3M44A

Crystal structure of the mutant v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
207
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPTLRFADAIIAGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 76
structure length 207
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m44A00
4BFAA 1VRDA 2V82A 3W71A 3P84A 4MY8A 3S1WA 3BV4A 3BVJA 3CTLA 3M5VA 5K7JA 3MBFA 4UTKA 4PC8A 1OX4A 3U8GA 1GPWA 1FWSA 3STGA 1TPUA 4N6FA 4MFEA 3DKJA 3TH6A 1B4KA 5HWMA 3ABRA 2PC4A 4JTUA 4NJGA 2WSQA 2ZZ2A 4JNMA 1Q6RA 1XBVA 2F7FA 1H7NA 3O06A 3BW4A 3NL5A 2JK2A 2A85A 1WXJA 2RHGA 1GTHA 3G1VA 1K8XA 4IMDA 4O16A 3LX9A 4AAJA 4RK8A 3KVLA 5L6UA 3M16A 1JQXA 2ISVA 2E5DA 1XL9A 4IMCA 2VOMA 4JX4A 3NQDA 2CZ5A 4U4MA 5ABTA 4ZQRA 1G6CA 2Q8LA 3C3NA 1AL7A 3I7SA 1S5TA 4K8HA 1LOLA 4R7JA 5G2WA 1TTPA 4DBEA 2CLKA 3KVJA 1NVMA 2KZHA 2ZTKA 3ZR4A 1EWEA 2AQWA 2V8ZA 3GNDA 4GXMA 3PR2A 1OFEA 2EAWA 5D33A 4ZQNA 1AW2A 1PHQA 4ZMGA 3G1AA 2WSRA 2WV8A 1VYRA 1QAPA 1OK6A 3NOEA 3VKJA 3DHFA 1YPFA 4RXFA 3UZ5A 3NQEA 3W2LA 3MP5A 2GUUA 2X1SA 5I3KA 5LHEA 2NWSA 3O05A 1Q6LA 4O1DA 1A5BA 4HSOA 5C5YA 4ZZ9A 4NJJA 5FEXA 1WYIA 3LCHA 4JGDA 5AOUA 4OWGA 4E2BA 1OFQA 4LV4A 4NUWA 3F4WA 2DZPA 2WNNA 3MMTA 4MJZA 3L5MA 1X8FA 4YMZA 1UJPA 1QPNA 2V30A 2I1OA 1LBLA 3QMSA 3PSVA 4E2DA 3W7HA 3NR0A 1XUZA 1KV8A 4KFNA 3LCIA 3TXVA 1DJQA 1TO3A 4UMBA 1RQBA 3R8RA 5BOOA 2Y6ZA 3E0IA 4JTHA 3UWUA 4RX0A 1I2QA 1K7XA 2GVJA 1Y0EA 3FEMA 5AHNA 2J88A 3O6CA 1PIIA 3KRUA 4TO8A 4PL2A 3SGUA 2YW3A 1G4SA 1K3UA 3F1QA 2ZZ6A 1S5VA 4I9AA 1TQJA 1NSJA 4EVZA 3AO0A 4O0ZA 3TJLA 3TC7A 2XN2A 3T78A 5F1UA 1W5OA 1YXCA 2YX0A 1K03A 2A6NA 3GDLA 4XQ6A 3YPIA 3IIXA 3FJ6A 3LI0A 3NQVA 1GVOA 1PL9A 5LZLA 5EPDA 2X30A 1DV7A 1TV7A 3W86A 4LV9A 4UCGA 2GVLA 5CZSA 3W85A 4LVBA 2FIQA 4JTGA 2NV2A 1GYNA 3ELFA 1H5YA 4WX2A 1YXDA 3QW3A 2H3DA 1R2SA 3BK0A 4JYEA 3OIXA 3MHGA 4Q4KA 1H7PA 1H1YA 3GXTA 1T8XA 2CLMA 5K9XA 5C55A 1SZNA 1OFAA 4U28A 3NQ7A 3EEGA 2C14A 1KLYA 3U2OA 4WD0A 1L6WA 3MW7A 4JICA 5IM51 4JYFA 4R53A 5E0KA 4R33A 4WY0B 2YCEA 1B57A 4QNWA 4RLIA 3UYCA 5HR6A 2B4GA 4N9BA 2NX1A 1O94A 4N9CA 1F7BA 5E1QA 3PVFA 3QQ0A 1W5QA 1FDZA 3QEZA 1H7WA 3IGXA 4AHQA 3AJXA 4DQWA 3LBCA 1XUUA 3QQ1A 6TIMA 2NXGA 4Z1BA 3IVUA 5I3JA 2R94A 4WUIA 1R2RA 1KFKA 4UR8A 2ABAA 3VI2A 1VHNA 5K9DA 1HO1A 3DZ1A 1KM3A 3PM6A 3CIWA 2C13A 2YYTA 1T96A 4EOUA 4BWLA 4LS0A 2QCLA 3GXNA 4IXHA 4CCDA 3L0GA 2YFOA 3CLMA 4FB7A 1X1ZA 1A50A 2QCGA 5I3IA 1QDSA 1TSIA 3STFA 1LORA 1RV8A 1V7YA 3N2MA 3WJSA 3O07A 3UD6A 3UWVA 5LNRA 3DI1A 1ZJIA 4CQ8A 1ML1A 1YPIA 2NUWA 3ZWTA 3T4CA 3D0CA 4L4LA 3IIVA 1BEUA 3W2MA 4WY0F 3LDVA 2AAMA 1LROA 3QYQA 1FBAA 2C6QA 3T55A 4JYDA 2VFDA 1K7EA 2P10A 2A21A 4NQ1A 3TNOA 2E77A 1AK5A 5HJLA 1LM1A 4YL2A 2WNZA 3I7RA 1ALDA 3M5XA 3HF3A 1XM3A 4HNNA 3S8HA 1NF0A 4UTWA 2YXGA 1JR1A 1EP1A 4QSHA 5HWJA 2ABBA 4HSNA 3DXIA 3HO8A 4PTNA 2Z6IA 4DO5A 1Z48A 3T40A 5DBUA 1GZGA 1K8YA 4MJMA 4AHPA 1ZAJA 2LLEA 4UMCA 4IGHA 4A2RA 1L9WA 1C8VA 4JTEA 5FF4A 4IOTA 1KM6A 3M9YA 4I7UA 3W75A 4GBUA 1JCNA 1GVRA 4CQAA 3W1XA 3UWYA 2EGZA 1GVQA 1H7XA 1GTEA 1X1OA 4NZJA 1ME7A 4NJHA 3SECA 3GAKA 3N3MA 3HQ1A 1RQHA 3R5EA 5LHFA 4N4PA 4GWEA 3WK2A 4UNLA 1XI3A 2FPYA 4LNYA 5H91A 1BWLA 1HO4A 3O63A 3Q94A 5G2HA 4ZVJA 3G24A 5C2XA 4W9TA 3TAOA 3UWZA 3CQ0A 3GK0A 3W88A 5BRBA 5F4SA 1JRCA 4M7SA 4LVFA 1RR2A 3R13A 1W1ZA 3TIMA 1FCQA 1FCVA 3H53A 1PE1A 3NQ8A 4O10A 1ZFJA 3NQFA 3WK1A 3TROA 3ABSA 1GWJA 2QJGA 5AN7A 4O17A 2Y62A 4TMBA 2A7NA 1OFOA 3NPWA 4CNPA 1SU5A 3MP4A 4DO4A 1UBSA 1GT8A 5BW6A 2ZBTA 4BWLC 2FFCA 1TTIA 1RVGA 1P4CA 2NUYA 3K30A 4UFIA 5AHEA 2QUVA 3BG5A 1MXSA 2J9ZA 3B0UX 4JY9A 5KZEA 2NZLA 3M0ZA 4DPPA 4UTMA 3NZ1A 1JUKA 3W87A 3NL3A 1FWRA 2NWRA 1UUOA 3LCLA 3BLEA 1SO3A 3ZS4A 3S0CA 4XUGA 3STCA 3TSBA 3L9CA 4QISA 1PV8A 1VH7A 3W2NA 1JCMP 4UXDA 3EXTA 2VEMA 3HGOA 1FWNA 1B9BA 3N14A 1FY6A 3HB9A 5F1VA 5TIMA 2CZEA 3P5YA 3QPZA 4CLMA 4LT9A 1S5WA 3PBYA 5LKYA 3WJWA 3VFLA 1PCWA 1N7KA 1XCFA 1W5MA 1G4TA 4G1KA 4AWSA 4H3DA 1R30A 1A5CA 1EB3A 3KX6A 3NVTA 2QCMA 5HWNA 3GVGA 2C1HA 4FO4A 4DXVA 3GNNA 2XN1A 4UTIA 3R2GA 4FNTA 3MYOA 4DO6A 5LNSA 4LS2A 1KV5A 3SFKA 1KFBA 1SPQA 4GJ1A 3RNDA 3LOTA 5F4WA 1KA9F 1LRTA 1WDWA 1K7FA 4NT0A 3O6YX 4OV4A 1SZEA 2JKEA 4QIUA 3V75A 4ZL1A 2G97A 5MHBA 3TC6A 1TPB1 2ZRYA 1LLZA 2OCZA 1VQTA 1HFBA 8TIMA 1LCOA 4DF1A 3CEUA 3N34A 1Q45A 2VELA 1EX5A 2WNQA 3N19B 3PULA 2NXIA 4GNJA 5CZ0A 4C1LA 3P60A 1FXPA 3LHZA 4JIPA 2C15A 2FJKA 3NQ6A 1ONRA 1DJNA 1CX9A 5HUOA 3L5AA 4LC6A 2QCDB 3N9SA 2B7NA 3NQ2A 4O28A 5J5DA 1EA0A 3QRHA 2FPVA 3A5VA 2WO5A 3LRKA 4AMAA 3T7VA 3E12A 4LRSA 4WJEA 1S3HA 3P80A 4MKNA 4XKYB 1GG1A 4HNUA 1RQEA 3SI9A 3NNTA 3HGSA 2R14A 5K9CA 3W2JA 5D03A 4LC8A 4UR7A 3BLFA 4WQ6A 4AF0B 4FX6M 5AHLA 3Q37A 4OV9A 2J6XA 3G8RA 3EKZA 4LVAA 3JR2A 1ZENA 2B7PA 3W72A 5HNRA 1TQXA 1FX6A 3DH7A 1EUNA 4HIBA 2PURA 2R8WA 1NEYA 1G4PA 1P0NA 3LHTA 3EWWA 3P7YA 3FS2A 4FIQA 2DORA 2VXNA 2NUXA 4JX6A 4GRSA 2GVGA 4ALDA 2WKJA 3W83A 4O13A 2HSAA 4FNPA 3C52A 3LB0A 1TJPA 4E0CA 1IF2A 2V81A 1OX4B 4UFLA 4JDBA 1J4EA 1VYPX 2PRLA 2Q8ZA 5FEPA 1GEQA 4Y90A 3UY7A 5F2LA 2VENA 4IXXA 4EIVA 3L21A 4LW7A 4Z08A 3NM3A 4A2SA 3GKFA 3NO5A 2V9DA 3SY5A 1HUVA 3TQ0A 5H2ZA 5AC8A 2A6LA 5TQLA 1MSSA 1SSGA 1ZHAA 2EPHA 5HMSA 4MYXA 1BKSA 4LU0A 1KBJA 5FF0A 1D3GA 1VGAA 2W6RA 2PE4A 5G4WA 3USBA 4M19A 3P62A 3HG5A 3Q58A 2QCHA 3SR7A 2G5WA 1JCLA 4OQVA 2BX7A 2X1TA 3UXAA 3HPZA 4OT7A 3P67A 2ZCGA 2J24A 5F2GA 1WV2A 4PA8A 2CLLA 2NX3A 3KVKA 4PH6A 1UCWA 1VCGA 3WJXA 2CLHA 3TMQA 3PSWA 5CSRA 4FNRA 5KINA 1ZY9A 4LUIA 3SW6A 1LP6A 1F6KA 4PL1A 2VFHA 2ZRZA 1W5NA 2VEKA 4IPJA 3W70A 2VEPA 4CCCA 3W1RA 5FF2A 4XWUA 2X16A 4I7WA 5EMUA 5D38A 4CNOA 3CB8A 3HG2A 4O52A 1L6YA 3N73A 1VC4A 2RFGA 5D37A 1QR7A 1SFJA 1GYLA 1YDNA 1ZALA 3P8JA 4QITA 2VEIA 4XTIA 4DEFA 3S1XA 2TMDA 2ZDRA 3NZRA 1FDJA 1Q6QA 1P0KA 3L67A 2BXVA 2EF9A 5DELA 1H1ZA 2X1UA 4ORIA 3O15A 4FXSA 5LSMA 3LV5A 4Z0JA 1EWDA 1U5JA 4O18A 5K2ZA 1SFLA 3FIGA 2FPTA 3UWQA 2J27A 1AMKA 1M5WA 1VJIA 3BG9A 1MEIA 5DY3A 1OHLA 2A0NA 2BZNA 4XZ9A 2DP3A 4RZ5A 1JUBA 1SO5A 2JBMA 4S2BA 3GAYA 2XN0A 3TMLA 2ZA1A 3LBMA 1GQNA 3M5YA 5LNVA 3B0VC 3I68A 3R12A 4LTSA 4QQ3A 3FFSA 1I2PA 1LBMA 3CEPA 3HGRA 1H63A 5DLCA 4NJKA 1G7UA 1OFBA 1XBXA 1NAL1 2C0AA 3NQCA 1H7OA 5TBOA 1WA3A 4JTLA 4QAIA 3PBVA 3W9ZA 4AB4A 1EEPA 2E6AA 3NG3A 1FWWA 1YTKA 1D9EA 1TRIA 5FF3A 3S1UA 1LOQA 1TTJA 4A22A 3B05A 2ZRXA 2YGYA 3UY8A 3STEA 5DCBA 3EKLA 3PF3A 3EWXA 1R46A 4A21A 3P8IA 1G67A 2QCEA 1QO5A 3CWNA 3B06A 3TSMA 3PBUA 5K4XA 4Y6GA 3EXSA 3LCFA 5DCDA 2WJZA 1WOBA 2V2HA 2B7QA 1DL3A 2J9XA 1W8SA 1TMHA 2X1RA 5U4NA 1XFBA 2QUTA 5J5RA 1W37A 3W7MA 4Q32A 4LRTA 2QUUA 3LLDA 3GB6A 5FEZA 4JTJA 4A29A 1W31A 2FB3A 3C2RA 1TV8A 1TPH1 2FQIA 4HPJA 3IVSA 2CWNA 3W3OA 3S5NA 1QPQA 3BO9A 4DF2A 5AHMA 1SSDA 1FXQA 1U83A 4JTFA 2WQPA 2CLIA 3G18A 3PUOA 4O1BA 4JS3A 4HNTA 1F5ZA 2G96A 2QJHA 2W0UA 1AL8A 3L0NA 4O50A 3B04A 3IV3A 3BW3A 3LTPA 5HINA 3KFTA 5F4XA 4HHPA 4YCPA 4XBSA 1W3NA 3KXQA 3EWBX 2Y7EA 4ONVA 2ZYFA 1P5BA 1LRQA 4Y9AA 2ATMA 5GVJA 1X7FA 5KZDA 1VZWA 3FJLA 2A2IA 4MLRA 5LGZA 2VFIA 3FYPA 3GZ3A 1ZCOA 4X3ZA 7TIMA 4FX8A 5AFDA 2TYSA 3L66A 1JQVA 3MBDA 3W1UA 2BWGA 3B4UA 2NX9A 4ICNA 1LYXA 1OJXA 1Z44A 3GYEA 4HPXA 3NDOA 4LY8A 5BMWA 2JGYA 4ADTA 1K02A 3NEVA 4GUJA 4LVDA 2EHHA 2CLFA 1H50A 2Y7GA 1XBYA 3S5YA 2YZRA 1JCYA 1Q6OA 3BPWA 3LHVA 4RZ4A 4NNBA 4D2JA 1QWGA 4JTIA 3P61A 4MY1A 5CPLA 3W07A 2QR6A 1ZAHA 4JTSA 3W7PA 2C19A 1I45A 1G7VA 2V5LA 4JY8A 3FLUA 1JCXA 2FTPA 4POCA 3ABQA 3G0SA 5L9FA 3M47A 3HIJA 4PODA 5AYZA 3MJYA 1EP3A 3RF9A 1OFPA 3LTYA 4GFSA 2ZZ4A 4DELA 1OG0A 1TRDA 3MO7A 3QSTA 1M6JA 2RDUA 3CHVA 3W74A 2Z6JA 3OVRA 1OF8A 3TFCA 3W1NA 6ALDA 2ISSA 3L5LA 3A22A 4GE8A 4YWIA 5LNWA 2DZWA 4MZ1A 2OT0A 3A9IA 3E49A 3LM7A 3EX6A 3L2IA 1TTQA 2XFWA 3G0XA 5EYWA 1XBZA 3KVMA 4NZFA 1QCWA 3G1HA 4O15A 1YADA 4Z0SA 2CLOA 4N02A 1QOPA 1L2UA 1YTEA 4LS1A 1TPFA 1SO6A 4M6VA 3TU9A 2HMCA 2C16A 3PUDA 1IIGA 2VFGA 1QFEA 1TPDA 1M7OA 4ZQMA 2Z2UA 2E68A 1SO4A 4FHAA 1WAUA 5CG7A 4UTHA 2EKCA 3G22A 4AVFA 2BLEA 3W1QA 2RKXA 2GQ9A 4MIMA 3HOJA 1R2TA 5T26A 3GDMA 3C4UA 5FF7A 3NM1A 3G1XA 3DENA 3W2UA 1H61A 5D2TA 1AW5A 1GVFA 1HL2A 3GR8A 4GUIA 1SR9A 3PC0A 3ATZA 4QNEA 1VHCA 2WPBA 2ZTJA 2OZ0A 4AXKA 3W22A 2YR1A 4NVTA 3EWZA 3I6RA 4O4VA 2H3BA 3LERA 2H90A 3VE7A 2QAPA 4WXYA 1KTCA 1SQ7A 2QDGA 3W1MA 4UMAA 2E09A 3NA8A 1SW7A 1TPEA 4Z1AA 4TIMA 3P82A 3JRKA 1OF6A 1W3IA 3M1ZA 3EB2A 2V2DA 3DFSA 2Y70A 1JRBA 3W7IA 3NQMA 1B4EA 4J9JA 1H51A 1KFCA 1WQ5A 4FNSA 5AYYA 2HTMA 4N9EA 1R47A 1LOSA 1JUEA 5FESA 2OMAA 1OYAA 1LRNA 3EXRA 3GDTA 4O53A 5EBUA 3M7WA 2AGKA 2ZFAA 3HG4A 4OE7A 4AWTA 4UTWC 4NX0A 5BMXA 4ZQCA 1TREA 1MEWA 2TSYA 3UPBA 3DFNA 4MFDA 1D3HA 3W1PA 2A7PA 2GOUA 3IEBA 1NFBA 3LRLA 3H55A 2VKZG 4N6EA 1RD5A 2P1FA 3CPRA 3VCRA 2NV1A 3KOFA 4AEOA 1P1XA 3IIPA 3PY2A 1OVDA 4ADUA 3C8FA 1O95A 2YSWA 3QMRA 4TU1A 1Z42A 1CW2A 1W3TA 1KM5A 4GUFA 4JTKA 2FLIA 4UC5A 5CZTA 1L6SA 1A5SA 4FIRA 2A7RA 4LVGA 1QOQA 5CPMA 3QZEA 4Z1CA 4IPIA 2BTMA 3SZ8A 2JKPA 4PEKA 4MOZA 3TKFA 5KTLA 3W7LA 5LGXA 3ZWSA 2HS6A 1WBHA 3NGJA 3MI3A 1DQXA 1O60A 5CZJA 1GG0A 3OVPA 4IWWA 1UUMA 3S6DA 1JCJA 3LGEA 4NX5A 3RLUA 3IGSA 3MYPA 3PG9A 5DCEA 2O7SA 4HNVA 4UNKA 1DBTA 4K8EA 4NXKA 3TW7A 3WK0A 3LHYA 4FF7A 4MZ8A 3W7JA 4K37A 3HGJA 4O11A 4BI7A 2DZTA 4YCOA 2FDSA 3WFAA 2PCQA 1TB3A 1FWTA 2B0MA 4IMGA 4EWND 1TPC1 1FCUA 4PCFA 3C56A 3FA5A 4GUGA 4AH7A 2ZZ7A 3C6CA 3NXFA 1OK4A 1UB3A 2Y89A 3OEXA 1SUXA 1TV5A 4BI5A 4K7YA 4AWUA 3W7NA 1FUYA 1TJRA 3PAJA 3UPWA 3FKRA 1PCKA 2JKAA 4YLWA 3UQNA 2RH9A 4XBKA 1KM2A 3NQGA 4MUZA 1X6UA 5G1YA 3HPSA 1ICSA 5EA9A 3VNDA 1IXPA 3W7QA 1LZOA 1EIXA 1A5AA 3M41A 5HULA 4E38A 4UIOA 5I3FA 1KFEA 2QCCA 1A53A 4S2CA 4MYAA 1EPXA 2V2CA 3PUEA 4IUOA 3HBLA 1PS9A 3M6YA 3W1TA 2WSYA 3W2KA 5F2IA 3I7QA 4N2YA 1KW1A 2VFFA 3INPA 2C18A 5G2IA 4WOQA 4UTLA 2DJLA 2GJLA 4LWWA 4RXGA 1TYGA 2ZQ0A 4JN6A 3CM4A 4N9DA 1KLZA 3C61A 1OFRA 4Y96A 4S1FA 5C6MA 4HN4A 3TCEA 3P74A 4K6AA 1GOXA 1YDOA 3GKAA 1DKWA 4ADSA 3R89A 3T44A 3LCWA 3QH2A 1B3OA 3EX1A 3TR2A 4RCXA 2JGQA 3QMTA 3TV8A 4P61A 4CNNA 2B7OA 3SSJA 4O54A 3EWYA 3UWWA 5IBXA 5FEWA 3M43A 1XKYA 4MY9A 1G4EA 3N9RA 3OA3A 3TX9A 3G1SA 3E96A 4JR5A 2ZZ5A 4OBTA 3LXAA 3M44A 3KRSA 4O1CA 1PHWA 3BG3A 2OT1A 1VLWA 2YDAA 4X9SA 5A5WA 4Q33A 5D04C 3SJ3A 1AW1A 5CPOA 3EX3A 1KTNA 4FXRA 4IMEA 3NYZA 1EP2A 3UZJA 3VE9A 5DXYA 2E6YA 3CIXA 1BWKA 3P81A 3L0KA 1W0MA 2G95A 1YXYA 5C54A 1XC4A 3EX2A 4X2RA 5DN1A 2ALDA 1T0OA 1O5XA 3GDKA 5EL1A 3RMJA 2X2GA 3MI6A 4NNCA 5K4ZA 3PG8A 1RZMA 2H8XA 1O5KA 3OG3A 3ABOA 3O1NA 4DBDA 3BGJA 2IQTA 3TAKA 2J9YA 2O7QA 4K38A 5KSWA 1OABA 2QEZA 3TE9A 3O16A 3W7DA 3G1DA 4M7TA 1JVNA 1Z41A 3QW4B 3G1FA 3KAOA 3PS7A 4JTTA 5A8GA 4K36A 1OYCA 3OVQA 3FKKA 3LRMA 1H60A 1BTMA 4IX0A 2ZRVA 4A3UA 2W79A 2CFFA 2Q3OA 5KITA 2CW6A 5G5IA 3C2FA 3MP3A 2Q3RA 1IGSA 3TXZA 1FQ0A 3LHUA 2YPIA 2WOQA 4UTUA 3G1YA 1IXOA 5D30A 3TQKA 1SZFA 1JULA 5AHFA 3TSDA 4CQ9A 3BW2A 4FEZA 3W7RA 1G69A 3S1VA 3QJAA 5I3GA 3IIOA 2E5CA 4O57A 1WOAA 2I9EA 3TW6A 4UFMA 3G3MA 2GPTA 1N8FA 1GVSA 4N4QA 1KFJA 3C0JA 1OYBA 3TDFA 4JEQA 5AC6A 4BI6A 1RPXA 1WX0A 2NLIA 3DFTA 3HPXA 1F76A 2VC6A 4ORMA 1F73A 4WY0A 3O8AA 4FNUA 4M6QA 3W7EA 4YXGA 4UFKA 3B0PA 2I14A 1HG3A 1I2NA 3FOKA 2BSLA 5U7SA 3SIZA 4O8RA 3BARA 1ICQA 1J2WA 1C9DA 4JDYA 5G4EA 2HS8A 3W73A 3TA6A 3ANYA 4P2VA 3NQAA 4NJIA 4UTTA 4JIQA 4NNAA 1W56A 2QDHA 1TCDA 4ZQPA 3NL6A 1FDYA 5IBXC 3DI0A 1W5PA 1CI1A 3TJXA 3BGGA 1IIHA 3PWAA 1F6PA 4O0KA 1TIMA 3PB0A 1LDCA 4RV8A 5DXXA 2CU0A 2DZVA 2GQ8A 4QJ1A 1HTIA 5CSSA 3DU0A 3LXBA 1DQWA 2TRSA 1AG1O 5DY2A 3L65A 5AHIA 3CU2A 2QCNA 4WZHA 1KM4A 4LOCA 1YDVA 1YYAA 5D2VA 3HJZA 3NPUA 2E6FA 3ZFHA 2A1YA 1ICPA 5EKYA 1THFD 5SWUA 3QFEA 3DBPA 1N55A 3U6WA 3WK3A 1WBJA 4NU7A 3W7GA 3MHUA 4O14A 3P5ZA 1IXNA 3THQA 3F4NA 3L68A 2GJNA 2A5HA 3FYOA 3GXPA 4MVAA 1ADOA 2YYUA 1VCFA 5BNKA 3CWOX 5KMYA 5G1TA 3TK7A 4BF9A 1M7PA 3C2VA 3HG3A 4UFJA 2H8ZA 2OX1A 4OGZA 2UV8G 4NXSA 1I8JA 2QAFA 3GDRA 3KRZA 2D73A 3GR7A 1ZNNA 4RJEA 3E02A 2CZDA 5CGQA 1QO2A 4BK9A 4RKAA 1KBIA 1VS1A 5AC7A 4R34A 4M6PA 3W1AA 3LI1A 5F2MA 4FX7A 5D2YA 1C29A 3A21A 3TFXA 1DHPA 3QSRA 2QKFA 4UUIA 2OJPA 3W1LA 5KZMA 3EX4A 2CLEA 4IQLA 3S9YA 5D2WA 3F03K 2QJIA 2RDWA 4O19A 1XDLA 1ME9A 2CZFA 3V1PA 1LTDA 4UFHA 3BLIA 3N2XA 4IX2A 4I7VA 2Z1BA 1KTBA 3E9AA 2ATSA 3DAQA 1VLIA 3W7KA 4HT3A 1T99A 3W6YA 2A4AA 3IIZA 4BR1A 4O1AA 2E5BA 3PBWA 3W23A 4UTJA 4IMFA 4Y8FA 1SW3A 3UXDA 2R91A 3QC3A 4H4IA 3DHDA 2ZRWA 3W76A 1MZHA 1LLWA 1DORA 1GJPA 1UASA 4FNQA 1TPWA 4KKXA 2FB2A 4UTTC 3M5ZA 5D2XA 2Y61A 3WJZA 1OFDA 4GUHA 2QCFA 2NXHA 3QM3A 4EF9A 4GC4A 3RU6A 3DGRA 3B03A 3O6DA 1QPRA 3A24A 4QM1A 4K39A 3RLVA 3W7OA 2V5BA 3A5FA 5AYXA 2Y63A 1ZAIA 3GIYA 3TQVA 3IGUA 2E6DA 1YTDA 4PFMA 3DKLA 5CKSA 4ML9A 3PB2A 3W84A 4OU1A 1E51A 3DFQA 4TX9A 2V0TA 2DZXA 3OBKA 4H6KA 3LXCA 1QNVA 2ZA2A 4KWWA 4JX5A 1EUAA 1SW0A 3RFAA 3S5OA 2DZUA 1O4UA 3LCGA 1Q3NA 4TR9A 1OX5A 4L4MA 3NAVA 5I3HA 4RR4A 3IVTA 3QF0A 3MHFA 1K8ZA 1QMLA 3NL2A 3NPVA 4KFPA 3W7CA 3NPXA 1J5TA 3B8DA 3C2OA 1I2RA 5HQEA 3UNDA 5LNUA 5HR7A 4WXZA 3IRDA 2DJXA 5DBTA 2YW4A 2ISWA 4Z1DA 3HMJG 1ME8A 5D05A 3G8EA 1KFLA 2ZZ3A 1VPXA 2PRHA 2H6RA 3TUUA 5E93A 5D32A 3LLFA 5D09A 1F05A 4JD4A 4HKPA 1MEHA 4IJBA 1FCBA 2Y7DA 5EY5A 3DFOA 4RZ6A 2P0OA 4OHQA 5K3VA 3G0UA 1OX6A 3THAA 1H62A 3SGZA 3LV6A 2QF7A 1DVJA 1W54A 2Y88A 1I2OA 1NF7A 1YLVA 1QPOA 2PRMA 3LTSA 3DFPA 1XDMA 2ZA3A 1TPVA 1XXXA 4MLJA 3GLCA 2C3ZA 3RK8A 3EWUA 3LHWA 2Y7FA 4WOZA 1LBFA 3KHJA 2Z0IA 5FI8A 1KM0A 4O12A 4CCEA 3OHIA 1JJKA 4M5PA 4O4WA 2DU2A 1VYSX 4KFOA 4C1KA 2F84A 2ZZ1A 3A23A 4XTDA 1VR6A 2QCDA 3WJYA 1H7RA 1SZGA 3CT7A 3MWAA 1IXQA 3MI2A 2E1DA 4MZYA 3S42A 3LCXA 2Y85A 3C2EA 4K7VA 4TMCA 4XKYA 4DF0A 2GQAA 1MO0A 2VFEA 3QPYA 2TPSA 2RDTA 3JS3A 1I4NA 3S5ZA 3ATYA 1F74A 3I65A 1V5XA 4JXCA 4LUJA 5CPNA 1DOSA 4AF0A 4AHOA 3G3DA 5D02A 3GX9A 1KM1A 4B5NA 3Q2DA 2YFNA 4MPQA 3CC1A 3MUXA 4DPQA 1PVNA 5HUPA 2DZSA 1VCVA 3H54A 4ZQOA 4EF8A 4X22A 5AB3A 1F2JA 2ZRUA 4KWVA
chains in the Genus database with same CATH superfamily
1GCYA 4V1YA 1E56A 2ZC8A 1W9BM 3S1WA 4HZMA 3BVJA 4C6QA 3M5VA 4ASTA 4PUKA 3MBFA 1JZ6A 5TD4A 3OLEA 1Q4NX 4XG1A 3AS0A 1VIWA 3GSMA 1NY1A 1XD1A 4JTUA 3E5BA 1C3FA 1XBVA 3O06A 1EJXC 3NL5A 1JAEA 4NIRA 3W37A 5I24A 3PJXA 1F61A 2XSXA 3G1VA 4F0MA 3FAXA 4IMDA 2CBIA 3KVLA 3M16A 2ISVA 3K8MA 4IMCA 1NQ6A 4L4PA 2NT0A 4ACZB 1UWQA 2CZ5A 4QE4A 4ZQRA 3SB0A 5CC7A 4K8HA 1S5TA 3MDWA 4EPKA 5G2WA 2D24A 3KBVA 4O1EA 5E9XA 2HPIA 4JCMA 1BFNA 1EWEA 4BJHA 3WMLA 4LAZA 2J79A 2EAWA 5D33A 1JD7A 4CD8A 3PZMA 3B3DA 1MW0A 4OJYA 4K3ZA 4Q8UA 1D8WA 1O1ZA 3NOEA 3UU0A 3R6IA 4U5KA 3WQWA 4S3KA 2E4TA 1YPFA 2HRWA 1UKQA 1VBJA 2NWSA 3GRIA 3O05A 5CJMA 4YVVA 4R9OA 3TR9A 1GW9A 4E2BA 3NGFA 3F4WA 2ZUSA 3L5MA 1X8FA 3RX4A 4DBWA 3KLLA 3PSVA 4BF5A 1IT0A 1EH9A 1JZ5A 1TR1A 3LCIA 2QPUA 4GI4A 1KKRA 2DUAA 3FXYA 4MWAC 1FP8A 1RQBA 5BOOA 1RHCA 1HKMA 1SGJA 3E0IA 2GVJA 1Y0EA 2J88A 3FJNA 3KRUA 4PL2A 1G4SA 3LMZA 1K3UA 4PMXA 1AQFA 3LMYA 2XN2A 3ITOA 3EB3A 5LIXX 2ZWYA 3SCPA 1BGAA 1TUXA 2CXGA 3FJ6A 5EPDA 4B2DA 2EPNA 3BLKA 2X30A 4C6EA 3PNUA 1TV7A 4WDUA 3W86A 4UCGA 1Y8BA 3IJQA 2VZOA 1V6UA 1M7XA 5AYIA 2FIQA 1KFWA 4J7RA 3VO0A 3G5EA 3RR1A 1E1EA 1CEOA 4PUWA 4W7UA 2Q09A 4S3EA 2PDYA 4L6DA 3GXTA 5AVHA 1JGMA 2CLMA 4NILA 5K9XA 4TX6A 4D72A 4I5UA 2HEJA 1OC7A 2DIKA 3VGBA 4L6HA 1JG9A 3SGGA 3U2OA 1UQZA 3NSXA 4JYFA 3SM0A 4R33A 2IKGA 2QIWA 2FGZA 3NVDA 1B57A 4QNWA 2WJDA 3C2YA 3GC5A 2OWWA 4MNJA 5E1QA 2ZKMX 3PVFA 3BGAA 1W5QA 3HFTA 1MUCA 3IGXA 1S5NA 3AJXA 2XHYA 4IQDA 4P8XA 1W3JA 1R3SA 3BZJA 4YVPA 3F5JA 4Q8MA 3IVUA 4B91A 5I3JA 2XSAA 1R2RA 1FWAC 4B5SA 4UR8A 1U1HA 2ABAA 4D6IA 1EYEA 3DFHA 1IYXA 2BHUA 3ME3A 1SJDA 2QCLA 2WC3A 2YFOA 1UP3A 4MMWA 2QCGA 2XVPA 4HTYA 1TSIA 3STFA 4AQLA 6A3HA 1GEHA 3GFYA 3WJSA 1E6RA 5LNRA 3DI1A 4GY7A 3SCVA 1YPIA 2DSZA 1OCQA 2PCEA 8XIAA 3W2MA 1QBBA 2WQDA 3VAVA 1ZJBA 2EKGA 3SFWA 1LROA 2VFDA 4S3JA 2D3LA 3TNOA 3DIPA 1AK5A 1LM1A 4YL2A 4PBGA 2WSKA 2F61A 1XM3A 4HNNA 3S8HA 1NF0A 3VUPA 2YCLB 4QSHA 3OB8A 3CH9A 4DO5A 2W5FA 1G94A 4PZVA 5DBUA 1ZAJA 2LLEA 4J35A 3P14A 4U31A 4DJDD 1L9WA 5CGMA 3WLLA 4JTEA 3DHPA 1XYBA 4IJRA 2OO0A 3SCTA 1JCNA 1EYWA 2BFGA 4BZYA 3W1XA 5HPOA 2XZ9A 1GVQA 1X1OA 4GZ7A 4Z17A 3GAKA 3N3MA 5D9PA 2OZ3A 2MANA 4RNHA 5D9OA 2PDWA 3R5EA 4KBXA 5FSEC 4FP1A 3RPMA 4GWEA 3WQVA 4DUOA 4PMDA 4LNYA 4UOQA 5M1TA 2ZVIA 1J01A 3O63A 4L7ZA 1UMYA 3CQ0A 3IJ9A 2YCJA 2DH2A 4M7SA 3T8QA 2WVVB 1QI0A 3UF9A 4NYUA 2NW0A 4ERGA 2GOKA 1W1ZA 2DVXA 3D47A 3TIMA 4IFOA 1ZFJA 1EXPA 2O4QA 2PTZA 3WK1A 1MI3A 3GBDA 3KUMA 2A7NA 2PDJA 4GX8A 2ACUA 4J2MA 2JIEA 2NVCA 4H00A 1QNPA 1TUFA 4BWLC 1XICA 1T41A 1M41A 3DG7A 2J7EA 4JQAA 5KZEA 3TWAA 4DPPA 3T81A 4Q7IA 4QG9A 2NWRA 4GIRA 3BAKA 1GVYA 1KBKA 3BLEA 3ZS4A 4XUGA 3I4EA 3L9CA 4A8NA 1PV8A 1JCMP 3EXTA 2VEMA 1FY6A 5TIMA 3QPZA 3S9IA 3EDFA 3MCMA 3WQEA 5LKYA 1MVYA 3WQOA 1PB0A 3VFLA 1N7KA 4MTVA 1W5MA 1CT5A 4OZOA 4LBUA 4QLLA 4H8VA 2QCMA 4HHHA 3UJEA 3VGFA 5HWNA 4FO4A 4DXVA 4KWSA 4ZE4A 1PTGA 1ONXA 3SFKA 1SPQA 4GJ1A 2OYKA 3LOTA 5F4WA 1E55A 1KA9F 3VDAA 4B90A 4NT0A 1JZ3A 1VEPA 4OV4A 1SZEA 2JKEA 1LWHA 1QVBA 1TPB1 1VQTA 1MW3A 4LJ3A 3VFCA 2Z2BA 3FA4A 3RUBL 3PZUA 1W91A 5I79A 5CZ0A 1T5AA 3NO1A 3P60A 4X2PA 4JIPA 4LC6A 3VZZA 3N9SA 2B7NA 4O28A 2WVTA 1W9UA 2V5KA 3WBYA 3WQ6A 1LQAA 2FZ9A 4AMAA 2X0SA 4H9XA 4WJEA 3AHXA 2DSUA 5FAJA 3H7VA 5CAKA 4QXIA 3Q45A 3L4WA 1KCLA 2OKOA 4FX6M 3Q37A 2O4MA 4ZA0A 3B0YA 2BY2A 5I03A 2R8WA 3T09A 1P0NA 1F3EA 3P7YA 1LWJA 3IUDA 2DORA 3PNZA 4Q4SA 3H70A 4G6CA 4C6DA 3ZVHA 3MPGA 2HSAA 4FNPA 1WDDA 3R4IA 4KRZA 3TW9A 1IF2A 3GG8A 3W53A 3WEOA 3E74A 4GOAA 5FEPA 3BAJA 1UYQA 1GEQA 7XIMA 3O2LA 4UQCA 5F2LA 5A8NA 3ZXWA 8A3HA 4KESA 3BSHA 4IXXA 3L21A 4ZSUA 2DUXA 3WLMA 2NSOA 1SZRA 3NO5A 3SY5A 1WXZA 1E40A 4I5XA 2PDQA 2QJNA 5MKGB 5HMSA 1BKSA 4LU0A 1A0DA 4AVOA 5FF0A 2VCAA 3N6JA 1FHVA 4M82A 2J25A 3USBA 2VT0A 3P62A 5IHSA 3VOJA 1CGTA 3VMPA 4M8UA 3Q58A 2QCHA 4DN1A 1JCLA 2PWUA 4DJDA 2X1TA 3JW7A 4GYPC 1NDVA 4OT7A 2ZCGA 3ARQA 4PA8A 1GOMA 3KVKA 2OKTA 1UCWA 3WJXA 4LF1A 3TMQA 4FNRA 5KINA 3UG3A 1LP6A 4JZ5A 1F6KA 4PL1A 2ZRZA 3FYYA 2VEKA 1UR1A 3M7SA 1RVKA 3SAZA 4AY1A 3VNZA 4XWUA 4CVUA 5EMUA 3KBNA 4O52A 3R94A 3N73A 1VC4A 2RFGA 2EPKX 2P76A 5D37A 1GYLA 1ZALA 1GOWA 3V1HA 1FDJA 4OVXA 1P0KA 3L67A 2BXVA 5DELA 4AXNA 3AICA 1P7TB 3SY8A 3R0UA 4YVXA 4Z0JA 4LYQA 3BLOA 3BQ5A 3PAOA 2Y24A 3UWQA 3EDDA 4RV3A 3T42A 2J27A 3CBWA 1OHLA 4RZ5A 1JUBA 2JBMA 4S2BA 4W85A 4H9YA 3MT1A 4HN8A 1GQNA 4GIEA 1NU5A 3OZYA 3I68A 2BXZA 1NH6A 3PJUA 3QZAA 1H7OA 2FZMA 1RSCA 1UWAA 3BWWA 3W9ZA 4NP7A 4PMRA 2V3FA 1RK6A 4RNJA 1YTKA 3F4CA 1TTJA 4J40A 4NRRA 3ARUA 2YGYA 3QFWA 3STEA 4PB3A 3GVQA 3EKLA 4KF1A 3P8IA 3U7BA 2QPSA 1LL7A 5K4XA 3COTA 4BF7A 2A3HA 1L6GA 3VKCA 2WJZA 1YNYA 2B7QA 2XH7A 3A13A 1DL3A 2X1RA 5U4NA 2QUTA 1W37A 2DGAA 3MSRA 3LLDA 5FEZA 4JTJA 3C2RA 3S2MA 4XAYA 1DTUA 3ZT6A 5C9ZA 3A4XA 1ITQA 3WMCA 2DIJA 3S5NA 1ONEA 1TV4A 5AHMA 4X0NA 2D0FA 4ZTYA 3A9BA 4FZIA 2Z1VA 2PWFA 2WYSA 2J74A 4JS3A 4CKQA 3A47A 2DPEA 4NHVA 2RAGA 1WCGA 2W0UA 1S39A 3L0NA 4MWAD 4QEEA 1HJWA 3RRXA 3BW3A 3KFTA 4GVFA 5F4XA 4C6FA 4XBSA 4HMCA 1Z9AA 2GL5A 2PWVA 5BROA 3WBAA 4ONVA 2Y1HA 4Y9AA 5GVJA 3V35A 1SFSA 1XGEA 1UIPA 1EJWC 5LGZA 1JQVA 4MAVA 3W1UA 3B4UA 2PGRA 1QHPA 3WKZA 1B2YA 1CGXA 1E15A 3NOYA 1OCBA 3NDOA 1CLKA 5BMWA 1LL6A 2EHHA 3WO8A 2YZRA 3U2ZA 1UROA 1C90A 3P61A 2PBGA 4PMZA 2QR6A 1ZAHA 2ZUUA 2HVMA 4ACYA 1HL9A 1G7VA 3RAOA 1G0CA 2PFHA 3FLUA 4POCA 4GO9A 2YCLA 4DHGA 3GQYA 1V0NA 4H6RA 2E1WA 4GFSA 3VD7A 3PPFA 2P8CA 4DELA 4GXWA 3ONBA 1OF8A 1ENUA 4FOUA 5LNWA 5C2CA 4MZ1A 2PLCA 3EX6A 2XFWA 3LQLA 1XBZA 2J7GA 1PAMA 4KMQA 1YADA 5IFPA 2BHYA 1TPFA 1SO6A 1WXYA 1V3LA 3H4GA 3AWNA 4UOJA 1UWSA 1TPDA 3POHA 4ZQMA 4L9XA 3B97A 3AALA 4QGCA 2EKCA 3AYSA 4QR6A 2RKXA 2GQ9A 1GKPA 3AOFA 3ITGA 3G1XA 3W2UA 3EMQA 4R88A 4UZSA 4KQNA 3WDIA 1H2JA 3ZR5A 3ATZA 5C2GA 4ZEPA 2ZTJA 3WCZA 3PFMA 3UG5A 1TMQA 4O4VA 3KWXA 3T08A 2ZUNA 3LERA 2BHZA 2VR4A 1HJUA 1XQLA 3LPGA 1ZLPA 4TX8A 4GNKB 4PCSA 4C91A 3THCA 4S39A 1OF6A 1W3IA 4S23A 1NWUA 4Z2HA 3NQMA 2OZTA 3MCNA 2QUMA 1WQ5A 3LUTA 5A6AA 4N9EA 5FESA 1UR3M 3BLPX 1OYAA 4AZ7A 3QGVA 3GDTA 3V5FA 2A3BA 3SRHA 2INFA 3P2VA 1BVZA 3M7WA 1K6WA 2EO7A 3HG4A 3OU8A 4OE7A 4AWTA 3V4BA 2PTWA 3UJSA 2WLZA 1MEWA 2TSYA 3EZ4A 1D3HA 4Y2WA 3W1PA 3N3TA 4ZB2A 2A7PA 1NFBA 1XYAA 2XINA 4I3GA 3TJ4A 4S3BA 4D6DA 4IHCA 3CPRA 3VCRA 3KOFA 1ODZA 4L4OA 1K8CA 3PY2A 2IW0A 4ADUA 2YSWA 3MSGA 4WR3A 1Z42A 1W3TA 3IGHX 1A5SA 1Q85A 1BYAA 1U5VA 4GKTA 3MTWA 1UP2A 2JKPA 4LANA 5BRPA 4E6MA 5KTLA 3PZQA 1IZJA 5ABFB 3NGJA 4F0KA 1DQXA 4IWWA 1SFTA 3S6DA 1UR9A 1DWAM 1K9EA 3IGSA 2Q8XA 4R5EA 5DCEA 4DXKA 2OYMA 2PB1A 4H01A 4BHYA 4FF7A 4MWAA 3EA1A 2SFPA 4D71A 3ZLGA 3HGJA 5A6KA 4W4QA 1A0CA 4B3LA 3WFAA 2B0MA 4EWND 1TPC1 1FCUA 1PSCA 4PCFA 1ZQ5A 2ZX9A 4LYRA 4MUPA 1OK4A 3MV11 1IR1A 4YTQA 4B3KA 2GGJA 4JBRA 4AWUA 3W7NA 3UPWA 3PAJA 2CXEA 2PU1A 3VIJA 5GNZA 1V6VA 2RH9A 1KM2A 4Q6JA 3W24A 3NQGA 1X6UA 4C6JA 1EIXA 3UR2A 4HHLA 3U7VA 1EPXA 5HK4A 1C91A 1DIOA 4WDTA 2V69A 2DSWA 3W1TA 3W2KA 4HSHA 1ZRQA 2ICSA 2WMKA 4N2YA 5AVNA 3VNJA 5FL1A 1NDZA 4DO7A 4UTFA 4WKHA 4WOQA 2PTYA 3MA8A 1UKSA 1TYGA 4IP7A 3N12A 6XIMA 5GNYA 2PP1A 4LYKA 2NQHA 2G4FA 3GG1A 1GOXA 2VJXA 2VD8A 2ZWZA 3AS2A 2EBNA 3VIKA 3NDZA 1G01A 3QH2A 5HQMA 1B3OA 1E1CA 1UKOA 2JGQA 1OWQA 2DT1A 1UR8A 1X39A 4GZEA 3SSJA 1NJJA 4XVDA 5A2AA 1G4EA 5E0FA 3G1SA 3K4DA 4E5TA 3QY6A 5A69A 4C7GA 1W1VA 4CEXC 4JTQA 3BG3A 2OT1A 1VLWA 1TR9A 3CHDA 1UBPC 1KTNA 4FXRA 1U22A 3UZJA 1EP2A 4HYWA 1GYMA 3CAQA 3QN3A 1F3TA 5DXYA 1BWKA 3KTSA 5IXEA 3EX2A 1T0OA 5HNTA 3KCJA 3ZR6A 2C79A 5ECUA 1RALA 3TYDA 4JHOA 4S3CA 1SMAA 3O1NA 5B80A 2NSXA 1QNQA 5CQ1A 3E0VA 3WIJA 4IG2A 5KZ6A 2HNHA 5KSWA 4AIBA 4E4UA 3TE9A 2GK1A 5REQB 1QI4A 1JVNA 2TODA 3PJTA 3VD4A 1EQCA 3BCFA 2BY0A 1ISXA 5IOBA 1JNEA 1OZMA 4K36A 4UQ9A 3SCQA 2D2JA 4H6EA 2CCRA 1MWOA 5FJJA 2ZRVA 3AZRA 2I9UA 5KITA 4XZMX 5G5IA 2FZ8A 2Q3RA 2V5JA 3FGCB 1H4PA 2Z28A 1BF6A 1SZFA 3UVAA 5AHFA 2I16A 4CQ9A 3BW2A 5EFDA 2PDUA 3S1VA 1OG6A 8XIMA 1TE6A 1EO5A 1WOAA 3TW6A 3ARRA 3K8KA 3URNA 4O1FA 4N4QA 3C0JA 1OYBA 3TDFA 4JEQA 4Q22A 3STPA 1RUSA 3UG4A 3CK5A 3DFTA 3U0HA 3MUCA 3HPXA 3VIFA 1Q6CA 1QOXA 1F73A 4PUUA 4WY0A 3O8AA 4FNUA 4M6QA 3W7EA 2OFJA 1HG3A 1ZJAA 3FOKA 3M0KA 5U7SA 2ZUTA 4PRWA 4JDYA 4Q6XA 3AHVA 5G4EA 3W73A 2HE8A 1K9DA 4XD4A 3ANYA 3GS6A 3QR3A 1WNOA 4Q7BA 4D6JA 3IV8A 1DWGM 2F9RA 4PEEA 2V5CA 3QYSA 1W5PA 3HJEA 3TJXA 5IRPA 3BGGA 1IIHA 3CH0A 3ZOAA 1UR4A 3PB0A 3WF2A 3NJ3A 4RV8A 4KCTA 5DXXA 2GQ8A 3S2LA 5HBFA 3DU0A 4LCRA 2PEVA 4TTUA 1AG1O 5DY2A 5AHIA 5I78A 4LUTB 1VEOA 4TTGA 5CC3A 5D2VA 3HJZA 3MVTA 3ZJKA 2DW7A 2A1YA 1V3IA 3BH4A 3U6WA 3WK3A 4YYCA 4NU7A 2Y5EA 3RM9A 3W7GA 3FHQA 3VDHA 1UD8A 1BRLB 4JFUA 1TZ7A 3AYRA 1OD8A 1IZKA 5JH1A 3L68A 3WMSA 1VFLA 1U1JA 3QGKC 1C8XA 3VNLA 1QWKA 1H41A 3CWOX 5HXMA 5KMYA 2OQHA 5G1TA 1XLGA 3VGEA 4GYJA 3TK7A 4C6KA 4QG8A 4PCTA 1XD0A 1I8JA 3GFZA 1B90A 2D73A 4PMOA 4J2PA 2P88A 4E3VA 1CDGA 2UY3A 3VGGA 3WG6A 3V7PA 2PF8A 5C71A 4OOZA 2WWDA 1K6AA 1YQ2A 3LI1A 2D22A 4MJ4A 5F2MA 2WZTA 4GZJA 1XSIA 3QKZA 2QKFA 1QNRA 2VZSA 2GSEA 3GC4A 7TAAA 1SVDA 3W1LA 4IQEA 2CLEA 1K1DA 1LWIA 2G8ZA 3VOHA 3ITVA 4QLKA 3PK7A 1B0IA 2CZFA 2Q02A 2C0HA 3L4ZA 5EMKA 2Z1BA 4H19A 3DAQA 3RLHA 3W7KA 3RITA 1BYBA 2E28A 2EPLX 4Y8FA 1XSKA 3QC3A 2DZBA 4C7DA 1GJPA 3LQGA 1TPWA 4UTTC 1DTNA 4WKFA 5D2XA 3PJWA 3GUWA 3QM3A 3NSNA 1FVPA 4A05A 3DGRA 4LUSA 3IUHA 2BVDA 2GJXA 3A24A 1A0EA 3KTCA 2NQJA 2HK0A 3GIYA 2IXUA 1DIEA 3IGUA 3TQVA 1W2VA 3DX5A 5CKSA 4ML9A 3PB2A 4PUEA 1W1B1 3RCNA 4OU1A 1VFHA 3U3HA 3C0QA 4B4HA 1QNVA 4KWWA 1OGSA 1PYFA 1XH1A 4JX5A 5M3WA 4LALA 1OGGA 5BU6A 2VR2A 2PP0A 3EPMA 4JKKA 1K70A 3LGDA 1UJQA 3LCGA 4FF5A 3VD5A 1E6QM 4L4MA 3IVTA 3MHFA 3IJ8A 1J5TA 3UNDA 3CHFA 4DIAA 5HR7A 3VUSA 4IPPA 1DQUA 3DYPA 4HA4A 3LD5A 1ME8A 1RCXB 2XGBA 3G8EA 1MNZA 1TJ0A 1VPXA 2PRHA 2H6RA 2E9BA 2PWHA 2DQXA 3L4UA 3TUUA 3N15A 2CNCA 5D09A 3QOKA 4JD4A 3P0WA 3PZ9A 1BXNA 3DFOA 1W3LA 2P0OA 3GG7A 2Y88A 1FKWA 3PZOA 1RD6A 4Q4OA 5AY7A 1OM0A 3GNXA 4GYPA 3LTSA 2PLMA 3DFPA 3SQSA 2ZA3A 4PMJA 3WDPP 1XXXA 1ZBWA 2C3ZA 1PIFA 4QCFA 2Y7FA 4WOZA 1XRSA 3KHJA 2Z0IA 1KM0A 1ADSA 4ZR8A 1R9ZA 3VM7A 4O4WA 3KLKA 2WNWA 2ALRA 1VYSX 1YE4A 4WDXA 3BOXA 4KFOA 4C1KA 2ZZ1A 2QCDA 1H7RA 3PPGA 4DAFA 4OKDA 4FLRA 3S42A 3LCXA 3C2EA 1REQB 1S2VA 1ZP4A 1QI5A 3R8GA 4F9DA 4DF0A 2GQAA 3WH8A 3L23A 2CKSA 2TPSA 3E0FA 4H1ZA 1YBQB 3S83A 1I4NA 3S5ZA 3QR0A 4YS1A 1TJ1A 1F74A 4JXCA 3BJTA 1MQQA 2Z7KA 4M56A 1UWTA 4UWMA 5GJNA 4AF0A 2BGNE 2IS7A 3G3DA 1OCJA 2AKMA 3LEPA 3LZ3A 2XU2A 4EF8A 4AD0A 2ZRUA 3V0SA 4BFAA 4MY8A 3OZOA 3BV4A 3CTLA 5K7JA 1RP9A 4HYRA 4E8CA 5G4HC 3LSCA 1GPWA 1OQFA 4N6FA 2XVKA 1MQRA 4LAUA 3TH6A 4JNZA 2OX4A 1VFSA 3ABRA 2PC4A 3K8LA 4KS0A 4NJGA 2WSQA 2HNEA 1B54A 1HVQA 3NURA 4JNMA 1Q6RA 1H7NA 4AMCA 2JK2A 3C8NA 2VDGA 2AKZA 2ZXBA 4O16A 4D6HA 1H3GA 4BA0A 1CZ1A 4AZBA 1TJ2A 3GO2A 3NQDA 5ABTA 1G6CA 2PP3A 2Q8LA 5CGTA 1AL7A 1HP4A 4DUWA 1IWAA 1LOLA 2Q6ZA 7REQA 1S2UA 1TTPA 3KVJA 1NVMA 2ZTKA 2WANA 1FWJC 1UUQA 1DWIM 2V8ZA 2OG9A 1OFEA 2GSHA 5I09A 4F2BA 1PHQA 2OODA 4ZMGA 4PUJA 3WQGA 3C86A 2WSRA 4W8BA 2OSXA 1RJPA 4JN7A 3W01A 1LG2A 3NQEA 3W2LA 4BQ4A 5A6MA 3OG2A 4IIGA 2XFFA 2VZTA 3F4VA 2X1SA 5LHEA 1J0KA 1RK5A 1A5BA 3CMGA 4HSOA 3CV6A 1E0UA 1U30A 2QDEA 3AIEA 1IT7A 4NJJA 3LCHA 1I6NA 5AOUA 1J0ZA 2WNNA 3MMTA 4MJZA 3WBWA 1BHGA 1QPNA 5CZKA 4Q8NA 1VEMA 5T91A 4F2UA 1LBLA 5A8OA 3NR0A 1KV8A 3DBNA 5E5CA 3CHEA 3R43A 3CT2A 4GJIA 5T8GA 3SCOA 3DG3A 2PDNA 1C8YA 1QK0A 3ISIX 2Y6ZA 4ZO8A 1KRAC 4RX0A 4F9JA 1I2QA 1K7XA 4QROA 3HN3A 4YIWA 3FEMA 1E4MM 3WLNA 3RO8A 1PIIA 6XIAA 1Q7ZA 4GQBA 2DUZA 1TV2A 1FWFC 2YW3A 1FRBA 3RRAA 2ZZ6A 1TQJA 2E25A 4KETA 1NSJA 3GU2A 5DMYA 4O0ZA 3CUJA 3TC7A 1AH4A 3T78A 2VGGA 4E3TA 1W5OA 1YXCA 4C6OA 1KNWA 4XQ6A 4D8ZA 2O0TA 3LI0A 3NQVA 3GU1A 3NDYA 2QUNA 5HOSA 4JTDA 4L61A 2GVLA 5CZSA 1U2YA 4LVBA 2WMIA 2WJEA 4PGLA 1W32A 2NV2A 3AIRA 3CYJA 1GYNA 2XIOA 1VENA 5CC5A 3ELFA 2WM1A 4GQRA 1J9YA 2BP1A 2H3DA 1R2SA 4JYEA 3OIXA 1VIZA 1H7PA 2WCSA 5T9BG 1T8XA 3PZIA 2IKHA 3ITLA 2ZXDA 3DUGA 2YJQA 2BY1A 3NQ7A 3M07A 1V77A 3RILA 3QY8A 3FK4A 4WD0A 1L6WA 3GUGA 2XGZA 4JICA 1DEDA 4R53A 1M1BA 5AECA 5E0KA 1IWBA 4FXFA 4CQCA 3W02A 2Y0FA 1M68A 2NX1A 4N9CA 1EZ2A 3EOLA 3QEZA 3GWQA 4DQWA 1OZQA 4IF2A 1XUUA 3OLDA 3OO2A 6TIMA 4P7LA 3RJXA 4QSFA 3NXLA 1XX1A 1LL4A 4DZIA 4HJFA 1VHNA 3OODA 1UC4A 1KM3A 1EJ7L 1ZBCA 2C13A 1YMYA 4MB3A 2OQYA 4LS0A 3GXNA 1ZPTA 1NFPA 2FMNA 1VB9A 4XZIA 3L0GA 3ARYA 2UBPC 4HYVA 3T8LA 3CLMA 4FB7A 4WDWA 5I3IA 1QDSA 1LORA 1V7YA 3O07A 3UD6A 6REQA 4AD3A 1XYCA 1AZ1A 3WDQA 3NZGA 1ML1A 1E6SM 1H0GA 3VIMA 3QYQA 1FBAA 3UZZA 1LLOA 4HK7A 3T55A 5IFTA 2P10A 1AD4A 3TEVA 4ECLA 5HJLA 3H2AA 3TWBA 4C6LA 2WNZA 4Y9NA 1JFHA 2OEKA 2JE8A 3N29A 4HSNA 3DXIA 3HO8A 1ZU8A 4HZ6A 4KH2A 3T40A 4IGHA 5FF4A 1XRFA 1KM6A 3M9YA 4I7UA 4WSKA 1KXVA 1LT7A 1VBHA 3KBWA 1GVRA 3UWYA 2EGZA 1QJWA 4CN4A 4PMQA 2QJMA 4NZJA 1K4GA 3GG0A 3WNMA 2VNCA 3WF1A 1ZS2A 4LBRA 5LHFA 1XLHA 7ODCA 4KGLA 1XI3A 4IGNA 4DYKA 2BDQA 2FPYA 5H91A 1BWLA 3Q94A 5G2HA 3CQHA 1PKNA 3M4HA 1XPYA 3HQNA 3W88A 5BRBA 4NI3A 1HKWA 2WC7A 2CPUA 1I1XA 1V0MA 2J77A 1RR2A 1Y5XA 3R13A 1FCQA 3H53A 3AMKA 1Q6FA 4KEMA 4QS5A 2R82A 1RJRA 3TYUA 3PHAA 3TROA 1GWJA 3GVWA 3IPWA 4KRUA 3N17A 3QV9A 3N04A 3GBEA 1SU5A 4S3AA 3AU6A 3MP4A 4YTSA 1XG3A 4DO4A 2ZBTA 4QDWA 3AMDA 4RW3A 1TTIA 1RVGA 1P4CA 3C0SA 3K30A 3KCLA 1UZHA 3TNBA 2J47A 2QUVA 1LUCB 1MXSA 2J9ZA 4JY9A 2NZLA 2I17A 3M0ZA 3NZ1A 3EKGA 4M1RA 2VL4A 3W87A 2ISDA 4XD6A 3SEPA 3URQA 1UUOA 3E2RA 3S0CA 1JZ8A 3MKKA 3F2DA 1ZSXA 3IK4A 3STCA 3TSBA 1EBGA 3ABZA 1IQ8A 1V93A 2G3JA 2W63A 3OYXA 1CYGA 3FCPA 2B31A 1B9BA 4E8DA 3HQOA 2CZEA 3QY7A 4CLMA 5DMMA 4Q7NA 1UIOA 1XIEA 3PBYA 3WJWA 3S9ZA 1AZ2A 5ABHA 1G4TA 4G1KA 1EOKA 1R30A 5EFFA 2J7DA 3NVTA 2R9RA 4UTIA 1HNYA 3R2GA 3BAYA 4HU8A 1L8NA 4FNTA 1ITCA 4DO6A 3GHUA 5FJTA 5LNSA 1KFBA 3QLDA 3RNDA 4BQ2A 1HJSA 1K7FA 4M29A 2ZIDA 1AODA 4WK9A 1R3VA 3T0BA 4DRSA 4QIUA 3V75A 4IH3A 1DPMA 1PTDA 2ZRYA 3MCOA 2OCZA 4PULA 8TIMA 3CEUA 4GY0A 1HN1A 2VMFA 5LYRA 2VELA 1EX5A 2WNQA 3PULA 3WH7A 4HA0A 4C1LA 2XIJA 4A3QA 1ONRA 4EPBC 2NT1A 1DJNA 3H21A 1CX9A 3S46A 4PCNA 3NQ2A 4C6IA 4XZBA 3AXXA 2VQTA 2PGEA 1I60A 3E12A 3FEQA 3P80A 1IEVA 1RQEA 3SI9A 3NNTA 2R14A 1FTXA 3MV01 4GK8A 4H8UA 3BLFA 4AY8A 4OV9A 5HNRA 1TQXA 4HIBA 2PURA 3B8IA 3TTYA 3FS2A 3REQB 4FIQA 2V5DA 4NZ5A 1J0IA 4YNGA 2NUXA 1Z7AA 4GRSA 2VWTA 4ALDA 2WKJA 3W83A 3ZT5A 3GFXA 3LB0A 1EXBA 1TJPA 4JFSA 3SRDA 2I56A 4UFLA 3QTPA 1VYPX 3WD4A 1UOKA 1JGIA 2ADAA 4GGHA 1TELA 1BSIA 3UG8A 3WEZA 2PZNA 3W26A 3NM3A 3RPDA 4RW5A 3GKFA 2X05A 1HUVA 3TQ0A 1J8VA 3BMWA 1VFOA 2A6LA 1MSSA 2FTWA 5TQLA 2EPHA 4AZCA 4MYXA 1KBJA 1FA2A 1VGAA 2WW5A 4AIUA 2IUZA 4ZOEA 2PE4A 5G4WA 1XQKA 5CG0A 1V02E 2X8RA 1BQCA 3LYEA 4DM2A 3HPZA 3D46A 1DXFA 1WV2A 2NX3A 4L5ZA 4CGTA 1ZY9A 3ALGA 4Q4RA 3H2CA 3UGRA 4A35A 2WVSA 3WZ0E 2VFHA 4EKJA 3NWRA 4IPJA 2VEPA 2NVAA 3HPFA 2X16A 4I7WA 4CNOA 1LF1A 1Z89A 4MNLA 3HG2A 1QR7A 1YDNA 3P8JA 3DFYA 2VEIA 4XTIA 3TYZA 3ZZ1A 4DEFA 1Q6QA 3TCSA 4Z2IA 3GTHA 4JQ4A 1KRMA 3DOPA 3I6EA 2X1UA 1BD0A 1EBHA 4ORIA 3O15A 4UQBA 1VFFA 2PD9A 1EWDA 4FR1A 4O18A 1SFLA 3FIGA 3AZSA 4JKLA 2ZXQA 1GHSA 2D1ZA 1M5WA 3WDHA 1MEIA 5DY3A 3ITXA 2BZNA 2XZ7A 4XZ9A 2DP3A 3URBA 1JDFA 3VKKA 1V08A 1W9PA 2XN0A 3LBMA 3M5YA 5LNVA 3C3UA 3FFSA 3CIVA 4TXEA 1TKKA 3WUGA 3QOMA 1H63A 3CV2A 1G7UA 5JVLA 1NAL1 2C0AA 2VZUA 5I23A 1WA3A 5D8WA 3RLGA 4QAIA 2AMXA 3NG3A 2ZC1A 3U5UA 5FF3A 3BUVA 3S2CA 1XYZA 4ES4A 4UZUA 4KWUA 1W9DM 2YXOA 1R46A 2QCEA 4ZXLA 2EXOA 1QXLA 2Z7GA 3XISA 1JDDA 1W8SA 1TMHA 2J9XA 3RG6A 4ZCWA 4J3TA 4MPKA 4YHEA 2HBXA 3BDKA 5JBEA 2WLYA 3W27A 3JU2A 3W82A 1PKLA 2P3ZA 4HPJA 4DJDC 5TNVA 2CWNA 1NTHA 3MDUA 1FXQA 2WQPA 2CLIA 2X7WA 4O1BA 4HNTA 1GGOA 2VX5A 4GIYA 2R6OA 1KR1A 1AL8A 1DWJM 3AZTA 2W62A 4I9MA 3ZSSA 4RE2A 1GHRA 3LTPA 5FJOA 4HHPA 4YCPA 1K4HA 3EPOA 3SUTA 1W3NA 3KXQA 4AZGA 1V03A 2OLAA 3EWBX 1E1FA 3B8WA 4RE4A 4R7OA 3MANA 4M51A 1ZCOA 4X3ZA 3BLLA 2WXDM 4FX8A 2V67A 3U2EA 3MBDA 4ZTXA 1UH2A 1SMDA 3VNYA 2ESCA 1OIFA 4ICNA 3GTIA 1FWIC 3PFRA 4FAMA 4ADTA 1QW8A 1K02A 3NEVA 4RDWA 3FSUA 4LVDA 1TX0A 1H50A 4LFYA 1XBYA 4CN6A 1Q6OA 1KQYA 3TOYA 3VX1A 3BPWA 3LHVA 4D2JA 1QWGA 4JTIA 4LUYA 5CPLA 3ZMRA 3QBUA 4IT1A 2BY3A 2C19A 1EOMA 1J10A 2WHKA 4JY8A 4DLMA 3WMBA 1EHNA 2FTPA 3G0SA 3HIJA 4PODA 3GTFA 3MJYA 2ZZ4A 1VRXA 1OG0A 1XFCA 3MO7A 2RDUA 1P6CA 3FX4A 4GLEA 4GE8A 2XSBA 3F7JA 4H04A 2DZWA 2OT0A 3E49A 3BV7A 2YLLA 5E09A 3AROA 3G0XA 5EYWA 3KVMA 1NIUA 2WK2A 1QCWA 4O15A 1JPIA 4Z0SA 2CLOA 3NCOA 4IGMA 1UWIA 2FZDA 2YA1A 4C6PA 5HDRA 1YTEA 1WAWA 3APYA 3UZXA 3GH4A 3H12A 4GINA 2QHAA 4MGGA 1HKJA 2HMCA 3MMDA 3PUDA 2OWXA 4JKMA 3SCWA 1QNSA 4EANA 4UTHA 4XIAA 4JFWA 4MIMA 3HOJA 1AJ2A 1OIMA 1DHKA 3DENA 2L5HA 3E38A 3VDBA 3VA8A 3CMJA 1E5NA 1SR9A 1Z69A 4GKLA 2E3ZA 3HM7A 3UJRA 2WPBA 1V3KA 5C9XA 3W22A 1J6OA 4GPNA 4IM4A 3RJYA 1Z3NA 4S3FA 2H90A 3TYCA 1KXQA 3UESA 2QAPA 3CL8A 3VOCA 3ICJA 4WXYA 3BXWA 1BQGA 2W27A 1XIJA 3W1MA 3NA8A 3IJ7A 3RPTA 3V5CA 1GZ1A 2XWDA 1TPEA 2XUCA 1RA5A 2BOGX 3UXIA 4TQTA 3EB2A 2DW6A 3DFSA 4BQ3A 1J11A 1T40A 1B4EA 1R3QA 1H51A 1KFCA 4IQJA 3DCPA 1AH3A 2XVLA 1EO7A 2I5IA 3MUIA 1LOSA 2J8GA 4X9YA 3VD9A 1QU4A 3WLTA 1E6ZA 5EBAA 1FH7A 1G9HA 3EXRA 2UWFA 3CO4A 2VX4A 3ITYA 3ZLFA 4GI8A 1D7KA 3CL7A 2O9TA 4U3AA 1BLIA 4J3SA 1CXKA 1TREA 4KT2A 4MFDA 4LNCA 1B3YA 3T2PA 4PBFA 3IEBA 3H55A 2OELA 4QQUA 2NV1A 1HJQA 2VURA 1P1XA 2HK1A 1OVDA 1TWZA 3UJ2A 3DHUA 3VD3A 1X98A 3N1AA 1XYFA 5CZTA 4UC5A 1L6SA 3VGHA 1DJXA 4FIRA 5ECVA 4LVGA 1QI3A 3W81A 4GHRA 1Q63A 5DQPA 5HAOA 3SZ8A 4MOZA 2DEPA 1KCXA 1U33A 2BASA 3O0KA 3TKFA 5A6SA 3W7LA 3K1DA 1XH2A 3LZ5A 3SSZA 3IUIA 2PDCA 3RDKA 2BOEX 3BJFA 1SM9A 3LGEA 4XKMA 1VFUA 4GVHA 3RLUA 1JD9A 5EGRA 2W67A 4A8RA 4NXKA 3WDJA 3WELA 3LHYA 4BI7A 4PSRA 2DZTA 4MDPA 5DANA 4LY4A 2PCQA 1HGYA 1MNSA 2QT3A 4PBEA 3C56A 3ANVA 4AH7A 1TVPA 1UB3A 4WJXA 5ABEA 2Y89A 2GGHA 3DC0A 4Z2GA 4YPJA 2DVUA 2W61A 4YLWA 2FKPA 5A2CA 5G1YA 3HPSA 1ICSA 3QQWA 1TA3A 2QYGA 5LIKX 4E38A 4MHBA 1KFEA 5HA7A 4S2CA 4R3UA 4MYAA 1EKOA 3CAKA 2V2CA 4IUOA 2G3IA 4C6BA 1JPHA 1PS9A 3K13A 2HCVA 2WSYA 3HU7A 2RGMA 3ZVHB 5F2IA 4GNVA 3WLPA 3RN6A 3HTWA 2DJLA 3R11A 5HJYA 2ZQ0A 1KR0A 4N9DA 3C61A 1OFRA 1OBAA 1TWDA 1E0WA 5C6MA 4HN4A 3TCEA 3P74A 4K6AA 2OZ8A 3GKAA 1DKWA 4ADSA 4ZB0A 3TR2A 2FGBA 1NARA 4B9ZA 3APTA 1HKKA 5CSYA 4CQBA 4P61A 4CNNA 2B7OA 3EWCA 3KWSA 3EWYA 4O54A 4EWJA 3UWWA 3B8SA 5IBXA 5FEWA 3AHZA 4W93A 5FL0A 3SCNA 3N9RA 1XLIA 3UW6A 5H8PA 3M44A 3KRSA 2NV9A 4TOQA 3SJ3A 5D04C 5CPOA 3SCSA 1Y5WA 3W29A 4IMEA 3VE9A 1JYNA 3AMLA 2Y4SA 3TZFA 1TE1A 2GVYA 1N8WA 1W0MA 2G95A 2ZE3A 1C92A 3DYOA 1BGGA 2RJGA 3PZGA 3MI6A 4ERAA 4NNCA 2OGJA 3WYZA 3CUFA 2A3CA 2QGHA 7A3HA 4G9PA 3IJIA 3BGJA 4TVCA 2IQTA 2VCCA 4NSBA 2O7QA 4K38A 5H6HA 1S3TC 3P6LA 1RBAA 2QJJA 3U2CA 1HW6A 4LCQA 3G1DA 2WBKA 5IHRA 2YKKA 5LA2A 4KCWA 3FDKA 1CXEA 3PS7A 4MNKA 3FKKA 3GU9A 1BTMA 4IX0A 4A3UA 2Q3OA 1IGSA 2FGLA 2VO5A 2YPIA 1BG9A 4LAOA 2WOQA 1A5UA 3OHMB 4UTUA 1IXOA 4H8HA 3TQKA 3EEZA 2DT3A 3O0FA 2C71A 3IARA 2WB5A 3W7RA 2PTXA 2ZE0A 2GSJA 3WNNA 3EMZA 1EA9C 3ZJ7A 1HKVA 1US3A 2GPTA 1KFJA 3E0WA 4C1NA 1H5VA 4X63A 1WX0A 2E40A 3M0MA 1GJWA 2VC6A 2J7CA 1R9XA 4YXGA 4D1JA 4UFKA 3B0PA 2I14A 2I5QA 2HV5A 3SIZA 1NOFA 3CL6A 1C9DA 1F6YA 1PDZA 1TV3A 2GFTA 3TA6A 2X42A 2VTFA 4NNAA 1WKFA 1W56A 3FV9A 3EOUA 4QHRA 3XINA 1H0IA 3ORWA 1TZ9A 3DI0A 1ZBKA 1CI1A 3AMCA 4O0KA 4P7QA 2H9AA 4KCUA 2CU0A 2DZVA 4QJ1A 3FNDA 1HTIA 2WZHA 4HJWA 5CCZA 2FZNA 3LXBA 2TRSA 1JAKA 2RDXA 3OLIA 3EBVA 3M64A 1ODUA 3CU2A 3CYVA 2HVOA 3M46A 1HL8A 2E6FA 4GGBA 1Y65A 1ICPA 4FLSA 1THFD 1YRRA 3QFEA 3VC5A 1A5KC 3I3DA 1S46A 4QAWA 4TV5A 3WNOA 2ZX5A 2ISFA 2G3NA 3O7UA 3THQA 1S5MA 1VFTA 3WLSA 1R85A 3M0LA 2BMBA 1S2WA 4XSLA 4DYJA 3FYOA 5JBFA 1ADOA 2J7BA 3KP1A 4CNUA 1VCFA 5BNKA 1E4NA 2PWDA 3BTNA 2WWCA 2X7VA 4UFJA 2WMHA 4D9PA 5EMJA 2OX1A 1BG4A 1XHGA 3S6TA 3KRZA 5CGQA 3L12A 1QO2A 4BK9A 3A12A 3F2CA 1PZ3A 4M6PA 2CHRA 3TYAA 3PZTA 4W7WA 1IV8A 4FX7A 2CEQA 2QPXA 4NYYA 3QSRA 3CUHA 2RUSA 1CXFA 5KZMA 1GONA 1VD6A 1XLDA 3BMXA 1JI2A 3S9YA 4H9UA 5DRIA 4ERIA 5B7ZA 1R7AA 4MAZA 3SURA 1EC7A 2PWGA 1JPMA 1XDLA 3CMFA 1LTDA 3N2XA 4IX2A 5CPQA 4GG9A 2PDKA 1UP0A 2FHCA 2Z4GA 4J5NA 2A4AA 3VMNA 3PBWA 2J7FA 4IMFA 4PCPA 1OINA 3GH7A 1KWKA 4H9MA 1MZHA 1DORA 4AEFA 3L2LA 2FB2A 1QW7A 5FCZA 4HK5A 2Y61A 1OFDA 4YU1A 4IZGA 4NAFA 3GH5A 4GQQA 5FIPA 3VCCA 1WZMA 1EJTC 3VKDA 2P5NA 4K39A 3RLVA 2V5BA 3A5FA 4H7ZA 1YTDA 2OOGA 5E0CA 2INZA 3F4DA 4TUFA 3W84A 1JF5A 3WFLA 3KS5A 4PUNA 1XSJA 3DFQA 3CZ8A 4TX9A 2V0TA 2DZXA 3LXCA 3II1A 2DFAA 2AMGA 3UEQA 1YEYA 1DE5A 3H4WA 3RFAA 3V18A 1VJSA 2WPGA 4L64A 4XB3A 3VOFA 1GPFA 4MJ2A 3SDOA 1Q3NA 2G41A 5I3HA 4AX7A 3WQFA 4XV0A 3N18A 3UBPC 1K8ZA 3NL2A 3NPVA 4KFPA 1L6FA 3W7CA 2BB0A 3B8DA 5HQEA 1I2RA 4WXZA 3IRDA 5DBTA 2YW4A 4ML4A 4JN8A 2DY3A 3F5LA 1AH0A 1ELSA 3CPGA 5D05A 3KL3A 4EAMA 4B9YA 5D32A 4HKPA 1R3TA 3B4YA 4DJEA 2Y7DA 5K3VA 1OX6A 3THAA 2PDFA 2QF7A 3LV6A 1W54A 4XAGA 1YLVA 3R25A 1DYSA 1QPOA 1XDMA 1QATA 3CZEA 1VBUA 4LAMA 6PTDA 4PUDA 4RDVA 3PTDA 1S2TA 3V0TA 4NASA 4N42A 1JJKA 2DU2A 4PR4A 5CLTA 4ZO7A 3RX3A 1NDWA 5D8ZA 3WJYA 1SZGA 4W86A 1XLEA 1I75A 4C65A 2XH2A 3ES7A 4TV6A 3VDCA 1WDSA 2Y85A 4W5ZA 4K7VA 1DP0A 2UZ9A 4US6A 4XKYA 2XYLA 2J75A 3G77A 1MO0A 2BBFA 4C5ZA 3ATYA 2DIEA 4CU6A 1ZTVA 4LUJA 2KX9A 3WFZA 4DY1A 1AMYA 4GCXA 1DOSA 4ZSTA 2VCBA 3GNRA 5D02A 3GX9A 5A8PA 1BF2A 4QCEA 4MPQA 3BCJA 3CC1A 3MUXA 1M53A 2DZSA 1VCVA 3H54A 2FFIA 4KPLA 1MRQA 4MWAB 4WVXA 3B9EA 2BS9A 1F2JA 5CXPA 4NY2A 1VRDA 3W71A 3UR8A 3QTGA 3WH6A 4UTKA 1OX4A 1FWSA 3K46A 3PUGA 3STGA 5A6BD 2PMQA 3MJMA 1XKJA 3DKJA 4MFEA 1B4KA 1XCXA 1Q65A 3HV9A 4CVWA 3D3FA 4GJJA 3ARWA 1KGUA 2ZZ2A 4QE1A 1EC9A 2F7FA 3BW4A 5DO8A 2RHGA 5KEZA 4DAIA 5A95A 3N4EA 2Y2WA 2OSYA 3GTNA 4RK8A 1GQJA 3KBSA 4D6CA 3NFUA 1IE7C 3AUJA 2EPMX 3UVIA 1V3JA 2OEJA 4JX4A 1E6PA 4P5UA 4UQEA 4U4MA 1KRBC 4NF7A 5M17A 4H9VA 3ZR4A 4JTRA 1JDAA 5I5RA 3PR2A 1GORA 1AW2A 1V3MA 4ZQNA 3AMGA 3AQUA 4HQVA 3VKBA 4AD4A 1P6BA 1QAPA 2VX6A 5DF0A 4C90A 1OK6A 4DNMA 3DHFA 1K9FA 1E1CB 4DXXA 3DYMA 2HXUA 5C9UA 5I3KA 4U2YA 4O1DA 1EGVA 5C5YA 4ZZ9A 1WYIA 4OWGA 3A4AA 5E6ZA 3KZPA 3UZWA 3TZNA 3OYZA 4YMZA 1UJPA 3ZQ9A 1MXDA 3SIMA 3M0XA 3QMSA 5DEZA 4E2DA 3W7HA 1XCWA 3OQEA 2FJUB 3TP4A 4KFNA 1Y7VA 3TXVA 1E9IA 3LS9A 5TF0A 1DJQA 3WLOA 1TO3A 4JCLA 3R8RA 3L4XA 3WUEA 4JTHA 5LIUX 3B9DA 1ZP3A 1OEPA 2PDMA 3KEHA 4ZXOA 2CLPA 1EDGA 3SGUA 4IG2B 1O12A 1S5VA 3T9PA 4EVZA 4P7OA 4ZOAA 3WD3A 3AO0A 1RA0A 3TJLA 4UQAA 5F1UA 3N2CA 2GK1B 3WNPA 1EEXA 2YX0A 1K03A 4Q8QA 1PBGA 4FK9A 1POJA 3RCMA 1DJWA 3F2BA 1GVOA 1PL9A 5LZLA 1YIXA 3LA4A 1HP5A 1DV7A 4W84A 4LV9A 3WSUA 4M6UA 3QV6A 3UFYA 3E1F1 4GISA 4KEVA 1CXLA 4XSMA 3MU7A 3IAQA 2ZADA 1H5YA 4TVUA 1YXDA 3QW3A 3WBEA 3WQ4A 4EAYA 2PDLA 5JMUA 4Q4KA 1C8QA 4QRNA 3ZJ8A 3V5OA 1ISYA 1SZNA 3A6OA 1OFAA 2TAAA 3WH5A 4D6FA 1E4LA 2C14A 4YYFA 4JIIX 4YTUA 5IM51 2DVTA 4IPNB 4WY0B 2YCEA 2JQXA 3K4WA 3FDGA 5EMMA 2E9LA 4RLIA 2VGFA 1F7BA 3VIHA 1PXGA 1AUSL 2WBGA 3QQ0A 3U57A 1FDZA 1XW8A 4REQA 3WLHA 4P8VA 3W00A 4AHQA 2YDRA 3QQ1A 1P6WA 2NXGA 1XV8A 3VTRA 1A80A 5E70A 1ZJHA 4Z1BA 1UD6A 1W1YA 2VHLA 2OO6A 1CTNA 4WUIA 1KFKA 2IXVA 3VI2A 3WUBA 1HO1A 3VOGA 4B15A 1R87A 2YYTA 3VM5A 4XISA 1LQ0A 1CIUA 4EOUA 3N2OA 1S1PA 1O5QA 2FH8A 3MZ2A 2Y5SA 1XLMA 4GA8A 1JFXA 1X1ZA 3ZVIA 1A50A 2GDQA 1N2VA 2XFRA 1RV8A 2PDBA 3MY9A 3T05A 1J96A 4AVNA 2JIWA 1ZJIA 2CWXA 4GQGA 4CQ8A 5HJXA 1RLDA 2NUWA 3ZWTA 2J62A 2NQ5A 3IIVA 1BEUA 3NQBA 4WY0F 3LDVA 2W92A 2UY2A 3WQDA 5A6BA 4IP5A 1ONWA 3ARXA 3WNLA 1UZDA 3I7RA 7CGTA 1CGVA 9XIMA 1WE5A 3PBGA 6TAAA 2YXGA 5HWJA 1EHAA 2F2KA 1GZGA 4MJMA 1C8VA 3W0KA 4IOTA 3R10A 3VC6A 3T6CA 1W1TA 4DI9A 4GBUA 3EOSA 4CQAA 1OT2A 1H7XA 2BOFX 1ME7A 1OADA 4NJHA 1E43A 4DBSA 4D6EA 3HQ1A 2P0IA 1RQHA 1GQLA 3DN5A 3SN1A 3L2MA 3THUA 3MMUA 1HO4A 5I00A 3G24A 3MUY1 3MC5A 4W9TA 3TAOA 1V0KA 2XDFA 3PTKA 5F4SA 4LVFA 2VRJA 3MB9A 4LBSA 2Z29A 3QZ6A 1MUWA 4F0SA 1FCVA 4WKAA 1IEXA 4O10A 1IGWA 4XO7A 3NQFA 1G5AA 3T4WA 3XIMA 3ABSA 4LUSB 2Y62A 2VQUA 3DDMA 2GJXB 2VX7A 4CNPA 2C1GA 4B16A 1UBSA 5BW6A 2FFCA 4HVXA 4LEQA 2NUYA 1UMLA 4UFIA 1Q6EA 3B0UX 1T8QA 4UTMA 1EJSC 4UBPC 1FWRA 1WKYA 3H2MA 3SCRA 1TG7A 3H2OA 1Q66A 4V1XA 3O3RA 4K68A 2EQDA 1PPIA 4QISA 1MUMA 1R6WA 1VH7A 3W2NA 4UXDA 1K9TA 1T6MA 5C9WA 3SY1A 1FWNA 3N14A 4H2CA 5F1VA 4CNSA 2EG8A 3P5YA 3H2NA 4R9XA 1S38A 4LT9A 1S5WA 4IIFA 4G1NA 1PCWA 1XCFA 3TN3A 4H3DA 5JH2A 3CZKA 1C7TA 2C1HA 3GNNA 2V6AA 4ATLA 4K1WA 3E5PA 3MUZ1 2R1KA 5G1MA 3HZ3A 2EG6A 4LS2A 4JEJA 4G7EA 4B92A 5H8MA 4HA1A 1H09A 3BICA 1WDWA 1DJIA 3M0IA 1VFMA 4ZL1A 3ARPA 2G97A 5MHBA 3TC6A 1E0XA 4I6KA 4BCEA 5XIAA 1TZZA 3IJLA 2HZGA 1HFBA 1LCOA 4DF1A 3N34A 1QI2A 4IUGA 2QMJA 4P7RA 3A3WA 3N19B 2NXIA 4GNJA 2QIIA 3LY0A 2YBUA 2REQA 3HMCA 1FXPA 3L5AA 3OBEA 2QCDB 4DLFA 4QP0A 3QHNA 3W4RA 2FPVA 2WO5A 2E7FA 1BYDA 2WM0A 4HA3A 3KRBA 3T7VA 4LRSA 2VWSA 1S3HA 4MKNA 1IZCA 2QXWA 3B9NA 4X60A 1AVAA 2GUYA 3Q65A 4JIHA 2F38A 5D03A 4LC8A 2MNRA 1H11A 3SBFA 4WQ6A 1AFSA 3TA9A 2GWNA 4AF0B 3LNPA 2J6XA 3G8RA 3EKZA 4LVAA 5M5DA 3BSMA 1UR2A 3W72A 1FX6A 3DH7A 1EUNA 5PTDA 3EYPA 3M0YA 4N0RA 3WD1A 3WN6A 2WHJA 2VXNA 5LA1A 2GVGA 4OOUA 2PC8A 4L80A 3C52A 4W87A 4HCHA 1XYMA 2V81A 5IDZA 4JDBA 1J4EA 4EXAA 2HXTA 2W3ZA 4Y90A 2CYGA 2YXXA 1CENA 1LJYA 2VENA 4LW7A 2V3GA 4Z08A 3IS4A 4XAZA 3BL3A 3VK5A 4MG4A 3FVMA 1E9ZB 5H2ZA 3TQPA 1VKFA 3VU2A 1ZHAA 2VVNA 2W6RA 3NZPA 3H26A 3LPFA 4M19A 2QV4A 3HG5A 3SR7A 2G5WA 3RR4A 3OOQA 2BX7A 2XG9A 3UXAA 2W91A 2BGQA 3EB4A 7REQB 3P67A 3GE7A 1MW2A 2J24A 5F2GA 2CLLA 4NG3A 3WLIA 4PH6A 3E0LA 2BG5A 3PN8A 4BQ5A 3H7UA 3G2GA 4JIEA 1XR2A 3EA2A 4AIEA 5FA5A 1KGXA 3SW6A 3T0TA 3AYVA 3GY1A 1F3WA 1W5NA 2X2YA 3W70A 4GH1A 2J78A 3RM8A 3W1RA 5FF2A 3WQCA 5D38A 1W2PA 1V8EA 5DRCA 3CB8A 5LIWX 1SFJA 4QITA 3B8UA 3S1XA 3NZRA 3AS3A 1S1RA 3VNIA 3IWPA 4L9YA 3CAVA 1OGBA 4HD5A 4FXSA 4WSHA 3LV5A 1A3HA 5BXSA 4FLQA 3LSBA 1RBOB 1TIWA 4GIAA 4DWSD 2DV0A 3PP7A 1AMKA 1VJIA 2FZBA 1JYVA 2A0NA 2QV5A 3K4AA 3GAYA 4LB4A 3TMLA 1KC7A 2ZA1A 2IPFA 3UR5A 2VYOA 4CUCA 1LBMA 3UZYA 1WZLA 3HGRA 4CD6A 4R7WA 2VP8A 2VVSA 3NQCA 4LX4A 2VOTA 4H7CA 5TBOA 2OGYA 2E6AA 3AJ7A 3CB3A 3S1UA 1LOQA 1UW9A 3B05A 2JFEX 3GW3A 4GO8A 3FW6A 2DT2A 2HISA 4NI8A 2WMIB 1QO5A 3B06A 3FA3A 3E2SA 3EXSA 4A3RA 3EA3A 2XIQA 3ERPA 1WOBA 2V2HA 5KETA 1UH4A 3ABXA 3W7MA 3B9OA 4Q32A 5I7GA 4LRTA 2QUUA 4A29A 1W31A 4PTWA 2FQIA 3IVSA 2FHFA 2PGFA 3S6OA 3BO9A 4L1XA 1SSDA 4KWOA 4JTFA 1E70M 1PZ2A 2ZX7A 3CV1A 3MZNA 3G18A 5M2FX 1A5OC 3BLDA 3FAWA 3PUOA 3RXZA 1GJUA 3GIPA 5J04A 2QJHA 3KDNA 4MSSA 1Q7MA 3B04A 5B7YA 1JEZA 3IV3A 1UD4A 2XH4A 4W89A 4QX4A 4NAEB 1NFGA 1JPKA 1XINA 2ZYFA 4HNLA 2ATMA 2NVDA 2PI6A 1X7FA 1UD2A 3TONA 5KZDA 3FJLA 2A2IA 3CV7A 2VFIA 3FYPA 3GZ3A 3IANA 3UGVA 2TYSA 3LK6A 3LLXA 1JCTA 2NX9A 1UQYA 3GIQA 4S3DA 2I57A 1LYXA 1OJXA 3GYEA 3S5SA 4LY8A 3KM8A 3E6EA 2CLFA 1OY0A 2DSKA 4RZ4A 3G6MA 4O8AA 5BOFA 4ZFCA 2ACSA 3PWGA 1FH8A 6REQB 4MDOA 4JTSA 3W7PA 4P7NA 1M9HA 2GZXA 3J7HA 1JCXA 4QG6A 1W17A 3ABQA 3QPEA 4ICCX 5AYZA 1OFPA 3LTYA 4FI4A 5D9NA 1WZKA