3M44A

Crystal structure of the mutant v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
207
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPTLRFADAIIAGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 76
structure length 207
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m44A00
2PRMA 4FHAA 4Q32A 3SJ3A 3T78A 2GUUA 4M6PA 1WDWA 1NF0A 1QO2A 4K39A 5AYZA 1JUEA 1S5TA 4ICNA 5H2ZA 4OU1A 3MW7A 1PCWA 1SFJA 2W6RA 2E1DA 4TX9A 1O95A 1EWDA 2B7NA 2WV8A 3W7KA 1EEPA 4UCGA 4NQ1A 1QFEA 5DY2A 1GYNA 4LT9A 2WQPA 4HNTA 1TIMA 1JR1A 1LCOA 2RFGA 3OG3A 3DXIA 3V1PA 1K8ZA 3S6DA 4LNYA 3FJLA 1GT8A 4UTJA 2DP3A 4LRTA 3LOTA 2OMAA 1OFRA 3PWAA 3LCHA 3M16A 1TJPA 4EWND 3W1NA 3PR2A 1FCBA 4KFNA 1R2SA 3NZ1A 4EVZA 3L2IA 1YDOA 3I65A 1KTBA 3CLMA 4S2BA 1UBSA 1F73A 2YPIA 5GVJA 2RDWA 4DF0A 2FPYA 4MPQA 4O0KA 3LRLA 4O19A 4PEKA 3LM7A 2E77A 3HG5A 4YMZA 4JX4A 1QOPA 4K37A 1UJPA 2A5HA 1OFAA 4N6FA 3PSVA 1YTEA 3KX6A 3TQKA 1M7PA 4UMAA 4NNBA 3TW7A 4LVAA 4KFOA 1KLZA 4NJIA 4AAJA 4OV9A 3HGJA 1EA0A 1N8FA 1SO3A 3P82A 1D3HA 4JGDA 3W70A 3T4CA 3W72A 2PRLA 2C14A 2F7FA 3P84A 1VPXA 4QIUA 2FIQA 2YDAA 2OZ0A 1BWKA 2ZRXA 4Z1BA 3PBUA 1JCMP 1W1ZA 4AHQA 3MI6A 3OA3A 3S5YA 3VFLA 3BLEA 1C9DA 2ZQ0A 4EF9A 1LOQA 2QDHA 2V9DA 1K7FA 1ME8A 4ORMA 3TFCA 2ZDRA 3TAOA 5DELA 2JGYA 4O16A 1DJQA 3C2VA 1XUUA 3W75A 3N73A 2DZPA 5CPLA 3NM1A 2VEPA 2DZVA 3QYQA 2TPSA 2V82A 1GVFA 4O15A 5EL1A 4JEQA 1MEIA 4IWWA 2Y7FA 1OF6A 4IMEA 4QNWA 1QOQA 4QSHA 3HG4A 4FF7A 3EWBX 3W1XA 5DN1A 3IIZA 4CCCA 4MJZA 4D2JA 4PC8A 5TBOA 1OK6A 1XBYA 1I4NA 4QITA 2QAPA 4NJHA 3C2OA 1W56A 3E12A 4Z0JA 4JNMA 3SGZA 3C2FA 3FOKA 3T44A 4L4LA 3NQ2A 2GVJA 1KM0A 5E93A 4A2SA 3BGGA 3P67A 5D37A 2TRSA 5K4XA 2PRHA 4MZYA 4IPJA 3P62A 3A5FA 4CNOA 4FNUA 3MJYA 1KM5A 1LBLA 1TJRA 3KAOA 4K8EA 1G4PA 2V30A 4JTGA 5IBXC 1HFBA 4HNVA 1SR9A 4YWIA 2GJNA 4JR5A 2BXVA 3IGXA 3SI9A 1LOSA 2ZCGA 3P7YA 3G18A 4MY8A 2PCQA 5BOOA 3QW4B 1LM1A 4HNNA 4I7WA 1R30A 2CZDA 4RCXA 5C2XA 1D3GA 1ZJIA 1AW5A 3UXAA 2G95A 3L0NA 2GOUA 1O60A 4UIOA 4XTIA 1H7WA 5D2XA 5K4ZA 1OYAA 4GFSA 4GUJA 2Y63A 3CU2A 1UUOA 4AWUA 1OFQA 4WJEA 1YYAA 2NXHA 4N2YA 5FEWA 3H54A 2E5DA 3A23A 4JYFA 1NAL1 5CZ0A 4OE7A 2J9XA 4FNTA 3NL3A 1JULA 2EF9A 3L67A 3S42A 3CIXA 3W2LA 3BGJA 4UFMA 1LLZA 4NJJA 4UTTC 4Q4KA 1DORA 2Y7DA 3F03K 3IGUA 2WNZA 4CNNA 3MBFA 4Z1CA 1F5ZA 3C3NA 4XZ9A 4MOZA 3THQA 2A85A 1SFLA 3SR7A 4CQAA 4O4VA 1OF8A 1SO4A 1OYCA 3UY8A 3R8RA 4LUJA 3UQNA 5C55A 1SPQA 5K3VA 3W7MA 4WY0F 3W85A 2A1YA 4M19A 3LLDA 1G6CA 1Z42A 2B7QA 3RNDA 1HO1A 3KVLA 4IXXA 3C56A 3LTPA 3NEVA 1Q6OA 2R8WA 2QKFA 2B7PA 2Z1BA 3LX9A 3MYPA 2QJHA 1GOXA 1Q3NA 2QUVA 3KHJA 1FWNA 3QQ1A 1P0KA 3KVMA 2Y85A 3I68A 4UTWC 3O1NA 5F1VA 5DCBA 1F6KA 4YLWA 4Z1AA 3LBCA 5DY3A 2NXIA 3S9YA 1OFBA 2R14A 4JTHA 2UV8G 3N2XA 3C6CA 3BARA 3T7VA 2Z2UA 3GXNA 3EB2A 1LDCA 4W9TA 5HINA 5LGXA 4O12A 3G3MA 2YGYA 2B7OA 4PL1A 2DZWA 1JUBA 4FIQA 4IGHA 1W54A 2QCGA 1GG0A 3W2MA 1GVOA 4OT7A 5TQLA 3LV5A 1FY6A 1VCFA 4K36A 2CZEA 5ABTA 2NUWA 1AL7A 4LOCA 1T0OA 5F2MA 1TMHA 1XL9A 3LGEA 3W3OA 1DKWA 4N9EA 5D33A 1Q45A 4S1FA 3S1UA 1IIGA 4AB4A 1BKSA 1R2RA 2W79A 1P0NA 2JK2A 2BLEA 4FO4A 4UUIA 2C15A 3ELFA 3QPZA 3LHVA 4GUFA 2J9YA 1DQWA 2RH9A 3DGRA 1LLWA 2NX9A 2X2GA 4K8HA 1JCLA 4FX7A 5A5WA 4UTMA 4DBDA 1KFLA 2X30A 1LBFA 4YL2A 5G4WA 2FFCA 4LVDA 1GQNA 3STCA 4O13A 1WA3A 3M7WA 4TU1A 4O50A 2VFIA 4KFPA 1EP2A 1R2TA 2QAFA 2ALDA 4Y9AA 5CZJA 3OHIA 2ZZ5A 1VS1A 2E5BA 1VYRA 4DEFA 2CLKA 2CZ5A 3SFKA 1E51A 3G8EA 3QW3A 3H53A 2HSAA 1VJIA 3E49A 1EWEA 2QCLA 4IX0A 4IMCA 1KFBA 3CEPA 3Q94A 4LS1A 2BSLA 4KWVA 3GAKA 1LROA 1MZHA 2Y62A 2JKEA 4ZQRA 4FNRA 1QCWA 5AHMA 1VQTA 3BW4A 1QPQA 5DBUA 2WNQA 4A2RA 4JTIA 3BVJA 4O1DA 5FEXA 3TIMA 1DJNA 1SZEA 2C18A 3ANYA 3GAYA 1SW7A 4N4PA 4RZ6A 1QO5A 3IGSA 4HT3A 1GYLA 1TSIA 4UR8A 4GJ1A 1OHLA 1EUNA 2FJKA 5FF7A 1B3OA 4O18A 5U4NA 1KLYA 3NM3A 4O11A 1IXQA 2QDGA 5F4WA 3DFPA 5HNRA 4HPXA 2ABAA 3GR7A 1JUKA 3UWQA 3EXSA 3QRHA 1Z44A 1TPC1 3OVQA 1XBVA 1W3TA 4I7VA 2FDSA 1K8XA 3PB0A 3BG9A 1N7KA 1RPXA 3INPA 4O0ZA 2BTMA 1H7XA 3O63A 5FI8A 1FQ0A 4JYDA 1PCKA 1WOBA 1XCFA 3IIPA 1WOAA 1FWTA 4CQ8A 2QJIA 3QMSA 1OVDA 3N2MA 5LNVA 4WUIA 5K2ZA 5AYYA 1YXCA 1WYIA 3PBWA 2X1RA 1FWSA 3LBMA 2E68A 3A22A 4M7SA 3NL2A 5AOUA 3HO8A 3NPWA 2NV2A 3O8AA 3GKAA 3W87A 4P61A 3UD6A 1V5XA 2AQWA 2QF7A 2ZZ7A 1S5WA 2ISSA 1X1ZA 2X1UA 3CQ0A 1EB3A 2CLFA 5A8GA 3WJWA 1LBMA 3NQ7A 3G1AA 3P5YA 3SGUA 3C4UA 1T99A 3TXZA 3NPUA 2VFFA 2TMDA 2DORA 5C5YA 4UFLA 5F2LA 3GXTA 3TX9A 4RX0A 1KTNA 4N4QA 3M5ZA 3RMJA 3STGA 3M9YA 5LNSA 2FB2A 3U2OA 5D38A 3PAJA 5K9CA 3TCEA 3QSTA 4PFMA 3O07A 1H7RA 1KBJA 2CLLA 3NQ8A 2ZRZA 3TW6A 1ZCOA 3G1DA 4BI6A 2A7RA 4GUGA 5HUOA 3SECA 1XUZA 1XBXA 4FXSA 3TA6A 5L9FA 2YCEA 4HNUA 3DENA 3WK2A 1VGAA 4NT0A 3W7DA 1H51A 3DFOA 2EHHA 1U5JA 2QCNA 3F4NA 3QF0A 4WY0A 2ATSA 2FQIA 2YYUA 3LI1A 1OX4B 5CPNA 4RXFA 2XN2A 4ZQCA 3LTYA 4WY0B 3MHGA 1J5TA 5IBXA 3G24A 4JTEA 3N3MA 1M5WA 1F6PA 4UFJA 3U8GA 2VFEA 1H50A 3NVTA 1VCGA 3ABRA 3DHDA 2ZRYA 3NPVA 1O5XA 1H62A 4Y90A 4GUIA 1H1ZA 1SQ7A 5MHBA 3RF9A 3C2RA 1EPXA 3W88A 3TAKA 1ME9A 4LVGA 2VOMA 2BWGA 3OBKA 2C1HA 4LV4A 5KINA 4BFAA 2FLIA 1VYSX 4IOTA 1JCNA 2CWNA 3B4UA 4LTSA 4NJGA 3A5VA 3LTSA 1GVSA 5SWUA 2BZNA 4OV4A 3BO9A 2C13A 2YW4A 3ABQA 4JY8A 5HQEA 2Y6ZA 3P81A 3G1SA 3QQ0A 4JIPA 4HN4A 1P5BA 3N9SA 1G4SA 2E6FA 2A21A 3TFXA 3M47A 3LI0A 3FFSA 1MSSA 1KFJA 3NA8A 3EEGA 3L5MA 3UNDA 4NXKA 4WD0A 3HGSA 5C6MA 3HBLA 3EWZA 1GZGA 5CPMA 5FEZA 1AW2A 4NX5A 1TRDA 2RHGA 2Y61A 1FCQA 3NZRA 3Q2DA 3M41A 2V5BA 1KM4A 2ZRVA 4NZFA 5K9DA 5G2HA 1QMLA 2GVLA 1ZHAA 2NV1A 4JTKA 3PM6A 3M5XA 5D2YA 2Q8ZA 1TCDA 2WNNA 2P1FA 3V75A 1H7NA 4FIRA 2I14A 5FF4A 4ZQOA 3R5EA 1GJPA 3E96A 3LRMA 5I3JA 1K7XA 2FPTA 2ISWA 2Z6JA 1I2OA 4K6AA 4LUIA 3GNNA 4LC8A 3W1RA 5G1YA 6ALDA 4Q33A 1YLVA 1VH7A 4EOUA 1V7YA 1I45A 2X16A 3CPRA 4DBEA 1XXXA 1LP6A 2XN1A 4MFEA 1TB3A 3S8HA 1ONRA 3LXCA 3G3DA 2B4GA 2YR1A 4POCA 4IMGA 3W07A 1Q6QA 1O5KA 1A5SA 1OABA 3TJXA 4O4WA 1KV8A 3HQ1A 3PG8A 3LERA 1ICQA 1YTDA 3B05A 1AW1A 1Y0EA 3FA5A 1X8FA 1LORA 3DFSA 1WAUA 1ZNNA 4N02A 1PV8A 4M6VA 4UR7A 3FIGA 5I3IA 5HR7A 2Y88A 5KZDA 4MZ1A 1ZFJA 1TPVA 1RR2A 4K7YA 5KITA 4JX6A 3M5VA 1O94A 4DF1A 4WQ6A 3HPSA 2GQAA 2QEZA 3B0UX 4WOQA 4XKYB 4YCPA 3KRUA 5HUPA 5D2WA 3IV3A 4M5PA 1QPOA 1FCVA 3TKFA 5E0KA 4RZ4A 1PVNA 1CW2A 4LVBA 5DLCA 3S1XA 1HL2A 3UPWA 1B57A 4TO8A 4H4IA 5F4SA 2PURA 5FF0A 4H6KA 2B0MA 3P61A 6TIMA 2FTPA 3NAVA 2VFDA 3CEUA 2QUTA 5KZMA 2A4AA 5LSMA 1OFOA 4PA8A 3C8FA 3IVUA 1A5CA 4NNCA 1KFKA 2GQ8A 3PULA 3BG5A 4ZQMA 4NX0A 3DI0A 5D32A 4QJ1A 5AHNA 1FX6A 3C2EA 1XM3A 1TPDA 4ADTA 1FDZA 5F2IA 4I7UA 1CX9A 5HULA 4LV9A 3W1LA 4U28A 3TQ0A 2Q3RA 4MUZA 2OX1A 4O1BA 3FYPA 3CT7A 3NYZA 3PS7A 2C0AA 3BK0A 3N19B 3PBVA 2ZYFA 3IEBA 5BNKA 5DCEA 1QAPA 1ADOA 1H63A 2WSRA 1TTQA 2QUUA 3P8JA 2J9ZA 3UZ5A 3TXVA 1BEUA 1H5YA 1IIHA 2ISVA 2J27A 4R33A 4QM1A 3HMJG 3GYEA 3W2UA 4C1LA 2QCEA 1QWGA 2A6NA 4ZZ9A 1IXNA 3PVFA 4UTLA 1G7UA 1WBHA 5CSRA 3QMRA 4OQVA 3CTLA 5LKYA 2NLIA 1YDNA 4FNSA 3R13A 2QCFA 5H91A 2YFOA 1TV7A 3SW6A 3TC6A 4TR9A 3CHVA 2O7SA 4AWTA 2IQTA 5EYWA 4IMFA 3NPXA 3FKRA 3G1XA 3M1ZA 4JTJA 3L68A 3W7QA 1NFBA 3I7RA 3QEZA 3DI1A 5AC7A 1WQ5A 2ZA1A 3VE7A 3M44A 2XN0A 4AH7A 1RQEA 4FNQA 4E38A 1K03A 5AC6A 2QJGA 2DZTA 4XBKA 1AMKA 3GR8A 1VC4A 5EA9A 3LCLA 3R12A 4FNPA 2QCHA 1SSDA 1VCVA 3SZ8A 2WPBA 4O53A 3WFAA 4M7TA 2VFHA 2TSYA 2NXGA 5HWJA 4IQLA 4HSNA 4N9BA 3G1YA 3MMTA 4ADSA 1TV8A 3BLFA 2C16A 5AHFA 1KV5A 1GWJA 1YXDA 4E0CA 5CKSA 1WV2A 2G97A 1XI3A 3NQEA 4DO6A 3HJZA 5FF2A 1ML1A 4AVFA 4P2VA 3IVSA 4NU7A 3S5NA 1ICPA 2G96A 3GDKA 4I9AA 2H90A 4TMBA 5DXYA 3PC0A 1YXYA 5AC8A 1KM2A 4GE8A 1SW3A 1I2NA 5G5IA 3VKJA 3P80A 3DFTA 2W0UA 4X22A 3O05A 4GXMA 3U6WA 3LXBA 1SZFA 5KSWA 4LW7A 4BWLA 1DBTA 1GVRA 3UZJA 4NNAA 4ZQPA 3C52A 4ZL1A 3DAQA 4IJBA 3FS2A 3S5OA 3M6YA 1TQXA 2V2DA 4JS3A 1H60A 3B03A 3WK1A 3EX2A 4NUWA 2ZA2A 3QH2A 2WJZA 3FKKA 3S1VA 4PCFA 3UWYA 5L6UA 5G1TA 4HPJA 3ZWTA 5E1QA 3CB8A 3WK0A 1SUXA 5EMUA 1QPNA 3W7OA 2YW3A 4N9CA 4JTUA 3O06A 1NEYA 2ZZ1A 2OCZA 4IXHA 1KM6A 2VELA 4PODA 1OYBA 4CCDA 3W1PA 2QR6A 5K9XA 3P74A 1J4EA 4UC5A 1UUMA 4IX2A 2C3ZA 1TRIA 3G0XA 4LS0A 1JCXA 2ZFAA 3KRZA 4TIMA 1RQBA 3IRDA 2CLMA 2CLOA 3DZ1A 5HJLA 3PUDA 1QR7A 3FLUA 4FEZA 1EX5A 4UNLA 3TNOA 4MJMA 1ALDA 1TPUA 2CU0A 4JDYA 3W1AA 2NWRA 1EP3A 3LCFA 1CI1A 1KFCA 4GNJA 3B06A 1FCUA 3I6RA 4YCOA 3W7NA 2WO5A 1BTMA 2VEKA 1SSGA 5BRBA 3B8DA 2J24A 2ATMA 4NVTA 4NZJA 3W7EA 1W8SA 4GWEA 4LRSA 4FX8A 4O28A 1RD5A 3IIVA 3L66A 4WOZA 4HHPA 3O6CA 1D9EA 4UTIA 4MY9A 3W7PA 4DPQA 2A6LA 3P5ZA 4R7JA 1VR6A 1TPFA 1ICSA 2CLIA 3ZFHA 4YXGA 1FWWA 2QCCA 3SY5A 1EUAA 1LYXA 2JGQA 1RV8A 2VXNA 3GLCA 5HR6A 1KA9F 3OVPA 1TYGA 5LNUA 1T8XA 1EIXA 3YPIA 2ZZ4A 3FYOA 3G8RA 3NQ6A 5TIMA 3GKFA 3HGRA 1C8VA 3W7GA 2EKCA 3HOJA 3FJ6A 3MBDA 3NL6A 4RLIA 1L6WA 1R46A 3ATYA 1ZENA 3CWNA 2ZZ6A 3GIYA 3MHFA 3LHTA 4ML9A 1NVMA 3GNDA 1TPH1 3CC1A 5LGZA 4LS2A 1QNVA 3EX6A 3HIJA 3PB2A 3W71A 2NX1A 1X6UA 3UPBA 3EX1A 3LCXA 2VFGA 4AXKA 4AMAA 3LCWA 4XBSA 2R94A 5D09A 3NQMA 3UWVA 3EXTA 2ZZ3A 3QPYA 1ZALA 2ABBA 1VLIA 3PG9A 1RZMA 5DBTA 4UTKA 3CM4A 4RK8A 4A29A 4FXRA 4ZMGA 2LLEA 2GVGA 8TIMA 1F05A 3KVKA 3TK7A 1WXJA 4ADUA 1A50A 3S5ZA 1L2UA 1WBJA 1SZGA 2RDUA 2YXGA 1DHPA 5HWMA 3M43A 1JRBA 2Q8LA 5I3FA 4WX2A 3TJLA 1LTDA 3UWWA 1NSJA 3QC3A 5CPOA 4E2DA 4IMDA 3O16A 2Y7GA 4XUGA 3NR0A 3USBA 2EGZA 4DELA 4G1KA 3W6YA 5AB3A 3EKZA 2R91A 2X1SA 1TREA 1VZWA 5I3GA 4O52A 1G7VA 1B9BA 3F4WA 1S3HA 4BR1A 3LDVA 1JVNA 3A21A 5CGQA 3W7LA 5C54A 3DKJA 3W73A 4IPIA 3DFNA 1S5VA 1M7OA 1BWLA 1OJXA 4ONVA 5D2VA 1W0MA 3NQAA 4GUHA 2E6DA 4AHOA 2Y70A 1TTPA 1L9WA 3E9AA 4H3DA 3IVTA 2JKAA 2VC6A 3VE9A 3CIWA 3TE9A 3W22A 3QJAA 2YZRA 1YDVA 3QSRA 3P60A 4MLRA 5LHEA 1W3NA 1UCWA 4JX5A 3W2KA 1L6SA 4Z1DA 3BLIA 5I3HA 4R34A 2FPVA 3AJXA 3VNDA 4BI5A 3TSMA 3EWWA 1K7EA 3O15A 3O6YX 5CZSA 2I1OA 2H8ZA 3CWOX 4B5NA 1H61A 3Q58A 4AEOA 1OFPA 3TU9A 3NO5A 2A7PA 3LHYA 2VEMA 3NQCA 3TUUA 3RU6A 3B0VC 3N9RA 4OHQA 4XWUA 1FWRA 4XKYA 1SZNA 5U7SA 5EY5A 1N55A 1ZAIA 4HKPA 3TMQA 7TIMA 2NWSA 2F84A 3DBPA 5LNRA 4BK9A 2GQ9A 4O1CA 2YSWA 1MEHA 4DPPA 1K02A 4CCEA 4JIQA 3GZ3A 1DL3A 4MFDA 1GEQA 2V2HA 1PE1A 2OJPA 1I8JA 1TPEA 1JQXA 3VI2A 4N9DA 1QDSA 2HS6A 2QCMA 1LRNA 5D30A 5AYXA 2ZA3A 4LU0A 1RVGA 2WKJA 4S2CA 3ZR4A 5AHLA 1IXPA 4U4MA 2P0OA 1W5QA 1MEWA 4KWWA 4NJKA 3TV8A 2E6YA 1YPIA 3D0CA 3PF3A 3W76A 3ATZA 3C61A 3KXQA 1HTIA 3TSDA 4CQ9A 1IGSA 4M6QA 4PL2A 3MI2A 3GDLA 3PBYA 1VHCA 3EX3A 3ABOA 2BX7A 2O7QA 5FF3A 3SSJA 3O6DA 1I2PA 3NQVA 3R89A 5IM51 1W37A 3S1WA 4GRSA 1HO4A 3RFAA 3G1VA 1X7FA 1KFEA 3G1HA 3WJXA 3TDFA 4LWWA 1VHNA 4DF2A 1JCYA 2ZZ2A 1DV7A 3HGOA 1FDJA 2AAMA 2DJLA 1SO5A 1KM1A 3MP3A 1SW0A 1HG3A 3G0UA 3AO0A 2GPTA 3GXPA 3TH6A 4QAIA 1W31A 3B0PA 4LY8A 1LOLA 2WSYA 4A22A 2VENA 4OWGA 4QNEA 4UFHA 3EX4A 2X1TA 3NGJA 1PIIA 1Q6RA 3RK8A 1YTKA 3FEMA 1GTEA 1I2QA 4UTUA 1GTHA 3TR2A 3T40A 2A7NA 1F2JA 4JN6A 1EP1A 1FUYA 2H8XA 3LXAA 1XKYA 1F7BA 1OK4A 3W7RA 5F4XA 5T26A 1SU5A 1FDYA 3QZEA 3KOFA 1O4UA 1B4EA 4N6EA 2YFNA 3W83A 1KBIA 2V81A 3L5LA 4LVFA 3UY7A 4TMCA 1OG0A 1FBAA 4PTNA 3Q37A 2QCDA 4X9SA 4JTFA 1A5BA 1XDLA 3OIXA 1KW1A 4JDBA 4ZVJA 3LHZA 1J2WA 5DXXA 1P1XA 3HG2A 3W84A 2V2CA 4JXCA 5D05A 2DZXA 4O57A 1OX6A 2GJLA 4L4MA 4X2RA 3L21A 1PHQA 1XDMA 2ZTKA 3LV6A 4MYXA 1W3IA 4AF0B 1TO3A 3W1TA 4GBUA 3W86A 1ZAHA 2ZRUA 1G4EA 1W5NA 2OT1A 3NOEA 5D02A 3VCRA 3N34A 4RJEA 4PH6A 4Y96A 5FEPA 1JRCA 3UWUA 1H7OA 2FB3A 1Z41A 3MP4A 3BW3A 4CLMA 3MWAA 1THFD 4IUOA 1F74A 2E09A 4XQ6A 1TPB1 1KM3A 4J9JA 4DO4A 3STEA 1TPWA 2PE4A 3NQFA 4UNKA 4FX6M 4KKXA 3E02A 4R53A 3W7HA 3S0CA 1AK5A 4UXDA 1LRQA 4OGZA 3L9CA 4Z08A 3JR2A 3NG3A 3LRKA 1GG1A 1IXOA 1WX0A 4UMCA 1DOSA 1W5OA 3KFTA 3G1FA 1ZY9A 1DQXA 4JD4A 4OBTA 3W74A 5KZEA 2EPHA 4A3UA 1FXQA 3GX9A 1ZAJA 5G4EA 2ZBTA 2C6QA 5BMWA 1TQJA 4UTHA 5EPDA 2NUYA 3EWYA 4RXGA 1MO0A 4WZHA 2DZUA 1C29A 3DFQA 3GK0A 3I7SA 1OFEA 3KRSA 2QCDB 1Z48A 3OEXA 2JKPA 1SO6A 3LB0A 3L0KA 3R2GA 3UWZA 1L6YA 2C19A 1DVJA 3DU0A 3A24A 3KVJA 4Z0SA 1XFBA 3TQVA 1PL9A 1OX5A 2A0NA 2NZLA 4UTTA 1A53A 3T55A 4UMBA 5LHFA 5G2IA 3PSWA 1XBZA 5J5DA 1PHWA 2DJXA 4JY9A 4E2BA 5D04C 4O17A 3TROA 3GDMA 2PC4A 4JTSA 2CW6A 2TYSA 2Z0IA 2G5WA 3NNTA 2E5CA 1TTIA 3TMLA 2V8ZA 3W2NA 4BF9A 1X1OA 4RZ5A 3UXDA 3DH7A 5AFDA 3LLFA 1F76A 1I2RA 4Y8FA 1H7PA 4O14A 1PS9A 2E6AA 3W2JA 4MZ8A 3STFA 3SIZA 1LZOA 3IIXA 3RLUA 1ME7A 2CZFA 4JTLA 2RDTA 3GB6A 2YYTA 2VEIA 2HS8A 5EKYA 4O54A 4XTDA 4UTWA 2CLHA 1W5MA 2NX3A 4O1AA 3MYOA 3HPZA 3THAA 5CZTA 3NQDA 5LZLA 1OFDA 1AL8A 5D2TA 3EXRA 3W7IA 2DZSA 2P10A 5EBUA 4EIVA 2EAWA 5J5RA 3EKLA 4Y6GA 3LHWA 3MUXA 1FXPA 4RR4A 4GC4A 5CSSA 3JRKA 3ZS4A 4QISA 3WJZA 4O8RA 3HPXA 2RKXA 3MI3A 3PY2A 3G0SA 5F1UA 4AWSA 3W7JA 1G67A 2V5LA 3DHFA 2NUXA 1QPRA 3QMTA 1KTCA 4FB7A 5BW6A 4K7VA 2AGKA 5AHIA 3EWXA 2Z6IA 5KTLA 1UASA 3OVRA 3HG3A 1M6JA 1H1YA 4MIMA 3W23A 3TSBA 4JTTA 2D73A 4CNPA 1IF2A 3GDRA 5DCDA 4DXVA 4ALDA 1NF7A 1LRTA 3E0IA 1TTJA 3DKLA 3LCIA 4MKNA 5AHEA 4X3ZA 3B04A 3TC7A 4A21A 3K30A 3NQGA 4RV8A 3H55A 2I9EA 4C1KA 4MLJA 3WJSA 3WK3A 1G4TA 5D03A 2DU2A 2J6XA 1P4CA 2ZTJA 2HTMA 2WOQA 3W9ZA 3NDOA 3M5YA 2OT0A 4QQ3A 4HIBA 3I7QA 3W7CA 1YADA 3W1QA 3M0ZA 3F1QA 3W1UA 2JBMA 1XC4A 1W5PA 1B4KA 1JQVA 4AHPA 3N14A 1HUVA 4K38A 2H3BA 1G69A 5F2GA 1GPWA 3W1MA 2H6RA 4LC6A 3MO7A 1OX4A 2WSQA 5HWNA 1K8YA 5KMYA 1A5AA 4MVAA 4DQWA 3MP5A 3QFEA 1JJKA 4EF8A 5I3KA 4JICA 3NL5A 3HF3A 3IIOA 3JS3A 3G22A 4NXSA 2V0TA 3BG3A 2YX0A 3EWUA 4WXZA 4BWLC 5CG7A 3UYCA 5AN7A 1R47A 2A2IA 1JCJA 2KZHA 1U83A 4ZQNA 2HMCA 2ZRWA 4O10A 2H3DA 5G2WA 3PUOA 5LNWA 1TV5A 3NXFA 3HB9A 3GVGA 3L65A 1AG1O 2CLEA 1GVQA 1VYPX 4UFKA 1RQHA 2Y7EA 3WJYA 5K7JA 1T96A 2VKZG 3BW2A 1Q6LA 3LCGA 3P8IA 4UFIA 2J88A 4DO5A 3C0JA 4HSOA 3BPWA 1VLWA 3L0GA 3ZWSA 5BMXA 3LHUA 4AF0A 5FESA 3GDTA 3L5AA 3BV4A 3PUEA 3A9IA 4RKAA 1K3UA 1MXSA 5HMSA 4ORIA 1UB3A 1VRDA 4MYAA 4WXYA 3MHUA 1YPFA 3QM3A 4MY1A 2XFWA 3ABSA 4JYEA 2CFFA 2Y89A 3RLVA 4BI7A 2Q3OA
chains in the Genus database with same CATH superfamily
1XGZA 4LAKA 3SJ3A 4MADA 2RDXA 3QLDA 1CLKA 5AYZA 1JUEA 1S5TA 4ICNA 3UR5A 1J10A 5H2ZA 1IEIA 5HNNA 4OU1A 3EMZA 3K46A 1SFJA 2E1DA 3ARSA 3KZPA 4HK5A 1O95A 2B31A 3AS0A 4W86A 5B7ZA 2WV8A 4IG2B 1EEPA 4LUSB 1GYNA 4LT9A 1RA5A 1DYSA 1JDFA 1JR1A 2RFGA 3V1PA 1H1NA 5A69A 1HQTA 3MKKA 4LNYA 4IFRA 5HDRA 3GC5A 1CB2A 2WJFA 4PMQA 1QUMA 2AMGA 2NVAA 2X05A 2E40A 2VL4A 4H2HA 2PDWA 3SM0A 3CLMA 5A6MA 2YCJA 3H2FA 3UVAA 3LRLA 4QLKA 4PEKA 1YNPA 3HG5A 4JX4A 4ZSTA 2GVEA 2XH7A 3H12A 4KEMA 3KL3A 1XH0A 2Y4SA 2A5HA 2OYLA 1C93A 4TQTA 2V3FA 3GIPA 3UESA 4V2XA 4DX3A 2V3DA 4OV9A 1SO3A 4Q8NA 1FWJC 1C7SA 3BSHA 3W72A 2F7FA 2Z28A 3P84A 1ECEA 4US5D 4DUOA 3FA4A 1BYCA 2XFFA 2ZRXA 4Z1BA 3ORWA 4I9JA 3AALA 3MI6A 2WC4A 3H26A 3L4XA 2WVVA 5CC3A 3S5YA 3BLEA 1M7JA 2ZC1A 2ZQ0A 4EF9A 4KCVA 2I5QA 2QDHA 1W2VA 1K7FA 4GYPA 4HHLA 3TFCA 5IFTA 3TAOA 1LWHA 1SJCA 3KBMA 1XUUA 2DZPA 3NM1A 1FFRA 1EJSC 3RJYA 1GVFA 1XRVA 4JFUA 2QIIA 3L4YA 3RYSA 4NZ3A 1OF6A 3WD3A 1QOQA 4QSHA 3W1XA 4FF7A 3RX3A 1FFQA 2W67A 1UR8A 1E1CA 2GLKA 3THCA 3PJXA 1YMYA 4CCCA 2J74A 4MJZA 3D46A 1YW1A 1I4NA 2XM1A 1N8WA 1HJQA 2GYIA 4LCRA 4IJRA 3SGZA 3POHA 2ZUUA 1KM0A 5E93A 3BGGA 3V5FA 4NASA 4XZWA 1B31A 5D37A 4MZYA 1CEOA 3P62A 3A5FA 4CNOA 1DWIM 4FNUA 3VIGA 1K6WA 2Y8KA 2EPMX 2PDQA 3W27A 5JQ9A 1G4PA 4OKDA 1SR9A 3FK4A 3SI9A 2ZCGA 3B4YA 4LY4A 3RRXA 1LL6A 1R30A 2CZDA 5C2XA 1ZJIA 3UXAA 1DJXA 1O60A 4UIOA 1YKWA 3QGVA 1H7WA 3EOSA 4GUJA 2Y63A 1UUOA 4WJEA 3IJDA 1MNZA 4KRZA 2FDMA 4WJXA 1NAL1 4OE7A 4GZJA 2J9XA 2B81A 1JULA 1UP3A 2EF9A 4ZTYA 3L67A 3W2LA 3BGJA 4W84A 4CN1A 3S9ZA 2R24A 2OB3A 2W5FA 2WJEA 4EK7A 3EWDA 4D8AA 1LT8A 3GVQA 2BOGX 2A85A 2XH0A 3AU2A 4IQJA 3SR7A 2BGSA 3CQJA 2OFJA 1OF8A 3VGHA 1SO4A 1S5MA 1OYCA 3R8RA 4IH3A 1EJ7L 3A47A 3N04A 2Y5EA 1VF8A 1A0EA 5AVHA 4M19A 1Z42A 2B7QA 2Z7GA 4GH1A 1HO1A 3KVLA 1EA9C 1FWBC 2R8WA 3PANA 3LX9A 2Z1BA 2WC3A 4KWUA 3DEQA 3UXLA 2OSXA 3CHCA 3QQ1A 4GQBA 3KVMA 4HU3A 2Y85A 1BRLB 4UTWC 3O1NA 5F1VA 1X7IA 3LBOA 3FVDA 2HRWA 3LD5A 4I9MA 3LBCA 1WUEA 2R14A 1CECA 3SCSA 3BARA 3WH8A 1B1YA 3KHDA 3QTGA 5HINA 3AOFA 4AIEA 4KH2A 4O12A 2IPGA 3ALGA 1EXPA 1UKSA 3T08A 1XD0A 2XVNA 3RG6A 4Z2GA 5LA0A 2XM2A 4ZE5A 1NOWA 4PL1A 2FTYA 4FIQA 4IIBA 1Q85A 3BOXA 3FDKA 1GG0A 2J77A 3WD0A 4HOWA 4AD2A 5B80A 5ABEA 2NUWA 4NAFA 4NG3A 1TMHA 1XL9A 3WD1A 4A4AA 3KL5A 4CU7A 1IIGA 3GHUA 3EOOA 1R2RA 2W79A 1P0NA 1NP2A 2CKRA 2GJXA 3ELFA 9CGTA 3CAWA 1VD6A 2ZIDA 4J3UA 2C7FA 2X2GA 4IJCA 4O8AA 1JCLA 1JDDA 4GCAA 5HAOA 3WQ5A 5REQA 2X30A 2W3ZA 3SAZA 1LBFA 3H70A 5D4YA 4A8LA 4QP0A 1S2CA 4IUGA 1UH3A 2Z1SA 4Q8OA 1VS1A 3T6CA 2CLKA 5JH1A 3M0XA 1QNRA 4YTSA 1VJIA 2J7GA 5I06A 4KEUA 4H9MA 2DUZA 3LGDA 1XSKA 3AU6A 3TTQA 1MZHA 3SUUA 2JKEA 1FP8A 1Z9AA 2CBJA 4XZHA 1W9PA 3UW6A 1V02A 3T9PA 4JTIA 4HOXA 2C18A 4JEJA 1NOUA 1NWRA 3IGSA 5HJXA 4GZ7A 2YDSA 4GC3A 3G2GA 3KP0A 1EUNA 3O6AA 2FJKA 2X2YA 2POZA 3NM3A 1UW9A 2V68A 3RO8A 2QDGA 2GJPA 1WP6A 3ITTA 3GR7A 1JUKA 3EXSA 3PTMA 3F5LA 1QRQA 3CS2A 2WYSA 2W27A 1K6AA 3OVQA 5BU9A 1XBVA 4J1OA 2FDSA 1K8XA 2J8GA 3BG9A 2BTMA 1GZJA 3O63A 3NWRA 4PYSA 2BOFX 4Q4PA 1E55A 3QMSA 4RV3A 3QV9A 1QI0A 5K2ZA 3GNOA 1RHCA 4UQCA 1K9FA 2X1RA 3GHTA 1FWSA 3LBMA 1TWWA 1BSLA 1PWLA 3MU7A 2PODA 2PBGA 3NPWA 1VPQA 2VP8A 2HQAA 4F0LA 4TTGA 3GKAA 1VB9A 5KEZA 2W62A 2AQWA 3DG7A 4S3GA 4GYPC 2DPEA 2QDEA 3GD6A 4QAWA 2CLFA 2ISDA 3P5YA 3O9NA 1TMQA 2A3EA 2O4MA 3TXZA 5JBDA 2HWGA 3ICJA 1AQFA 3OTRA 3H4WA 3QXBA 2TMDA 5C5YA 3TX9A 1KTNA 2ZDSA 3WH7A 3GUGA 3U2OA 3TCEA 5FAGA 3SDOA 3O07A 4I8DA 3BMWA 1Q13A 4HU0A 1ZCOA 1F3TA 4BI6A 1R3QA 3FNDA 4J3SA 3SECA 2PEVA 3RU8X 4HNUA 1E3XA 2VEFA 4NT0A 3C3UA 4XKMA 3DFOA 2QCNA 3F4NA 3QF0A 4LYQA 5C0QA 3LI1A 1OX4B 5CPNA 5IRPA 2WBGA 2XGBA 1UC4A 3ITLA 3PJTA 4ZQCA 3WO8A 1V03A 3B97A 1J5TA 4AU0A 1E4IA 3U8GA 1F6PA 3MMDA 3Q67A 2YL6A 3BXWA 3B9OA 4E3TA 3E2VA 3LEPA 3N2BA 3C2RA 4D6JA 4Z2KA 3IV8A 3TAKA 4LVGA 3GG0A 3TTYA 2VOMA 1H11A 4YS1A 5HMEA 3AXMA 2FLIA 1VYSX 3PPHA 1JCNA 2CWNA 4F4RA 5LIKX 1GVSA 4M56A 4OV4A 3L4VA 2YW4A 1KCLA 4JTRA 3P81A 5HQEA 3USZA 3QQ0A 1Y5XA 4DO7A 2HXTA 1P5BA 4UQAA 3EDJA 3J7HA 3FY1A 1MSSA 1Y5WA 3APYA 1KFJA 3VDAA 3EEGA 2Z1KA 3UNDA 2QULA 3O2LA 3HGSA 5C6MA 1BF2A 3R1ZA 1GZGA 4CEUC 4KBXA 4NX5A 1DE6A 2EXOA 1FCQA 3NZRA 3Q2DA 1U1HA 2ZRVA 1QMLA 1XLBA 1E4NA 2NV1A 3FGCA 5CBBA 1L8PA 3M6DA 1PZ1A 1ZP4A 5D2YA 2WNNA 3B8VA 4ZQOA 3NUKA 3R5EA 1E9ZB 4K8GA 2BNJA 4R5EA 2Z6JA 3E6EA 2IPJA 3GNNA 4P5UA 2E3ZA 1NQKA 1RVKA 1TZ7A 3BTNA 1VH7A 2INFA 1V7YA 2DZBA 1LP6A 5AECA 2VCCA 3BICA 3FN9A 1JZ2A 5DRCA 3VO0A 4JL2A 3PJWA 4GI4A 3WDPP 1RA0A 4Y9NA 1AW1A 2I5IA 3U48A 1Y0EA 1X8FA 1E1EA 2VZSA 3V18A 1TVNA 4XSLA 3KM8A 3FIGA 5GNYA 2Y88A 1EFZA 4MZ1A 3UG8A 1ZFJA 5BCAA 3ITXA 3ME3A 4PBGA 1WUFA 2P53A 4AVNA 5I6SA 2ESCA 3M5VA 4DF1A 3RDKA 2X41A 3B0UX 4DWSC 3ZT5A 4YCPA 3KRUA 3IV3A 4M5PA 1TX2A 3WLSA 5E0KA 2CBUA 2DIJA 2PP0A 1HL2A 2JIEA 3VD7A 1B57A 3R10A 1A3XA 4TO8A 3H21A 3SBFA 3AIVA 3L2LA 2B0MA 3P61A 1RJPA 2I57A 2VFDA 3BLLA 2GGIA 2A4AA 5KZMA 5LSMA 3LS9A 2PGEA 1A5CA 3PTDA 9RUBA 1KFKA 2EG7A 3JW7A 2V5CA 3PULA 3BG5A 1I1WA 3WSUA 1XP3A 3B8IA 1T8QA 1XIGA 3C2EA 1XM3A 4ADTA 4CD6A 3WLNA 2GGEA 3L4ZA 3U4FA 4CU8A 1CX9A 4AZ6A 3AIQA 3CLWA 3E2RA 2EG6A 1V77A 5E9XA 5H1WA 2WB5A 2C0AA 3BK0A 1VFMA 1JCTA 4B5WA 5GPRA 2J9ZA 4YTTA 1AZ1A 2BB0A 1BEUA 2I16A 1WPCA 1US0A 4R33A 3GYEA 3MUIA 2QCEA 4WSJA 1EJVC 4ZZ9A 1IXNA 1G7UA 4PUDA 4KF1A 1P0EA 3QMRA 3UJ2A 1YDNA 2FGLA 1OC6A 4B91A 3WLQA 2QCFA 5H91A 3QHMA 2RGMA 3V1HA 1TFVA 4N0RA 3NPXA 1GJWA 3W7QA 3I7RA 1WZLA 1D8WA 1O12A 3DI1A 5AC7A 3M44A 2OPJA 5HQMA 2I5GA 1GKRA 1UZHA 1ISVA 1XRTA 3WUEA 1W9VA 3R12A 4FNPA 4KGJA 3BV7A 1VCVA 3SZ8A 4GABA 2VRQA 3WFAA 4GIAA 2TSYA 3NSMA 3H7UA 1TVLA 4CQBA 4ZB0A 4URIA 3MMTA 3W4RA 4GKLA 1FRBA 5TF0A 3L23A 1XYZA 1OZQA 2E9LA 2Y8VA 4C6IA 1GWJA 4E0CA 1ITQA 1QWKA 2QMKA 1UH4A 4XZLX 7A3HA 3ALFA 3EPNA 3FJ4A 2PGWA 3HJZA 2F2KA 3GTHA 3IVSA 4NU7A 3S5NA 1XV8A 5H8PA 1AVAA 3KRBA 3RN6A 1X98A 6REQB 1SW3A 1I2NA 3VKJA 1PX3A 3RM8A 4X22A 2FZNA 3N25A 1DP0A 1DIKA 4L6OA 2G3JA 4LW7A 3ZOAA 3C52A 2WZHA 3B0YA 2V2DA 2IKIA 3B03A 1XLIA 4W89A 4QTGA 4U3CA 2WJZA 3FKKA 3S1VA 1UWAA 1WKFA 3BE7A 3ZWTA 1TWIA 2PTZA 1SUXA 2V69A 1QPNA 4RE3A 2GUYA 2NQJA 4MMWA 1F6YA 3O06A 1R38A 1W2PA 4H6RA 1UZ1A 1DXFA 4A6GA 3CAQA 1HN1A 4CCDA 5K9XA 4UC5A 1UUMA 2C3ZA 1TRIA 3G0XA 5A8NA 1JCXA 5CH9A 2CLMA 1IWBA 4P7QA 4W8LA 5DMNA 1A0DA 1JPKA 1OGGA 3PUDA 1QR7A 4RDWA 5FL0A 4PCSA 4LUSA 4XK2A 1E40A 4UNLA 1QVBA 4MJMA 1ALDA 4JDYA 1EGVA 1TELA 1MNSA 3LCFA 4ZB2A 1SMDA 2PWEA 4JFTA 5FAJA 5I78A 1FCUA 1D8CA 3W7NA 2PDGA 4CN6A 5BRBA 2VEKA 1UKPA 1BF6A 2J24A 5CPSA 2ATMA 4NZJA 5A6SA 3W7EA 3ARRA 1W8SA 3HFTA 4LRSA 3IIVA 5REQB 4HHPA 2VZUA 2BASA 2W66A 4RW3A 1IZKA 1L0PA 2G4JA 1ICSA 3MUY1 2CLIA 3QOMA 3T09A 1RV8A 3GE7A 3GLCA 2EQDA 5LNUA 2ZZ4A 1LL4A 4QLJA 3FYOA 3G8RA 1J2BA 4WCJA 3HGRA 1Q4WA 2EKCA 3HOJA 3FJ6A 3WLHA 3NL6A 4NP7A 1UD6A 1QK2A 3GS6A 3P0XA 4ZOCA 4OQVA 3ATYA 1ZENA 4ML9A 3VILA 1VEOA 1TPH1 3LNPA 2VTFA 4JZ5A 3HIJA 4DM1A 2DSKA 2NX1A 3EX1A 3OHMB 1A5KC 3LCXA 2R94A 4ZEPA 1GKQA 2XIQA 2ZZ3A 1FWGC 3RUBL 2FFIA 4GBDA 2PBOA 1Q6EA 2LLEA 8TIMA 3R94A 1MFVA 1MW3A 3TK7A 1E1CB 5A3HA 3F2DA 1ISXA 4GIEA 1AUSL 1SZGA 2UY4A 5GNZA 5D9PA 2I7GA 3K2GA 3RILA 3BL3A 3S9IA 1JGMA 5E9AA 4XUGA 4IP4A 1UIPA 4BKNA 4XIAA 4LAZA 3QY8A 5IOBA 1OG6A 4LYRA 2X1SA 3CPUA 3I3DA 3A21A 1JZ5A 1IR1A 4V33A 4NI3A 1JEZA 1BWLA 4JTAA 3HQOA 1NY1A 3RXZA 3NQAA 2DVXA 1DIOA 4OOZA 4AHOA 5HMDA 2ZE0A 1NWTA 1EL3A 4C65A 2BVWA 3GQYA 1UP0A 3TE9A 4MG4A 3QZAA 2C91A 1HJXA 4GXWA 2YZRA 1YDVA 3P60A 2J75A 1XLLA 5LHEA 2XDFA 3B8UA 3WEZA 4HP5A 1UCWA 3UR2A 4JX5A 1L6SA 2DQWA 1XCWA 2DSWA 4XIMA 3ABXA 1K7EA 2C71A 2EG8A 3O15A 4UBPC 4Z17A 4IGMA 1H61A 1UHVA 5HMFA 2BVYA 2WHKA 1GQJA 3CZGA 4R9OA 5LXXA 3B0VC 4NF7A 1ZPTA 4OHQA 1SZNA 2HVNA 3WUBA 1N55A 3GU1A 4QGCA 2OSWA 3AXKA 1DJWA 3F4VA 3R7MA 2F84A 3DBPA 5LNRA 4BK9A 4HA3A 2GQ9A 2GOKA 5DMLA 3URAA 1W9BM 3VMNA 2YSWA 4GVFA 4ML4A 1K02A 2E8YA 2VJXA 4JIQA 4CCEA 2BOEX 1E43A 1CIUA 2V2HA 1PE1A 4B9ZA 3FJNA 1NM9A 3K8KA 4N9DA 2HS6A 1WDSA 2F61A 2QCMA 2OEMA 1DWFM 3UJSA 1CGXA 1BRLA 1RVGA 3TTSA 1FWCC 3S4TA 2H9AA 3NDYA 3MVIA 3ARXA 3I6EA 1QASA 8XIAA 3KP1A 3S3GA 3LG3A 4GD0A 5LIXX 3CMGA 2VC5A 3LUTA 2BHZA 4ERAA 1LQAA 3ATZA 2DUAA 1XKJA 1QW9A 4ILSA 4CQ9A 2F6XA 5I0DA 4S38A 1E70M 3E2SA 1JGIA 1VHCA 3DFYA 3ABOA 3GTNA 4JFSA 2O7QA 3SSJA 3O6DA 3RPTA 3R6IA 4UB9A 4H9YA 3S1WA 1HO4A 3LGGA 1A5MC 3AMCA 4WKFA 3LM3A 4LWWA 1VHNA 2E8ZA 4EAMA 2AAMA 8XIMA 2V63A 2PDUA 3AO0A 2GPTA 1H3GA 1VFLA 4BA0A 3TH6A 1ISWA 3B0PA 4LY8A 1LOLA 4OWGA 3WD2A 2XZ7A 1CPUA 3EX4A 4C6QA 3QQWA 3OLEA 4JFWA 1W1B1 1YTKA 4OECA 2R1KA 2HROA 1M3UA 4LUTB 3IWPA 3OLDA 4Z2IA 1OK4A 1QW7A 1O1ZA 4AFYA 4PUKA 1IGWA 3KOFA 1O4UA 4GO8A 5HA7A 4LEQA 2VGIA 3ERPA 3S2MA 3N6HA 3N12A 1YPXA 3L5LA 4TOQA 2VZVA 3Q37A 4PBEA 4JHZA 3GC2A 4JTFA 1A5BA 2YL5A 3CUIA 4O1EA 1EOKA 4ZVJA 1IEQA 1P1XA 1OM0A 2XIOA 3HG2A 4H8NA 2V2CA 1LUCA 2DZXA 2ZTKA 4IIDA 2O9TA 1E72M 1S2TA 3W1TA 2XINA 3E5BA 1G4EA 4NSBA 3VCRA 1ISYA 4RJEA 3WNKA 5FEPA 1HJWA 3AS2A 2J66A 1H7OA 2FB3A 1Z41A 4CLMA 1UPPA 3CUZA 1K70A 3LA4A 3NTYA 1TPB1 1KM3A 4DO4A 3FVMA 1CNVA 3E38A 4KKXA 1DHKA 1FWAC 1OT1A 3E02A 4R53A 2WW5A 4FA3A 1QBBA 3S0CA 4HNLA 2E25A 3VZYA 1LRQA 2E1WA 3WLPA 3ZLGA 3WLJA 3UCQA 1WX0A 4D6GA 4C6JA 2HK0A 3G1FA 4CD5A 1DQXA 2BXYA 1M65A 2WMHA 4A3UA 1ZAJA 4C7GA 2ZBTA 3QVQA 2F8QA 1FHVA 2UY2A 2VD9A 1CGTA 2NUYA 3O0KA 3PZGA 4RXGA 4WZHA 2BGQA 1IT8A 1W1A1 3ARZA 3P93A 2HISA 3CV2A 2QCDB 3OEXA 2JKPA 4R7WA 1RSCA 1BQGA 1L6YA 3RITA 2ACUA 1DVJA 3DU0A 3M4HA 1PL9A 4H9TA 3UNTA 1KD0A 2A0NA 4XB3A 1W1IE 2NZLA 1A53A 3T55A 2ZUMA 1VENA 3U3HA 1XBZA 1KWGA 2ASHA 3SCVA 5D04C 3WQWA 4O17A 3UT0A 2Z0IA 3GY1A 4PMNA 3TMLA 1JZ4A 3W2NA 3BMXA 5XIAA 4C1NB 3HM7A 5AFDA 1M41A 3TW9A 3LLFA 2HEJA 1F76A 5CSYA 4DWSA 4K1WA 1PS9A 2E6AA 4G5DA 1K4GA 3ZIZA 4MZ8A 4JQ2A 1LZOA 3UWEA 3IIXA 1Q7ZA 4JTLA 2RDTA 3GB6A 3EA2A 1CGWA 4DYKA 1JAEA 4JQ3A 4ZE4A 2ACRA 3UEQA 3OLGA 2CLHA 2NX3A 3ITCA 2PLKA 5TNVA 3MYOA 3THAA 1OFDA 1E4LA 1RK6A 4M6UA 3VX0A 4QROA 2DZSA 1CLXA 1MYRA 3NJ3A 1ONWA 3PZIA 5CSSA 1UYQA 3JRKA 4WR3A 3WJZA 3HPXA 4MWAE 1OGSA 4Q6XA 1D7FA 1ZB5A 2PZ0A 3FAXA 5F1UA 3VC6A 3N2TA 1XLMA 1G67A 1H2JA 3GVVA 3ZR6A 2NUXA 1QPRA 1UP2A 1KFWA 1ESWA 2AGKA 3EWXA 2QUNA 5KTLA 3HG3A 1UROA 2VC9A 2AKZA 1M04A 2OR2A 1TTJA 1W1PA 3W6LA 4MKNA 3TC7A 3HPFA 4RV8A 3H55A 2PS2A 4C1KA 1Q65A 2OTDA 4MDPA 1R3RA 3WJSA 1G4TA 5D03A 2VRJA 2F9RA 1P4CA 2HTMA 3ZQ9A 1F3WA 1OB0A 1WZKA 3QYSA 2ZXQA 4D6EA 4ZO6A 2XVPA 4B5SA 4QQ3A 3LPGA 4HQVA 3W1QA 3G77A 3W1UA 4PSRA 1W5PA 5CGTA 4AG0A 7ENLA 1JQVA 1HP5A 1HUVA 2R9RA 1M1BA 3B8WA 5AYIA 3W1MA 1RPKA 4AMCA 4F40A 4XZMX 5KMYA 1A5AA 1I1XA 4MVAA 1EHNA 3N29A 1GQLA 2YCKX 3PNZA 2BG5A 1QXLA 1W3LA 2V0TA 4HCDA 2CHNA 1U33A 1R47A 4Q4SA 2P8BA 1TR1A 4RL3A 2RJHA 1W9DM 3AMKA 1B3ZA 3VNLA 2WMFA 2EBNA 2PDLA 1EF2A 1AG1O 1MXGA 1GEHA 2NQ9A 4M0XA 4BHYA 3WJYA 3EBVA 5K7JA 1T96A 2DV0A 2VKZG 1BVZA 4M29A 7CGTA 1CDGA 1X38A 4DO5A 4Q7NA 2PLJA 4QS6A 4G6CA 3AMLA 3BANA 3K1DA 3FXGA 3L5AA 1UG6A 3TCSA 3AXIA 5HANA 1F3EA 1Z8AA 1YPFA 4WLCA 2Y89A 4L1GA 4PTWA 4BI7A 2Q3OA 3O7UA 1WNOA 3T78A 2GUUA 1NF0A 1S39A 3R0DA 2D23A 2X8RA 3NGFA 3MW7A 3II1A 1EWDA 2Q01A 2B7NA 4CD7A 3PWGA 3TYZA 5JMUA 3JZEA 3WMBA 1QFEA 1QI2A 1WKEA 5TD4A 4R7OA 2Z2BA 2WQPA 1TIMA 1PB0A 3DXIA 1TA3A 4M8UA 3S6DA 3MA8A 4UTFA 2PTDA 3FJLA 4F0SA 3UGVA 3PWAA 3WEMA 2AOSA 3LCHA 5J04A 3UR7A 3M16A 4XZBA 1FCBA 4KFNA 4EVZA 1UR1A 3L2IA 1YDOA 3WX7A 4K68A 1UR3M 1UBSA 3DYMA 4DF0A 2D0HA 2FPYA 4AX6A 4O0KA 2Z4GA 2WZEA 4K37A 4L9XA 4A3YA 2DIKA 1OFAA 3WMSA 3OA5A 3TEVA 2BMBA 3PSVA 1YTEA 1IHIA 4DAIA 3KX6A 3TQKA 1M7PA 4LVAA 4UZUA 1KLZA 4NJIA 2Q6ZA 1EA0A 3P3BA 3D3AA 4JIHA 3T4CA 2PRLA 2C14A 2FIQA 2OZ0A 1O5QA 1BWKA 4X63A 4N7QA 4RZBA 1RH9A 4YTRA 4AXNA 3GXFA 2UWFA 1EJRC 2J6VA 1IEVA 3DC0A 1C9DA 1BVWA 5CZKA 3NYDA 4DWSB 2VO5A 3VC5A 4ORMA 3BAXA 1C7TA 5DELA 4HZ6A 3NZPA 2EJ1A 3VOIA 5CPLA 4H9ZA 4U3AA 3LPFA 4EX4A 1P6BA 1JAKA 5EL1A 4E4PA 2VUYA 2Y7FA 3ARUA 4QNWA 3VKCA 4EANA 4QXIA 3MV11 4EWJA 1S46A 4D2JA 4PC8A 3VIMA 1EIBA 4GIYA 5FOOA 1MRQA 3WNMA 3WQ8A 4LAUA 4S23A 2INEA 5CBIA 3C2FA 3FOKA 3T44A 4ZOBA 2OZ8A 4A2SA 3VK5A 3LSBA 5K4XA 5C70A 2PRHA 3PPFA 1B3XA 1TJRA 4K8EA 2V30A 4B4HA 1HFBA 4HNVA 2GJNA 4BEUA 1GQIA 2BXVA 4JR5A 3IGXA 4HA0A 5HK4A 2GZXA 4YVVA 2WQDA 3OB8A 1VEMA 3BOFA 3G18A 2PCQA 4JBRA 1S5NA 5ENLA 3QW4B 1VEPA 4I7WA 3RX2A 3VA8A 3F4DA 2G95A 4OBSA 2GOUA 4QG9A 5GJNA 1EDGA 6XIAA 5D2XA 3TYAA 1V51A 2J62A 1JG9A 1UUQA 2F38A 3CU2A 1OFQA 2YLLA 2EPOA 2E5DA 3N1AA 3BSMA 3QHNA 5CZ0A 2DUXA 4WEVX 1XS2A 3S42A 3CIXA 3IGHX 2ZX7A 4PUNA 1EJWC 4NJJA 1XGDA 3L7RA 4J5NA 3IJ8A 2Y7DA 4PCPA 4CEXC 2DGAA 3BQ5A 3MCOA 4U2YA 4CNNA 4PCNA 4ZO9A 3C3NA 4XZ9A 2AMXA 2G3NA 1J9YA 4O4VA 3CQHA 2NT0A 3UY8A 5K3VA 1TUFA 1QT1A 4FSAA 3CHEA 2KAUC 4ES4A 1YX1A 3WQPA 1BQCA 3C56A 4GJJA 4RDZA 1Q3NA 2DZAA 2QUVA 1FWNA 4XVDA 4AISA 3AIEA 1XQLA 3I68A 2QYGA 3VPLA 5DCBA 4JIRA 5DY3A 1OFBA 3QV7A 1BXNA 2UV8G 3N2XA 3T7VA 3FA3A 1VFOA 3HA1A 4JFVA 1XR2A 4B4FA 4W9TA 1J18A 2PTYA 1ISZA 4JCMA 5C2GA 5TAOA 1OCNA 1AQMA 2R1MA 3UGRA 1BFNA 2PWGA 2GSJA 4Q22A 3KEHA 3W2MA 2YLAA 4OT7A 4EXBA 4UQ9A 1VCFA 4K36A 1AL7A 4ICCX 4LOCA 4N9EA 2REQA 4S1FA 2YBVA 1WZMA 6ENLA 5I00A 1BKSA 3RJXA 4QDPA 3DHPA 4LSBA 3LHVA 2Z1WA 4L6DA 3WDIA 2J9YA 3F5JA 2REQB 1WKYA 2NQ5A 1B54A 3M07A 4K8HA 3D3FA 4GJIA 1KFLA 4J4KA 2CEQA 4YL2A 2IXVA 3STCA 4S3CA 4D6DA 3CAVA 3S2JA 3M7WA 2X09A 1RLDA 5CZJA 1UD4A 1RUSA 3AROA 4FR1A 3TZFA 1BKHA 1VYRA 4DEFA 4JCLA 3QW3A 3NZGA 2XUCA 1X6LA 3B3DA 1EWEA 4IX0A 2Y5SA 1U2YA 1KFBA 1M7XA 2WCSA 4WDUA 2AGTA 1V0KA 3GAKA 4DBUA 1LROA 4F0HA 2PF8A 5AYBA 3QKEA 2WMKA 4IP5A 1VQTA 4NZ4A 3IJIA 1DWHM 2WNQA 3EOEA 3HPAA 5FEXA 3TIMA 2D3NA 1DJNA 1SZEA 5BOEA 3GAYA 4DVOA 5CPQA 4RZ6A 2E7FA 1OHLA 4JAWA 1YNYA 5FF7A 1KLYA 4O11A 2QIWA 5F4WA 3DFPA 4W5UA 3N4AA 3PWIA 4DY1A 4HPXA 3KZSA 2ABAA 2VX4A 5ECVA 2XSXA 5A6BA 1P0BA 3QRHA 1QNOA 2D2JA 4PMVA 1TPC1 4IFKB 2QV5A 1PDYA 1W3TA 4I7VA 3WBXA 4GIRA 1JYVA 3WDRA 3A3HA 2ZX6A 3ISIX 5EBAA 1RPXA 3RLHA 3INPA 1Z89A 3VX1A 1IEWA 5FI8A 3FDGA 1UKTA 3OBEA 1KQYA 3GNRA 4CQ8A 1S2UA 3U4AA 3W37A 3VIHA 2D22A 2GWGA 5A6JA 1WYIA 3PBWA 2GGJA 1FH8A 3AWOA 4LEFA 3HO8A 1HP4A 1XQKA 1XRFA 3O8AA 2VCAA 3W87A 4GGBA 2DFAA 4JNYA 2OO0A 3W82A 4QCFA 2YXXA 2ZZ7A 1J96A 5LA2A 3AIRA 2GDUA 1X1ZA 4YYFA 3CQ0A 1EPVA 5A8GA 5G4HC 3NQ7A 3G1AA 2WLZA 3C4UA 1T99A 2ZE3A 2VFFA 3FCPA 4Z2LA 2DORA 4UFLA 3GXTA 3JUGA 1W3KA 3VIFA 4LALA 3RMJA 2XSAA 3M9YA 5LNSA 2FB2A 3PAJA 2X7VA 4P7LA 1VP5A 5FJUA 1KBJA 3TW6A 2VCBA 3Q65A 3G1DA 2G3FA 1RJQA 1PKYA 4GUGA 7REQA 1NDYA 2PB1A 1XBXA 5C71A 3VZXA 1NWUA 1ODZA 3R79A 2QJNA 3DENA 4DYJA 3WK2A 1VGAA 1MVYA 3W7DA 4LCQA 1H51A 3C0QA 1U5JA 3A64A 4DRSA 3ECQA 4K2SA 2ATSA 2YYUA 2ZC8A 3LTYA 3CT2A 4WY0B 3MHGA 1N8IA 1DJGA 1XLCA 4JTEA 3NVTA 1VCGA 1QHZA 3NPVA 1H62A 5IDIA 1E6XM 2X40A 3IK4A 3F4CA 3QY7A 3RF9A 4J3VA 2X7WA 2OLSA 2J4GA 4KEZA 3T8LA 4DYEA 3BMVA 4S3FA 3SGGA 3OBKA 2XFYA 1GPFA 3VD4A 4ROQA 2FVMA 3B9EA 4IOTA 3B4UA 4PZVA 3A5VA 4WIWA 4ZXLA 2QZRA 5M2FX 3BO9A 2C13A 4JY8A 1Q6GA 3DHUA 4Z2HA 2L5HA 4JTCA 1A80A 2CKSA 4TTUA 3TFXA 3OZOA 3LI0A 3WLMA 3NA8A 4AYSA 5MKGB 3HBLA 3EWZA 1JYWA 3UCCA 2ZX5A 4LJ3A 1JD9A 3NXLA 5EU9A 4IZGA 1TRDA 4NZFA 3CO4A 4L4OA 1UWRA 1ZHAA 2GVLA 4QLLA 3L4WA 1OSEA 5FJTA 3PM6A 4IT1A 4LQ1A 4W88A 1HVQA 2P1FA 2Q02A 4FIRA 1GJPA 2PDKA 5I3JA 1OIMA 1BSIA 2D1ZA 4LUIA 3W1RA 3AIBA 1YLVA 3M0MA 1XWYA 2QUMA 4DBEA 1TB3A 3SEPA 3OBAA 1ONRA 3BQ6A 3CL6A 4TVDA 1CGUA 2YR1A 2X0SA 2VD8A 1UWUA 2YCLB 5C7VA 3W07A 1KCZA 1O5KA 2DSZA 1OABA 3TJXA 2ZXAA 3FYYA 3A3WA 5B7YA 3LERA 3MZ2A 4P7NA 2PSNA 4J27A 1YTDA 3M0LA 3FA5A 3RM4A 1JI1A 4GNKB 4KIEA 1T7LA 1JYXA 4M6VA 5I3IA 1R85A 5F7UA 4FLQA 4LPCA 3GFYA 3DECA 3RHGA 1RR2A 2WZIA 1PIGA 1O94A 3EPMA 4WQ6A 3TTOA 4IPLA 5I03A 2QEZA 4WOQA 1CGVA 4XKYB 1H0IA 4D8ZA 5HUPA 1QPOA 4PCTA 1FCVA 3TYBA 1C9WA 3ZM8A 1SYTA 4LVBA 3UPWA 4NAEB 4K1GA 3A4AA 5C9RA 4Z1YA 3VINA 5FF0A 3CB3A 6TIMA 1HX0A 1QBAA 2WVTA 1CXFA 1OFOA 3VUSA 4DZ5A 2GGHA 3C8FA 4Q7IA 3E1F1 3GIQA 4F9JA 4DM2A 1E3ZA 2OODA 1C91A 4BZYA 4E8CA 4KESA 1FDZA 1EDQA 4I7UA 3W1LA 3RX4A 3TQ0A 1IR2A 4MUZA 4GYKA 3WQEA 4NZ5A 2OX1A 4LXFA 1PX8A 4Q4RA 3NYZA 3PS7A 1TKKA 2IPWA 2WMIA 1XH2A 3IACA 4S3AA 3P8JA 3E74A 1K9DA 2V3GA 2WHMA 2DIEA 4QM1A 3HMJG 1K77A 1AZ2A 1QWGA 2A6NA 2OYMA 3OODA 3PVFA 3OIHA 5HOSA 2DW7A 3K8LA 3CTLA 4GYFA 1HZYA 2NLIA 5LKYA 1E6NA 5JUVA 2A3BA 3LENA 3R13A 1SFTA 2YFOA 1NH6A 1Z6KA 4TR9A 3CHVA 2FMOA 2O7SA 3UJRA 2IQTA 4IMFA 3IPWA 1Y8BA 3M1ZA 4HPNA 3THUA 1V0NA 2VUNA 2ZA1A 3VE7A 2YCLA 4UZSA 3AFBA 1TWSA 5AC6A 2QJGA 4GACA 3KOWA 1AMKA 5BOFA 1T6MA 1VC4A 3WZ0E 1UWQA 3GXMA 3QV8A 4U5KA 1B90A 3VM5A 2QGYA 2WKGA 3PZ9A 3ARQA 4O53A 3VGBA 4M7TA 2EEXA 4FF5A 2PUZA 3B8TA 3T0CA 4ADSA 1JZ6A 5AHFA 5ECUA 2WSKA 1KV5A 3UZYA 1WV2A 3T2OA 3VD5A 3VIPA 4L1WA 4KPLA 3GNXA 1J11A 4AVFA 4ZOAA 3IANA 2MNRA 1ICPA 3CZLA 4EPEC 1YXYA 5AC8A 3VOCA 4OFCA 1R3YA 2V5JA 1ZTVA 4C90A 3MWCA 1OCQA 4FAMA 1A5LC 4PUUA 1JPDX 3O05A 1DBTA 3UZJA 5BRQA 4DJFA 4ZL1A 2JF7A 3WNNA 3QR1A 4C6BA 1OBAA 4JS3A 3WK1A 5DMYA 3P2VA 3M0KA 1PSCA 2ZUWA 2V5KA 1IZCA 3UWYA 5L6UA 4HPJA 4LF2A 5E1QA 2IPFA 2GDQA 3W7OA 4N9CA 1XIMA 3H4XA 4G7FA 1NEYA 2ZZ1A 4MWAA 2X1IA 2OCZA 1R3SA 2HNEA 1KM6A 3T05A 4XZIA 3PBGA 2QR6A 1J4EA 4L80A 4KIRA 5AC5A 1AH0A 2P88A 4C6PA 3F2BA 3S2NA 4IF2A 4TIMA 3IRDA 5M1TA 2CLOA 3ID7A 5HJLA 4QDWA 1RY8A 4WDTA 4QHRA 1TPUA 5CPTA 3W1AA 4H04A 1G01A 1CI1A 1W3JA 3B06A 3I6RA 3N3TA 3AYSA 2WO5A 1SSGA 1KXHA 1JYNA 2XIJA 4GX9A 4DZAA 4NVTA 2D0FA 3SCTA 1OEPA 4GWEA 4XG1A 2VYOA 3KBNA 3UXKA 4WOZA 3LQGA 3SSZA 3O6CA 3W7PA 1J0YA 3CK5A 2QDDA 4DPQA 3H24A 4RPPA 4ACZA 2A3LA 3P5ZA 5I09A 3ZFHA 4YXGA 4QR6A 1FWWA 2QCCA 8CGTA 4I5UA 5J8LA 1Z7AA 4JKMA 2VXNA 4DJFC 1ONEA 1KA9F 4F0KA 4MB5A 1EIXA 1Q6FA 3NQ6A 2JALA 1K8CA 3GKFA 1WKDA 3AIUA 5AVNA 1R46A 3CWNA 3MHFA 3GIYA 3ZJ6A 3GNDA 5A8PA 1QNVA 3MPGA 1XYCA 3PB2A 4EAYA 3BUVA 3UPBA 2VFGA 4IICA 4AXKA 3WDJA 3ZJ8A 3NQMA 3VCCA 3QPYA 1FHUA 1ZALA 2ABBA 3TQPA 3K5XA 3CM4A 4MSSA 4FXRA 2A79A 4A8IA 3KVKA 1XG4A 2DDXA 1WXJA 1OD8A 4HK6A 1UR9A 4ADUA 1A50A 1G9HA 1L2UA 4MWAB 1EC7A 3OG2A 1DHPA 1JRBA 5I3FA 3OO2A 2XWEA 1FP9A 3AWNA 1NSJA 5CPOA 3N17A 4IMDA 1IYXA 3O16A 4MGGA 2Y7GA 1RD6A 3USBA 4DELA 3ZJ7A 1W1TA 3RO6A 3W6YA 5AB3A 3M0YA 1TREA 3MVTA 4I6KA 3O3RA 2J7BA 1B9BA 3F4WA 4BR1A 1HIZA 2RGLA 4WDXA 1BWVA 4MUPA 3ITOA 4DXKA 3EDKA 1Z32X 1I9CB 4W87A 1OJXA 2JF6A 5C7HA 3LYEA 4ONVA 5D2VA 2E6DA 2J7CA 3TLLA 3CZ8A 1L9WA 3D47A 1GORA 4CCZA 1FH7A 3WQOA 2JKAA 2VC6A 4OZOA 5FACA 1VFTA 3R4IA 4LUYA 3QJAA 3LZ5A 3BLIA 1A3HA 2P76A 1XPGA 2FPVA 2PC8A 3AJXA 3VNDA 3TSMA 3UERA 1K9EA 1TE6A 3GVRA 3O6YX 1XYMA 3QGKC 5CZSA 2VQTA 3CWOX 2H8ZA 4HMCA 1Q7QA 2A7PA 3LHYA 3TUUA 3NQCA 3S83A 1S3TC 4I8YA 5EY5A 3S47A 2OGYA 1UBPC 2J8FA 4AIOA 1GOWA 4HKPA 1XLAA 1TZZA 4O1CA 1ZU8A 4DJFD 4L9ZA 1QNPA 4DPPA 1VBUA 1UH2A 3GZ3A 1UOZA 1DL3A 4MFDA 3EGJA 2OJPA 3SQSA 3WG6A 1TPEA 3KWXA 1K1DA 4MB1A 5D30A 4H41A 4AZCA 2PDYA 1UD8A 2ODOA 4AEFA 1W5QA 3H8AA 4GQQA 1HJSA 4DN1A 3XIMA 3D0CA 1UWTA 3C61A 3N9KA 3GG8A 1HTIA 3NOYA 1GCYA 3SY8A 1IGSA 3MI2A 1XIFA 4MJ4A 4PRTA 2Y24A 4H9XA 1V6YA 5A1AA 1W37A 4HYWA 3VGGA 1AFSA 1B2YA 1VBRA 3NO3A 3DOPA 3G1HA 3VABA 1JCYA 1AH3A 1DV7A 2ZZ2A 2IQ0A 3HGOA 1EEXA 4MNMA 2VRKA 4NIRA 3M7SA 3U7BA 1XIBA 3GXPA 1NTHA 1I0DA 4QAIA 1PZ2A 3DYPA 4DWSD 4MNLA 5CCZA 3PZOA 4YJ5A 3KBJA 1PIIA 1Q6RA 2VWTA 5EMLA 1GTEA 4D1JA 3TR2A 4FXJA 3T40A 2H9AB 5AZ1A 3IUIA 1U30A 3O0FA 4D6HA 2A7NA 4D6CA 4ACZB 1EP1A 4GI9A 1FUYA 4B9YA 4C7DA 2H8XA 3WLKX 3BCJA 1F7BA 3W7RA 1XD1A 1VJZA 3QZEA 2IMRA 4N6EA 3QHOA 1XLHA 3WIJA 1UPMB 3UY7A 4TMCA 1OG0A 1FBAA 1PZ3A 2WCGA 1R86A 1EQCA 1ZGDA 3MY9A 5DXXA 4CGTA 1B9ZA 3VNJA 3SQLA 3W84A 1JIBA 4JXCA 5D05A 2Y1HA 3JZUA 3KCLA 2GJLA 1XINA 4L4MA 4X2RA 1XDMA 3CL7A 2NSOA 1W91A 1V0LA 4GBUA 1E6QM 1EJXC 1ZAHA 2D20A 5D02A 3U2CA 3DG3A 4Y96A 3WDQA 2GVYA 3UWUA 4A3HA 1H49A 1XX1A 1B0IA 3IARA 4C6OA 1JZ7A 1TPWA 3MQTA 2PE4A 2ADAA 4UNKA 1Q8JA 1KXTA 1VBHA 3HMCA 5DO8A 3L9CA 3NG3A 3URQA 1IXOA 4UMCA 1W5OA 3AISA 4V15A 1M68A 4CQCA 1JNDA 1G0CA 5CXPA 3KFTA 2G3IA 1IE7C 3W74A 2VR5A 3GX9A 2FJUB 4M1RA 3C86A 4NZ1A 3EB3A 1TQJA 3ARPA 5EPDA 2DY3A 1MO0A 1BGAA 1CYGA 1QATA 4HSHA 3U7VA 1C29A 1FVPA 2WC7A 3DFQA 3CPGA 3I7SA 3KRSA 1FOBA 3LB0A 1MQPA 2CETA 3N2OA 2JQXA 1ZJAA 2C19A 3N6QA 2HCVA 2Y0FA 1XFBA 4IFKA 2ZWZA 3ZO9A 4QRNA 4GGHA 3VNKA 4LB3A 4ZENA 1TZ9A 3C2YA 2G8ZA 4E2BA 2WMGA 1M01A 3OQ8A 3TROA 2KX9A 2PC4A 4JTSA 2TYSA 2G5WA 4PUMA 2QJMA 3OQEA 4GFIA 1J79A 3GTXA 2Z00A 2ZUSA 1W6TA 1R9YA 3EB4A 1X1OA 4AY8A 3GM8A 2HZGA 3SCOA 2IKJA 1Z69A 4KMQA 1I2RA 3R0UA 1Q66A 4O14A 4DLMA 3W2JA 3STFA 4YTQA 2NQZA 4KS0A 4UCFA 3KTSA 2VI0A 4C5ZA 3AHTA 2WZTA 4DBWA 4Q8MA 2PLMA 5EKYA 4AYGA 2OEKA 3E5PA 4XTDA 5BXTA 4G1NA 4XX6A 1W5MA 1TVPA 5CZTA 5LZLA 1V3KA 2FZ9A 2ZUTA 3V0UA 1VFHA 3WF0A 1AL8A 5D2TA 4B15A 4OUIA 3E0WA 3EXRA 4IQDA 3W7IA 3ZSTA 5EBUA 5CC6A 5M17A 1NQ6A 5T8GA 5A8OA 4Y6GA 4JQAA 3MUXA 4L64A 3RR4A 4GC4A 4I3GA 4W85A 4HHMA 3MI3A 3GXIA 3LPOA 4AWSA 1V3MA 2IW0A 1J0ZA 2V5LA 1DWGM 5A2BA 4DUXA 1EF3A 1KGWA 1S1RA 3VZZA 4MJ2A 5AHIA 4YVXA 3AUJA 1TJ2A 4GOAA 1UASA 4LF1A 5IHSA 3EWCA 4MIMA 4JTTA 1IF2A 3GDRA 4H8UA 4GI8A 3CH9A 1B3WA 1NF7A 3T2QA 4AZCB 1LRTA 4E8GA 1BGGA 3LCIA 3MDUA 5AHEA 3K30A 3EKGA 1VBGA 1KBLA 1F9CA 4MLJA 2XH4A 5M03A 2ZTJA 3UA3A 2IQDA 3UETA 2PDFA 2TODA 2PU1A 2WOQA 3NDOA 3M5YA 1ZLPA 4JTQA 3PFRA 4HIBA 1CTNA 2DT1A 3I7QA 3W7CA 1TMLA 1YADA 3CXOA 4XVEA 4YVPA 2JBMA 2OOFA 1V02E 3CTTA 5BWAA 1B4KA 4KRUA 4AHPA 3N14A 4L61A 1ZL1A 1F4HA 2H3BA 4G7EA 5F2GA 1GPWA 2GDVA 4V27A 3MO7A 1OX4A 1YDYA 2WSQA 1F61A 5HWNA 2WMJA 1MI3A 4JN7A 4H7VA 2BVTA 3MT1A 1JJKA 4EF8A 1V3JA 2VVSA 1EBHA 3N2CA 4JICA 3HF3A 3UF9A 4MKSA 2YX0A 4BWLC 1KWKA 2YJQA 4UOJA 1ZBWA 2FGBA 2KZHA 1U83A 4DBSA 2HMCA 5G2WA 2XVKA 3GVGA 3G1RA 3L65A 3FHQA 1OADA 3EDFA 4ERGA 1GVQA 2Y5JA 2Y7EA 4B3ZA 4D9PA 1UA3A 4C60A 3OP2A 4YHGA 3ITVA 3KTXA 2G4FA 3BPWA 1VLWA 3ZWSA 1SM9A 3FSTA 3WDHA 3E3HA 4QQUA 3VM7A 3BV4A 1K3UA 1MXSA 4EKJA 3HQNA 4ORIA 3MHUA 3QM3A 2QMJA 2HXUA 3ABSA 2OQYA 2CFFA 3RLVA 1PUDA 3GHSA 1AD4A 2PRMA 4FHAA 4Q32A 4LBUA 3SRKA 4IHCA 3BAJA 4M6PA 1BHGA 1WDWA 1QO2A 4K39A 2GQ3A 4XZNX 4D72A 4KCUA 3K4WA 2VX6A 2W6RA 1MXDA 3UG3A 4MNJA 1BLIA 1TUXA 4AC7C 3FGCB 1GOMA 4UCGA 4B90A 3CV1A 5DY2A 3QC0A 2PU0A 2Z25A 5CC7A 1MQQA 2EJAA 1Q7MA 3KBVA 2YA2A 1YBQB 5GNXA 4TV5A 4IISA 3VNMA 3H7RA 1K8ZA 5A6KA 1ZQ5A 4UTJA 1D3CA 2DP3A 4LRTA 4PUJA 4XSMA 2OMAA 3MB9A 4HA1A 1E56A 3W1NA 3UZWA 3NZ1A 1V6VA 3ABZA 2BODX 4JN8A 3I65A 4AWEA 1KTBA 3EA1A 2YBTA 1F73A 4NZCA 5GVJA 2RDWA 2F6KA 4A8NA 4O19A 2QPSA 2E77A 3LM7A 4P7RA 4YMZA 4UOZA 5LIUX 1QOPA 5A8QA 4GINA 1HF6A 4BQ5A 1UJPA 1EOMA 4EPBC 4XUYA 4RE0A 4N6FA 3XISA 4M24A 3WQVA 2BY2A 2Z29A 1MW2A 4UMAA 3TW7A 4KFOA 3IK2A 4AAJA 1E6SM 3HJEA 3HGJA 3KS5A 1N8FA 3EDEA 1C92A 3CAKA 1VPYA 4FPSA 2YDQA 4JGDA 1S2AA 3NSXA 3W70A 3EOUA 3DIPA 1VPXA 4B92A 1WCGA 2YDAA 4JHOA 1U1UA 1W1ZA 4AHQA 1V0MA 1HL8A 4H19A 3OA3A 3GYCA 2CERA 3Q45A 3VFLA 1EZ2A 5A94A 3LQLA 1LOQA 4BQ4A 4BEQA 3VKBA 1ME8A 2JGYA 5EMKA 2VWSA 4O16A 1DJQA 3W75A 3HFYA 2VEPA 2DZVA 3GW3A 3QYQA 3WQFA 4W4QA 4F2TA 4JEQA 4DIAA 1L2QA 1C3FA 3WL0A 4IWWA 4IMEA 2G37A 2GGGA 1EJUC 4S3DA 2XJ7A 2HBXA 5DEZA 3GUWA 4Q6JA 1OK6A 1XBYA 2ZXDA 4QITA 2QAPA 3C2OA 2NW0A 1W56A 3E12A 4JNMA 4Q8UA 2OELA 3KL0A 3SQMA 1UMLA 3P67A 2TRSA 4Y9PA 4NAEA 2PGRA 1UKOA 2D0GA 3MJYA 4JTGA 3M0HA 3S46A 3PAOA 4YWIA 2E0PA 3L4UA 4EP8C 4AIUA 5BOOA 4HNNA 1AW5A 1Q4NX 1U5HA 3L0NA 1WXYA 4HCHA 1IV8A 1TG7A 3LY0A 4XTIA 5K4ZA 1OYAA 4WKAA 4MNKA 2V6AA 4RNIA 4AWUA 2SFPA 5FEWA 1GVYA 1UD3A 4ZA0A 4HOZA 3CJPA 3A23A 3S2CA 4N42A 2PP3A 1TX0A 3CUXA 1I0BA 1WDRA 4YWSA 3BZGA 1QK0A 2J7EA 1A47A 4UFMA 3WCZA 4UTTC 1DORA 3F03K 4YHEA 3IGUA 3A4JA 3VIOA 3FXYA 4Z1CA 3SCNA 1F5ZA 4J7RA 4GVHA 1ZCCA 1SFLA 3SO7A 3VKDA 4CQAA 4WJ8A 3WUFA 3UQNA 5C55A 1SPQA 1YE4A 3VGDA 4JIEA 4WY0F 3W85A 1PWMA 1R87A 3LLDA 1G6CA 2ACSA 1V6UA 1HXJA 3BWWA 3RNDA 1BYDA 4IXXA 2MUCA 3APGA 3NEVA 3RIKA 2GSHA 3TWBA 1Q6OA 1UQZA 2B7PA 2QKFA 4PMRA 2QJHA 1GOXA 3KHJA 3K13A 4G2DA 4RW5A 1P0KA 2IUZA 3VAVA 4GA8A 1G1YA 1QPKA 4M82A 2NXIA 4JTHA 1EYWA 3GXNA 4M51A 2HV5A 3EB2A 1LDCA 3E0VA 5D9NA 4XO7A 1VFUA 4J2PA 2YGYA 2ZX8A 3DCPA 4HMEA 4DUVA 3DERA 2DZWA 1JUBA 3N6JA 3SUSA 1GVOA 2UY5A 2OX4A 4QBXA 3LV5A 4AY1A 1XIJA 3WBEA 5ABTA 1E0XA 4QG8A 2VZOA 3ONBA 3TYCA 1T0OA 3LGEA 1DKWA 4KERA 1P7TB 4AB4A 3WYZA 2OWXA 4Q8QA 2JK2A 4E4UA 3STPA 2BLEA 4UUIA 4DLFA 3WUGA 1AJ2A 1Y65A 1LLWA 2NX9A 3DGRA 2D24A 5DQPA 3B9NA 4HA4A 4UTMA 4DBDA 3OU8A 5G4WA 2FFCA 4LVDA 1YBQA 4O13A 2Q8XA 6CGTA 1C8YA 4GZEA 5H8UA 4TU1A 4O50A 4KFPA 1R2TA 2ALDA 4Y9AA 5EMYA 3OHIA 5HNTA 2E5BA 5EMMA 2BS9A 5CGMA 3SFKA 4GISA 3E49A 3UR8A 3GH5A 4AUBA 2PD9A 3CEPA 4LS1A 2BSLA 3ARVA 2YXOA 3E0LA 2Y62A 4GLEA 1HKWA 4ZQRA 5AHMA 3UG5A 2CLPA 3ZSSA 3BW4A 1TJ1A 1QPQA 5DBUA 4LAMA 5RUBA 1POKA 5I2UA 3BVJA 4IP7A 1X39A 3ANYA 2O55A 1SW7A 4N4PA 1QO5A 1CENA 4HT3A 1GYLA 2WVSA 1TSIA 1FHDA 5I23A 1UZDA 2ZKMX 3CUFA 5HNRA 3WKZA 3A12A 2DW6A 3B8SA 3PTKA 2AL2A 3EMCA 3UWQA 1YHTA 1Z44A 4AZ7A 1MW1A 3MV01 3CWHA 3PB0A 5G1MA 1BXCA 2HDJA 4ASTA 4O0ZA 1JZ8A 1H7XA 1FQ0A 1GW1A 2ZOXA 1PCKA 1XCFA 5FIPA 1OZMA 3IIPA 3A6OA 1FWTA 2QJIA 4LYKA 4WUIA 2DVUA 3KBWA 2MANA 5AYYA 4IQEA 1RP8A 3WNLA 3R25A 3NL2A 3LU2A 5C9ZA 2IKGA 3G6LA 2OZTA 1QHPA 1VJSA 1XLKA 4P61A 3UD6A 1N2VA 2QF7A 1S5WA 1BD0A 4FR6A 4BQ3A 4W8AA 1RBAA 3WJWA 1KXVA 3VCNA 5F2LA 3ARTA 3M5ZA 5D8ZA 2WZMA 3MSGA 4FZIA 4OOUA 5K9CA 3QSTA 1M9HA 1QNQA 5E70A 1J12A 1E5NA 2VGGA 4MWAD 4C91A 2CCRA 2PI6A 4FXSA 4EPKA 1QI3A 2YCEA 3WY1A 1S38A 2EHHA 4J35A 1HVXA 2IXUA 1E9LA 3HV9A 3SY1A 4RXFA 4A8RA 1HKIA 5IBXA 3G24A 4QS5A 3EYPA 5E5CA 2VFEA 1H50A 3ZT6A 3H2MA 4W7WA 4XO6A 1NARA 4DJEC 3ABRA 2ZRYA 1TV2A 1O5XA 4R3UA 3N18A 1H1ZA 1XPYA 1SQ7A 4U31A 3ENLA 4LX4A 4J3TA 4PN2A 4HPHA 6XIMA 1ME9A 2FHFA 2BWGA 4PMJA 4WSHA 1WDQA 4X0VA 4RNFA 3T1GA 4LV4A 2GK1A 5KINA 4BFAA 3KWSA 1K4HA 1PDZA 2YA0A 2BZNA 2D3LA 1KGUA 5CG0A 4UR9A 4F8XA 1U5VA 1CXKA 3GZAA 4JIPA 2XFRA 4HN4A 1O5RA 1G4SA 4B5UA 2E6FA 2V3EA 4DJDC 3WBAA 1UR4A 3L5MA 4NXKA 2YL8A 4WD0A 4DNMA 3CUGA 4XD6A 3FX4A 5CPMA 5FEZA 3VYLA 2Y61A 3ZYZA 3M41A 2V5BA 4J2MA 5K9DA 3PP7A 3TJ4A 2CHOA 3ZJKA 3KBSA 4Q4QA 4JTKA 3W24A 2Q8ZA 1TCDA 3V75A 1H7NA 1V7AA 3E96A 3LRMA 3VOFA 1M03A 1I2OA 1UA7A 4K6AA 4KWOA 2AL1A 4LC8A 4PR4A 3WFZA 4C6NA 1GVEA 6ALDA 4Q33A 4EOUA 4NAFB 4ICMA 3MZNA 1I45A 4QSFA 4MFEA 3S8HA 4DB7A 1U22A 2PDHA 3LXCA 3VNYA 3G3DA 2B4GA 4POCA 3AIWA 1CBGA 3N11A 3A4WA 1A5SA 4O4WA 1KV8A 2PDIA 1MWOA 3BJTA 4D71A 1ICQA 1OD0A 1H0GA 3R8GA 1ZNNA 4N02A 1PV8A 4UR7A 5HR7A 5KZDA 1JF5A 1TPVA 3CNYA 4K7YA 5KITA 4JX6A 2HVMA 2DEPA 2FYMA 1B5TA 3HPSA 2Z26A 1EQPA 2FZDA 3BLPX 3GDBA 5BROA 5D2WA 3WF2A 1EO5A 2E67A 4HYRA 3TKFA 2ON3A 2VR2A 1PVNA 5BWFA 1ZBVA 3TVAA 5FJIA 3S2LA 2PURA 2OVLA 4H6KA 3M0IA 2X42A 3NAVA 2QUTA 4PA8A 4J3XA 1LL7A 3SJNA 3EMQA 3IVUA 4LFYA 4NNCA 4R27A 2GQ8A 2YIHA 1SJDA 2F2HA 3VIJA 2YA1A 3DI0A 4AD1A 1E0UA 1FX6A 4FLRA 1XICA 1P48A 4M3PA 3AHXA 3OYXA 9XIAA 5F2IA 5HULA 1EGZA 2OQHA 4U28A 2OXNA 4REQB 2OQLA 2X0YA 3ANVA 1U1JA 3WLIA 3SRFA 3GTIA 4KGLA