3M4OK

Rna polymerase ii elongation complex b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3m4oK00
2CW0A 4XSZA 4YFNA 2E2HC 2NVQK 5C4XC 2JA5C 5FJ8K 4A3BK 5IYBC 5FLMC 1K83K 4A3FC 4BXXK 4A3GK 5IP7K 4Y7NK 4QIWD 4A3JC 2R7ZC 2B63C 5C3EC 5IYCC 3M3YK 2A68A 3S15K 1Y1VC 3M4OC 4A3CK 2PMZD 2YU9K 4BBRK 3GTLC 4BY7K 2A6HA 3CQZC 3S1RC 4KN4A 3H3VD 4KN7A 1TWHK 4A3EK 1I6HK 3HKZD 2WAQL 3S16C 4A3DC 4G7ZA 5IP9C 4Y52K 3HOWC 5IYDK 3GTKC 4BBSK 2WB1L 3GTMK 3GTGC 5D4DA 3S1NC 1YNJA 2JA8K 1SMYA 3HOUK 1TWGC 5C4JC 5M5XK 1R9TK 2NVTK 4XLPA 3S14C 4YFXA 2NVXK 1HQMA 4LJZA 3I4NK 4YFKA 3S2HK 3GTJK 3RZDC 4MQ9A 5C4JK 1WCMK 1R9TC 4Q5SA 1TWGK 2JA7C 2R93K 1TWFC 4A3LK 2R93C 3S1NK 4A93C 2E2IC 3S17K 4LK1A 1I50K 5M3MK 3HOXC 3I4MK 3RZOK 4YG2A 2R92C 3DXJA 3S16K 4G7HA 4ZH4A 5TMCA 4A3IK 2PA8L 2JA8C 2Y0SL 3S1QC 3GTGK 3I4MC 2YU9C 3GTLK 3H3VL 2E2IK 5IYDC 3HKZL 3HOWK 3M3YC 5C3EK 2B63K 3S15C 4A93K 1TWFK 3WODA 3S1QK 4A3CC 4MEYA 4A3IC 4A3LC 4C3JK 5IYBK 1TWHC 1WCMC 5C4XK 5FLMK 2R92K 4G7OA 3GTJC 3S1RK 3S2HC 3I4NC 5M3FK 2O5JA 3RZOC 3GTQC 3PO3K 1I50C 3HOXK 2NVXC 3S17C 4KMUA 3M4OK 3HOUC 4QJVB 5IP7C 4Y7NC 4A3JK 2R7ZK 4XSXA 4OIRA 2JA7K 3HOYK 3S1MK 3GTMC 2NVQC 3RZDK 3K7AC 4A3KC 4A3BC 4A3GC 4LLGA 3GTOK 3GTKK 1XPPA 2A6EA 3H0GK 4C3HK 2NVTC 3S14K 1I6HC 4AYBD 3S2DK 3CQZK 2BE5A 3HOZC 1I3QK 1YNNA 4Q4ZA 4JK1A 2NVYK 2PPBA 4BY1K 4BBSC 1Y1VK 1I6VA 5TMFA 5IP9K 2PA8D 4A3DK 2Y0SD 1K83C 4A3FK 4BXXC 3FKIK 2JA5K 1IW7A 1BDFA 1TWCK 4OIOA 1Y1WC 3GTPC 4OIQA 2JA6K 2VUMC 4QIWL 5M5YK 4X6AK 1ZYRA 4C3IK 4BY7C 5C44C 4A3EC 4BBRC 3HOVC 4X6AC 2PMZL 4QJVA 1TWCC 4Y52C 1Y1WK 5IYCK 1SFOC 4LK0A 4NOIA 4A3MK 1TWAK 4OINA 2O5IA 2NVYC 2WAQD 2E2HK 3HOVK 3PO2K 3HOZK 2JA6C 2VUMK 3GTPK 2E2JK 5M5WK 2WB1D 3FKIC 4C2MK 3PO2C 3GTOC 4OIPA 4BY1C 3PO3C 3K7AK 4A3KK 4MEXA 1I3QC 1TWAC 3HOYC 3S1MC 4AYBL 2A69A 3S2DC 4GZYA 4A3MC 1SFOK 3EQLA 2E2JC 3H0GC 4XLNA 5C44K 3GTQK
chains in the Genus database with same CATH superfamily
4WILA 4YFNA 5C4XC 2JA5C 4A3GK 5IYBC 5IP7K 4Y7NK 4QIWD 3TFJA 4A3JC 3M4OC 1VJEA 4KM8A 1O2FB 1VGXA 4LOWA 2YU9A 1TWCA 3IPJA 4BY7K 1G51A 3H3VD 1XXCA 3S16C 1DCHA 5IYDK 4C45A 3GTKC 2WB1L 3S1NC 3HOUK 1O28A 4KMAA 1TWGC 5CJ9A 5TJ3A 4YFKA 3RZDC 4MQ9A 3QX3A 4G0WA 1I50K 3HOXC 3RZOK 4G7HA 1WCMA 2CFAA 3AD8C 5TMCA 3AQPA 3CQZA 3GIRA 4P9SA 3FOFA 3GEIA 5IYDC 3HKZL 3S15C 4P5BA 1B4BA 2P8TA 5FLMK 4C3JK 2E2HA 5M3FK 3S17C 1VRQC 2Y3PA 3M4OK 3HOUC 4QJVB 5IP7C 4Y7NC 4A3JK 2JA7K 3N0CA 3S1MK 4A3GC 4LLGA 3GTKK 3S14K 1XZQA 3S2DK 1UV7A 1VH2A 4GTFA 5JVOA 1I3QK 1IE0A 1USMA 1EK8A 4JK1A 4BBSC 3N3YA 1I6VA 5IP9K 1XXAA 2JA5K 1IW7A 4OIOA 4Y52K 2R93A 5M5YK 3S0XA 1ZYRA 2JA7A 5C44C 1PJ7A 2FQOA 4Y52C 4LK0A 2NVXA 1WQHA 3ADAC 1WQGA 2E2HK 3HOVK 3TFHA 2E2JK 1C0AA 1IBAA 1JOEA 3HXAA 3PO2C 3A8KA 1TWAC 1EH1A 3GDZA 3S1MC 4GTDA 4A3MC 4J3NA 3AH5A 4A3EK 4KB2A 4WJ4A 2NVQK 4C3JC 3A8JA 5IOTA 4FZBA 5FLMC 4A3FC 2R7ZC 3N0BA 3S15K 5IYCC 4KMHA 1SFOA 1Y1VC 3LAJA 4KN7A 4A3DC 4KATA 4G0UA 1F7UA 1ISEA 2EBBA 4G7ZA 3GTMK 2ZUFA 5M5XK 4XLPA 2NVXK 3G4CA 5JFEA 3S2HK 4Q5SA 1TWGK 4FM9A 2R93K 4A3LK 3S1NK 4A93C 1WQFA 3AD7C 3BUEA 3DXJA 1O29A 3Q3QA 3S16K 1I3QA 1O2BA 1WOOA 2PA8L 3S1QC 4GTBA 3GTGK 3I4MC 3GEHA 2E2IK 3HOWK 1XZPA 4A3IC 5IYBK 1TWHC 1WCMC 5C4XK 1KQ4A 1O26A 1USOA 3GTJC 2R92K 3S1RK 2GSUA 4BLAA 4KMUA 3GTQA 1ZXOA 4XSXA 1PJ6A 4A3BC 5IORA 1J6VA 3MMLB 3H0GK 1ZVUA 2NVTC 1I6HC 1TWGA 4G0VA 1JVIA 2Y0SD 5IOQA 3GTPC 4OIQA 1TWFA 2JA6K 4QIWL 2VUMC 3GTMA 4C3IK 4BBRC 2RGRA 1SFOC 4NOIA 4KMDA 3OPFA 1INNA 3HOZK 4C2MC 5M5WK 2WB1D 3FKIC 3JSTA 3GTOC 4BY1C 3SZYA 3K7AK 4AH6A 4MEXA 4WJ3M 3HOYC 1XZQB 4AYBL 2A69A 4GZYA 2E2IA 3GTQK 3PO3C 4XSZA 1DD5A 2D6FC 4BXXK 1K83K 2B63C 5C3EC 4A3CK 2A68A 1YX2A 2PMZD 4GT9A 4BBRK 4C3IC 3CQZC 5L46A 3GTGA 3HKZD 2WAQL 3L4KA 1IQ0A 1V5VA 2GAHC 4GTEA 3FOEA 4XCHA 3L4JA 1O27A 1BJTA 2CFAB 4BLBA 4KDDA 1SMYA 2JA8K 2NVTK 1WOSA 2XCRB 4LJZA 1F9NA 3CAGA 3I4NK 5C4JK 1R9TC 1O2AA 1TWFC 2VUMA 1HI9A 3H0GA 2GAGC 4LR2A 3GTKA 5EGHA 3AD9C 4YG2A 3T00A 2R92C 1DCPA 4ZH4A 4A3IK 2JA8C 2YU9C 3GTLK 3H3VL 2XCQA 3FKIA 2V6SA 3M3YC 3S1QK 1TWFK 2JA6A 4MEYA 4RMFA 4KB4A 2NVYA 4G7OA 2W7VA 3I4NC 1WORA 4KAWX 3T02A 4O2DA 1YCLA 3GTJA 1TWHA 2JH3A 1J6WA 4A3KC 1EI6A 1ZBSA 1XPPA 2A6EA 1WSVA 4C3HK 2ZFZA 1J98A 4GTCA 1WIHA 1DCOA 3CQZK 2GSNA 2NVYK 4BY1K 5TMFA 2FQTA 4A3DK 1K83C 4BXXC 3FKIK 1TWCK 1BDFA 1Y1WC 4X6AK 4X6AC 4GTAA 1TWCC 3AQOA 1Y1WK 5IYCK 3A8IA 1PJ5A 5EGEA 2NVYC 1VLOA 1WOPA 2P5MA 2JA6C 2VUMK 3GTPK 1B4AA 4C3HC 4C2MK 3ERED 1XXBA 4OIPA 1O25A 4KASA 4A3KK 3V4GA 2R92A 1O24A 3VA7A 1EFWA 2V6UA 4PAAA 3BP3A 3G4AA 1SFOK 4P5AA 3EQLA 2E2JC 1I50A 2B63A 3H0GC 2R7ZA 2CW0A 2E2HC 5FJ8K 4A3BK 4GTLA 3NUHA 3M3YK 3OREA 1IL2A 2YU9K 3GTLC 2A6HA 1EQRA 1TWAA 3OEPA 4KN4A 3S1RC 1TWHK 3TFIA 1I6HK 3FHZA 5IP9C 3GSIA 3HOWC 4BBSK 3GTGC 5E68A 5D4DA 1YNJA 1ZQ1C 5C4JC 1R9TK 3S14C 4YFXA 2ZUEA 1HQMA 1L0WA 3GTJK 1BS2A 1WCMK 2JA7C 2R93C 2V6TA 3T01A 2E2IC 3S17K 2PHCB 4LK1A 5M3MK 3I4MK 1RU0A 1GE9A 1X31C 3LAPA 2Y0SL 4GFQA 2XCOA 4DDQA 4A93K 5C3EK 2B63K 4A3CC 4A3LC 3WODA 3LPXA 2JA5A 5CHPA 4LQYA 3S2HC 2O5JA 3RZOC 3GTQC 3PO3K 1I50C 3HOXK 2NVXC 4BKWA 4KM9A 2R7ZK 3GEEA 4OIRA 3HOYK 3GTMC 2NVQC 3RZDK 3K7AC 2RH6A 1R9TA 3GTPA 3GTOK 1F93A 1AB4A 4PABA 1WSRA 4AYBD 2BE5A 3HOZC 1YNNA 4M1XA 4Q4ZA 2PPBA 1JQWA 1Y1VK 4KC6A 1IS1A 2PA8D 4A3FK 4BY7C 4A3EC 2GSOA 3HOVC 2PMZL 4QJVA 3GTLA 1Y1WA 1K83A 4KARA 4A3MK 1TWAK 4OINA 2O5IA 2WAQD 3BP8C 3PO2K 5IOSA 5HL8A 1F7VA 3SZZA 1J6XA 2KWAA 3TTGA 1BGWA 1I3QC 4ILDA 3GTOA 1XZPB 3S2DC 1Y1VA 4XLNA 5C44K
chains in the Genus database with same CATH topology
2CW0A 4XSZA 4YFNA 2E2HC 2NVQK 5C4XC 2JA5C 5FJ8K 4A3BK 5IYBC 5FLMC 1K83K 4A3FC 4BXXK 4A3GK 5IP7K 4Y7NK 4QIWD 4A3JC 2R7ZC 2B63C 5C3EC 5IYCC 3M3YK 2A68A 3S15K 1Y1VC 3M4OC 4A3CK 2PMZD 2YU9K 4BBRK 3GTLC 4BY7K 2A6HA 3CQZC 3S1RC 4KN4A 3H3VD 4KN7A 1TWHK 4A3EK 1I6HK 3HKZD 2WAQL 3S16C 4A3DC 4G7ZA 5IP9C 4Y52K 3HOWC 5IYDK 3GTKC 4BBSK 2WB1L 3GTMK 3GTGC 5D4DA 3S1NC 1YNJA 2JA8K 1SMYA 3HOUK 1TWGC 5C4JC 5M5XK 1R9TK 2NVTK 4XLPA 3S14C 4YFXA 2NVXK 1HQMA 4LJZA 3I4NK 4YFKA 3S2HK 3GTJK 3RZDC 4MQ9A 5C4JK 1WCMK 1R9TC 4Q5SA 1TWGK 2JA7C 2R93K 1TWFC 4A3LK 2R93C 3S1NK 4A93C 2E2IC 3S17K 4LK1A 1I50K 5M3MK 3HOXC 3I4MK 3RZOK 4YG2A 2R92C 3DXJA 3S16K 4G7HA 4ZH4A 5TMCA 4A3IK 2PA8L 2JA8C 2Y0SL 3S1QC 3GTGK 3I4MC 2YU9C 3GTLK 3H3VL 2E2IK 5IYDC 3HKZL 3HOWK 3M3YC 5C3EK 2B63K 3S15C 4A93K 1TWFK 3WODA 3S1QK 4A3CC 4MEYA 4A3IC 4A3LC 4C3JK 5IYBK 1TWHC 1WCMC 5C4XK 5FLMK 2R92K 4G7OA 3GTJC 3S1RK 3S2HC 3I4NC 5M3FK 2O5JA 3RZOC 3GTQC 3PO3K 1I50C 3HOXK 2NVXC 3S17C 4KMUA 3M4OK 3HOUC 4QJVB 5IP7C 4Y7NC 4A3JK 2R7ZK 4XSXA 4OIRA 2JA7K 3HOYK 3S1MK 3GTMC 2NVQC 3RZDK 3K7AC 4A3KC 4A3BC 4A3GC 4LLGA 3GTOK 3GTKK 1XPPA 2A6EA 3H0GK 4C3HK 2NVTC 3S14K 1I6HC 4AYBD 3S2DK 3CQZK 2BE5A 3HOZC 1I3QK 1YNNA 4Q4ZA 4JK1A 2NVYK 2PPBA 4BY1K 4BBSC 1Y1VK 1I6VA 5TMFA 5IP9K 2PA8D 4A3DK 2Y0SD 1K83C 4A3FK 4BXXC 3FKIK 2JA5K 1IW7A 1BDFA 1TWCK 4OIOA 1Y1WC 3GTPC 4OIQA 2JA6K 2VUMC 4QIWL 5M5YK 4X6AK 1ZYRA 4C3IK 4BY7C 5C44C 4A3EC 4BBRC 3HOVC 4X6AC 2PMZL 4QJVA 1TWCC 4Y52C 1Y1WK 5IYCK 1SFOC 4LK0A 4NOIA 4A3MK 1TWAK 4OINA 2O5IA 2NVYC 2WAQD 2E2HK 3HOVK 3PO2K 3HOZK 2JA6C 2VUMK 3GTPK 2E2JK 5M5WK 2WB1D 3FKIC 4C2MK 3PO2C 3GTOC 4OIPA 4BY1C 3PO3C 3K7AK 4A3KK 4MEXA 1I3QC 1TWAC 3HOYC 3S1MC 4AYBL 2A69A 3S2DC 4GZYA 4A3MC 1SFOK 3EQLA 2E2JC 3H0GC 4XLNA 5C44K 3GTQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW0 A;  4XSZ A;  4YFN A;  2E2H C;  2NVQ K;  5C4X C;  2JA5 C;  5FJ8 K;  4A3B K;  5IYB C;  5FLM C;  1K83 K;  4A3F C;  4BXX K;  4A3G K;  5IP7 K;  4Y7N K;  4QIW D;  4A3J C;  2R7Z C;  2B63 C;  5C3E C;  5IYC C;  3M3Y K;  2A68 A;  3S15 K;  1Y1V C;  3M4O C;  4A3C K;  2PMZ D;  2YU9 K;  4BBR K;  3GTL C;  4BY7 K;  2A6H A;  3CQZ C;  3S1R C;  4KN4 A;  3H3V D;  4KN7 A;  1TWH K;  4A3E K;  1I6H K;  3HKZ D;  2WAQ L;  3S16 C;  4A3D C;  4G7Z A;  5IP9 C;  4Y52 K;  3HOW C;  5IYD K;  3GTK C;  4BBS K;  2WB1 L;  3GTM K;  3GTG C;  5D4D A;  3S1N C;  1YNJ A;  2JA8 K;  1SMY A;  3HOU K;  1TWG C;  5C4J C;  5M5X K;  1R9T K;  2NVT K;  4XLP A;  3S14 C;  4YFX A;  2NVX K;  1HQM A;  4LJZ A;  3I4N K;  4YFK A;  3S2H K;  3GTJ K;  3RZD C;  4MQ9 A;  5C4J K;  1WCM K;  1R9T C;  4Q5S A;  1TWG K;  2JA7 C;  2R93 K;  1TWF C;  4A3L K;  2R93 C;  3S1N K;  4A93 C;  2E2I C;  3S17 K;  4LK1 A;  1I50 K;  5M3M K;  3HOX C;  3I4M K;  3RZO K;  4YG2 A;  2R92 C;  3DXJ A;  3S16 K;  4G7H A;  4ZH4 A;  5TMC A;  4A3I K;  2PA8 L;  2JA8 C;  2Y0S L;  3S1Q C;  3GTG K;  3I4M C;  2YU9 C;  3GTL K;  3H3V L;  2E2I K;  5IYD C;  3HKZ L;  3HOW K;  3M3Y C;  5C3E K;  2B63 K;  3S15 C;  4A93 K;  1TWF K;  3WOD A;  3S1Q K;  4A3C C;  4MEY A;  4A3I C;  4A3L C;  4C3J K;  5IYB K;  1TWH C;  1WCM C;  5C4X K;  5FLM K;  2R92 K;  4G7O A;  3GTJ C;  3S1R K;  3S2H C;  3I4N C;  5M3F K;  2O5J A;  3RZO C;  3GTQ C;  3PO3 K;  1I50 C;  3HOX K;  2NVX C;  3S17 C;  4KMU A;  3M4O K;  3HOU C;  4QJV B;  5IP7 C;  4Y7N C;  4A3J K;  2R7Z K;  4XSX A;  4OIR A;  2JA7 K;  3HOY K;  3S1M K;  3GTM C;  2NVQ C;  3RZD K;  3K7A C;  4A3K C;  4A3B C;  4A3G C;  4LLG A;  3GTO K;  3GTK K;  1XPP A;  2A6E A;  3H0G K;  4C3H K;  2NVT C;  3S14 K;  1I6H C;  4AYB D;  3S2D K;  3CQZ K;  2BE5 A;  3HOZ C;  1I3Q K;  1YNN A;  4Q4Z A;  4JK1 A;  2NVY K;  2PPB A;  4BY1 K;  4BBS C;  1Y1V K;  1I6V A;  5TMF A;  5IP9 K;  2PA8 D;  4A3D K;  2Y0S D;  1K83 C;  4A3F K;  4BXX C;  3FKI K;  2JA5 K;  1IW7 A;  1BDF A;  1TWC K;  4OIO A;  1Y1W C;  3GTP C;  4OIQ A;  2JA6 K;  2VUM C;  4QIW L;  5M5Y K;  4X6A K;  1ZYR A;  4C3I K;  4BY7 C;  5C44 C;  4A3E C;  4BBR C;  3HOV C;  4X6A C;  2PMZ L;  4QJV A;  1TWC C;  4Y52 C;  1Y1W K;  5IYC K;  1SFO C;  4LK0 A;  4NOI A;  4A3M K;  1TWA K;  4OIN A;  2O5I A;  2NVY C;  2WAQ D;  2E2H K;  3HOV K;  3PO2 K;  3HOZ K;  2JA6 C;  2VUM K;  3GTP K;  2E2J K;  5M5W K;  2WB1 D;  3FKI C;  4C2M K;  3PO2 C;  3GTO C;  4OIP A;  4BY1 C;  3PO3 C;  3K7A K;  4A3K K;  4MEX A;  1I3Q C;  1TWA C;  3HOY C;  3S1M C;  4AYB L;  2A69 A;  3S2D C;  4GZY A;  4A3M C;  1SFO K;  3EQL A;  2E2J C;  3H0G C;  4XLN A;  5C44 K;  3GTQ K; 
#chains in the Genus database with same CATH topology
 4WIL A;  4YFN A;  5C4X C;  2JA5 C;  4A3G K;  5IYB C;  5IP7 K;  4Y7N K;  4QIW D;  3TFJ A;  4A3J C;  3M4O C;  1VJE A;  4KM8 A;  1O2F B;  1VGX A;  4LOW A;  2YU9 A;  1TWC A;  3IPJ A;  4BY7 K;  1G51 A;  3H3V D;  1XXC A;  3S16 C;  1DCH A;  5IYD K;  4C45 A;  3GTK C;  2WB1 L;  3S1N C;  3HOU K;  1O28 A;  4KMA A;  1TWG C;  5CJ9 A;  5TJ3 A;  4YFK A;  3RZD C;  4MQ9 A;  3QX3 A;  4G0W A;  1I50 K;  3HOX C;  3RZO K;  4G7H A;  1WCM A;  2CFA A;  3AD8 C;  5TMC A;  3AQP A;  3CQZ A;  3GIR A;  4P9S A;  3FOF A;  3GEI A;  5IYD C;  3HKZ L;  3S15 C;  4P5B A;  1B4B A;  2P8T A;  5FLM K;  4C3J K;  2E2H A;  5M3F K;  3S17 C;  1VRQ C;  2Y3P A;  3M4O K;  3HOU C;  4QJV B;  5IP7 C;  4Y7N C;  4A3J K;  2JA7 K;  3N0C A;  3S1M K;  4A3G C;  4LLG A;  3GTK K;  3S14 K;  1XZQ A;  3S2D K;  1UV7 A;  1VH2 A;  4GTF A;  5JVO A;  1I3Q K;  1IE0 A;  1USM A;  1EK8 A;  4JK1 A;  4BBS C;  3N3Y A;  1I6V A;  5IP9 K;  1XXA A;  2JA5 K;  1IW7 A;  4OIO A;  4Y52 K;  2R93 A;  5M5Y K;  3S0X A;  1ZYR A;  2JA7 A;  5C44 C;  1PJ7 A;  2FQO A;  4Y52 C;  4LK0 A;  2NVX A;  1WQH A;  3ADA C;  1WQG A;  2E2H K;  3HOV K;  3TFH A;  2E2J K;  1C0A A;  1IBA A;  1JOE A;  3HXA A;  3PO2 C;  3A8K A;  1TWA C;  1EH1 A;  3GDZ A;  3S1M C;  4GTD A;  4A3M C;  4J3N A;  3AH5 A;  4A3E K;  4KB2 A;  4WJ4 A;  2NVQ K;  4C3J C;  3A8J A;  5IOT A;  4FZB A;  5FLM C;  4A3F C;  2R7Z C;  3N0B A;  3S15 K;  5IYC C;  4KMH A;  1SFO A;  1Y1V C;  3LAJ A;  4KN7 A;  4A3D C;  4KAT A;  4G0U A;  1F7U A;  1ISE A;  2EBB A;  4G7Z A;  3GTM K;  2ZUF A;  5M5X K;  4XLP A;  2NVX K;  3G4C A;  5JFE A;  3S2H K;  4Q5S A;  1TWG K;  4FM9 A;  2R93 K;  4A3L K;  3S1N K;  4A93 C;  1WQF A;  3AD7 C;  3BUE A;  3DXJ A;  1O29 A;  3Q3Q A;  3S16 K;  1I3Q A;  1O2B A;  1WOO A;  2PA8 L;  3S1Q C;  4GTB A;  3GTG K;  3I4M C;  3GEH A;  2E2I K;  3HOW K;  1XZP A;  4A3I C;  5IYB K;  1TWH C;  1WCM C;  5C4X K;  1KQ4 A;  1O26 A;  1USO A;  3GTJ C;  2R92 K;  3S1R K;  2GSU A;  4BLA A;  4KMU A;  3GTQ A;  1ZXO A;  4XSX A;  1PJ6 A;  4A3B C;  5IOR A;  1J6V A;  3MML B;  3H0G K;  1ZVU A;  2NVT C;  1I6H C;  1TWG A;  4G0V A;  1JVI A;  2Y0S D;  5IOQ A;  3GTP C;  4OIQ A;  1TWF A;  2JA6 K;  4QIW L;  2VUM C;  3GTM A;  4C3I K;  4BBR C;  2RGR A;  1SFO C;  4NOI A;  4KMD A;  3OPF A;  1INN A;  3HOZ K;  4C2M C;  5M5W K;  2WB1 D;  3FKI C;  3JST A;  3GTO C;  4BY1 C;  3SZY A;  3K7A K;  4AH6 A;  4MEX A;  4WJ3 M;  3HOY C;  1XZQ B;  4AYB L;  2A69 A;  4GZY A;  2E2I A;  3GTQ K;  3PO3 C;  4XSZ A;  1DD5 A;  2D6F C;  4BXX K;  1K83 K;  2B63 C;  5C3E C;  4A3C K;  2A68 A;  1YX2 A;  2PMZ D;  4GT9 A;  4BBR K;  4C3I C;  3CQZ C;  5L46 A;  3GTG A;  3HKZ D;  2WAQ L;  3L4K A;  1IQ0 A;  1V5V A;  2GAH C;  4GTE A;  3FOE A;  4XCH A;  3L4J A;  1O27 A;  1BJT A;  2CFA B;  4BLB A;  4KDD A;  1SMY A;  2JA8 K;  2NVT K;  1WOS A;  2XCR B;  4LJZ A;  1F9N A;  3CAG A;  3I4N K;  5C4J K;  1R9T C;  1O2A A;  1TWF C;  2VUM A;  1HI9 A;  3H0G A;  2GAG C;  4LR2 A;  3GTK A;  5EGH A;  3AD9 C;  4YG2 A;  3T00 A;  2R92 C;  1DCP A;  4ZH4 A;  4A3I K;  2JA8 C;  2YU9 C;  3GTL K;  3H3V L;  2XCQ A;  3FKI A;  2V6S A;  3M3Y C;  3S1Q K;  1TWF K;  2JA6 A;  4MEY A;  4RMF A;  4KB4 A;  2NVY A;  4G7O A;  2W7V A;  3I4N C;  1WOR A;  4KAW X;  3T02 A;  4O2D A;  1YCL A;  3GTJ A;  1TWH A;  2JH3 A;  1J6W A;  4A3K C;  1EI6 A;  1ZBS A;  1XPP A;  2A6E A;  1WSV A;  4C3H K;  2ZFZ A;  1J98 A;  4GTC A;  1WIH A;  1DCO A;  3CQZ K;  2GSN A;  2NVY K;  4BY1 K;  5TMF A;  2FQT A;  4A3D K;  1K83 C;  4BXX C;  3FKI K;  1TWC K;  1BDF A;  1Y1W C;  4X6A K;  4X6A C;  4GTA A;  1TWC C;  3AQO A;  1Y1W K;  5IYC K;  3A8I A;  1PJ5 A;  5EGE A;  2NVY C;  1VLO A;  1WOP A;  2P5M A;  2JA6 C;  2VUM K;  3GTP K;  1B4A A;  4C3H C;  4C2M K;  3ERE D;  1XXB A;  4OIP A;  1O25 A;  4KAS A;  4A3K K;  3V4G A;  2R92 A;  1O24 A;  3VA7 A;  1EFW A;  2V6U A;  4PAA A;  3BP3 A;  3G4A A;  1SFO K;  4P5A A;  3EQL A;  2E2J C;  1I50 A;  2B63 A;  3H0G C;  2R7Z A;  2CW0 A;  2E2H C;  5FJ8 K;  4A3B K;  4GTL A;  3NUH A;  3M3Y K;  3ORE A;  1IL2 A;  2YU9 K;  3GTL C;  2A6H A;  1EQR A;  1TWA A;  3OEP A;  4KN4 A;  3S1R C;  1TWH K;  3TFI A;  1I6H K;  3FHZ A;  5IP9 C;  3GSI A;  3HOW C;  4BBS K;  3GTG C;  5E68 A;  5D4D A;  1YNJ A;  1ZQ1 C;  5C4J C;  1R9T K;  3S14 C;  4YFX A;  2ZUE A;  1HQM A;  1L0W A;  3GTJ K;  1BS2 A;  1WCM K;  2JA7 C;  2R93 C;  2V6T A;  3T01 A;  2E2I C;  3S17 K;  2PHC B;  4LK1 A;  5M3M K;  3I4M K;  1RU0 A;  1GE9 A;  1X31 C;  3LAP A;  2Y0S L;  4GFQ A;  2XCO A;  4DDQ A;  4A93 K;  5C3E K;  2B63 K;  4A3C C;  4A3L C;  3WOD A;  3LPX A;  2JA5 A;  5CHP A;  4LQY A;  3S2H C;  2O5J A;  3RZO C;  3GTQ C;  3PO3 K;  1I50 C;  3HOX K;  2NVX C;  4BKW A;  4KM9 A;  2R7Z K;  3GEE A;  4OIR A;  3HOY K;  3GTM C;  2NVQ C;  3RZD K;  3K7A C;  2RH6 A;  1R9T A;  3GTP A;  3GTO K;  1F93 A;  1AB4 A;  4PAB A;  1WSR A;  4AYB D;  2BE5 A;  3HOZ C;  1YNN A;  4M1X A;  4Q4Z A;  2PPB A;  1JQW A;  1Y1V K;  4KC6 A;  1IS1 A;  2PA8 D;  4A3F K;  4BY7 C;  4A3E C;  2GSO A;  3HOV C;  2PMZ L;  4QJV A;  3GTL A;  1Y1W A;  1K83 A;  4KAR A;  4A3M K;  1TWA K;  4OIN A;  2O5I A;  2WAQ D;  3BP8 C;  3PO2 K;  5IOS A;  5HL8 A;  1F7V A;  3SZZ A;  1J6X A;  2KWA A;  3TTG A;  1BGW A;  1I3Q C;  4ILD A;  3GTO A;  1XZP B;  3S2D C;  1Y1V A;  4XLN A;  5C44 K; 
#chains in the Genus database with same CATH homology
 2CW0 A;  4XSZ A;  4YFN A;  2E2H C;  2NVQ K;  5C4X C;  2JA5 C;  5FJ8 K;  4A3B K;  5IYB C;  5FLM C;  1K83 K;  4A3F C;  4BXX K;  4A3G K;  5IP7 K;  4Y7N K;  4QIW D;  4A3J C;  2R7Z C;  2B63 C;  5C3E C;  5IYC C;  3M3Y K;  2A68 A;  3S15 K;  1Y1V C;  3M4O C;  4A3C K;  2PMZ D;  2YU9 K;  4BBR K;  3GTL C;  4BY7 K;  2A6H A;  3CQZ C;  3S1R C;  4KN4 A;  3H3V D;  4KN7 A;  1TWH K;  4A3E K;  1I6H K;  3HKZ D;  2WAQ L;  3S16 C;  4A3D C;  4G7Z A;  5IP9 C;  4Y52 K;  3HOW C;  5IYD K;  3GTK C;  4BBS K;  2WB1 L;  3GTM K;  3GTG C;  5D4D A;  3S1N C;  1YNJ A;  2JA8 K;  1SMY A;  3HOU K;  1TWG C;  5C4J C;  5M5X K;  1R9T K;  2NVT K;  4XLP A;  3S14 C;  4YFX A;  2NVX K;  1HQM A;  4LJZ A;  3I4N K;  4YFK A;  3S2H K;  3GTJ K;  3RZD C;  4MQ9 A;  5C4J K;  1WCM K;  1R9T C;  4Q5S A;  1TWG K;  2JA7 C;  2R93 K;  1TWF C;  4A3L K;  2R93 C;  3S1N K;  4A93 C;  2E2I C;  3S17 K;  4LK1 A;  1I50 K;  5M3M K;  3HOX C;  3I4M K;  3RZO K;  4YG2 A;  2R92 C;  3DXJ A;  3S16 K;  4G7H A;  4ZH4 A;  5TMC A;  4A3I K;  2PA8 L;  2JA8 C;  2Y0S L;  3S1Q C;  3GTG K;  3I4M C;  2YU9 C;  3GTL K;  3H3V L;  2E2I K;  5IYD C;  3HKZ L;  3HOW K;  3M3Y C;  5C3E K;  2B63 K;  3S15 C;  4A93 K;  1TWF K;  3WOD A;  3S1Q K;  4A3C C;  4MEY A;  4A3I C;  4A3L C;  4C3J K;  5IYB K;  1TWH C;  1WCM C;  5C4X K;  5FLM K;  2R92 K;  4G7O A;  3GTJ C;  3S1R K;  3S2H C;  3I4N C;  5M3F K;  2O5J A;  3RZO C;  3GTQ C;  3PO3 K;  1I50 C;  3HOX K;  2NVX C;  3S17 C;  4KMU A;  3M4O K;  3HOU C;  4QJV B;  5IP7 C;  4Y7N C;  4A3J K;  2R7Z K;  4XSX A;  4OIR A;  2JA7 K;  3HOY K;  3S1M K;  3GTM C;  2NVQ C;  3RZD K;  3K7A C;  4A3K C;  4A3B C;  4A3G C;  4LLG A;  3GTO K;  3GTK K;  1XPP A;  2A6E A;  3H0G K;  4C3H K;  2NVT C;  3S14 K;  1I6H C;  4AYB D;  3S2D K;  3CQZ K;  2BE5 A;  3HOZ C;  1I3Q K;  1YNN A;  4Q4Z A;  4JK1 A;  2NVY K;  2PPB A;  4BY1 K;  4BBS C;  1Y1V K;  1I6V A;  5TMF A;  5IP9 K;  2PA8 D;  4A3D K;  2Y0S D;  1K83 C;  4A3F K;  4BXX C;  3FKI K;  2JA5 K;  1IW7 A;  1BDF A;  1TWC K;  4OIO A;  1Y1W C;  3GTP C;  4OIQ A;  2JA6 K;  2VUM C;  4QIW L;  5M5Y K;  4X6A K;  1ZYR A;  4C3I K;  4BY7 C;  5C44 C;  4A3E C;  4BBR C;  3HOV C;  4X6A C;  2PMZ L;  4QJV A;  1TWC C;  4Y52 C;  1Y1W K;  5IYC K;  1SFO C;  4LK0 A;  4NOI A;  4A3M K;  1TWA K;  4OIN A;  2O5I A;  2NVY C;  2WAQ D;  2E2H K;  3HOV K;  3PO2 K;  3HOZ K;  2JA6 C;  2VUM K;  3GTP K;  2E2J K;  5M5W K;  2WB1 D;  3FKI C;  4C2M K;  3PO2 C;  3GTO C;  4OIP A;  4BY1 C;  3PO3 C;  3K7A K;  4A3K K;  4MEX A;  1I3Q C;  1TWA C;  3HOY C;  3S1M C;  4AYB L;  2A69 A;  3S2D C;  4GZY A;  4A3M C;  1SFO K;  3EQL A;  2E2J C;  3H0G C;  4XLN A;  5C44 K;  3GTQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...