA 4LAMA 1ZS2A 1Q2RA 3STFA 3HPFA 4ML4A 2BODX 1C8YA 1S2WA 2OPJA 3WQWA 3TTOA 1G4PA 1XRSA 3WLTA 4RZ5A 2ZUSA 2DZBA 3VCCA 3L4XA 3S5YA 1O4UA 4JD4A 4UMAA 1W1PA 1MMFA 3UY7A 2VEMA 3VKCA 4WY0A 2W61A 1TTQA 3K30A 2WSQA 4ZR8A 3WH9A 2XG9A 4MYXA 1V0KA 1OABA 4H04A 4JCMA 1VB9A 3UU0A 3NDZA 3M0KA 4UTLA 2HBXA 1KGWA 4NYUA 2VZSA 2CLOA 2YCLA 3S1XA 3TYUA 1GVRA 3W0KA 3GHUA 4LS0A 2HVOA 2BHZA 4IGMA 3EA3A 2XINA 4YWIA 1W1A1 4A4AA 4WY0F 1OY0A 3BOLA 1WB0A 3U6WA 3B9OA 3BE7A 4DXXA 4JNZA 1VFUA 4TU1A 4QRNA 3KVLA 3CTLA 1POKA 3UG8A 2VWSA 1FWDC 1UZHA 1XG3A 2ZXDA 4WKFA 4LU0A 2WLYA 2EG6A 2RDXA 2JIEA 3KFTA 1TMQA 1FBAA 4R5EA 1RJPA 2FZMA 3GYEA 1VEOA 3W1MA 1Z3NA 3GNXA 4YTSA 5BYWA 3MWAA 4OV9A 2YL8A 3AIWA 4JTEA 3OVQA 4F2TA 3ARPA 3V5CA 3DAQA 2A4AA 1U22A 1FDJA 3BMXA 1DJQA 3PNUA 3SIZA 2BBFA 1OX4B 1TVLA 5AFDA 4RKAA 4WDUA 1NDZA 3N9RA 3BURA 1JYWA 3SRFA 1XSJA 3KBJA 3PAOA 4JXCA 2BV9A 2PLJA 1OBAA 3BJTA 4MDPA 3ZT5A 1TPDA 3MVIA 5K4ZA 1W8GA 3SCVA 1ODUA 2EQDA 3NNTA 2CW6A 1A0EA 2A3EA 3R25A 1BHGA 1UWSA 4H6KA 4PUMA 1XSKA 4LAUA 2BMBA 4KRUA 3CYJA 2CZFA 1XC4A 2QVNA 4TMCA 2VL4A 3CB3A 3W01A 1HKMA 4PMOA 1LG2A 1IXOA 1ML1A 3ME3A 1FHLA 4ES4A 3ZJ8A 1RD5A 2VT0A 2VRJA 3KS6A 4LVAA 1I6NA 1CW2A 1R7AA 1E4MM 3CIXA 4J3WA 1AA1B 3C3UA 1PX3A 2H3DA 3UERA 1V6XA 3BICA 3RN6A 1J8VA 4Y6GA 1ZFJA 4Q7BA 1QW8A 1J0KA 4XTDA 2B7QA 1M01A 3G22A 1B3ZA 4GIRA 1UP2A 2G96A 1Z41A 2NLIA 5C55A 2TMDA 4CU8A 2I5IA 1K9DA 4NG3A 1RP8A 3IJIA 3GIQA 5DXXA 2I56A 4F0SA 4WHBA 1FOBA 3VNYA 2E09A 1XGZA 3L5LA 1TREA 2GVGA 4QNEA 4QLLA 2PDJA 1UD3A 7REQA 2D22A 4J7RA 2FFIA 2CC0A 2O4MA 3W6LA 3TX9A 2ZZ7A 5MF5A 3WUFA 4TXEA 3VIGA 5RUBA 5C7HA 4HU8A 5A1AA 3MMDA 2WZIA 3QFEA 1J2WA 4IIFA 4NP7A 3UVIA 4DPPA 1JXJA 5GPRA 3KBMA 1ODZA 3EPNA 3V1HA 6XIAA 3TVAA 1C3FA 3AC0A 2CYGA 1QI3A 4GRSA 4ZFCA 3C2RA 5F2IA 4QQ3A 1MZHA 5DXYA 3F4VA 3VIJA 5GJMA 1HT6A 1BGAA 3WBEA 1MO0A 3C0LA 3HQ1A 5LNRA 1IGWA 4FXRA 3OG2A 2WWCA 1DJNA 1NTHA 2ZFAA 2P0OA 2XWEA 4CLMA 2I7GA 1JFXA 1BSIA 3TUUA 3WJSA 3W7HA 5H8UA 3NEVA 2GOUA 1RCQA 3GO2A 1C9DA 2E77A 1BWKA 4GGBA 4M56A 1Z9AA 2RAGA 4V28A 1TV4A 3CK5A 5AY7A 2P3EA 3LMZA 1J01A 3WH7A 1E1CB 3OLEA 2ZRXA 1OHLA 2WKLA 4P2VA 1BF6A 2WC3A 4PODA 4GFIA 3FGCA 2OLSA 1XLCA 2FMOA 5KTLA 4S3CA 5I09A 2Z0IA 3WFAA 2VC6A 1QATA 4IISA 4G2DA 4FB7A 3VC6A 2EPNA 4N9EA 1DWGM 5IFPA 2DEPA 1HO1A 1VAHA 4PTMA 2OOFA 3I68A 5ABFB 2PDBA 4O18A 3LD5A 4H9VA 3V5FA 3WF1A 3PVFA 4MZ1A 3W1TA 1OJXA 4A8RA 1YLVA 1O6IA 3T09A 3GBDA 1L8NA 2QDGA 2O55A 4XBSA 3P0WA 1JRCA 1D7KA 3H54A 4TOQA 2VJXA 3FEQA 4AHPA 1EZ2A 4C1KA 3WQDA 3R8GA 4PCPA 1QNRA 4XVDA 3H12A 4LUTA 3C61A 4WJ8A 7TAAA 3LGGA 4M6VA 4L5ZA 4PBEA 3FCPA 1XIFA 4OOUA 2VX6A 4ACYA 1EX5A 3SUSA 1KR0A 1UZ4A 2CXEA 3KTXA 4GIYA 3BOFA 5GJPA 3FNDA 1G5AA 4WQ6A 3OP2A 1KXHA 2D2HA 2E8ZA 5I3FA 3WJZA 2VQUA 5FAJA 4YCOA 1KRCC 1X1OA 4M29A 3UYCA 3M0HA 3TJIA 2V5JA 1XG4A 5GNZA 3GUWA 4LPCA 4I9TA 4YL2A 1T99A 3DFYA 4P7LA 4AX6A 5TAOA 3UA4A 3WUBA 1CBGA 4R34A 4N4PA 4O28A 2IMRA 4UQEA 1I60A 3HQNA 4UMCA 4MFDA 4O16A 1OT2A 3NOYA 2ICSA 3HG5A 3W24A 2PGFA 4IMGA 3Q65A 3DC8A 3TA6A 3O0FA 4PL1A 5G4HC 2PPGA 2R9RA 2B7PA 3BDKA 2J75A 4MADA 4MJ2A 1H49A 4A2RA 4Q8WA 1WCGA 3NQ7A 3QC0A 3GY1A