3M4OJ

Rna polymerase ii elongation complex b
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3m4oJ00
1FTTA 1DU6A 1RESA 1GT0C 2M9HA 2R5YA 3FKIJ 4B4CA 2LVSA 2HOTA 5M5YJ 3S2HJ 2ID3A 2TRTA 2DA1A 2EZHA 1U9NA 5EF6A 5J3LA 1K83J 4X6AJ 2X6OA 1BJZA 4Y52J 5E3OA 4XRSA 3ZQFA 3LSGA 1U78A 1NK3P 5IYCJ 4A3IJ 3JRIA 2XRLA 1ENHA 1IJWC 1XC5A 3SDGA 2HXOA 5DTDA 3JRCA 1MSFC 3B6CA 1TWCJ 3HBLA 3Q3SA 1ZQ3P 3TP3A 4I6ZA 2FJ1A 5C4JJ 4BXXJ 1MBEA 1TWFJ 3WHBA 5C4XJ 1AU7A 3BR1A 1Z0XA 5IP7J 2R5ZA 4FTHA 3S2DJ 5K7ZA 2CRGA 3S1QJ 3JREA 4AYBN 1IRZA 2JMWA 1BW6A 2ELKA 2XB5A 3MVPA 3HOYJ 1JT6A 3K2AA 3TW7A 3A03A 5IOZA 1T56A 3GTPJ 4IHWA 2CJJA 3FK6A 2DMNA 5F08A 3CQZJ 4D7MA 1YRNA 3G1OA 1H8AC 2L7MP 2JJ7A 3I4NJ 1IDYA 4M3DA 2D5VA 3HOWJ 1FEXA 5EGOB 1X2MA 1LFBA 4A3EJ 2DJNA 1JJ8C 4BY7J 4B1RA 3JRAA 2IEKA 3FISA 2EH3A 4AUXA 4A3FJ 1ZGWA 2GBYA 3QQAA 2H8RA 2VUMJ 2X48A 3LSJA 4MFEA 3HOXJ 5M5XJ 5FKNA 3BR0A 4JX4A 2LKXA 1HF0A 2WAQN 2R93J 1XS9A 4XRSG 4XK4A 2GLOA 1MBHA 2ME6A 3GTKJ 3S14J 2LLKA 2CUFA 1ETXA 3B6AA 1WCMJ 3PM1A 1MH4A 1IV6A 5HODA 1R9TJ 1WI3A 3S17J 3ZQGA 4A3KJ 2K9NA 2HOAA 3BT9A 2EQRA 3BR6A 4FE4A 1JUMA 1MBGA 5K7FA 4GFBA 2B63J 5M3FJ 2DA7A 4UUSB 3ZQCA 1E3OC 5F0HA 4RDUA 2HDDA 1Y1VJ 2DA5A 4EEFG 1D5YA 1A5JA 3BQZA 1ZTRA 1DU0A 2Y0SN 2JN6A 3OSGA 1JTYA 3BQYA 5IPAA 1AHDP 1K61A 1TWAJ 1FIPA 3IH3A 4L5EA 3BG9A 2VI6A 2JA8J 2NVQJ 5EG0B 5J1UA 1UG2A 5GPAA 3IH4A 4DW6A 4MO7A 3GTLJ 1B72A 1BL0A 2R0QC 3S15J 3G1MA 2PMZN 1FTZA 3O8GA 4G12A 3K7AJ 1OCTC 2CUEA 4FISA 1F36A 2DMUA 3JR9A 5IYDJ 2NVTJ 4JYKA 5IP6A 1O4XA 2MSYA 3IH2A 4JP0A 1MBKA 4QIWN 4FCYA 3BTIA 5JLWA 2CQQA 5EZHA 3LOCA 1LFUP 3W6VA 1AKHA 2DMTA 2AO9A 3G1LA 4DYCA 1GV5A 2HYJA 1I6HJ 4I76A 1B8IB 1JKRC 2IBDA 3MKLA 1IG7A 4HNVA 2LP0A 2VPRA 4M3FA 2X9DA 3BG3A 3GTJJ 1JGGA 2KT0A 1NK2P 4C3HJ 3HEFA 2WV1A 5FKMA 2NVYJ 1WH7A 1JKPC 3E7LA 1VNDA 2NS7A 4A3JJ 3BR3A 4IHXA 1IC8A 2W48A 1MNMC 2JA5J 1H88C 2MW8A 3I4MJ 4XIDA 2HQ5A 1ETYA 4M3EA 4A3CJ 5IYBJ 4IEJA 4BKXA 4BY1J 4CYCB 4MFDA 1JKQC 2R5YB 3WHCA 1UMQA 1Q1VA 3O8HA 3OOUA 1HDDC 3S16J 1Y1WJ 4UUSA 3JRFA 4D7NA 2HXIA 5C44J 4QSHA 2L9RA 1UHSA 2R7ZJ 2E2HJ 1U8BA 1VFCA 2ECCA 2XPUA 2Y2ZA 1P7IA 3S1NJ 2XGCA 1RPWA 3JRGA 1POGA 1W0UA 5F1JA 3FIWA 2EZIA 5EG0A 2L0KA 4W1UA 4A3MJ 4IHYA 2JA6J 1SFOJ 2R5ZB 3LSRA 1QRYA 5F27A 4BBSJ 1H89C 1JT0A 1TC3C 1IUFA 2XSDC 5EDNA 1OFCX 2JWTA 5J1YA 2Y31A 3MN2A 1W0TA 1HDPA 2YUSA 1MBJA 2LD5A 1F43A 2ZB9A 3RQIA 2O7OA 1TWGJ 2E1OA 4X1EA 1RKWA 5FKLA 3NARA 1GVDA 3RZDJ 1CQTA 2FX0A 4C3JJ 5E3NA 2EZKA 2KDZA 4M6VA 2XGDA 1RR7A 4V2GA 3PO2J 2LTPA 1WH5A 5EEAA 1RKTA 3M3YJ 4XRMA 3TEDA 4A69C 2E2JJ 4A3BJ 3HGYA 3FK7A 2LR8A 3S1RJ 4A3GJ 3BR5A 4ABZA 4AC0A 2ECBA 3NAUA 4B3AA 3BR2A 3CDLA 1GUUA 3C2BA 3Q0UA 3TP0A 2JK3A 1LE8B 2XPWA 2Y9YA 1HCRA 1T33A 2CQXA 4RBOA 3A01B 1FIAA 2K9QA 5F0CA 1GV2A 1EF4A 2DA4A 2L7ZA 3DEWA 2TCTA 1JTXA 1APLC 2WB1N 1GDTA 4CYCA 1OJLA 2Y9ZA 1RETA 2MG4A 4D5FA 1NTCA 4NDLA 5F04A 2RAEA 3M4OJ 2OF7A 3GBGA 4JX5A 3D1NI 5EGOA 4W97A 3HOUJ 2XGEA 2LFBA 2XPVA 5M5WJ 3CCYA 2E19A 1HLVA 3RZOJ 2COBA 3PO3J 2YS9A 3TW6A 4M3BA 3S1MJ 2E2IJ 3JRBA 2XB0X 3H0GJ 3Q0WA 3Q0VA 3ZQHA 1PUFB 5GPCA 1WPKA 5IP9J 5F0FA 2VKEA 1ETVA 2I10A 3BTLA 2M2EA 5M3MJ 1TWHJ 2HOSA 2LK2A 2FD5A 3HDDA 1ETWA 2R92J 3GTGJ 1MBFA 3HKZN 5FKKA 3RKQA 3HB9A 4A3DJ 3HOZJ 4C2MJ 1JJ6C 2L7FP 3GTMJ 1HOMA 5E3LA 3VPRA 1QVTA 2M34A 5EYRA 1QVUA 4D5CA 1B72B 2VKVA 2DA2A 3HM5A 1JUSA 4C3IJ 1U9OA 1BW5A 2DMQA 2H1KA 4M3GA 4MLOA 1A6IA 3QPLA 1IDZA 5GP9A 3H3VK 3BTJA 2HI3A 2O9LA 3HGGA 2AHQA 2G0EA 2M8GX 2EZLA 3JRHA 2GM4A 3GTOJ 1ETQA 1FJLA 2MGQA 1SANA 2O8KA 4S0HB 5IOYA 4J19A 1ORKA 2IAIA 4Y7NJ 3OIOA 1WGXA 1AKHB 4DZJA 1VF9A 2N8GA 1X2NA 2EBIA 2QCOA 3ZOBA 4BBRJ 3UKGA 3BTCA 4DZPA 2LY9A 1MSEC 2NS8A 5FLMJ 2K9SA 3F0CA 5BNGA 2NVXJ 5EZGA 1XG1A 2P81A 3HOVJ 1S7EA 3L1PA 1LE8A 1IGNA 4A3LJ 3A01A 5E3MA 2DTZA 5JLXA 4MIMA 4IHVA 2M0CA 3BG5A 1ETOA 2DA6A 2JA7J 5DS9A 3QPSA 1VI0A 2DN0A 1OCPA 3A02A 3OSFA 1ZK8A 1Z77A 4LOCA 1YRNB 5C3EJ 1X58A 1ZR2A 3DCFA 5J1RA 1I50J 2FQ4A 4QTRA 2YU9J 3ZQIA 4UUTA 1B8IA 4DYQA 4DYRA 1ZKGA 1P7JA 2OPTA 4JX6A 1ZR4A 1JKOC 1I3QJ 2NOGA 3JRDA 2QF7A 3CMYA 2ME0A 1PUFA 4A93J 3SFIA 1MH3A 1JUPA 2K40A 9ANTA 1ETKA 1QPIA 2Y30A 2DMPA 4V2FA 2ID6A 5FJ8J 3LNQA 4XICA 1ITYA 3GTQJ 3SJMA 5FKOA 3LSPA 1BA5A 4FE7A 1G2HA 2DA3A 5FLVA 5K7HA 2CU7A 3ZQLA 3IV5A
chains in the Genus database with same CATH superfamily
1FTTA 1B4AA 2M9HA 4XKBA 1MZBA 3CCMI 3FXOA 2JT1A 2HOTA 3NRVA 2ID3A 2JVGA 1OMIA 2DA1A 4BXFA 5LHIA 5J3LA 3ELKA 2BY0A 2B0LA 3KYCB 1OYIA 2X6OA 5E79C 2UXXA 4U7BA 1I39A 2BV6A 4ENMA 1TT5B 3ZRGA 4XRSA 1FYMA 3P7NA 4H0EA 4C30A 5IYCJ 4AIDA 1J7KA 4AM3A 3FZVA 5DTDA 4WK8F 1SAXA 3Q3SA 1OISA 2ESHA 1ZQ3P 3TP3A 2FJ1A 1UG0A 1UJ8A 3B02A 4HBLA 5KAIC 5E1XA 3FM3A 3UR3C 4FTHA 4UV8A 4IOAF 5J4YA 2XF7A 1NG7A 3ZR8X 2VJ5A 1XGMA 5BQTA 1WJ5A 3K1MA 1SD4A 4LG0B 4CCKA 2JMWA 2IGMA 1Y39A 2XB5A 3HOYJ 1AWCA 1KYWA 2FSWA 3RKYA 4CCNA 5HOOA 3TGNA 3A03A 2HS5A 4CYDA 5IOZA 3PSIA 4M6XA 2WBMA 2EA4A 5L3EA 1ZGJA 3ZN1A 1YRNA 3CQZJ 2IGKA 2JZYA 4A2UA 2WADA 4E4HA 2HFHA 4AIJA 2L7MP 2R7XA 1R5ID 1D8JA 1ON1A 3OR2C 3CUQC 3EUHC 1HW1A 4RB3C 1MMDA 1IDYA 1WJCA 2BOLA 3VWBA 3J7AY 1HKTA 4HRIA 4OIQF 2KIQA 3TOAA 4B1RA 3WTSC 2K4JA 4XLPF 1O3RA 2OQGA 3P5JA 2EH3A 4AUXA 3LSIA 5L3DA 3OMYA 2ZJ2A 4ZDLA 1QBJA 2VUMJ 3HOXJ 3DPUA 4OAYA 3Q9SA 4MQVA 4PK4A 2LKXA 2CW7A 2WAQN 2EINH 2R93J 3CJRB 1XS9A 2ZXJA 4YFNF 3HRUA 2QSFX 3KP6A 4AIHA 1VQ9I 4AVZA 1X4OA 2CUFA 4MGRA 3K1NA 1ETXA 4BEHB 2OBPA 1VQPI 1WCMJ 5BPIA 1ERDA 3GVAA 1IV6A 1JXSA 2WB1A 3RPUA 1R9TJ 2P5LC 2OQRA 1QA6A 1WI9A 2KZVA 4A5NA 4D9JA 3BY6A 1D0ZA 3LA2A 3F9KA 3AFHA 3FMQA 5JHUA 1XCBA 2KMUA 4FE4A 3QPTA 3S32A 1ZLKA 4GFBA 3CP8A 2I5UA 2DA7A 3K4JA 4I99C 1E3OC 4NQWB 2DA5A 4M6YA 1VQ4I 4EEFG 2LMDA 4I02A 3DWLE 2P0WA 1T38A 2OCEA 3DPLC 1TT0A 3L2VA 3SXYA 2V4JC 4BH9A 2XF6A 3H36A 4IRGA 3IH3A 1FIPA 4L5EA 2NVQJ 2QQAA 3BG9A 4UNOA 4GYGA 1UFMA 2HGCA 2XASA 4BQAA 3GFJA 2K85A 2W85A 1OKRA 3ABLH 3V4GA 3KP2A 1FYLA 4O5VA 2P6TA 2KRHA 1B72A 2R0QC 5IT9K 2PMZN 2ZXWH 3GCMA 3K7AJ 2QENA 4FISA 3CJNA 1F36A 2GQQA 1EJ9A 1FC3A 2XV4S 1G3SA 3T1BA 5LLQA 4LGWA 4BQNA 1IAWA 4PJ0C 1MBKA 1ZG3A 4QIWN 2ZCWA 5JLWA 2DO7A 2PN6A 3E0JB 1T39A 3W6VA 5DD8A 2DMTA 2M0MA 3F6OA 2EWNA 3VYSB 4HV6A 3OYDA 2AO9A 2L4MA 1YO5C 1GV5A 5AIQA 3L7WA 2W00A 3MKLA 2EB7A 1W36C 1IG7A 2E34A 2V1DA 2X9DA 1FX7A 2PQ8A 2V9KA 1NK2P 1RZ4A 2F4MB 5FKMA 3GEZA 2ZJPF 2A6EF 3E7LA 3EDPA 3OYBA 1VNDA 4N0BA 1IUYA 1RUNA 3VSLA 1IC8A 2H1LA 4EQQA 5E18F 5D4SA 1H88C 4C9YA 2JA5J 2IP2A 1PP8F 3I4MJ 3OOPA 4XIDA 4LD5A 3SZTA 3H9GA 3I55I 2G9WA 2CFXA 3C2GA 3HYIA 4BKXA 3J80Z 5FGMA 3M8EA 2HOEA 1R4MB 3ABMH 1UMQA 2CW0F 3HPHA 6PAXA 4ON0A 3S16J 1WHUA 1W7PA 3W6KB 1LQ1A 2XAFA 1KQ9A 2CW8A 1QU3A 1ZREA 3IWZA 2E2HJ 3GUDA 2X0LA 3IKTA 2P8TA 5JHFA 4UVBA 4KYWA 2XRNA 5E8IA 1R5HA 1G4DA 2X6XA 4L5JA 1KZHA 2F5VA 4BDYA 2Y0SA 1W0UA 1GXPA 3FIWA 1ON2A 1QHGA 4A3MJ 3DTIA 1IXRC 4P55A 1FOKA 4RLFA 2O3FA 1LPQA 2IS4A 2QQ9A 2MD5A 1LVAA 2QGUA 3WGHA 2JA6J 5DDGA 2Q0OA 4UHTA 3LSRA 2R7SA 1ONVA 2K9LA 4KA4A 1TC3C 1IUFA 5EDNA 2MH2A 3M9AA 1QQIA 4DQ2A 2DT6A 4XN3A 1MDMB 1P9QC 2E60A 2DT5A 3ZMUA 2UZKA 1O3TA 2VODA 1QO0D 2W25A 4GXOA 2CV0A 4XLCA 2DI3A 4X1EA 1RKWA 5DM7F 4M74A 1CQTA 1MMSA 1B9NA 2FX0A 3HRTA 1WRJA 5HS8A 1LDJA 5E3NA 2E5ZA 1R22A 2QKMB 4HOBA 4M6VA 4CH7A 1RR7A 4V2GA 2K4BA 3CUQB 1FBUA 5HDKA 5FLXZ 3K70D 2QZ8A 3COAC 4XRMA 2VC0A 4XKCA 3SYTA 5K5OA 4A3BJ 4XMYA 3HGYA 4G7ZF 1P4WA 3RPUD 5ICEA 2XKOA 2M7BA 1UZCA 3C2HA 2V79A 1FMVA 3CCJI 2VE8A 1X3ZB 2EIMH 5AIPA 2LBFB 3ZQ7A 2A68F 4BACA 1OR7A 2W82A 2MYSA 3M8JA 2Y9YA 2XPWA 1IZ1A 3IAM2 2CQXA 1RNLA 1TLHB 3K2ZA 1A31A 3KYLA 3MAJA 2CV1A 2A69F 2JUCA 2L7ZA 1U5TC 1YHQI 1HQCA 3SEQA 3CF2A 1UHMA 2XAQA 1Z67A 1XCVA 2RDPA 4CYCA 1S72I 3J81Z 3WG7H 2MG4A 2VBZA 3GWZA 1NTCA 1Y8QB 1MMNA 4LMYA 3T0YA 2OF7A 4PZJA 2MLKA 1FBQA 2MC3A 2XF5A 5CYVA 3WODF 4JX5A 5EGOA 2KKOA 3JW4A 2HTSA 4W97A 3CCRI 2XGEA 2OTLI 3FKJA 3L2UA 3TO7A 3OIPA 3CLQA 5D8LB 3K0LA 2D2WA 2COBA 1K79A 2L54A 1DQUA 2YS9A 1D1CA 1V54H 4HYEA 3S1MJ 2E2IJ 1G3WA 2GOXB 3QODA 2E7XA 3HL2A 2VQGA 4AVPA 2ETHA 3Q0VA 1HSJA 2Q2EA 4ESJA 1PUFB 4ZC3A 1WPKA 3V42A 4ENKA 1ETVA 1FOYA 2V7FA 3BTLA 4BJTA 2H09A 3OYKA 2K7LA 3NWSA 3PQJA 4KT5C 2A5YB 3N97A 1TQMA 2FMLA 1FZPB 2QBYB 3AAFA 2C6YA 4PGHA 1SD6A 3I9V2 4HDVA 5E3LA 1Z6TA 1QVTA 3VPRA 3ML6A 2HVSA 2BEOA 3KYDB 4ZH4F 4ZYDA 2VKVA 2WV0A 1IRXA 5HDNA 4YIRX 4M3GA 1IDZA 3DQVC 4IXAA 4ZYHA 1SC7A 2EFNA 3H3VK 1BR4A 1F4KA 2O9LA 2AHQA 2MBFA 1XSDA 4XN0A 2EZLA 2IW5A 3HG9A 2GM4A 1FSHA 5L3CA 3D5LA 2DTRA 1SANA 3WE2A 2KDOA 3E97A 3H9JA 1CF7B 3HJEA 4Y7NJ 1WGXA 1AKHB 1WFXA 3KLOA 4HG2A 2X1DA 1QGPA 2FBKA 4PUSA 1D3YA 4RAYA 2EBIA 1UCRA 1MJBA 2QCOA 1TW3A 2EA2A 3KZIC 4JQFA 1F5TA 3PNVA 1MSEC 3WTYC 4KIBA 2PMHA 4CUGA 1BI0A 2M4KA 4CA0A 5EZGA 1S7EA 1RRJA 4IL6C 4M72A 5FD6A 4IOCF 2L02A 5E3MA 1RUOA 1FT9A 5HS7A 3QPHA 2M0CA 4IHVA 2P6SA 2DDAA 3RTRA 4S05A 2NNNA 1E3PA 3LA7A 3MWMA 1DGRM 3CLOA 1ETOA 2DBBA 3CJTB 5E20A 3OYNA 4YIIA 4HLYA 3QPSA 3F22A 2HEOA 1XSVA 2V1XA 1OCPA 5HVQC 4PJMA 3AG4H 2OJED 3OSFA 4LOCA 4OIOF 5C3EJ 2EV0A 1X58A 2GOMA 1LVKA 3DCFA 2BY2A 1ZR2A 1SMTA 2YU9J 2DQRA 1SFEA 4UUTA 2FRHA 3F72A 2NVUB 1Z1DA 4WCGA 1F1ZA 3RYPA 5B66C 3E5QA 3WTTC 1UAAA 3L2CA 3CMYA 4E6KG 2ME0A 4IO9F 2K02A 2CUZA 3LAPA 3DXJF 9ANTA 2CWEA 4O3MA 3ERMA 2DOEA 1BJAA 3DKXA 2OA4A 3CCLI 2EJRA 5FJ8J 2M30A 1UELB 2L7KA 3W3CA 4FE7A 1Z6RA 1V4RA 5LEJA 1FP2A 4HAMA 3ZQCA 4EVIA 3IRQA 3G4SI 5E1ZB 1RESA 3FKIJ 5J47A 4DGWB 2IGNA 4B4CA 2LVSA 5EJCA 3S2HJ 3L9FA 3K4NA 5EF6A 3K9TA 4AIKA 4X6AJ 4HF2A 2DCEA 5DM6F 3TL4X 4JK1X 3LSGA 1HKSA 2W1OA 1X1PA 4I0BA 3OYGA 4A3IJ 4DBQA 3JTGA 1I6XA 1SD5A 1IJWC 1XC5A 4LB6B 4G7HF 5KAFC 2Z1DA 3B6CA 1DDNA 3P9CA 3JSPA 3L2WA 1ZYRF 5B5EC 4I6ZA 5C4JJ 1VQ8I 1MBEA 3WHBA 2V6CA 3CMAI 3KEYA 3BR1A 2R5ZA 3LMMA 4P1WA 5K7ZA 2CRGA 3LA3A 1T8IA 1H9GA 2VQCA 2XROA 4BE2A 2QQBA 1XB4A 3ASNH 4L9TA 3EQLF 1IRZA 4A0XA 3L09A 4II2A 3R4KA 1LDDA 5DCMA 2STWA 2K27A 4XSXF 3OYJA 4EGZA 2F48A 5B1BH 1O7FA 3K2AA 4B47A 1U5TB 3OYEA 3ISPA 3QRFF 3V7CA 3TQNA 1XMXA 4QPOA 4RGRA 4NC6A 4HF0A 3U9GA 1T56A 5KNLA 4HX7A 3G2BA 4IHWA 3GLXA 5F08A 1SAUA 5HNFA 2FMYA 5D8KB 1KU3A 1SEUA 2M1BA 1Z7UA 1PP7U 3BP8A 1O57A 3QYFA 2D5VA 2ISZA 3DU6A 2O8XA 3HOWJ 1X2MA 4GO1A 2RVCA 4OMZA 5F64A 2DOFA 3WTUC 2IEKA 2CUJA 3MD2A 2H8RA 1MD0A 1F9NA 3DTKA 3GF2A 3LSJA 4MFEA 4OIRF 3FXKA 3N4MA 2M5WA 5D5VB 2KQRA 1OCZH 3ESWB 5E17F 3KP5A 2X6WA 4F3QA 1P92A 1MJ9A 1BOBA 4MEYF 2F2EA 2ME6A 2XAUA 3IHUA 1UHWA 1EA3A 4PCQA 3GMEA 3B6AA 3K70C 3O3KA 5CVJA 5L3BA 5BMZA 4ITVA 3H0DA 2JA2A 4EMSA 3CCVI 3S17J 4M9XA 3WU1B 2DODA 1FLIA 4JOMA 3ZQGA 3N05A 4A3KJ 2K9NA 2HOAA 3J80K 1RIOH 5D4RA 3SZGA 5M3FJ 4IPAA 2LOOA 1OCCH 1YIJI 2HDDA 1Y1VJ 4RB1A 4RGSA 2H6BA 5ILUA 1W5TA 1DPUA 4RA2A 1D5YA 3KX2A 2Y48A 1ZTRA 2Y0SN 2JN6A 3OSGA 2ZMEC 4HEA2 3T8RA 4KNYA 1K4SA 1K61A 4O6JA 3VYUB 2MD0A 2CMPA 2JA8J 1ZH5A 3G3ZA 5BS6A 2VI6A 4I98B 5EG0B 1UG2A 5CKTA 1HA8A 4ZTJA 4DW6A 2E7WA 2JQ7A 4BQOA 1VTNC 4LG0A 3GTLJ 1BL0A 1LB2A 3ABUA 2CSOA 3G1MA 4CSWA 3NWTA 1WWXA 3OL3A 3HHHA 2QLZA 1E0EA 2WTEA 1BR1A 3A0BC 1N77A 4XOTA 4XLEA 4F55A 4UY8I 3FHZA 2ESNA 3OYHA 5GAEJ 1JHFA 3GYHX 4FCYA 2PG4A 2CQQA 5EZHA 2HPMA 4KN7X 4Q48A 4EV0A 1R1TA 2P7VB 4BU2A 4DYCA 3QP5A 4DIQA 4I76A 2BXYA 2IBDA 1EV7A 5FLXK 1PDNC 2LP0A 2VPRA 4M3FA 4OAZA 4XLFA 3R61A 3OWTA 3BG3A 3VB2A 3HEFA 5HNHA 2WV1A 2NVYJ 4BXUA 1TQIA 1YJNI 5BOXA 1V55H 4KMFA 4Q4ZF 2HZDA 2IXSA 4EJOA 3HOTA 1G3YA 2VN2A 4BEHA 1VQNI 3K69A 1TNTA 1QZZA 1X19A 2EILH 2KHMA 1NG6A 3CESA 3DFGA 4WXCA 3V8JA 2BVLA 1I3AA 4BY1J 1JKQC 5FO5A 1QPMA 3U2RA 3KZYA 1HDDC 1T2KA 3P9IA 4I09A 5CQGA 3OS0A 2LDUA 3J81K 5J8CA 1IW7F 1Z21A 4UV9A 1K6OA 2HXIA 5C44J 3LQRA 1G3TA 3H5NA 4BQQA 2ECCA 2XPUA 4RGUA 3FBNB 1P7IA 5GTHC 3S1NJ 2XGCA 1YQAA 3KE2A 3RJPA 3JRGA 3BLYA 1POGA 4ZTFA 2ELJA 4OOIA 1FP1D 3L2RA 2L0KA 4W1UA 2L5QA 4IHYA 1P4XA 4L18B 1HXDA 1SD7A 2J5OA 1YX3A 4NUBA 3FXRA 5F27A 4BBSJ 5JVTA 3DLAA 1JT0A 2R7TA 3LAJA 4HF1A 4G7OF 2VIXA 2M45A 1S6LA 2JWTA 2AQEA 2XAGA 1MNEA 3EPZA 3LFUA 2YUSA 2FOKA 1MBJA 1FOXA 1F43A 1U6GA 5LFAA 2KP6A 2W24A 5FKLA 3NARA 1SVMA 4XLAA 4C3JJ 5LEKA 4E7HA 1BI2A 3SZPA 3W6JB 2ZXHA 4B44A 2EV6A 2XAJA 4ZYAA 4U0VA 1WH5A 5GAGJ 2E71A 2VBYA 4D0PA 1XGNA 3OYCA 4LFUA 4HW0A 2F4OB 3KEOA 4RM3A 5F1RA 1G59A 1Y0NA 3FK7A 2LR8A 3S1RJ 1VQMI 3P9KA 1XD7A 4UUVA 2A05A 3NAUA 4B3AA 2MFZA 3BR2A 3CDLA 4RB0A 1WKMA 3C2BA 4X0GA 1PJRA 1YS7A 2IJLA 2JK3A 2DFHA 1T33A 2HQNA 2HTJA 3A01B 3KP4A 3H3UA 3E3VA 4B43A 3K4BA 3I53A 4RAZA 3FDYA 1OR7C 3DEWA 2TCTA 4JBAA 5ICGA 1APLC 1R4NB 1HSTA 3HHGA 1GDTA 1BN5A 1XTAA 3WTXC 2Y9ZA 4I2OA 1RETA 2NRAC 2HVRA 2GIVA 4XORA 2JVHA 2RAEA 5F04A 3GBGA 3F3XA 2OC6A 2HQAA 5M5WJ 4NC7A 3QOEA 4KDPA 2RNJA 4G6DA 4M3BA 1MMGA 2HYFA 4XSZF 2XB0X 3JRBA 4S04A 2KIFA 4Y17A 3VDXA 2MC4A 3K4MA 3Q0WA 3ZQHA 2IA1A 2ZMEB 5GPCA 5IP9J 5F0FA 2ZBKA 4P5OA 2MLGA 1P2FA 4A0ZA 1V5GA 3OY9A 3OYLA 2HVQA 3HDDA 1ETWA 2R92J 3GTGJ 2PJRA 3F8MA 4U0WA 3JAMZ 5FD5A 3HOZJ 4C2MJ 1A36A 2L7FP 1DP3A 2F6CA 3GTMJ 1HOMA 4LLGF 3D0SA 1JE8A 5H2FC 5EYRA 1B72B 2PEXA 1MDMA 2LF8A 2DA2A 4HSRA 3F23A 5TJJA 1BIBA 5EEGA 3WE3A 3PJRA 2DMQA 1IN6A 3R60A 2GXBA 4MLOA 1A6IA 3QPLA 1MNDA 2LNBA 1SMYF 2FBIA 2PFBA 5FRNA 4WF2A 4IHSA 2WY7Q 2M8GX 3JRHA 3CUQA 4AD9A 2O8KA 2EFPA 3I54A 3ROUA 5GTIC 5IOYA 3WU2C 2ZFWA 2M8EA 4FX4A 3F8FA 2VPLA 3MKYB 1VF9A 2Q8KA 1YIOA 1ZN2A 1JHHA 2NS0A 5HLGA 1LFPA 3UKGA 1BIAA 1WJDA 3GW2A 1FY7A 5FLMJ 4EJTA 2LBFA 2H8WA 3F8CA 3V8KA 3F0CA 4YIFA 3PQKA 2LH9A 4EJWA 2DTZA 5JLXA 4YELA 2OD5A 4P96A 3G71I 2A3SA 3DV8A 2CQ7A 4P9UA 3O6BB 1OLTA 4KT6A 3GZ5A 4LK0F 3FM5A 2PLYA 2MA3A 5TRDA 4KITB 4IX7A 2YX4A 2ACJA 1BOAA 3H92A 2A5WA 1Z77A 5LHHA 5DUKA 4I7HA 4V19K 3F21A 3DBLB 1B8IA 3AG2H 3HZJA 4B09A 4DYRA 1YW9A 3W2WA 3TOBA 1J9IA 1I3QJ 2E35A 1PUFA 3E6MA 1ULYA 3KFWX 2GXAA 1MH3A 3FX3A 3ERED 2P5VA 2Y30A 2RKHA 3VODA 2DMPA 4V2FA 1DPRA 2ID6A 3E6DA 2CQNA 3A1YA 2QBYA 5FKOA 3LSPA 3HKZA 4YRVA 1TZLA 1VQ5I 5LRSA 3ZQLA 2X4HA 3IV5A 2KRCA 3K4KA 4XONA 1DU6A 2DFEA 2HQRA 3DKWA 2R5YA 3TBIA 1U2WA 3MZ8A 2GA1A 2EZHA 2P4WA 1U9NA 3CDIA 4J01A 2IS2A 4E70A 1K83J 4RS8A 2DK5A 3RSNA 2RV8A 2LSOA 5HDGA 5E3OA 3AL0C 3ZQFA 2EFWA 1S9HA 3CJQB 1KONA 2IPQX 1WQ2A 4IRIA 2DLLA 1NK3P 2RC4A 3M07A 2IA2A 2XRLA 1CF7A 1K7AA 2VKHA 3BPVA 3SDGA 1BI3A 2HXOA 1MSFC 3RKWA 3G6EI 1H9TA 3HBLA 4LLNA 2L9NA 5K5QA 1MIJA 2RN7A 1ZELA 2XC7A 1TWFJ 4F7ZA 5HLTA 3H9QA 2R7RA 1AU7A 1Z0XA 4KICA 3U21A 3BJAA 2DYRH 3DTEA 3U1DA 1R23A 5J40A 3VYTB 4CICA 4ESBA 3RQ4A 2R7QA 3CF5F 3JREA 1YJWI 5FRMA 4E7KA 1BBYA 2QA4I 2XVCA 2HZTA 1FOWA 1BW6A 2LY1A 2L9SA 3HSFA 3H3ZA 1JT6A 3EYYA 4FT8A 1X3UA 3QAHA 4BHPA 3EETA 1VQ7I 2IRFG 1WJAA 1MJAA 3C18A 4D1QA 2ZNYA 5IY5H 2LKPA 3V7RA 3BZKA 2CJJA 4NNJA 4D7MA 3G1OA 3HRSA 1ZAOA 4RAGA 4Z6YA 2R7WA 1H8AC 1Z3XA 4PSXA 2JJ7A 2PI0A 3I4NJ 2UWMA 3LL7A 2QQ8A 3KZZA 5DCFA 3HUGB 4M3DA 4UB6C 1IXSB 1FEXA 1S7AA 4IRHA 2CFOA 4UXNA 4KN4X 5EGOB 1LFBA 1JJ8C 2DJNA 1D5VA 1WJEA 2GA2A 2ZKZA 3R6SA 2VLAA 4LITA 1P4AA 4HSTA 3JRAA 3NEUA 3OL4A 5IT3A 1K78B 3CTAA 1ZGWA 1AOYA 3AG3H 3IUOA 2ZSIB 3QQAA 5F6FA 1I27A 3JCUC 1E3HA 3OR1C 4L9VA 3GXOA 1W7PD 4XLHA 3BR0A 5D6EA 2Q2EB 2B7EA 4JX4A 5JI6A 4CXFA 4XRSG 4XK4A 2GLOA 1XDUA 4M71A 4CDGA 4ETSA 3BCAA 3ZP5A 2X6YA 2HYGD 3BJOA 2LLKA 2MABA 2KJBA 3SQNA 2FA5A 5DUIA 4ZZDA 3NQOA 1WI3A 3IKVA 4M73A 2ZJQF 1IN8A 1IN7A 3CZ6A 1I5ZA 2PJPA 4C2UA 2Y69H 3BR6A 3E5XA 1K4TA 4U7DA 3OYMA 1MBGA 1TW2A 1Y0UA 1X1DA 3J7ZI 2B63J 2X1EA 4PFOA 4UUSB 3S3OA 5F0HA 4RDUA 1WJBA 1VQLI 2CH0A 2K86A 1EKEA 4QWQA 3BZ6A 1A5JA 2AXLA 4GCVA 1DU0A 2DOAA 3BQYA 3V7SA 1C0WA 4ZJZA 5IPAA 2ZJRF 2ZFUA 1AHDP 2V9VA 1TWAJ 1MGTA 5GAHJ 3ZPLA 3L00A 1U0JA 3LQQA 2HKXA 5FB2A 5GPAA 3I58A 4IJAA 3ZN0A 4WX9A 2KLOA 4KJZA 4BDZA 4B48A 3K1PA 3VFZA 4MO7A 1J0RA 2IVMA 1FTZA 1T6SA 3O8GA 3IRRA 2O5RA 4AYBA 1ZG5A 1U5TA 3JR9A 5IYDJ 2O0YA 4RMNA 4JYKA 2FU4A 2MSYA 1R7JA 1IN5A 4JP0A 5TISC 4BL0B 3I59B 1DUXC 3E6CC 1W5CC 2WA0A 4LK1F 3BTIA 2KZGA 3GZNB 1W5SA 4QPQA 1G6NA 4I01A 1YYVA 2D1VA 2EIKH 5DEQA 2F5FA 1X3WB 4UB8C 4HLXA 3QYBA 2D1HA 2LYCA 1D0XA 1JKRC 2RQQA 1NHAA 4HNVA 3R0JA 4HDUA 3M8FA 1FPQA 3GTJJ 1JGGA 3KP7A 2OZUA 1WH7A 1JKPC 2OZ6A 2W57A 1DGWY 2NS7A 3TO6A 3BR3A 4IZZA 4A3JJ 4IHXA 1J2XA 4BHCA 5CJ9A 1V3FA 2W48A 2RGVA 1MNMC 2VASA 3RIRA 3BROA 1S3JA 2BYVE 2MW8A 2NYXA 2F4IA 3ONQA 2WAEA 1Z7LA 3BC8A 1ETYA 4M3EA 4Y13A 5L3GA 4A3CJ 5IYBJ 4IEJA 2KPMA 4MFDA 5CVVA 3PFIA 2QWWA 3WHCA 1YTYA 4IQ4A 4GYIA 2VXDA 3OOUA 1I1SA 1FBSA 1L0OC 1V5EA 2BW3A 2KIMA 5TGTA 3AL0B 4CCOA 4R79A 2ZXIA 4FETA 4D7NA 4QSHA 1OCOH 3K4LA 3CD6I 2L4AA 1U8BA 3KLNA 1J59A 3EYIA 2PMUA 3ABTA 3GFIA 1RPWA 2VBWA 1QNTA 4R1HA 2OCCH 2R7VA 2L9VA 5EG0A 1SFXA 4ZYGA 2AQFA 2LG4A 1T95A 1MW7A 3OYAA 2ZSHB 4WWCA 2R5ZB 1QRYA 4LJZF 5ILVA 3MEXA 1H89C 3F6VA 2XSDC 4KISA 4A5MA 3REOA 3JAMK 5E8GA 1W0TA 3MN2A 1S7OA 1HDPA 2R3SA 5CPRB 4IHTA 2A61A 3GX4X 2ZB9A 3E5UA 3RQIA 2O7OA 1TWGJ 2E1OA 3F8BA 4EJVA 4B8XA 1GVDA 1R71A 5ED4A 4BS9A 1PYVA 4Y15A 3E1SA 1M1EB 3R0AA 5LGNA 2L2OA 2UXNA 4CCLA 2XGDA 3OS2A 3PO2J 2HU9A 2QM3A 2IS1A 1RKTA 3M3YJ 4A69C 4IVNA 2YX7A 1FSEA 4LIUA 2E2JJ 1T0FA 3BCBA 4KMUX 1EH7A 1OQYA 3W2AA 1D1BA 2FF4A 3FHNA 2R4GA 3M1EA 4Q5SF 1FWZA 1IRGA 2LY2A 3BPXA 3DKYA 5LGTA 3BR5A 2O61A 4AC0A 2CS3A 4EGYA 2R7OA 2ELHA 3DEEA 3DLLF 1GUUA 2P7CB 5J6XA 4G9YA 3TP0A 2DQLA 1LE8B 1IO2A 2ICWG 1HCRA 3CC2I 1YI2I 2K9QA 2VC1A 2E1CA 4LB5A 2G7UA 4XKVA 3ZCOA 1GV2A 3MQ0A 1EF4A 1HKQA 2DA4A 2VB6A 3VEPA 2H94A 2VQHA 3PNTA 4MTEA 2CO5A 2DJIA 3FXQA 1VZ0A 2GZWA 5A2QZ 3QU6A 5K5RA 2E5NA 4XNFA 3DU5A 2P5KA 4CZCA 5AONA 4E7LA 2BE5F 4RAFA 2VT3A 3RKXA 1ZG1A 1X4PA 1HLVA 3RZOJ 3CMMA 3IC7A 2WY8Q 4L0YB 3I0TA 1D1AA 5KVRA 3TW6A 3QOPA 2M4GA 3TDZC 3H0GJ 3LSHA 4ENJA 5H6RA 3CC7I 3HSRA 2HPIA 2OUMA 3C1DA 1EH8A 4OWRB 2CGPA 3T8TA 1N25A 2VKEA 2I10A 3BDDA 3H35A 2LKSA 2M2EA 3PNYA 3PL8A 2HOSA 2LK2A 3MMYB 2FD5A 3CMEI 2DDBA 4XL9A 2KFDA 1UB9A 1MBFA 3HKZN 4OINF 5FKKA 2DU9A 3RKQA 3WGIA 3GO5A 3HB9A 3EUAA 4A3DJ 1JJ6C 5B1AH 3MFKA 2Y75A 4N9IA 2QYOA 1A6QA 1X1BA 1JGSA 1FYKA 2M34A 4XLNF 2CV2A 2QSHX 3HPGA 2VOPA 4LIVA 3HM5A 4RGXA 4C3IJ 3GFMA 1L3LA 2XSJC 3I56I 2BHZA 2OV7A 4NQWA 2Z16A 5GP9A 2HI3A 4J00A 1B59A 3HGGA 2MH9A 2X85A 4U88A 3ECHA 3GTOJ 1ETQA 4G94A 2Z5UA 4IF4A 4S0HB 4J19A 1ORKA 2IAIA 4KUMA 3PIPF 3OIOA 3L2QA 5LGUA 4YG2F 1RR8C 1X2NA 3HIFA 2JPBA 3FWEA 3SDBA 4R8HA 4BBRJ 1FNNA 3CCUI 3ECOA 5ICCA 1Z05A 4DZPA 2BZTA 1KU7A 4HNUA 2AS5F 1USSA 3K10A 2NVXJ 3KP3A 1KU9A 2KIUA 2P81A 3SHFA 2BHYA 1PUEE 2IS6A 1OCRH 2BGCA 2DPDA 2QSGX 1B6AA 3A01A 4BE0A 5J8FA 4BHBA 4MIMA 1KQ8A 1BI1A 1HW5A 4PSWA 2JRMA 4YFKF 3BG5A 4XQFA 2V9PA 1ZRFA 2H27A 2JA7J 2Z2SB 4GDFA 4MEXF 5DYMA 4L0ZB 1VI0A 2DN0A 1YOVB 3JSOA 1Z3YA 1ZK8A 2VJIA 4CHUA 1YRNB 4OU0A 4ASNA 1ODDA 2OAZA 4QTRA 2NXNB 3MCZA 4EATA 4DYQA 1ZKGA 5CLSA 2OPTA 2R7DA 3Q9VA 4JX6A 3JRDA 2QF7A 1IN4A 1V5FA 1TQPA 1HW2A 2FQ3A 2ZMEA 3SFIA 2KJCA 3BWGA 1GHCA 3RCOA 2FNPA 1QPIA 1ACIA 3QU3A 3KETA 1LDKB 1JI8A 3O2PE 4U87A 4DNCA 2FNAA 2FOWA 3ZGKA 1P6RA 5DV5A 4E7IA 3GTQJ 4FX0A 2EPFA 2DA3A 1K6YA 3FXMA 5FLVA 1WZ2A 5K7HA 4N4OB 2X51A 2CU7A 3V8LA 4A0YA 1HC8A 1E2XA 2JRTA 4XOPA 4L9JA 3TO9A 1GT0C 4PDKA 3VSKA 2O6GE 2ZC2A 1BM9A 5M5YJ 2TRTA 4HZFA 1T08B 2VL8A 2QUFA 3DF8A 4TV7A 4N4NB 1BJZA 1ZRCA 4K2EA 4Y52J 4MTDA 2GXGA 1U78A 3JRIA 1ENHA 1YFHA 2R7UA 3JRCA 1TWCJ 2ADUA 1J75A 5D5UB 3KEQA 2DPUA 2RREA 3ZMVA 2L01A 4KIGA 4BXXJ 2B9SA 3I3LA 3PIOF 1D8KA 3J7YJ 5C4XJ 5IP7J 3S2DJ 4ZDOA 3HXLA 3S1QJ 3M1CA 3UNGC 4E7ZA 1XMKA 2FBHA 4KIFA 2X1CA 4BJ6C 4AYBN 3C3WA 5GADJ 3SFZA 1XSXA 2EK5A 4MNUA 1GLNA 2E1MC 2ELKA 1VQ6I 3M7GA 3M4OJ 3MVPA 4Z2YA 3DEUA 4F93B 3JTHA 1ZLJA 2A6TA 3GLLA 1LKXA 3KIOA 4XRFA 1EH6A 3TW7A 1BR2A 1TNSA 4N9HA 1J5YA 3GTPJ 1O3SA 3EUHA 3W2VA 3AG1H 2WAFA 3A4CA 2DMNA 3FK6A 3HSEA 4GRIA 4BNCA 2F5CA 1LNWA 1S29A 5KK1A 5FROA 2E36A 4Y4RA 3DBRB 1FMWA 2M87A 5LHGA 3DPTA 5CVIA 4YEJA 2Z99A 4EM0B 4RB2C 2STTA 2AXTC 4CGZA 2GWRA 4A3EJ 2XDVA 3CCEI 1R1VA 5H6QA 2K9MA 4BY7J 3K4CA 1G8XA 4PJNA 3TMOA 3MKWB 3FISA 4A3FJ 1STZA 2GBYA 3CO7C 2X48A 5EEHA 2VOOA 5M5XJ 5FKNA 3QP6A 4G6QA 5DD4A 1HF0A 3ZQQA 5D5WB 1R00A 3ABKH 4HQMA 2KRFA 5JVGF 4G6TB 1J09A 1MBHA 3AKZA 3GTKJ 4PGGA 1MMAA 3S14J 2CG4A 3FXJA 2HDWA 2PJRB 1RC9A 3PM1A 1MH4A 5HODA 2DW4A 3OYFA 1XX5A 4U0YA 3B73A 4Y33A 4OIPF 4HA8A 4DJAA 3HTSB 1Q1HA 3S93A 4FASD 4BGDA 2BVMA 1R5GA 3PFYA 2EQRA 3BT9A 3I4PA 3CCQI 1YW7A 2BY3A 1JUMA 5K7FA 4E7SA 1W7PB 4YFXF 1X1AA 4ZYEA 3BQZA 4CCMA 3ZXSA 2FUG2 1JTYA 1U8RA 3ULQB 2COMA 5K1YA 2EFQA 2DAOA 1YJ9I 2VKDA 2KISA 5J1UA 2FEZA 3IH4A 3FXUA 1KA8A 2VQLA 2HKOA 3S15J 3S3NA 1DP7P 2L3DA 4G12A 1OCTC 2CUEA 1IXCA 3MZYA 3A0HC 2NOJB 2DMUA 5LRRA 3SEZA 3ZMTA 4BAYA 2NVTJ 4KFCA 1YS6A 3DBHB 3LSKA 5IP6A 2JSPA 4A6DA 2VE9A 2EV5A 2ISYA 1O4XA 2H6CA 3IH2A 2O03A 3BG7A 3H5AA 3VYRB 1Z9CA 1OYYA 4PFPA 3LOCA 1LFUP 4HX4A 4RLQA 1AKHA 1TP4A 3HUGA 3KPHA 3G73A 4CCJA 3G1LA 3I64A 3WTVC 3WG9A 2HYJA 3I5UA 3IP4B 1AA7A 3BG6A 3OV8A 1I6HJ 1B8IB 3CDHA 3PSFA 2EIJH 4I0AA 1K78A 4WXHA 4HX8A 1O7LA 2KT0A 3QWLA 4HV5A 3FXLA 2OU2A 4C3HJ 3S8PA 3FMRA 1N75A 1OYWA 3S3MA 1YITI 2GIZA 1W1WE 2CYYA 3OS1A 1YX5A 2DYSH 4RM2A 3RDIA 3LFKA 2M7AA 1U3EM 5J4VA 4ZDPA 2WAQA 1H0MA 1R36A 3OYIA 1XDSA 1YLFA 2BY1A 4OMYA 2HQ5A 3D5RC 2K3PA 1OPCA 1Y6IA 4CYCB 2IGOA 2V1UA 3FMSA 4UVAA 2JTVA 3MKZA 2R5YB 1SVLA 4IQJA 1Q1VA 3O8HA 5A2QK 2VJ4A 4XBFA 1TTYA 1HBXG 3C7JA 2LREA 1D0YA 1N78A 1Y1WJ 4UUSA 3JRFA 5KHDA 4XM3A 2L9RA 1UHSA 2R7ZJ 4G8XA 5JR3A 1VFCA 2DFFA 5L3FA 2GAUA 3GZ6A 2Y2ZA 4NC8A 2JSCA 2XKPA 2A07F 5ICFA 1TL8A 3RYRA 3H1CA 5F1JA 2EZIA 4LLLA 2V1NA 1A04A 4FHTA 5IT9Z 3KCCA 3MZHA 2IT0A 1S8NA 5KCMA 4M9ZA 2UV1A 5LD2C 4AU7A 1SFOJ 1B9MA 1BC8C 1XMAA 1IRFA 2M3AA 4QLCU 2ZNZA 2PMZA 2E1MB 1OFCX 5J1YA 2Y31A 1T98A 4AWXB 4L5IA 2LD5A 3ZMSA 1O3QA 2K3FA 2KL4A 1QHHD 3IL2A 3I59A 3RZDJ 4BJ5C 1LJ9A 2HWVA 1X1CA 3HRMA 3RPQA 4E7JA 2QVOA 4P9FA 2FXAA 1Y56A 1R1UA 2EZKA 2KDZA 4EM2A 3IWFA 1YE9A 1SVOA 5FFXA 4HPQA 2LTPA 3PUBA 5EEAA 3J7AO 2YU3A 5CQEA 2FE3A 2VBXA 3TEDA 3EUKL 2D45A 2Z3YA 3RI4A 2QKLB 3ZMDA 2TDXA 1T0FC 4A3GJ 4ABZA 1A35A 2ECBA 4CZZA 5D6FA 1WSUA 5FFZA 4H4KC 4LG3A 3HC7A 3S2WA 2DK8A 3Q0UA 5ILSA 4XKWA 4RBOA 3WGGA 1XN7A 1FIAA 4Q47A 5F0CA 2EFOA 1LEBA 1ZRDA 3WTWC 2VJJA 3CO6C 1YG2A 4EJUA 1USTA 1JTXA 3BOQA 2WB1N 1WJFA 1LUJB 1SFUA 1OJLA 3ZMZA 4HQEA 4D5FA 4CO8A 1XPXA 1NH3A 4NDLA 5CVRA 4MQ9F 3D1NI 3HOUJ 3LWFA 2LFBA 2XGXA 2XPVA 3LSTA 3CCYA 2E19A 2DXIA 1ZARA 3PO3J 1LEAA 3D5SC 5HS9A 4UVCA 4GGGA 4NHJA 1KQ0A 1WVRA 3E6BA 4M9SA 4NBQA 3HTUA 4ESFA 3WTZA 2HR3A 4ANJA 5HLIA 2NAZA 5H20A 5M3MJ 1MKMA 1TWHJ 2VXZA 3BZCA 1Z91A 1E17A 2V26A 2WC2A 4F52A 3Q5FA 1KGSA 3BJ6A 1QZYA 4EM1A 2E1NA 1W36D 2DFIA 2YPRA 1QVUA 4D5CA 1W4MA 2G7HA 2IA0A 4PJLA 3DP7A 3I71A 1JUSA 1U9OA 1BW5A 3H5RA 3CUOA 3LSMA 2Q1ZB 2Z33A 2H1KA 1XGOA 3IAS2 2NNYA 2LRDA 3U1KA 3BTJA 3WU0A 3T5XA 2HNHA 3HOSA 2G0EA 3A2KA 3FBIB 1FJLA 2LC2A 2MGQA 1XGSA 1KYZA 1I1GA 3CCSI 3CP2A 1VQKI 4DZJA 2N8GA 1GVJA 2JUGA 2LF7A 5BPDA 4FQGA 2K5CA 3ZOBA 1RI7A 2F5DA 3BTCA 1S5LC 2OTJI 2LY9A 2NS8A 1B1BA 1QZEA 2DT7B 2K9SA 2PBIA 5BNGA 3OIQA 3HOVJ 1XG1A 3L1PA 1LE8A 3K6GA 1IGNA 4A3LJ 3ASOH 4DBRA 3QYEA 4L9NA 1IF1A 5D5XB 4MHGA 2ZO4A 1ZHFA 4A6EA 1PVEA 4PJJA 4B3XA 1R49A 4WXDA 2PX9A 5DCMB 2VONA 5B3SH 2HDCA 2RNGA 2J5PA 4ENNA 3GFLA 2XUBA 1CGPA 2DA6A 5ERIA 3F8NA 5DS9A 1GXQA 4DOZA 1TBXA 4F92B 2XAHA 2YSRA 2CQKA 2W84A 2I8DA 2Y0MA 4A12A 4BE1A 2XIGA 3A02A 1IV8A 4Y3OA 4HNTA 1REPC 1SFKA 2BXZA 2YR2A 5JFRA 5J1RA 1I50J 2FQ4A 2V6EA 3VOEA 3ZQIA 2WWYA 4II3A 1KU2A 4BUPA 1P7JA 1VQOI 2XHKA 2W7NA 1ZR4A 1R6RA 1JKOC 2NOGA 3CC4I 2BW3B 2VT2A 1BC7C 4XR6A 4F91B 4IKFA 2F5EA 2UUZA 4A93J 3TDUC 1JUPA 2K40A 3X2QH 1ETKA 2JPCA 4ZZLA 2W4SA 3FF5A 1R58A 5HLHA 5CVUA 5LBQA 4NB5A 4XICA 3LNQA 3PUFA 1ZGAA 1ITYA 1YW8A 3SJMA 4C2TA 4BYYA 1BA5A 1Y8RB 1G2HA 2Z9OA 2BBYA 5E1WA 2QEXI 3TKYA 2R7FA 2RQPA 2A6HF
chains in the Genus database with same CATH topology
1FTTA 1DU6A 1RESA 1GT0C 2M9HA 2R5YA 3FKIJ 4B4CA 2LVSA 2HOTA 5M5YJ 3S2HJ 2ID3A 2TRTA 2DA1A 2EZHA 1U9NA 5EF6A 5J3LA 1K83J 4X6AJ 2X6OA 1BJZA 4Y52J 5E3OA 4XRSA 3ZQFA 3LSGA 1U78A 1NK3P 5IYCJ 4A3IJ 3JRIA 2XRLA 1ENHA 1IJWC 1XC5A 3SDGA 2HXOA 5DTDA 3JRCA 1MSFC 3B6CA 1TWCJ 3HBLA 3Q3SA 1ZQ3P 3TP3A 4I6ZA 2FJ1A 5C4JJ 4BXXJ 1MBEA 1TWFJ 3WHBA 5C4XJ 1AU7A 3BR1A 1Z0XA 5IP7J 2R5ZA 4FTHA 3S2DJ 5K7ZA 2CRGA 3S1QJ 3JREA 4AYBN 1IRZA 2JMWA 1BW6A 2ELKA 2XB5A 3MVPA 3HOYJ 1JT6A 3K2AA 3TW7A 3A03A 5IOZA 1T56A 3GTPJ 4IHWA 2CJJA 3FK6A 2DMNA 5F08A 3CQZJ 4D7MA 1YRNA 3G1OA 1H8AC 2L7MP 2JJ7A 3I4NJ 1IDYA 4M3DA 2D5VA 3HOWJ 1FEXA 5EGOB 1X2MA 1LFBA 4A3EJ 2DJNA 1JJ8C 4BY7J 4B1RA 3JRAA 2IEKA 3FISA 2EH3A 4AUXA 4A3FJ 1ZGWA 2GBYA 3QQAA 2H8RA 2VUMJ 2X48A 3LSJA 4MFEA 3HOXJ 5M5XJ 5FKNA 3BR0A 4JX4A 2LKXA 1HF0A 2WAQN 2R93J 1XS9A 4XRSG 4XK4A 2GLOA 1MBHA 2ME6A 3GTKJ 3S14J 2LLKA 2CUFA 1ETXA 3B6AA 1WCMJ 3PM1A 1MH4A 1IV6A 5HODA 1R9TJ 1WI3A 3S17J 3ZQGA 4A3KJ 2K9NA 2HOAA 3BT9A 2EQRA 3BR6A 4FE4A 1JUMA 1MBGA 5K7FA 4GFBA 2B63J 5M3FJ 2DA7A 4UUSB 3ZQCA 1E3OC 5F0HA 4RDUA 2HDDA 1Y1VJ 2DA5A 4EEFG 1D5YA 1A5JA 3BQZA 1ZTRA 1DU0A 2Y0SN 2JN6A 3OSGA 1JTYA 3BQYA 5IPAA 1AHDP 1K61A 1TWAJ 1FIPA 3IH3A 4L5EA 3BG9A 2VI6A 2JA8J 2NVQJ 5EG0B 5J1UA 1UG2A 5GPAA 3IH4A 4DW6A 4MO7A 3GTLJ 1B72A 1BL0A 2R0QC 3S15J 3G1MA 2PMZN 1FTZA 3O8GA 4G12A 3K7AJ 1OCTC 2CUEA 4FISA 1F36A 2DMUA 3JR9A 5IYDJ 2NVTJ 4JYKA 5IP6A 1O4XA 2MSYA 3IH2A 4JP0A 1MBKA 4QIWN 4FCYA 3BTIA 5JLWA 2CQQA 5EZHA 3LOCA 1LFUP 3W6VA 1AKHA 2DMTA 2AO9A 3G1LA 4DYCA 1GV5A 2HYJA 1I6HJ 4I76A 1B8IB 1JKRC 2IBDA 3MKLA 1IG7A 4HNVA 2LP0A 2VPRA 4M3FA 2X9DA 3BG3A 3GTJJ 1JGGA 2KT0A 1NK2P 4C3HJ 3HEFA 2WV1A 5FKMA 2NVYJ 1WH7A 1JKPC 3E7LA 1VNDA 2NS7A 4A3JJ 3BR3A 4IHXA 1IC8A 2W48A 1MNMC 2JA5J 1H88C 2MW8A 3I4MJ 4XIDA 2HQ5A 1ETYA 4M3EA 4A3CJ 5IYBJ 4IEJA 4BKXA 4BY1J 4CYCB 4MFDA 1JKQC 2R5YB 3WHCA 1UMQA 1Q1VA 3O8HA 3OOUA 1HDDC 3S16J 1Y1WJ 4UUSA 3JRFA 4D7NA 2HXIA 5C44J 4QSHA 2L9RA 1UHSA 2R7ZJ 2E2HJ 1U8BA 1VFCA 2ECCA 2XPUA 2Y2ZA 1P7IA 3S1NJ 2XGCA 1RPWA 3JRGA 1POGA 1W0UA 5F1JA 3FIWA 2EZIA 5EG0A 2L0KA 4W1UA 4A3MJ 4IHYA 2JA6J 1SFOJ 2R5ZB 3LSRA 1QRYA 5F27A 4BBSJ 1H89C 1JT0A 1TC3C 1IUFA 2XSDC 5EDNA 1OFCX 2JWTA 5J1YA 2Y31A 3MN2A 1W0TA 1HDPA 2YUSA 1MBJA 2LD5A 1F43A 2ZB9A 3RQIA 2O7OA 1TWGJ 2E1OA 4X1EA 1RKWA 5FKLA 3NARA 1GVDA 3RZDJ 1CQTA 2FX0A 4C3JJ 5E3NA 2EZKA 2KDZA 4M6VA 2XGDA 1RR7A 4V2GA 3PO2J 2LTPA 1WH5A 5EEAA 1RKTA 3M3YJ 4XRMA 3TEDA 4A69C 2E2JJ 4A3BJ 3HGYA 3FK7A 2LR8A 3S1RJ 4A3GJ 3BR5A 4ABZA 4AC0A 2ECBA 3NAUA 4B3AA 3BR2A 3CDLA 1GUUA 3C2BA 3Q0UA 3TP0A 2JK3A 1LE8B 2XPWA 2Y9YA 1HCRA 1T33A 2CQXA 4RBOA 3A01B 1FIAA 2K9QA 5F0CA 1GV2A 1EF4A 2DA4A 2L7ZA 3DEWA 2TCTA 1JTXA 1APLC 2WB1N 1GDTA 4CYCA 1OJLA 2Y9ZA 1RETA 2MG4A 4D5FA 1NTCA 4NDLA 5F04A 2RAEA 3M4OJ 2OF7A 3GBGA 4JX5A 3D1NI 5EGOA 4W97A 3HOUJ 2XGEA 2LFBA 2XPVA 5M5WJ 3CCYA 2E19A 1HLVA 3RZOJ 2COBA 3PO3J 2YS9A 3TW6A 4M3BA 3S1MJ 2E2IJ 3JRBA 2XB0X 3H0GJ 3Q0WA 3Q0VA 3ZQHA 1PUFB 5GPCA 1WPKA 5IP9J 5F0FA 2VKEA 1ETVA 2I10A 3BTLA 2M2EA 5M3MJ 1TWHJ 2HOSA 2LK2A 2FD5A 3HDDA 1ETWA 2R92J 3GTGJ 1MBFA 3HKZN 5FKKA 3RKQA 3HB9A 4A3DJ 3HOZJ 4C2MJ 1JJ6C 2L7FP 3GTMJ 1HOMA 5E3LA 3VPRA 1QVTA 2M34A 5EYRA 1QVUA 4D5CA 1B72B 2VKVA 2DA2A 3HM5A 1JUSA 4C3IJ 1U9OA 1BW5A 2DMQA 2H1KA 4M3GA 4MLOA 1A6IA 3QPLA 1IDZA 5GP9A 3H3VK 3BTJA 2HI3A 2O9LA 3HGGA 2AHQA 2G0EA 2M8GX 2EZLA 3JRHA 2GM4A 3GTOJ 1ETQA 1FJLA 2MGQA 1SANA 2O8KA 4S0HB 5IOYA 4J19A 1ORKA 2IAIA 4Y7NJ 3OIOA 1WGXA 1AKHB 4DZJA 1VF9A 2N8GA 1X2NA 2EBIA 2QCOA 3ZOBA 4BBRJ 3UKGA 3BTCA 4DZPA 2LY9A 1MSEC 2NS8A 5FLMJ 2K9SA 3F0CA 5BNGA 2NVXJ 5EZGA 1XG1A 2P81A 3HOVJ 1S7EA 3L1PA 1LE8A 1IGNA 4A3LJ 3A01A 5E3MA 2DTZA 5JLXA 4MIMA 4IHVA 2M0CA 3BG5A 1ETOA 2DA6A 2JA7J 5DS9A 3QPSA 1VI0A 2DN0A 1OCPA 3A02A 3OSFA 1ZK8A 1Z77A 4LOCA 1YRNB 5C3EJ 1X58A 1ZR2A 3DCFA 5J1RA 1I50J 2FQ4A 4QTRA 2YU9J 3ZQIA 4UUTA 1B8IA 4DYQA 4DYRA 1ZKGA 1P7JA 2OPTA 4JX6A 1ZR4A 1JKOC 1I3QJ 2NOGA 3JRDA 2QF7A 3CMYA 2ME0A 1PUFA 4A93J 3SFIA 1MH3A 1JUPA 2K40A 9ANTA 1ETKA 1QPIA 2Y30A 2DMPA 4V2FA 2ID6A 5FJ8J 3LNQA 4XICA 1ITYA 3GTQJ 3SJMA 5FKOA 3LSPA 1BA5A 4FE7A 1G2HA 2DA3A 5FLVA 5K7HA 2CU7A 3ZQLA 3IV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FTT A;  1DU6 A;  1RES A;  1GT0 C;  2M9H A;  2R5Y A;  3FKI J;  4B4C A;  2LVS A;  2HOT A;  5M5Y J;  3S2H J;  2ID3 A;  2TRT A;  2DA1 A;  2EZH A;  1U9N A;  5EF6 A;  5J3L A;  1K83 J;  4X6A J;  2X6O A;  1BJZ A;  4Y52 J;  5E3O A;  4XRS A;  3ZQF A;  3LSG A;  1U78 A;  1NK3 P;  5IYC J;  4A3I J;  3JRI A;  2XRL A;  1ENH A;  1IJW C;  1XC5 A;  3SDG A;  2HXO A;  5DTD A;  3JRC A;  1MSF C;  3B6C A;  1TWC J;  3HBL A;  3Q3S A;  1ZQ3 P;  3TP3 A;  4I6Z A;  2FJ1 A;  5C4J J;  4BXX J;  1MBE A;  1TWF J;  3WHB A;  5C4X J;  1AU7 A;  3BR1 A;  1Z0X A;  5IP7 J;  2R5Z A;  4FTH A;  3S2D J;  5K7Z A;  2CRG A;  3S1Q J;  3JRE A;  4AYB N;  1IRZ A;  2JMW A;  1BW6 A;  2ELK A;  2XB5 A;  3MVP A;  3HOY J;  1JT6 A;  3K2A A;  3TW7 A;  3A03 A;  5IOZ A;  1T56 A;  3GTP J;  4IHW A;  2CJJ A;  3FK6 A;  2DMN A;  5F08 A;  3CQZ J;  4D7M A;  1YRN A;  3G1O A;  1H8A C;  2L7M P;  2JJ7 A;  3I4N J;  1IDY A;  4M3D A;  2D5V A;  3HOW J;  1FEX A;  5EGO B;  1X2M A;  1LFB A;  4A3E J;  2DJN A;  1JJ8 C;  4BY7 J;  4B1R A;  3JRA A;  2IEK A;  3FIS A;  2EH3 A;  4AUX A;  4A3F J;  1ZGW A;  2GBY A;  3QQA A;  2H8R A;  2VUM J;  2X48 A;  3LSJ A;  4MFE A;  3HOX J;  5M5X J;  5FKN A;  3BR0 A;  4JX4 A;  2LKX A;  1HF0 A;  2WAQ N;  2R93 J;  1XS9 A;  4XRS G;  4XK4 A;  2GLO A;  1MBH A;  2ME6 A;  3GTK J;  3S14 J;  2LLK A;  2CUF A;  1ETX A;  3B6A A;  1WCM J;  3PM1 A;  1MH4 A;  1IV6 A;  5HOD A;  1R9T J;  1WI3 A;  3S17 J;  3ZQG A;  4A3K J;  2K9N A;  2HOA A;  3BT9 A;  2EQR A;  3BR6 A;  4FE4 A;  1JUM A;  1MBG A;  5K7F A;  4GFB A;  2B63 J;  5M3F J;  2DA7 A;  4UUS B;  3ZQC A;  1E3O C;  5F0H A;  4RDU A;  2HDD A;  1Y1V J;  2DA5 A;  4EEF G;  1D5Y A;  1A5J A;  3BQZ A;  1ZTR A;  1DU0 A;  2Y0S N;  2JN6 A;  3OSG A;  1JTY A;  3BQY A;  5IPA A;  1AHD P;  1K61 A;  1TWA J;  1FIP A;  3IH3 A;  4L5E A;  3BG9 A;  2VI6 A;  2JA8 J;  2NVQ J;  5EG0 B;  5J1U A;  1UG2 A;  5GPA A;  3IH4 A;  4DW6 A;  4MO7 A;  3GTL J;  1B72 A;  1BL0 A;  2R0Q C;  3S15 J;  3G1M A;  2PMZ N;  1FTZ A;  3O8G A;  4G12 A;  3K7A J;  1OCT C;  2CUE A;  4FIS A;  1F36 A;  2DMU A;  3JR9 A;  5IYD J;  2NVT J;  4JYK A;  5IP6 A;  1O4X A;  2MSY A;  3IH2 A;  4JP0 A;  1MBK A;  4QIW N;  4FCY A;  3BTI A;  5JLW A;  2CQQ A;  5EZH A;  3LOC A;  1LFU P;  3W6V A;  1AKH A;  2DMT A;  2AO9 A;  3G1L A;  4DYC A;  1GV5 A;  2HYJ A;  1I6H J;  4I76 A;  1B8I B;  1JKR C;  2IBD A;  3MKL A;  1IG7 A;  4HNV A;  2LP0 A;  2VPR A;  4M3F A;  2X9D A;  3BG3 A;  3GTJ J;  1JGG A;  2KT0 A;  1NK2 P;  4C3H J;  3HEF A;  2WV1 A;  5FKM A;  2NVY J;  1WH7 A;  1JKP C;  3E7L A;  1VND A;  2NS7 A;  4A3J J;  3BR3 A;  4IHX A;  1IC8 A;  2W48 A;  1MNM C;  2JA5 J;  1H88 C;  2MW8 A;  3I4M J;  4XID A;  2HQ5 A;  1ETY A;  4M3E A;  4A3C J;  5IYB J;  4IEJ A;  4BKX A;  4BY1 J;  4CYC B;  4MFD A;  1JKQ C;  2R5Y B;  3WHC A;  1UMQ A;  1Q1V A;  3O8H A;  3OOU A;  1HDD C;  3S16 J;  1Y1W J;  4UUS A;  3JRF A;  4D7N A;  2HXI A;  5C44 J;  4QSH A;  2L9R A;  1UHS A;  2R7Z J;  2E2H J;  1U8B A;  1VFC A;  2ECC A;  2XPU A;  2Y2Z A;  1P7I A;  3S1N J;  2XGC A;  1RPW A;  3JRG A;  1POG A;  1W0U A;  5F1J A;  3FIW A;  2EZI A;  5EG0 A;  2L0K A;  4W1U A;  4A3M J;  4IHY A;  2JA6 J;  1SFO J;  2R5Z B;  3LSR A;  1QRY A;  5F27 A;  4BBS J;  1H89 C;  1JT0 A;  1TC3 C;  1IUF A;  2XSD C;  5EDN A;  1OFC X;  2JWT A;  5J1Y A;  2Y31 A;  3MN2 A;  1W0T A;  1HDP A;  2YUS A;  1MBJ A;  2LD5 A;  1F43 A;  2ZB9 A;  3RQI A;  2O7O A;  1TWG J;  2E1O A;  4X1E A;  1RKW A;  5FKL A;  3NAR A;  1GVD A;  3RZD J;  1CQT A;  2FX0 A;  4C3J J;  5E3N A;  2EZK A;  2KDZ A;  4M6V A;  2XGD A;  1RR7 A;  4V2G A;  3PO2 J;  2LTP A;  1WH5 A;  5EEA A;  1RKT A;  3M3Y J;  4XRM A;  3TED A;  4A69 C;  2E2J J;  4A3B J;  3HGY A;  3FK7 A;  2LR8 A;  3S1R J;  4A3G J;  3BR5 A;  4ABZ A;  4AC0 A;  2ECB A;  3NAU A;  4B3A A;  3BR2 A;  3CDL A;  1GUU A;  3C2B A;  3Q0U A;  3TP0 A;  2JK3 A;  1LE8 B;  2XPW A;  2Y9Y A;  1HCR A;  1T33 A;  2CQX A;  4RBO A;  3A01 B;  1FIA A;  2K9Q A;  5F0C A;  1GV2 A;  1EF4 A;  2DA4 A;  2L7Z A;  3DEW A;  2TCT A;  1JTX A;  1APL C;  2WB1 N;  1GDT A;  4CYC A;  1OJL A;  2Y9Z A;  1RET A;  2MG4 A;  4D5F A;  1NTC A;  4NDL A;  5F04 A;  2RAE A;  3M4O J;  2OF7 A;  3GBG A;  4JX5 A;  3D1N I;  5EGO A;  4W97 A;  3HOU J;  2XGE A;  2LFB A;  2XPV A;  5M5W J;  3CCY A;  2E19 A;  1HLV A;  3RZO J;  2COB A;  3PO3 J;  2YS9 A;  3TW6 A;  4M3B A;  3S1M J;  2E2I J;  3JRB A;  2XB0 X;  3H0G J;  3Q0W A;  3Q0V A;  3ZQH A;  1PUF B;  5GPC A;  1WPK A;  5IP9 J;  5F0F A;  2VKE A;  1ETV A;  2I10 A;  3BTL A;  2M2E A;  5M3M J;  1TWH J;  2HOS A;  2LK2 A;  2FD5 A;  3HDD A;  1ETW A;  2R92 J;  3GTG J;  1MBF A;  3HKZ N;  5FKK A;  3RKQ A;  3HB9 A;  4A3D J;  3HOZ J;  4C2M J;  1JJ6 C;  2L7F P;  3GTM J;  1HOM A;  5E3L A;  3VPR A;  1QVT A;  2M34 A;  5EYR A;  1QVU A;  4D5C A;  1B72 B;  2VKV A;  2DA2 A;  3HM5 A;  1JUS A;  4C3I J;  1U9O A;  1BW5 A;  2DMQ A;  2H1K A;  4M3G A;  4MLO A;  1A6I A;  3QPL A;  1IDZ A;  5GP9 A;  3H3V K;  3BTJ A;  2HI3 A;  2O9L A;  3HGG A;  2AHQ A;  2G0E A;  2M8G X;  2EZL A;  3JRH A;  2GM4 A;  3GTO J;  1ETQ A;  1FJL A;  2MGQ A;  1SAN A;  2O8K A;  4S0H B;  5IOY A;  4J19 A;  1ORK A;  2IAI A;  4Y7N J;  3OIO A;  1WGX A;  1AKH B;  4DZJ A;  1VF9 A;  2N8G A;  1X2N A;  2EBI A;  2QCO A;  3ZOB A;  4BBR J;  3UKG A;  3BTC A;  4DZP A;  2LY9 A;  1MSE C;  2NS8 A;  5FLM J;  2K9S A;  3F0C A;  5BNG A;  2NVX J;  5EZG A;  1XG1 A;  2P81 A;  3HOV J;  1S7E A;  3L1P A;  1LE8 A;  1IGN A;  4A3L J;  3A01 A;  5E3M A;  2DTZ A;  5JLX A;  4MIM A;  4IHV A;  2M0C A;  3BG5 A;  1ETO A;  2DA6 A;  2JA7 J;  5DS9 A;  3QPS A;  1VI0 A;  2DN0 A;  1OCP A;  3A02 A;  3OSF A;  1ZK8 A;  1Z77 A;  4LOC A;  1YRN B;  5C3E J;  1X58 A;  1ZR2 A;  3DCF A;  5J1R A;  1I50 J;  2FQ4 A;  4QTR A;  2YU9 J;  3ZQI A;  4UUT A;  1B8I A;  4DYQ A;  4DYR A;  1ZKG A;  1P7J A;  2OPT A;  4JX6 A;  1ZR4 A;  1JKO C;  1I3Q J;  2NOG A;  3JRD A;  2QF7 A;  3CMY A;  2ME0 A;  1PUF A;  4A93 J;  3SFI A;  1MH3 A;  1JUP A;  2K40 A;  9ANT A;  1ETK A;  1QPI A;  2Y30 A;  2DMP A;  4V2F A;  2ID6 A;  5FJ8 J;  3LNQ A;  4XIC A;  1ITY A;  3GTQ J;  3SJM A;  5FKO A;  3LSP A;  1BA5 A;  4FE7 A;  1G2H A;  2DA3 A;  5FLV A;  5K7H A;  2CU7 A;  3ZQL A;  3IV5 A; 
#chains in the Genus database with same CATH topology
 1FTT A;  1B4A A;  2M9H A;  4XKB A;  1MZB A;  3CCM I;  3FXO A;  2JT1 A;  2HOT A;  3NRV A;  2ID3 A;  2JVG A;  1OMI A;  2DA1 A;  4BXF A;  5LHI A;  5J3L A;  3ELK A;  2BY0 A;  2B0L A;  3KYC B;  1OYI A;  2X6O A;  5E79 C;  2UXX A;  4U7B A;  1I39 A;  2BV6 A;  4ENM A;  1TT5 B;  3ZRG A;  4XRS A;  1FYM A;  3P7N A;  4H0E A;  4C30 A;  5IYC J;  4AID A;  1J7K A;  4AM3 A;  3FZV A;  5DTD A;  4WK8 F;  1SAX A;  3Q3S A;  1OIS A;  2ESH A;  1ZQ3 P;  3TP3 A;  2FJ1 A;  1UG0 A;  1UJ8 A;  3B02 A;  4HBL A;  5KAI C;  5E1X A;  3FM3 A;  3UR3 C;  4FTH A;  4UV8 A;  4IOA F;  5J4Y A;  2XF7 A;  1NG7 A;  3ZR8 X;  2VJ5 A;  1XGM A;  5BQT A;  1WJ5 A;  3K1M A;  1SD4 A;  4LG0 B;  4CCK A;  2JMW A;  2IGM A;  1Y39 A;  2XB5 A;  3HOY J;  1AWC A;  1KYW A;  2FSW A;  3RKY A;  4CCN A;  5HOO A;  3TGN A;  3A03 A;  2HS5 A;  4CYD A;  5IOZ A;  3PSI A;  4M6X A;  2WBM A;  2EA4 A;  5L3E A;  1ZGJ A;  3ZN1 A;  1YRN A;  3CQZ J;  2IGK A;  2JZY A;  4A2U A;  2WAD A;  4E4H A;  2HFH A;  4AIJ A;  2L7M P;  2R7X A;  1R5I D;  1D8J A;  1ON1 A;  3OR2 C;  3CUQ C;  3EUH C;  1HW1 A;  4RB3 C;  1MMD A;  1IDY A;  1WJC A;  2BOL A;  3VWB A;  3J7A Y;  1HKT A;  4HRI A;  4OIQ F;  2KIQ A;  3TOA A;  4B1R A;  3WTS C;  2K4J A;  4XLP F;  1O3R A;  2OQG A;  3P5J A;  2EH3 A;  4AUX A;  3LSI A;  5L3D A;  3OMY A;  2ZJ2 A;  4ZDL A;  1QBJ A;  2VUM J;  3HOX J;  3DPU A;  4OAY A;  3Q9S A;  4MQV A;  4PK4 A;  2LKX A;  2CW7 A;  2WAQ N;  2EIN H;  2R93 J;  3CJR B;  1XS9 A;  2ZXJ A;  4YFN F;  3HRU A;  2QSF X;  3KP6 A;  4AIH A;  1VQ9 I;  4AVZ A;  1X4O A;  2CUF A;  4MGR A;  3K1N A;  1ETX A;  4BEH B;  2OBP A;  1VQP I;  1WCM J;  5BPI A;  1ERD A;  3GVA A;  1IV6 A;  1JXS A;  2WB1 A;  3RPU A;  1R9T J;  2P5L C;  2OQR A;  1QA6 A;  1WI9 A;  2KZV A;  4A5N A;  4D9J A;  3BY6 A;  1D0Z A;  3LA2 A;  3F9K A;  3AFH A;  3FMQ A;  5JHU A;  1XCB A;  2KMU A;  4FE4 A;  3QPT A;  3S32 A;  1ZLK A;  4GFB A;  3CP8 A;  2I5U A;  2DA7 A;  3K4J A;  4I99 C;  1E3O C;  4NQW B;  2DA5 A;  4M6Y A;  1VQ4 I;  4EEF G;  2LMD A;  4I02 A;  3DWL E;  2P0W A;  1T38 A;  2OCE A;  3DPL C;  1TT0 A;  3L2V A;  3SXY A;  2V4J C;  4BH9 A;  2XF6 A;  3H36 A;  4IRG A;  3IH3 A;  1FIP A;  4L5E A;  2NVQ J;  2QQA A;  3BG9 A;  4UNO A;  4GYG A;  1UFM A;  2HGC A;  2XAS A;  4BQA A;  3GFJ A;  2K85 A;  2W85 A;  1OKR A;  3ABL H;  3V4G A;  3KP2 A;  1FYL A;  4O5V A;  2P6T A;  2KRH A;  1B72 A;  2R0Q C;  5IT9 K;  2PMZ N;  2ZXW H;  3GCM A;  3K7A J;  2QEN A;  4FIS A;  3CJN A;  1F36 A;  2GQQ A;  1EJ9 A;  1FC3 A;  2XV4 S;  1G3S A;  3T1B A;  5LLQ A;  4LGW A;  4BQN A;  1IAW A;  4PJ0 C;  1MBK A;  1ZG3 A;  4QIW N;  2ZCW A;  5JLW A;  2DO7 A;  2PN6 A;  3E0J B;  1T39 A;  3W6V A;  5DD8 A;  2DMT A;  2M0M A;  3F6O A;  2EWN A;  3VYS B;  4HV6 A;  3OYD A;  2AO9 A;  2L4M A;  1YO5 C;  1GV5 A;  5AIQ A;  3L7W A;  2W00 A;  3MKL A;  2EB7 A;  1W36 C;  1IG7 A;  2E34 A;  2V1D A;  2X9D A;  1FX7 A;  2PQ8 A;  2V9K A;  1NK2 P;  1RZ4 A;  2F4M B;  5FKM A;  3GEZ A;  2ZJP F;  2A6E F;  3E7L A;  3EDP A;  3OYB A;  1VND A;  4N0B A;  1IUY A;  1RUN A;  3VSL A;  1IC8 A;  2H1L A;  4EQQ A;  5E18 F;  5D4S A;  1H88 C;  4C9Y A;  2JA5 J;  2IP2 A;  1PP8 F;  3I4M J;  3OOP A;  4XID A;  4LD5 A;  3SZT A;  3H9G A;  3I55 I;  2G9W A;  2CFX A;  3C2G A;  3HYI A;  4BKX A;  3J80 Z;  5FGM A;  3M8E A;  2HOE A;  1R4M B;  3ABM H;  1UMQ A;  2CW0 F;  3HPH A;  6PAX A;  4ON0 A;  3S16 J;  1WHU A;  1W7P A;  3W6K B;  1LQ1 A;  2XAF A;  1KQ9 A;  2CW8 A;  1QU3 A;  1ZRE A;  3IWZ A;  2E2H J;  3GUD A;  2X0L A;  3IKT A;  2P8T A;  5JHF A;  4UVB A;  4KYW A;  2XRN A;  5E8I A;  1R5H A;  1G4D A;  2X6X A;  4L5J A;  1KZH A;  2F5V A;  4BDY A;  2Y0S A;  1W0U A;  1GXP A;  3FIW A;  1ON2 A;  1QHG A;  4A3M J;  3DTI A;  1IXR C;  4P55 A;  1FOK A;  4RLF A;  2O3F A;  1LPQ A;  2IS4 A;  2QQ9 A;  2MD5 A;  1LVA A;  2QGU A;  3WGH A;  2JA6 J;  5DDG A;  2Q0O A;  4UHT A;  3LSR A;  2R7S A;  1ONV A;  2K9L A;  4KA4 A;  1TC3 C;  1IUF A;  5EDN A;  2MH2 A;  3M9A A;  1QQI A;  4DQ2 A;  2DT6 A;  4XN3 A;  1MDM B;  1P9Q C;  2E60 A;  2DT5 A;  3ZMU A;  2UZK A;  1O3T A;  2VOD A;  1QO0 D;  2W25 A;  4GXO A;  2CV0 A;  4XLC A;  2DI3 A;  4X1E A;  1RKW A;  5DM7 F;  4M74 A;  1CQT A;  1MMS A;  1B9N A;  2FX0 A;  3HRT A;  1WRJ A;  5HS8 A;  1LDJ A;  5E3N A;  2E5Z A;  1R22 A;  2QKM B;  4HOB A;  4M6V A;  4CH7 A;  1RR7 A;  4V2G A;  2K4B A;  3CUQ B;  1FBU A;  5HDK A;  5FLX Z;  3K70 D;  2QZ8 A;  3COA C;  4XRM A;  2VC0 A;  4XKC A;  3SYT A;  5K5O A;  4A3B J;  4XMY A;  3HGY A;  4G7Z F;  1P4W A;  3RPU D;  5ICE A;  2XKO A;  2M7B A;  1UZC A;  3C2H A;  2V79 A;  1FMV A;  3CCJ I;  2VE8 A;  1X3Z B;  2EIM H;  5AIP A;  2LBF B;  3ZQ7 A;  2A68 F;  4BAC A;  1OR7 A;  2W82 A;  2MYS A;  3M8J A;  2Y9Y A;  2XPW A;  1IZ1 A;  3IAM 2;  2CQX A;  1RNL A;  1TLH B;  3K2Z A;  1A31 A;  3KYL A;  3MAJ A;  2CV1 A;  2A69 F;  2JUC A;  2L7Z A;  1U5T C;  1YHQ I;  1HQC A;  3SEQ A;  3CF2 A;  1UHM A;  2XAQ A;  1Z67 A;  1XCV A;  2RDP A;  4CYC A;  1S72 I;  3J81 Z;  3WG7 H;  2MG4 A;  2VBZ A;  3GWZ A;  1NTC A;  1Y8Q B;  1MMN A;  4LMY A;  3T0Y A;  2OF7 A;  4PZJ A;  2MLK A;  1FBQ A;  2MC3 A;  2XF5 A;  5CYV A;  3WOD F;  4JX5 A;  5EGO A;  2KKO A;  3JW4 A;  2HTS A;  4W97 A;  3CCR I;  2XGE A;  2OTL I;  3FKJ A;  3L2U A;  3TO7 A;  3OIP A;  3CLQ A;  5D8L B;  3K0L A;  2D2W A;  2COB A;  1K79 A;  2L54 A;  1DQU A;  2YS9 A;  1D1C A;  1V54 H;  4HYE A;  3S1M J;  2E2I J;  1G3W A;  2GOX B;  3QOD A;  2E7X A;  3HL2 A;  2VQG A;  4AVP A;  2ETH A;  3Q0V A;  1HSJ A;  2Q2E A;  4ESJ A;  1PUF B;  4ZC3 A;  1WPK A;  3V42 A;  4ENK A;  1ETV A;  1FOY A;  2V7F A;  3BTL A;  4BJT A;  2H09 A;  3OYK A;  2K7L A;  3NWS A;  3PQJ A;  4KT5 C;  2A5Y B;  3N97 A;  1TQM A;  2FML A;  1FZP B;  2QBY B;  3AAF A;  2C6Y A;  4PGH A;  1SD6 A;  3I9V 2;  4HDV A;  5E3L A;  1Z6T A;  1QVT A;  3VPR A;  3ML6 A;  2HVS A;  2BEO A;  3KYD B;  4ZH4 F;  4ZYD A;  2VKV A;  2WV0 A;  1IRX A;  5HDN A;  4YIR X;  4M3G A;  1IDZ A;  3DQV C;  4IXA A;  4ZYH A;  1SC7 A;  2EFN A;  3H3V K;  1BR4 A;  1F4K A;  2O9L A;  2AHQ A;  2MBF A;  1XSD A;  4XN0 A;  2EZL A;  2IW5 A;  3HG9 A;  2GM4 A;  1FSH A;  5L3C A;  3D5L A;  2DTR A;  1SAN A;  3WE2 A;  2KDO A;  3E97 A;  3H9J A;  1CF7 B;  3HJE A;  4Y7N J;  1WGX A;  1AKH B;  1WFX A;  3KLO A;  4HG2 A;  2X1D A;  1QGP A;  2FBK A;  4PUS A;  1D3Y A;  4RAY A;  2EBI A;  1UCR A;  1MJB A;  2QCO A;  1TW3 A;  2EA2 A;  3KZI C;  4JQF A;  1F5T A;  3PNV A;  1MSE C;  3WTY C;  4KIB A;  2PMH A;  4CUG A;  1BI0 A;  2M4K A;  4CA0 A;  5EZG A;  1S7E A;  1RRJ A;  4IL6 C;  4M72 A;  5FD6 A;  4IOC F;  2L02 A;  5E3M A;  1RUO A;  1FT9 A;  5HS7 A;  3QPH A;  2M0C A;  4IHV A;  2P6S A;  2DDA A;  3RTR A;  4S05 A;  2NNN A;  1E3P A;  3LA7 A;  3MWM A;  1DGR M;  3CLO A;  1ETO A;  2DBB A;  3CJT B;  5E20 A;  3OYN A;  4YII A;  4HLY A;  3QPS A;  3F22 A;  2HEO A;  1XSV A;  2V1X A;  1OCP A;  5HVQ C;  4PJM A;  3AG4 H;  2OJE D;  3OSF A;  4LOC A;  4OIO F;  5C3E J;  2EV0 A;  1X58 A;  2GOM A;  1LVK A;  3DCF A;  2BY2 A;  1ZR2 A;  1SMT A;  2YU9 J;  2DQR A;  1SFE A;  4UUT A;  2FRH A;  3F72 A;  2NVU B;  1Z1D A;  4WCG A;  1F1Z A;  3RYP A;  5B66 C;  3E5Q A;  3WTT C;  1UAA A;  3L2C A;  3CMY A;  4E6K G;  2ME0 A;  4IO9 F;  2K02 A;  2CUZ A;  3LAP A;  3DXJ F;  9ANT A;  2CWE A;  4O3M A;  3ERM A;  2DOE A;  1BJA A;  3DKX A;  2OA4 A;  3CCL I;  2EJR A;  5FJ8 J;  2M30 A;  1UEL B;  2L7K A;  3W3C A;  4FE7 A;  1Z6R A;  1V4R A;  5LEJ A;  1FP2 A;  4HAM A;  3ZQC A;  4EVI A;  3IRQ A;  3G4S I;  5E1Z B;  1RES A;  3FKI J;  5J47 A;  4DGW B;  2IGN A;  4B4C A;  2LVS A;  5EJC A;  3S2H J;  3L9F A;  3K4N A;  5EF6 A;  3K9T A;  4AIK A;  4X6A J;  4HF2 A;  2DCE A;  5DM6 F;  3TL4 X;  4JK1 X;  3LSG A;  1HKS A;  2W1O A;  1X1P A;  4I0B A;  3OYG A;  4A3I J;  4DBQ A;  3JTG A;  1I6X A;  1SD5 A;  1IJW C;  1XC5 A;  4LB6 B;  4G7H F;  5KAF C;  2Z1D A;  3B6C A;  1DDN A;  3P9C A;  3JSP A;  3L2W A;  1ZYR F;  5B5E C;  4I6Z A;  5C4J J;  1VQ8 I;  1MBE A;  3WHB A;  2V6C A;  3CMA I;  3KEY A;  3BR1 A;  2R5Z A;  3LMM A;  4P1W A;  5K7Z A;  2CRG A;  3LA3 A;  1T8I A;  1H9G A;  2VQC A;  2XRO A;  4BE2 A;  2QQB A;  1XB4 A;  3ASN H;  4L9T A;  3EQL F;  1IRZ A;  4A0X A;  3L09 A;  4II2 A;  3R4K A;  1LDD A;  5DCM A;  2STW A;  2K27 A;  4XSX F;  3OYJ A;  4EGZ A;  2F48 A;  5B1B H;  1O7F A;  3K2A A;  4B47 A;  1U5T B;  3OYE A;  3ISP A;  3QRF F;  3V7C A;  3TQN A;  1XMX A;  4QPO A;  4RGR A;  4NC6 A;  4HF0 A;  3U9G A;  1T56 A;  5KNL A;  4HX7 A;  3G2B A;  4IHW A;  3GLX A;  5F08 A;  1SAU A;  5HNF A;  2FMY A;  5D8K B;  1KU3 A;  1SEU A;  2M1B A;  1Z7U A;  1PP7 U;  3BP8 A;  1O57 A;  3QYF A;  2D5V A;  2ISZ A;  3DU6 A;  2O8X A;  3HOW J;  1X2M A;  4GO1 A;  2RVC A;  4OMZ A;  5F64 A;  2DOF A;  3WTU C;  2IEK A;  2CUJ A;  3MD2 A;  2H8R A;  1MD0 A;  1F9N A;  3DTK A;  3GF2 A;  3LSJ A;  4MFE A;  4OIR F;  3FXK A;  3N4M A;  2M5W A;  5D5V B;  2KQR A;  1OCZ H;  3ESW B;  5E17 F;  3KP5 A;  2X6W A;  4F3Q A;  1P92 A;  1MJ9 A;  1BOB A;  4MEY F;  2F2E A;  2ME6 A;  2XAU A;  3IHU A;  1UHW A;  1EA3 A;  4PCQ A;  3GME A;  3B6A A;  3K70 C;  3O3K A;  5CVJ A;  5L3B A;  5BMZ A;  4ITV A;  3H0D A;  2JA2 A;  4EMS A;  3CCV I;  3S17 J;  4M9X A;  3WU1 B;  2DOD A;  1FLI A;  4JOM A;  3ZQG A;  3N05 A;  4A3K J;  2K9N A;  2HOA A;  3J80 K;  1RIO H;  5D4R A;  3SZG A;  5M3F J;  4IPA A;  2LOO A;  1OCC H;  1YIJ I;  2HDD A;  1Y1V J;  4RB1 A;  4RGS A;  2H6B A;  5ILU A;  1W5T A;  1DPU A;  4RA2 A;  1D5Y A;  3KX2 A;  2Y48 A;  1ZTR A;  2Y0S N;  2JN6 A;  3OSG A;  2ZME C;  4HEA 2;  3T8R A;  4KNY A;  1K4S A;  1K61 A;  4O6J A;  3VYU B;  2MD0 A;  2CMP A;  2JA8 J;  1ZH5 A;  3G3Z A;  5BS6 A;  2VI6 A;  4I98 B;  5EG0 B;  1UG2 A;  5CKT A;  1HA8 A;  4ZTJ A;  4DW6 A;  2E7W A;  2JQ7 A;  4BQO A;  1VTN C;  4LG0 A;  3GTL J;  1BL0 A;  1LB2 A;  3ABU A;  2CSO A;  3G1M A;  4CSW A;  3NWT A;  1WWX A;  3OL3 A;  3HHH A;  2QLZ A;  1E0E A;  2WTE A;  1BR1 A;  3A0B C;  1N77 A;  4XOT A;  4XLE A;  4F55 A;  4UY8 I;  3FHZ A;  2ESN A;  3OYH A;  5GAE J;  1JHF A;  3GYH X;  4FCY A;  2PG4 A;  2CQQ A;  5EZH A;  2HPM A;  4KN7 X;  4Q48 A;  4EV0 A;  1R1T A;  2P7V B;  4BU2 A;  4DYC A;  3QP5 A;  4DIQ A;  4I76 A;  2BXY A;  2IBD A;  1EV7 A;  5FLX K;  1PDN C;  2LP0 A;  2VPR A;  4M3F A;  4OAZ A;  4XLF A;  3R61 A;  3OWT A;  3BG3 A;  3VB2 A;  3HEF A;  5HNH A;  2WV1 A;  2NVY J;  4BXU A;  1TQI A;  1YJN I;  5BOX A;  1V55 H;  4KMF A;  4Q4Z F;  2HZD A;  2IXS A;  4EJO A;  3HOT A;  1G3Y A;  2VN2 A;  4BEH A;  1VQN I;  3K69 A;  1TNT A;  1QZZ A;  1X19 A;  2EIL H;  2KHM A;  1NG6 A;  3CES A;  3DFG A;  4WXC A;  3V8J A;  2BVL A;  1I3A A;  4BY1 J;  1JKQ C;  5FO5 A;  1QPM A;  3U2R A;  3KZY A;  1HDD C;  1T2K A;  3P9I A;  4I09 A;  5CQG A;  3OS0 A;  2LDU A;  3J81 K;  5J8C A;  1IW7 F;  1Z21 A;  4UV9 A;  1K6O A;  2HXI A;  5C44 J;  3LQR A;  1G3T A;  3H5N A;  4BQQ A;  2ECC A;  2XPU A;  4RGU A;  3FBN B;  1P7I A;  5GTH C;  3S1N J;  2XGC A;  1YQA A;  3KE2 A;  3RJP A;  3JRG A;  3BLY A;  1POG A;  4ZTF A;  2ELJ A;  4OOI A;  1FP1 D;  3L2R A;  2L0K A;  4W1U A;  2L5Q A;  4IHY A;  1P4X A;  4L18 B;  1HXD A;  1SD7 A;  2J5O A;  1YX3 A;  4NUB A;  3FXR A;  5F27 A;  4BBS J;  5JVT A;  3DLA A;  1JT0 A;  2R7T A;  3LAJ A;  4HF1 A;  4G7O F;  2VIX A;  2M45 A;  1S6L A;  2JWT A;  2AQE A;  2XAG A;  1MNE A;  3EPZ A;  3LFU A;  2YUS A;  2FOK A;  1MBJ A;  1FOX A;  1F43 A;  1U6G A;  5LFA A;  2KP6 A;  2W24 A;  5FKL A;  3NAR A;  1SVM A;  4XLA A;  4C3J J;  5LEK A;  4E7H A;  1BI2 A;  3SZP A;  3W6J B;  2ZXH A;  4B44 A;  2EV6 A;  2XAJ A;  4ZYA A;  4U0V A;  1WH5 A;  5GAG J;  2E71 A;  2VBY A;  4D0P A;  1XGN A;  3OYC A;  4LFU A;  4HW0 A;  2F4O B;  3KEO A;  4RM3 A;  5F1R A;  1G59 A;  1Y0N A;  3FK7 A;  2LR8 A;  3S1R J;  1VQM I;  3P9K A;  1XD7 A;  4UUV A;  2A05 A;  3NAU A;  4B3A A;  2MFZ A;  3BR2 A;  3CDL A;  4RB0 A;  1WKM A;  3C2B A;  4X0G A;  1PJR A;  1YS7 A;  2IJL A;  2JK3 A;  2DFH A;  1T33 A;  2HQN A;  2HTJ A;  3A01 B;  3KP4 A;  3H3U A;  3E3V A;  4B43 A;  3K4B A;  3I53 A;  4RAZ A;  3FDY A;  1OR7 C;  3DEW A;  2TCT A;  4JBA A;  5ICG A;  1APL C;  1R4N B;  1HST A;  3HHG A;  1GDT A;  1BN5 A;  1XTA A;  3WTX C;  2Y9Z A;  4I2O A;  1RET A;  2NRA C;  2HVR A;  2GIV A;  4XOR A;  2JVH A;  2RAE A;  5F04 A;  3GBG A;  3F3X A;  2OC6 A;  2HQA A;  5M5W J;  4NC7 A;  3QOE A;  4KDP A;  2RNJ A;  4G6D A;  4M3B A;  1MMG A;  2HYF A;  4XSZ F;  2XB0 X;  3JRB A;  4S04 A;  2KIF A;  4Y17 A;  3VDX A;  2MC4 A;  3K4M A;  3Q0W A;  3ZQH A;  2IA1 A;  2ZME B;  5GPC A;  5IP9 J;  5F0F A;  2ZBK A;  4P5O A;  2MLG A;  1P2F A;  4A0Z A;  1V5G A;  3OY9 A;  3OYL A;  2HVQ A;  3HDD A;  1ETW A;  2R92 J;  3GTG J;  2PJR A;  3F8M A;  4U0W A;  3JAM Z;  5FD5 A;  3HOZ J;  4C2M J;  1A36 A;  2L7F P;  1DP3 A;  2F6C A;  3GTM J;  1HOM A;  4LLG F;  3D0S A;  1JE8 A;  5H2F C;  5EYR A;  1B72 B;  2PEX A;  1MDM A;  2LF8 A;  2DA2 A;  4HSR A;  3F23 A;  5TJJ A;  1BIB A;  5EEG A;  3WE3 A;  3PJR A;  2DMQ A;  1IN6 A;  3R60 A;  2GXB A;  4MLO A;  1A6I A;  3QPL A;  1MND A;  2LNB A;  1SMY F;  2FBI A;  2PFB A;  5FRN A;  4WF2 A;  4IHS A;  2WY7 Q;  2M8G X;  3JRH A;  3CUQ A;  4AD9 A;  2O8K A;  2EFP A;  3I54 A;  3ROU A;  5GTI C;  5IOY A;  3WU2 C;  2ZFW A;  2M8E A;  4FX4 A;  3F8F A;  2VPL A;  3MKY B;  1VF9 A;  2Q8K A;  1YIO A;  1ZN2 A;  1JHH A;  2NS0 A;  5HLG A;  1LFP A;  3UKG A;  1BIA A;  1WJD A;  3GW2 A;  1FY7 A;  5FLM J;  4EJT A;  2LBF A;  2H8W A;  3F8C A;  3V8K A;  3F0C A;  4YIF A;  3PQK A;  2LH9 A;  4EJW A;  2DTZ A;  5JLX A;  4YEL A;  2OD5 A;  4P96 A;  3G71 I;  2A3S A;  3DV8 A;  2CQ7 A;  4P9U A;  3O6B B;  1OLT A;  4KT6 A;  3GZ5 A;  4LK0 F;  3FM5 A;  2PLY A;  2MA3 A;  5TRD A;  4KIT B;  4IX7 A;  2YX4 A;  2ACJ A;  1BOA A;  3H92 A;  2A5W A;  1Z77 A;  5LHH A;  5DUK A;  4I7H A;  4V19 K;  3F21 A;  3DBL B;  1B8I A;  3AG2 H;  3HZJ A;  4B09 A;  4DYR A;  1YW9 A;  3W2W A;  3TOB A;  1J9I A;  1I3Q J;  2E35 A;  1PUF A;  3E6M A;  1ULY A;  3KFW X;  2GXA A;  1MH3 A;  3FX3 A;  3ERE D;  2P5V A;  2Y30 A;  2RKH A;  3VOD A;  2DMP A;  4V2F A;  1DPR A;  2ID6 A;  3E6D A;  2CQN A;  3A1Y A;  2QBY A;  5FKO A;  3LSP A;  3HKZ A;  4YRV A;  1TZL A;  1VQ5 I;  5LRS A;  3ZQL A;  2X4H A;  3IV5 A;  2KRC A;  3K4K A;  4XON A;  1DU6 A;  2DFE A;  2HQR A;  3DKW A;  2R5Y A;  3TBI A;  1U2W A;  3MZ8 A;  2GA1 A;  2EZH A;  2P4W A;  1U9N A;  3CDI A;  4J01 A;  2IS2 A;  4E70 A;  1K83 J;  4RS8 A;  2DK5 A;  3RSN A;  2RV8 A;  2LSO A;  5HDG A;  5E3O A;  3AL0 C;  3ZQF A;  2EFW A;  1S9H A;  3CJQ B;  1KON A;  2IPQ X;  1WQ2 A;  4IRI A;  2DLL A;  1NK3 P;  2RC4 A;  3M07 A;  2IA2 A;  2XRL A;  1CF7 A;  1K7A A;  2VKH A;  3BPV A;  3SDG A;  1BI3 A;  2HXO A;  1MSF C;  3RKW A;  3G6E I;  1H9T A;  3HBL A;  4LLN A;  2L9N A;  5K5Q A;  1MIJ A;  2RN7 A;  1ZEL A;  2XC7 A;  1TWF J;  4F7Z A;  5HLT A;  3H9Q A;  2R7R A;  1AU7 A;  1Z0X A;  4KIC A;  3U21 A;  3BJA A;  2DYR H;  3DTE A;  3U1D A;  1R23 A;  5J40 A;  3VYT B;  4CIC A;  4ESB A;  3RQ4 A;  2R7Q A;  3CF5 F;  3JRE A;  1YJW I;  5FRM A;  4E7K A;  1BBY A;  2QA4 I;  2XVC A;  2HZT A;  1FOW A;  1BW6 A;  2LY1 A;  2L9S A;  3HSF A;  3H3Z A;  1JT6 A;  3EYY A;  4FT8 A;  1X3U A;  3QAH A;  4BHP A;  3EET A;  1VQ7 I;  2IRF G;  1WJA A;  1MJA A;  3C18 A;  4D1Q A;  2ZNY A;  5IY5 H;  2LKP A;  3V7R A;  3BZK A;  2CJJ A;  4NNJ A;  4D7M A;  3G1O A;  3HRS A;  1ZAO A;  4RAG A;  4Z6Y A;  2R7W A;  1H8A C;  1Z3X A;  4PSX A;  2JJ7 A;  2PI0 A;  3I4N J;  2UWM A;  3LL7 A;  2QQ8 A;  3KZZ A;  5DCF A;  3HUG B;  4M3D A;  4UB6 C;  1IXS B;  1FEX A;  1S7A A;  4IRH A;  2CFO A;  4UXN A;  4KN4 X;  5EGO B;  1LFB A;  1JJ8 C;  2DJN A;  1D5V A;  1WJE A;  2GA2 A;  2ZKZ A;  3R6S A;  2VLA A;  4LIT A;  1P4A A;  4HST A;  3JRA A;  3NEU A;  3OL4 A;  5IT3 A;  1K78 B;  3CTA A;  1ZGW A;  1AOY A;  3AG3 H;  3IUO A;  2ZSI B;  3QQA A;  5F6F A;  1I27 A;  3JCU C;  1E3H A;  3OR1 C;  4L9V A;  3GXO A;  1W7P D;  4XLH A;  3BR0 A;  5D6E A;  2Q2E B;  2B7E A;  4JX4 A;  5JI6 A;  4CXF A;  4XRS G;  4XK4 A;  2GLO A;  1XDU A;  4M71 A;  4CDG A;  4ETS A;  3BCA A;  3ZP5 A;  2X6Y A;  2HYG D;  3BJO A;  2LLK A;  2MAB A;  2KJB A;  3SQN A;  2FA5 A;  5DUI A;  4ZZD A;  3NQO A;  1WI3 A;  3IKV A;  4M73 A;  2ZJQ F;  1IN8 A;  1IN7 A;  3CZ6 A;  1I5Z A;  2PJP A;  4C2U A;  2Y69 H;  3BR6 A;  3E5X A;  1K4T A;  4U7D A;  3OYM A;  1MBG A;  1TW2 A;  1Y0U A;  1X1D A;  3J7Z I;  2B63 J;  2X1E A;  4PFO A;  4UUS B;  3S3O A;  5F0H A;  4RDU A;  1WJB A;  1VQL I;  2CH0 A;  2K86 A;  1EKE A;  4QWQ A;  3BZ6 A;  1A5J A;  2AXL A;  4GCV A;  1DU0 A;  2DOA A;  3BQY A;  3V7S A;  1C0W A;  4ZJZ A;  5IPA A;  2ZJR F;  2ZFU A;  1AHD P;  2V9V A;  1TWA J;  1MGT A;  5GAH J;  3ZPL A;  3L00 A;  1U0J A;  3LQQ A;  2HKX A;  5FB2 A;  5GPA A;  3I58 A;  4IJA A;  3ZN0 A;  4WX9 A;  2KLO A;  4KJZ A;  4BDZ A;  4B48 A;  3K1P A;  3VFZ A;  4MO7 A;  1J0R A;  2IVM A;  1FTZ A;  1T6S A;  3O8G A;  3IRR A;  2O5R A;  4AYB A;  1ZG5 A;  1U5T A;  3JR9 A;  5IYD J;  2O0Y A;  4RMN A;  4JYK A;  2FU4 A;  2MSY A;  1R7J A;  1IN5 A;  4JP0 A;  5TIS C;  4BL0 B;  3I59 B;  1DUX C;  3E6C C;  1W5C C;  2WA0 A;  4LK1 F;  3BTI A;  2KZG A;  3GZN B;  1W5S A;  4QPQ A;  1G6N A;  4I01 A;  1YYV A;  2D1V A;  2EIK H;  5DEQ A;  2F5F A;  1X3W B;  4UB8 C;  4HLX A;  3QYB A;  2D1H A;  2LYC A;  1D0X A;  1JKR C;  2RQQ A;  1NHA A;  4HNV A;  3R0J A;  4HDU A;  3M8F A;  1FPQ A;  3GTJ J;  1JGG A;  3KP7 A;  2OZU A;  1WH7 A;  1JKP C;  2OZ6 A;  2W57 A;  1DGW Y;  2NS7 A;  3TO6 A;  3BR3 A;  4IZZ A;  4A3J J;  4IHX A;  1J2X A;  4BHC A;  5CJ9 A;  1V3F A;  2W48 A;  2RGV A;  1MNM C;  2VAS A;  3RIR A;  3BRO A;  1S3J A;  2BYV E;  2MW8 A;  2NYX A;  2F4I A;  3ONQ A;  2WAE A;  1Z7L A;  3BC8 A;  1ETY A;  4M3E A;  4Y13 A;  5L3G A;  4A3C J;  5IYB J;  4IEJ A;  2KPM A;  4MFD A;  5CVV A;  3PFI A;  2QWW A;  3WHC A;  1YTY A;  4IQ4 A;  4GYI A;  2VXD A;  3OOU A;  1I1S A;  1FBS A;  1L0O C;  1V5E A;  2BW3 A;  2KIM A;  5TGT A;  3AL0 B;  4CCO A;  4R79 A;  2ZXI A;  4FET A;  4D7N A;  4QSH A;  1OCO H;  3K4L A;  3CD6 I;  2L4A A;  1U8B A;  3KLN A;  1J59 A;  3EYI A;  2PMU A;  3ABT A;  3GFI A;  1RPW A;  2VBW A;  1QNT A;  4R1H A;  2OCC H;  2R7V A;  2L9V A;  5EG0 A;  1SFX A;  4ZYG A;  2AQF A;  2LG4 A;  1T95 A;  1MW7 A;  3OYA A;  2ZSH B;  4WWC A;  2R5Z B;  1QRY A;  4LJZ F;  5ILV A;  3MEX A;  1H89 C;  3F6V A;  2XSD C;  4KIS A;  4A5M A;  3REO A;  3JAM K;  5E8G A;  1W0T A;  3MN2 A;  1S7O A;  1HDP A;  2R3S A;  5CPR B;  4IHT A;  2A61 A;  3GX4 X;  2ZB9 A;  3E5U A;  3RQI A;  2O7O A;  1TWG J;  2E1O A;  3F8B A;  4EJV A;  4B8X A;  1GVD A;  1R71 A;  5ED4 A;  4BS9 A;  1PYV A;  4Y15 A;  3E1S A;  1M1E B;  3R0A A;  5LGN A;  2L2O A;  2UXN A;  4CCL A;  2XGD A;  3OS2 A;  3PO2 J;  2HU9 A;  2QM3 A;  2IS1 A;  1RKT A;  3M3Y J;  4A69 C;  4IVN A;  2YX7 A;  1FSE A;  4LIU A;  2E2J J;  1T0F A;  3BCB A;  4KMU X;  1EH7 A;  1OQY A;  3W2A A;  1D1B A;  2FF4 A;  3FHN A;  2R4G A;  3M1E A;  4Q5S F;  1FWZ A;  1IRG A;  2LY2 A;  3BPX A;  3DKY A;  5LGT A;  3BR5 A;  2O61 A;  4AC0 A;  2CS3 A;  4EGY A;  2R7O A;  2ELH A;  3DEE A;  3DLL F;  1GUU A;  2P7C B;  5J6X A;  4G9Y A;  3TP0 A;  2DQL A;  1LE8 B;  1IO2 A;  2ICW G;  1HCR A;  3CC2 I;  1YI2 I;  2K9Q A;  2VC1 A;  2E1C A;  4LB5 A;  2G7U A;  4XKV A;  3ZCO A;  1GV2 A;  3MQ0 A;  1EF4 A;  1HKQ A;  2DA4 A;  2VB6 A;  3VEP A;  2H94 A;  2VQH A;  3PNT A;  4MTE A;  2CO5 A;  2DJI A;  3FXQ A;  1VZ0 A;  2GZW A;  5A2Q Z;  3QU6 A;  5K5R A;  2E5N A;  4XNF A;  3DU5 A;  2P5K A;  4CZC A;  5AON A;  4E7L A;  2BE5 F;  4RAF A;  2VT3 A;  3RKX A;  1ZG1 A;  1X4P A;  1HLV A;  3RZO J;  3CMM A;  3IC7 A;  2WY8 Q;  4L0Y B;  3I0T A;  1D1A A;  5KVR A;  3TW6 A;  3QOP A;  2M4G A;  3TDZ C;  3H0G J;  3LSH A;  4ENJ A;  5H6R A;  3CC7 I;  3HSR A;  2HPI A;  2OUM A;  3C1D A;  1EH8 A;  4OWR B;  2CGP A;  3T8T A;  1N25 A;  2VKE A;  2I10 A;  3BDD A;  3H35 A;  2LKS A;  2M2E A;  3PNY A;  3PL8 A;  2HOS A;  2LK2 A;  3MMY B;  2FD5 A;  3CME I;  2DDB A;  4XL9 A;  2KFD A;  1UB9 A;  1MBF A;  3HKZ N;  4OIN F;  5FKK A;  2DU9 A;  3RKQ A;  3WGI A;  3GO5 A;  3HB9 A;  3EUA A;  4A3D J;  1JJ6 C;  5B1A H;  3MFK A;  2Y75 A;  4N9I A;  2QYO A;  1A6Q A;  1X1B A;  1JGS A;  1FYK A;  2M34 A;  4XLN F;  2CV2 A;  2QSH X;  3HPG A;  2VOP A;  4LIV A;  3HM5 A;  4RGX A;  4C3I J;  3GFM A;  1L3L A;  2XSJ C;  3I56 I;  2BHZ A;  2OV7 A;  4NQW A;  2Z16 A;  5GP9 A;  2HI3 A;  4J00 A;  1B59 A;  3HGG A;  2MH9 A;  2X85 A;  4U88 A;  3ECH A;  3GTO J;  1ETQ A;  4G94 A;  2Z5U A;  4IF4 A;  4S0H B;  4J19 A;  1ORK A;  2IAI A;  4KUM A;  3PIP F;  3OIO A;  3L2Q A;  5LGU A;  4YG2 F;  1RR8 C;  1X2N A;  3HIF A;  2JPB A;  3FWE A;  3SDB A;  4R8H A;  4BBR J;  1FNN A;  3CCU I;  3ECO A;  5ICC A;  1Z05 A;  4DZP A;  2BZT A;  1KU7 A;  4HNU A;  2AS5 F;  1USS A;  3K10 A;  2NVX J;  3KP3 A;  1KU9 A;  2KIU A;  2P81 A;  3SHF A;  2BHY A;  1PUE E;  2IS6 A;  1OCR H;  2BGC A;  2DPD A;  2QSG X;  1B6A A;  3A01 A;  4BE0 A;  5J8F A;  4BHB A;  4MIM A;  1KQ8 A;  1BI1 A;  1HW5 A;  4PSW A;  2JRM A;  4YFK F;  3BG5 A;  4XQF A;  2V9P A;  1ZRF A;  2H27 A;  2JA7 J;  2Z2S B;  4GDF A;  4MEX F;  5DYM A;  4L0Z B;  1VI0 A;  2DN0 A;  1YOV B;  3JSO A;  1Z3Y A;  1ZK8 A;  2VJI A;  4CHU A;  1YRN B;  4OU0 A;  4ASN A;  1ODD A;  2OAZ A;  4QTR A;  2NXN B;  3MCZ A;  4EAT A;  4DYQ A;  1ZKG A;  5CLS A;  2OPT A;  2R7D A;  3Q9V A;  4JX6 A;  3JRD A;  2QF7 A;  1IN4 A;  1V5F A;  1TQP A;  1HW2 A;  2FQ3 A;  2ZME A;  3SFI A;  2KJC A;  3BWG A;  1GHC A;  3RCO A;  2FNP A;  1QPI A;  1ACI A;  3QU3 A;  3KET A;  1LDK B;  1JI8 A;  3O2P E;  4U87 A;  4DNC A;  2FNA A;  2FOW A;  3ZGK A;  1P6R A;  5DV5 A;  4E7I A;  3GTQ J;  4FX0 A;  2EPF A;  2DA3 A;  1K6Y A;  3FXM A;  5FLV A;  1WZ2 A;  5K7H A;  4N4O B;  2X51 A;  2CU7 A;  3V8L A;  4A0Y A;  1HC8 A;  1E2X A;  2JRT A;  4XOP A;  4L9J A;  3TO9 A;  1GT0 C;  4PDK A;  3VSK A;  2O6G E;  2ZC2 A;  1BM9 A;  5M5Y J;  2TRT A;  4HZF A;  1T08 B;  2VL8 A;  2QUF A;  3DF8 A;  4TV7 A;  4N4N B;  1BJZ A;  1ZRC A;  4K2E A;  4Y52 J;  4MTD A;  2GXG A;  1U78 A;  3JRI A;  1ENH A;  1YFH A;  2R7U A;  3JRC A;  1TWC J;  2ADU A;  1J75 A;  5D5U B;  3KEQ A;  2DPU A;  2RRE A;  3ZMV A;  2L01 A;  4KIG A;  4BXX J;  2B9S A;  3I3L A;  3PIO F;  1D8K A;  3J7Y J;  5C4X J;  5IP7 J;  3S2D J;  4ZDO A;  3HXL A;  3S1Q J;  3M1C A;  3UNG C;  4E7Z A;  1XMK A;  2FBH A;  4KIF A;  2X1C A;  4BJ6 C;  4AYB N;  3C3W A;  5GAD J;  3SFZ A;  1XSX A;  2EK5 A;  4MNU A;  1GLN A;  2E1M C;  2ELK A;  1VQ6 I;  3M7G A;  3M4O J;  3MVP A;  4Z2Y A;  3DEU A;  4F93 B;  3JTH A;  1ZLJ A;  2A6T A;  3GLL A;  1LKX A;  3KIO A;  4XRF A;  1EH6 A;  3TW7 A;  1BR2 A;  1TNS A;  4N9H A;  1J5Y A;  3GTP J;  1O3S A;  3EUH A;  3W2V A;  3AG1 H;  2WAF A;  3A4C A;  2DMN A;  3FK6 A;  3HSE A;  4GRI A;  4BNC A;  2F5C A;  1LNW A;  1S29 A;  5KK1 A;  5FRO A;  2E36 A;  4Y4R A;  3DBR B;  1FMW A;  2M87 A;  5LHG A;  3DPT A;  5CVI A;  4YEJ A;  2Z99 A;  4EM0 B;  4RB2 C;  2STT A;  2AXT C;  4CGZ A;  2GWR A;  4A3E J;  2XDV A;  3CCE I;  1R1V A;  5H6Q A;  2K9M A;  4BY7 J;  3K4C A;  1G8X A;  4PJN A;  3TMO A;  3MKW B;  3FIS A;  4A3F J;  1STZ A;  2GBY A;  3CO7 C;  2X48 A;  5EEH A;  2VOO A;  5M5X J;  5FKN A;  3QP6 A;  4G6Q A;  5DD4 A;  1HF0 A;  3ZQQ A;  5D5W B;  1R00 A;  3ABK H;  4HQM A;  2KRF A;  5JVG F;  4G6T B;  1J09 A;  1MBH A;  3AKZ A;  3GTK J;  4PGG A;  1MMA A;  3S14 J;  2CG4 A;  3FXJ A;  2HDW A;  2PJR B;  1RC9 A;  3PM1 A;  1MH4 A;  5HOD A;  2DW4 A;  3OYF A;  1XX5 A;  4U0Y A;  3B73 A;  4Y33 A;  4OIP F;  4HA8 A;  4DJA A;  3HTS B;  1Q1H A;  3S93 A;  4FAS D;  4BGD A;  2BVM A;  1R5G A;  3PFY A;  2EQR A;  3BT9 A;  3I4P A;  3CCQ I;  1YW7 A;  2BY3 A;  1JUM A;  5K7F A;  4E7S A;  1W7P B;  4YFX F;  1X1A A;  4ZYE A;  3BQZ A;  4CCM A;  3ZXS A;  2FUG 2;  1JTY A;  1U8R A;  3ULQ B;  2COM A;  5K1Y A;  2EFQ A;  2DAO A;  1YJ9 I;  2VKD A;  2KIS A;  5J1U A;  2FEZ A;  3IH4 A;  3FXU A;  1KA8 A;  2VQL A;  2HKO A;  3S15 J;  3S3N A;  1DP7 P;  2L3D A;  4G12 A;  1OCT C;  2CUE A;  1IXC A;  3MZY A;  3A0H C;  2NOJ B;  2DMU A;  5LRR A;  3SEZ A;  3ZMT A;  4BAY A;  2NVT J;  4KFC A;  1YS6 A;  3DBH B;  3LSK A;  5IP6 A;  2JSP A;  4A6D A;  2VE9 A;  2EV5 A;  2ISY A;  1O4X A;  2H6C A;  3IH2 A;  2O03 A;  3BG7 A;  3H5A A;  3VYR B;  1Z9C A;  1OYY A;  4PFP A;  3LOC A;  1LFU P;  4HX4 A;  4RLQ A;  1AKH A;  1TP4 A;  3HUG A;  3KPH A;  3G73 A;  4CCJ A;  3G1L A;  3I64 A;  3WTV C;  3WG9 A;  2HYJ A;  3I5U A;  3IP4 B;  1AA7 A;  3BG6 A;  3OV8 A;  1I6H J;  1B8I B;  3CDH A;  3PSF A;  2EIJ H;  4I0A A;  1K78 A;  4WXH A;  4HX8 A;  1O7L A;  2KT0 A;  3QWL A;  4HV5 A;  3FXL A;  2OU2 A;  4C3H J;  3S8P A;  3FMR A;  1N75 A;  1OYW A;  3S3M A;  1YIT I;  2GIZ A;  1W1W E;  2CYY A;  3OS1 A;  1YX5 A;  2DYS H;  4RM2 A;  3RDI A;  3LFK A;  2M7A A;  1U3E M;  5J4V A;  4ZDP A;  2WAQ A;  1H0M A;  1R36 A;  3OYI A;  1XDS A;  1YLF A;  2BY1 A;  4OMY A;  2HQ5 A;  3D5R C;  2K3P A;  1OPC A;  1Y6I A;  4CYC B;  2IGO A;  2V1U A;  3FMS A;  4UVA A;  2JTV A;  3MKZ A;  2R5Y B;  1SVL A;  4IQJ A;  1Q1V A;  3O8H A;  5A2Q K;  2VJ4 A;  4XBF A;  1TTY A;  1HBX G;  3C7J A;  2LRE A;  1D0Y A;  1N78 A;  1Y1W J;  4UUS A;  3JRF A;  5KHD A;  4XM3 A;  2L9R A;  1UHS A;  2R7Z J;  4G8X A;  5JR3 A;  1VFC A;  2DFF A;  5L3F A;  2GAU A;  3GZ6 A;  2Y2Z A;  4NC8 A;  2JSC A;  2XKP A;  2A07 F;  5ICF A;  1TL8 A;  3RYR A;  3H1C A;  5F1J A;  2EZI A;  4LLL A;  2V1N A;  1A04 A;  4FHT A;  5IT9 Z;  3KCC A;  3MZH A;  2IT0 A;  1S8N A;  5KCM A;  4M9Z A;  2UV1 A;  5LD2 C;  4AU7 A;  1SFO J;  1B9M A;  1BC8 C;  1XMA A;  1IRF A;  2M3A A;  4QLC U;  2ZNZ A;  2PMZ A;  2E1M B;  1OFC X;  5J1Y A;  2Y31 A;  1T98 A;  4AWX B;  4L5I A;  2LD5 A;  3ZMS A;  1O3Q A;  2K3F A;  2KL4 A;  1QHH D;  3IL2 A;  3I59 A;  3RZD J;  4BJ5 C;  1LJ9 A;  2HWV A;  1X1C A;  3HRM A;  3RPQ A;  4E7J A;  2QVO A;  4P9F A;  2FXA A;  1Y56 A;  1R1U A;  2EZK A;  2KDZ A;  4EM2 A;  3IWF A;  1YE9 A;  1SVO A;  5FFX A;  4HPQ A;  2LTP A;  3PUB A;  5EEA A;  3J7A O;  2YU3 A;  5CQE A;  2FE3 A;  2VBX A;  3TED A;  3EUK L;  2D45 A;  2Z3Y A;  3RI4 A;  2QKL B;  3ZMD A;  2TDX A;  1T0F C;  4A3G J;  4ABZ A;  1A35 A;  2ECB A;  4CZZ A;  5D6F A;  1WSU A;  5FFZ A;  4H4K C;  4LG3 A;  3HC7 A;  3S2W A;  2DK8 A;  3Q0U A;  5ILS A;  4XKW A;  4RBO A;  3WGG A;  1XN7 A;  1FIA A;  4Q47 A;  5F0C A;  2EFO A;  1LEB A;  1ZRD A;  3WTW C;  2VJJ A;  3CO6 C;  1YG2 A;  4EJU A;  1UST A;  1JTX A;  3BOQ A;  2WB1 N;  1WJF A;  1LUJ B;  1SFU A;  1OJL A;  3ZMZ A;  4HQE A;  4D5F A;  4CO8 A;  1XPX A;  1NH3 A;  4NDL A;  5CVR A;  4MQ9 F;  3D1N I;  3HOU J;  3LWF A;  2LFB A;  2XGX A;  2XPV A;  3LST A;  3CCY A;  2E19 A;  2DXI A;  1ZAR A;  3PO3 J;  1LEA A;  3D5S C;  5HS9 A;  4UVC A;  4GGG A;  4NHJ A;  1KQ0 A;  1WVR A;  3E6B A;  4M9S A;  4NBQ A;  3HTU A;  4ESF A;  3WTZ A;  2HR3 A;  4ANJ A;  5HLI A;  2NAZ A;  5H20 A;  5M3M J;  1MKM A;  1TWH J;  2VXZ A;  3BZC A;  1Z91 A;  1E17 A;  2V26 A;  2WC2 A;  4F52 A;  3Q5F A;  1KGS A;  3BJ6 A;  1QZY A;  4EM1 A;  2E1N A;  1W36 D;  2DFI A;  2YPR A;  1QVU A;  4D5C A;  1W4M A;  2G7H A;  2IA0 A;  4PJL A;  3DP7 A;  3I71 A;  1JUS A;  1U9O A;  1BW5 A;  3H5R A;  3CUO A;  3LSM A;  2Q1Z B;  2Z33 A;  2H1K A;  1XGO A;  3IAS 2;  2NNY A;  2LRD A;  3U1K A;  3BTJ A;  3WU0 A;  3T5X A;  2HNH A;  3HOS A;  2G0E A;  3A2K A;  3FBI B;  1FJL A;  2LC2 A;  2MGQ A;  1XGS A;  1KYZ A;  1I1G A;  3CCS I;  3CP2 A;  1VQK I;  4DZJ A;  2N8G A;  1GVJ A;  2JUG A;  2LF7 A;  5BPD A;  4FQG A;  2K5C A;  3ZOB A;  1RI7 A;  2F5D A;  3BTC A;  1S5L C;  2OTJ I;  2LY9 A;  2NS8 A;  1B1B A;  1QZE A;  2DT7 B;  2K9S A;  2PBI A;  5BNG A;  3OIQ A;  3HOV J;  1XG1 A;  3L1P A;  1LE8 A;  3K6G A;  1IGN A;  4A3L J;  3ASO H;  4DBR A;  3QYE A;  4L9N A;  1IF1 A;  5D5X B;  4MHG A;  2ZO4 A;  1ZHF A;  4A6E A;  1PVE A;  4PJJ A;  4B3X A;  1R49 A;  4WXD A;  2PX9 A;  5DCM B;  2VON A;  5B3S H;  2HDC A;  2RNG A;  2J5P A;  4ENN A;  3GFL A;  2XUB A;  1CGP A;  2DA6 A;  5ERI A;  3F8N A;  5DS9 A;  1GXQ A;  4DOZ A;  1TBX A;  4F92 B;  2XAH A;  2YSR A;  2CQK A;  2W84 A;  2I8D A;  2Y0M A;  4A12 A;  4BE1 A;  2XIG A;  3A02 A;  1IV8 A;  4Y3O A;  4HNT A;  1REP C;  1SFK A;  2BXZ A;  2YR2 A;  5JFR A;  5J1R A;  1I50 J;  2FQ4 A;  2V6E A;  3VOE A;  3ZQI A;  2WWY A;  4II3 A;  1KU2 A;  4BUP A;  1P7J A;  1VQO I;  2XHK A;  2W7N A;  1ZR4 A;  1R6R A;  1JKO C;  2NOG A;  3CC4 I;  2BW3 B;  2VT2 A;  1BC7 C;  4XR6 A;  4F91 B;  4IKF A;  2F5E A;  2UUZ A;  4A93 J;  3TDU C;  1JUP A;  2K40 A;  3X2Q H;  1ETK A;  2JPC A;  4ZZL A;  2W4S A;  3FF5 A;  1R58 A;  5HLH A;  5CVU A;  5LBQ A;  4NB5 A;  4XIC A;  3LNQ A;  3PUF A;  1ZGA A;  1ITY A;  1YW8 A;  3SJM A;  4C2T A;  4BYY A;  1BA5 A;  1Y8R B;  1G2H A;  2Z9O A;  2BBY A;  5E1W A;  2QEX I;  3TKY A;  2R7F A;  2RQP A;  2A6H F; 
#chains in the Genus database with same CATH homology
 1FTT A;  1DU6 A;  1RES A;  1GT0 C;  2M9H A;  2R5Y A;  3FKI J;  4B4C A;  2LVS A;  2HOT A;  5M5Y J;  3S2H J;  2ID3 A;  2TRT A;  2DA1 A;  2EZH A;  1U9N A;  5EF6 A;  5J3L A;  1K83 J;  4X6A J;  2X6O A;  1BJZ A;  4Y52 J;  5E3O A;  4XRS A;  3ZQF A;  3LSG A;  1U78 A;  1NK3 P;  5IYC J;  4A3I J;  3JRI A;  2XRL A;  1ENH A;  1IJW C;  1XC5 A;  3SDG A;  2HXO A;  5DTD A;  3JRC A;  1MSF C;  3B6C A;  1TWC J;  3HBL A;  3Q3S A;  1ZQ3 P;  3TP3 A;  4I6Z A;  2FJ1 A;  5C4J J;  4BXX J;  1MBE A;  1TWF J;  3WHB A;  5C4X J;  1AU7 A;  3BR1 A;  1Z0X A;  5IP7 J;  2R5Z A;  4FTH A;  3S2D J;  5K7Z A;  2CRG A;  3S1Q J;  3JRE A;  4AYB N;  1IRZ A;  2JMW A;  1BW6 A;  2ELK A;  2XB5 A;  3MVP A;  3HOY J;  1JT6 A;  3K2A A;  3TW7 A;  3A03 A;  5IOZ A;  1T56 A;  3GTP J;  4IHW A;  2CJJ A;  3FK6 A;  2DMN A;  5F08 A;  3CQZ J;  4D7M A;  1YRN A;  3G1O A;  1H8A C;  2L7M P;  2JJ7 A;  3I4N J;  1IDY A;  4M3D A;  2D5V A;  3HOW J;  1FEX A;  5EGO B;  1X2M A;  1LFB A;  4A3E J;  2DJN A;  1JJ8 C;  4BY7 J;  4B1R A;  3JRA A;  2IEK A;  3FIS A;  2EH3 A;  4AUX A;  4A3F J;  1ZGW A;  2GBY A;  3QQA A;  2H8R A;  2VUM J;  2X48 A;  3LSJ A;  4MFE A;  3HOX J;  5M5X J;  5FKN A;  3BR0 A;  4JX4 A;  2LKX A;  1HF0 A;  2WAQ N;  2R93 J;  1XS9 A;  4XRS G;  4XK4 A;  2GLO A;  1MBH A;  2ME6 A;  3GTK J;  3S14 J;  2LLK A;  2CUF A;  1ETX A;  3B6A A;  1WCM J;  3PM1 A;  1MH4 A;  1IV6 A;  5HOD A;  1R9T J;  1WI3 A;  3S17 J;  3ZQG A;  4A3K J;  2K9N A;  2HOA A;  3BT9 A;  2EQR A;  3BR6 A;  4FE4 A;  1JUM A;  1MBG A;  5K7F A;  4GFB A;  2B63 J;  5M3F J;  2DA7 A;  4UUS B;  3ZQC A;  1E3O C;  5F0H A;  4RDU A;  2HDD A;  1Y1V J;  2DA5 A;  4EEF G;  1D5Y A;  1A5J A;  3BQZ A;  1ZTR A;  1DU0 A;  2Y0S N;  2JN6 A;  3OSG A;  1JTY A;  3BQY A;  5IPA A;  1AHD P;  1K61 A;  1TWA J;  1FIP A;  3IH3 A;  4L5E A;  3BG9 A;  2VI6 A;  2JA8 J;  2NVQ J;  5EG0 B;  5J1U A;  1UG2 A;  5GPA A;  3IH4 A;  4DW6 A;  4MO7 A;  3GTL J;  1B72 A;  1BL0 A;  2R0Q C;  3S15 J;  3G1M A;  2PMZ N;  1FTZ A;  3O8G A;  4G12 A;  3K7A J;  1OCT C;  2CUE A;  4FIS A;  1F36 A;  2DMU A;  3JR9 A;  5IYD J;  2NVT J;  4JYK A;  5IP6 A;  1O4X A;  2MSY A;  3IH2 A;  4JP0 A;  1MBK A;  4QIW N;  4FCY A;  3BTI A;  5JLW A;  2CQQ A;  5EZH A;  3LOC A;  1LFU P;  3W6V A;  1AKH A;  2DMT A;  2AO9 A;  3G1L A;  4DYC A;  1GV5 A;  2HYJ A;  1I6H J;  4I76 A;  1B8I B;  1JKR C;  2IBD A;  3MKL A;  1IG7 A;  4HNV A;  2LP0 A;  2VPR A;  4M3F A;  2X9D A;  3BG3 A;  3GTJ J;  1JGG A;  2KT0 A;  1NK2 P;  4C3H J;  3HEF A;  2WV1 A;  5FKM A;  2NVY J;  1WH7 A;  1JKP C;  3E7L A;  1VND A;  2NS7 A;  4A3J J;  3BR3 A;  4IHX A;  1IC8 A;  2W48 A;  1MNM C;  2JA5 J;  1H88 C;  2MW8 A;  3I4M J;  4XID A;  2HQ5 A;  1ETY A;  4M3E A;  4A3C J;  5IYB J;  4IEJ A;  4BKX A;  4BY1 J;  4CYC B;  4MFD A;  1JKQ C;  2R5Y B;  3WHC A;  1UMQ A;  1Q1V A;  3O8H A;  3OOU A;  1HDD C;  3S16 J;  1Y1W J;  4UUS A;  3JRF A;  4D7N A;  2HXI A;  5C44 J;  4QSH A;  2L9R A;  1UHS A;  2R7Z J;  2E2H J;  1U8B A;  1VFC A;  2ECC A;  2XPU A;  2Y2Z A;  1P7I A;  3S1N J;  2XGC A;  1RPW A;  3JRG A;  1POG A;  1W0U A;  5F1J A;  3FIW A;  2EZI A;  5EG0 A;  2L0K A;  4W1U A;  4A3M J;  4IHY A;  2JA6 J;  1SFO J;  2R5Z B;  3LSR A;  1QRY A;  5F27 A;  4BBS J;  1H89 C;  1JT0 A;  1TC3 C;  1IUF A;  2XSD C;  5EDN A;  1OFC X;  2JWT A;  5J1Y A;  2Y31 A;  3MN2 A;  1W0T A;  1HDP A;  2YUS A;  1MBJ A;  2LD5 A;  1F43 A;  2ZB9 A;  3RQI A;  2O7O A;  1TWG J;  2E1O A;  4X1E A;  1RKW A;  5FKL A;  3NAR A;  1GVD A;  3RZD J;  1CQT A;  2FX0 A;  4C3J J;  5E3N A;  2EZK A;  2KDZ A;  4M6V A;  2XGD A;  1RR7 A;  4V2G A;  3PO2 J;  2LTP A;  1WH5 A;  5EEA A;  1RKT A;  3M3Y J;  4XRM A;  3TED A;  4A69 C;  2E2J J;  4A3B J;  3HGY A;  3FK7 A;  2LR8 A;  3S1R J;  4A3G J;  3BR5 A;  4ABZ A;  4AC0 A;  2ECB A;  3NAU A;  4B3A A;  3BR2 A;  3CDL A;  1GUU A;  3C2B A;  3Q0U A;  3TP0 A;  2JK3 A;  1LE8 B;  2XPW A;  2Y9Y A;  1HCR A;  1T33 A;  2CQX A;  4RBO A;  3A01 B;  1FIA A;  2K9Q A;  5F0C A;  1GV2 A;  1EF4 A;  2DA4 A;  2L7Z A;  3DEW A;  2TCT A;  1JTX A;  1APL C;  2WB1 N;  1GDT A;  4CYC A;  1OJL A;  2Y9Z A;  1RET A;  2MG4 A;  4D5F A;  1NTC A;  4NDL A;  5F04 A;  2RAE A;  3M4O J;  2OF7 A;  3GBG A;  4JX5 A;  3D1N I;  5EGO A;  4W97 A;  3HOU J;  2XGE A;  2LFB A;  2XPV A;  5M5W J;  3CCY A;  2E19 A;  1HLV A;  3RZO J;  2COB A;  3PO3 J;  2YS9 A;  3TW6 A;  4M3B A;  3S1M J;  2E2I J;  3JRB A;  2XB0 X;  3H0G J;  3Q0W A;  3Q0V A;  3ZQH A;  1PUF B;  5GPC A;  1WPK A;  5IP9 J;  5F0F A;  2VKE A;  1ETV A;  2I10 A;  3BTL A;  2M2E A;  5M3M J;  1TWH J;  2HOS A;  2LK2 A;  2FD5 A;  3HDD A;  1ETW A;  2R92 J;  3GTG J;  1MBF A;  3HKZ N;  5FKK A;  3RKQ A;  3HB9 A;  4A3D J;  3HOZ J;  4C2M J;  1JJ6 C;  2L7F P;  3GTM J;  1HOM A;  5E3L A;  3VPR A;  1QVT A;  2M34 A;  5EYR A;  1QVU A;  4D5C A;  1B72 B;  2VKV A;  2DA2 A;  3HM5 A;  1JUS A;  4C3I J;  1U9O A;  1BW5 A;  2DMQ A;  2H1K A;  4M3G A;  4MLO A;  1A6I A;  3QPL A;  1IDZ A;  5GP9 A;  3H3V K;  3BTJ A;  2HI3 A;  2O9L A;  3HGG A;  2AHQ A;  2G0E A;  2M8G X;  2EZL A;  3JRH A;  2GM4 A;  3GTO J;  1ETQ A;  1FJL A;  2MGQ A;  1SAN A;  2O8K A;  4S0H B;  5IOY A;  4J19 A;  1ORK A;  2IAI A;  4Y7N J;  3OIO A;  1WGX A;  1AKH B;  4DZJ A;  1VF9 A;  2N8G A;  1X2N A;  2EBI A;  2QCO A;  3ZOB A;  4BBR J;  3UKG A;  3BTC A;  4DZP A;  2LY9 A;  1MSE C;  2NS8 A;  5FLM J;  2K9S A;  3F0C A;  5BNG A;  2NVX J;  5EZG A;  1XG1 A;  2P81 A;  3HOV J;  1S7E A;  3L1P A;  1LE8 A;  1IGN A;  4A3L J;  3A01 A;  5E3M A;  2DTZ A;  5JLX A;  4MIM A;  4IHV A;  2M0C A;  3BG5 A;  1ETO A;  2DA6 A;  2JA7 J;  5DS9 A;  3QPS A;  1VI0 A;  2DN0 A;  1OCP A;  3A02 A;  3OSF A;  1ZK8 A;  1Z77 A;  4LOC A;  1YRN B;  5C3E J;  1X58 A;  1ZR2 A;  3DCF A;  5J1R A;  1I50 J;  2FQ4 A;  4QTR A;  2YU9 J;  3ZQI A;  4UUT A;  1B8I A;  4DYQ A;  4DYR A;  1ZKG A;  1P7J A;  2OPT A;  4JX6 A;  1ZR4 A;  1JKO C;  1I3Q J;  2NOG A;  3JRD A;  2QF7 A;  3CMY A;  2ME0 A;  1PUF A;  4A93 J;  3SFI A;  1MH3 A;  1JUP A;  2K40 A;  9ANT A;  1ETK A;  1QPI A;  2Y30 A;  2DMP A;  4V2F A;  2ID6 A;  5FJ8 J;  3LNQ A;  4XIC A;  1ITY A;  3GTQ J;  3SJM A;  5FKO A;  3LSP A;  1BA5 A;  4FE7 A;  1G2H A;  2DA3 A;  5FLV A;  5K7H A;  2CU7 A;  3ZQL A;  3IV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...