3M4OK

Rna polymerase ii elongation complex b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3m4oK00
4GZYA 4A3GC 4C3HK 2JA5K 3H3VD 4A3DK 2NVYC 4Q5SA 1TWFK 1TWHC 1TWAC 4G7ZA 4YFKA 2WAQD 4A3JC 3S1QC 2JA5C 2NVYK 4LLGA 1TWHK 1TWAK 4QJVB 2R92C 4BBSC 4YFXA 4A3JK 3S1QK 3GTQC 3HOVC 5FLMC 2R92K 3RZDC 4BBSK 1I3QC 5M5XK 4A3FC 4G7OA 5C4JC 2BE5A 2WB1L 4LK0A 3GTQK 5FLMK 3HOVK 4C3JK 3RZDK 1I3QK 3S1RC 4A3FK 4XSXA 3S2DC 4OIQA 5C4JK 5IP9C 5C3EC 3GTGC 4Y52K 1YNNA 3S1RK 3S2DK 4LK1A 4YG2A 5IP9K 1I50C 5C3EK 5IP7C 3GTGK 2NVQC 4AYBD 4A3MC 3PO3C 2VUMC 2YU9C 2PA8L 5IP7K 3PO3K 1I50K 2A68A 1TWGC 2NVQK 4A3MK 3HOZC 3HOUC 2YU9K 4BXXC 3DXJA 1XPPA 1TWGK 3HOZK 3HOUK 4BXXK 4OIRA 3GTMC 3K7AC 2JA6C 3GTKC 2R7ZC 1R9TC 3GTMK 2PA8D 4ZH4A 3K7AK 2JA6K 3GTKK 2A6EA 5IYCC 4QIWL 1SMYA 2R7ZK 2O5JA 2Y0SL 4A3LC 1R9TK 3S17C 4OINA 3HOYC 3RZOC 3PO2C 5IYCK 1HQMA 2CW0A 4XSZA 2JA7C 4A3LK 3S17K 3HOYK 3S2HC 3M3YC 2NVTC 1TWCC 4XLPA 2E2HC 3PO2K 3GTOC 2JA7K 3S1NC 4MEXA 4JK1A 4BY1C 3M3YK 3S2HK 1TWCK 3EQLA 2E2HK 3S1MC 3GTOK 4NOIA 2VUMK 3S1NK 2NVXC 2PMZL 4BY1K 2WB1D 3S1MK 3GTJC 5M3MK 5M5WK 3GTPC 2NVXK 4X6AC 4KN7A 4C2MK 3H3VL 4MEYA 3GTJK 4BY7C 1Y1WC 5C44C 3S16C 3GTPK 4YFNA 4G7HA 2R93K 4X6AK 2WAQL 5M3FK 5IYDC 1Y1WK 5C44K 5D4DA 3S16K 4QJVA 5IYBC 2E2JC 3I4NC 4A3IC 5IYDK 5FJ8K 2E2IC 1ZYRA 4KN4A 3GTLC 1SFOC 5IYBK 2E2JK 3I4NK 3S14C 3HOXC 2E2IK 3RZOK 3GTLK 1SFOK 3CQZC 2JA8C 2A6HA 3I4MC 3S14K 1WCMC 3HOXK 3HOWC 4MQ9A 3FKIC 2NVTK 2O5IA 3CQZK 4KMUA 2JA8K 4Y7NC 4XLNA 3I4MK 1WCMK 4A3CC 3HOWK 1K83C 5C4XC 3FKIK 3HKZL 4AYBL 3WODA 4A3BC 4QIWD 5C4XK 4Y7NK 2B63C 2Y0SD 4A3CK 4A93C 3H0GC 1K83K 4LJZA 4BBRC 1IW7A 4A3BK 4A3GK 2B63K 4OIOA 4OIPA 4A93K 4Y52C 3H0GK 4BBRK 3S15C 1I6HC 4C3IK 4A3KC 2PPBA 3M4OC 2A69A 5TMFA 5TMCA 4BY7K 4Q4ZA 5M5YK 3S15K 1BDFA 1I6HK 1Y1VC 4A3KK 3M4OK 4A3EC 2R93C 1YNJA 2PMZD 3HKZD 1I6VA 1Y1VK 4A3DC 4A3EK 4A3IK 1TWFC
chains in the Genus database with same CATH superfamily
4GZYA 1WSRA 4A3DK 2V6SA 2NVYC 4Q5SA 3AQOA 4XCHA 3TFIA 2B63A 3S1QC 2EBBA 1TWHK 1F7VA 4BBSC 4PABA 1DCHA 3SZYA 2XCOA 5C4JC 2WB1L 3GTQK 3AQPA 1I3QK 4OIQA 2PHCB 4Y52K 3N0BA 2V6UA 1O27A 1YNNA 5CHPA 3PO3C 5IP9K 5C3EK 1XXAA 2VUMC 2PA8L 1WOSA 1TWHA 3JSTA 5IP7K 1TWGC 2NVQK 3LAPA 3TFHA 4FZBA 1VLOA 3GTQA 3HXAA 1I3QA 3K7AC 1XZPA 1R9TC 3GTMK 2PA8D 4ZH4A 2FQTA 3SZZA 2JA6K 2O5JA 2RH6A 4OINA 3HOYC 3RZOC 5IYCK 4XSZA 4A3LK 3S17K 3PO2K 1HI9A 3AD9C 3GTOC 2JA7K 4JK1A 4BY1C 3S2HK 1WSVA 3EQLA 4BLAA 2E2HK 1IBAA 3T00A 1PJ5A 3S1NK 2NVXC 2PMZL 4C2MC 3FHZA 3GTMA 4O2DA 2JA6A 4KN7A 4MEYA 5L46A 5M3FK 4KMDA 1Y1WK 4G0VA 3S16K 3I4NC 2JA7A 4P9SA 2E2HA 3Q3QA 3GEEA 3OREA 1SFOK 2JA8C 1WCMC 3HOWC 4KMUA 3I4MK 1WQGA 3HKZL 4GT9A 1Y1WA 4WILA 4Y7NK 4A3CK 1K83K 1IW7A 4C45A 4C3IC 4A3BK 5IOSA 4OIPA 4KB2A 2RGRA 5M5YK 3S15K 1SFOA 1I6HK 1Y1VC 4KC6A 2R93C 3TTGA 1RU0A 3HKZD 2JA5C 4LOWA 3BP3A 3AD8C 1B4AA 1VRQC 4C3HK 3H3VD 1VGXA 1K83A 1TWAC 4YFKA 1EH1A 5IOQA 3GTJA 2NVYK 4QJVB 2R92C 4YFXA 3S1QK 2CFAB 3HOVC 3RZDC 4BBSK 2JH3A 4G7OA 2BE5A 4FM9A 3S2DC 5C4JK 1VJEA 3A8JA 4AH6A 3L4JA 4LK1A 4YG2A 1I50C 4A3MC 3T01A 2NVYA 2YU9C 3PO3K 3HOUC 4BXXC 1WQFA 1TWGK 4OIRA 2GSOA 3GTKC 1O2FB 1O25A 3K7AK 1ZQ1C 1INNA 1R9TK 1IS1A 1DCOA 1C0AA 3HOYK 4XLPA 1VH2A 2XCQA 4GTEA 5E68A 5JFEA 1ISEA 1B4BA 3S1MC 1YCLA 4BLBA 3GTOK 4NOIA 4BY1K 2WB1D 2NVXK 4X6AC 4C2MK 1ZBSA 1R9TA 4BY7C 5C44C 3N3YA 3AH5A 4YFNA 2WAQL 1DCPA 1J6XA 5IYBC 2KWAA 1V5VA 4A3IC 2E2JC 1ZVUA 2E2IC 1ZYRA 3LPXA 2ZFZA 3BP8C 4ILDA 3I4NK 3GTOA 3HOXC 1YX2A 3CQZC 1XZQA 2A6HA 2NVXA 3FKIC 1XZPB 2NVTK 2O5IA 2JA8K 3A8IA 1WCMK 2ZUFA 3HOWK 4AYBL 1IL2A 3WODA 5JVOA 4LQYA 4A3GC 4A93C 3H0GC 5HL8A 1WIHA 4OIOA 4Y52C 4C3IK 2PPBA 3M4OC 4KB4A 4Q4ZA 4KARA 1BDFA 1O28A 1F93A 5EGHA 3MMLB 2PMZD 3FOFA 1Y1VK 1JQWA 1WCMA 2GSUA 2R93K 1JOEA 1TWFC 1F7UA 4BKWA 4DDQA 1WQHA 3G4CA 2JA5K 4G7ZA 1O24A 4A3JC 3ADAC 1TWAK 2ZUEA 1IE0A 1PJ7A 5FLMC 4C3JC 2R92K 5M5XK 4A3FC 4GTAA 4LK0A 3HOVK 1Y1VA 3RZDK 2R93A 3S1RC 4XSXA 3N0CA 3GTGC 4J3NA 2JA5A 3S2DK 1L0WA 4GTLA 1TWAA 4PAAA 1I50K 4A3MK 3HOZC 2YU9K 3G4AA 1BJTA 4GTCA 3HOUK 4BXXK 1F9NA 2R7ZC 2XCRB 3GTKK 2A6EA 4QIWL 1SMYA 2Y0SL 1J6VA 1ZXOA 1WOPA 1HQMA 2CW0A 2GAHC 2YU9A 2FQOA 1EI6A 3M3YC 1TWCC 1GE9A 4WJ3M 2GSNA 2VUMK 1EQRA 1XXBA 3S1MK 5TJ3A 3GTJC 2P5MA 3GTKA 5M5WK 3GTPC 4GTFA 1WORA 4G7HA 4X6AK 5IYDC 5C44K 5D4DA 1KQ4A 1O2AA 4G0WA 1WOOA 3GTLC 5IYBK 2E2JK 3S14C 2VUMA 4KAWX 3OPFA 2E2IK 3RZOK 1IQ0A 1TWGA 3HOXK 3GEIA 3CQZK 5C4XC 4XLNA 3FKIK 1PJ6A 3IPJA 2B63C 1O29A 3GEHA 4BBRC 4LJZA 1USOA 4KASA 4A3GK 4A93K 3H0GK 4A3KC 1G51A 2A69A 5TMCA 2E2IA 3FOEA 3M4OK 4A3EC 3CQZA 4A3DC 2P8TA 3FKIA 4KMHA 3L4KA 1TWFK 1TWHC 1EK8A 3VA7A 2WAQD 3OEPA 4LLGA 3H0GA 4RMFA 3A8KA 4A3JK 3GTQC 1I3QC 5IORA 1XZQB 5FLMK 1X31C 4C3JK 4A3FK 3QX3A 5IP9C 3AD7C 5C3EC 1BS2A 3TFJA 3V4GA 1TWFA 3S1RK 4KATA 5IP7C 3GTGK 2NVQC 4AYBD 3LAJA 2A68A 3T02A 1J98A 3DXJA 1XPPA 4G0UA 3HOZK 1XXCA 3S0XA 3GTMC 1BGWA 2JA6C 4P5AA 3CAGA 3GTGA 5IYCC 2R7ZK 5EGEA 4A3LC 3S17C 3GIRA 3GDZA 3PO2C 1JVIA 3GSIA 2JA7C 1DD5A 3S2HC 2NVTC 2E2HC 4M1XA 4KM9A 3S1NC 4MEXA 3M3YK 1TWCK 4KDDA 4KMAA 1EFWA 2R92A 3BUEA 5M3MK 2R7ZA 2Y3PA 3H3VL 4KM8A 5CJ9A 3GTJK 1Y1WC 1O26A 3S16C 3GTPK 4GFQA 4QJVA 5IYDK 5FJ8K 4P5BA 2CFAA 1J6WA 1TWCA 4KN4A 1I50A 1SFOC 1AB4A 4GTDA 2V6TA 3GTLK 4WJ4A 3S14K 3I4MC 4MQ9A 4Y7NC 2D6FC 4A3CC 3GTPA 1K83C 4A3BC 2GAGC 4QIWD 5C4XK 2Y0SD 5IOTA 1O2BA 2B63K 4BBRK 3S15C 1I6HC 4LR2A 5TMFA 4BY7K 4GTBA 1UV7A 3GTLA 2W7VA 4A3KK 1USMA 3NUHA 1YNJA 4C3HC 1I6VA 3ERED 4A3EK 4A3IK
chains in the Genus database with same CATH topology
4GZYA 4A3GC 4C3HK 2JA5K 3H3VD 4A3DK 2NVYC 4Q5SA 1TWFK 1TWHC 1TWAC 4G7ZA 4YFKA 2WAQD 4A3JC 3S1QC 2JA5C 2NVYK 4LLGA 1TWHK 1TWAK 4QJVB 2R92C 4BBSC 4YFXA 4A3JK 3S1QK 3GTQC 3HOVC 5FLMC 2R92K 3RZDC 4BBSK 1I3QC 5M5XK 4A3FC 4G7OA 5C4JC 2BE5A 2WB1L 4LK0A 3GTQK 5FLMK 3HOVK 4C3JK 3RZDK 1I3QK 3S1RC 4A3FK 4XSXA 3S2DC 4OIQA 5C4JK 5IP9C 5C3EC 3GTGC 4Y52K 1YNNA 3S1RK 3S2DK 4LK1A 4YG2A 5IP9K 1I50C 5C3EK 5IP7C 3GTGK 2NVQC 4AYBD 4A3MC 3PO3C 2VUMC 2YU9C 2PA8L 5IP7K 3PO3K 1I50K 2A68A 1TWGC 2NVQK 4A3MK 3HOZC 3HOUC 2YU9K 4BXXC 3DXJA 1XPPA 1TWGK 3HOZK 3HOUK 4BXXK 4OIRA 3GTMC 3K7AC 2JA6C 3GTKC 2R7ZC 1R9TC 3GTMK 2PA8D 4ZH4A 3K7AK 2JA6K 3GTKK 2A6EA 5IYCC 4QIWL 1SMYA 2R7ZK 2O5JA 2Y0SL 4A3LC 1R9TK 3S17C 4OINA 3HOYC 3RZOC 3PO2C 5IYCK 1HQMA 2CW0A 4XSZA 2JA7C 4A3LK 3S17K 3HOYK 3S2HC 3M3YC 2NVTC 1TWCC 4XLPA 2E2HC 3PO2K 3GTOC 2JA7K 3S1NC 4MEXA 4JK1A 4BY1C 3M3YK 3S2HK 1TWCK 3EQLA 2E2HK 3S1MC 3GTOK 4NOIA 2VUMK 3S1NK 2NVXC 2PMZL 4BY1K 2WB1D 3S1MK 3GTJC 5M3MK 5M5WK 3GTPC 2NVXK 4X6AC 4KN7A 4C2MK 3H3VL 4MEYA 3GTJK 4BY7C 1Y1WC 5C44C 3S16C 3GTPK 4YFNA 4G7HA 2R93K 4X6AK 2WAQL 5M3FK 5IYDC 1Y1WK 5C44K 5D4DA 3S16K 4QJVA 5IYBC 2E2JC 3I4NC 4A3IC 5IYDK 5FJ8K 2E2IC 1ZYRA 4KN4A 3GTLC 1SFOC 5IYBK 2E2JK 3I4NK 3S14C 3HOXC 2E2IK 3RZOK 3GTLK 1SFOK 3CQZC 2JA8C 2A6HA 3I4MC 3S14K 1WCMC 3HOXK 3HOWC 4MQ9A 3FKIC 2NVTK 2O5IA 3CQZK 4KMUA 2JA8K 4Y7NC 4XLNA 3I4MK 1WCMK 4A3CC 3HOWK 1K83C 5C4XC 3FKIK 3HKZL 4AYBL 3WODA 4A3BC 4QIWD 5C4XK 4Y7NK 2B63C 2Y0SD 4A3CK 4A93C 3H0GC 1K83K 4LJZA 4BBRC 1IW7A 4A3BK 4A3GK 2B63K 4OIOA 4OIPA 4A93K 4Y52C 3H0GK 4BBRK 3S15C 1I6HC 4C3IK 4A3KC 2PPBA 3M4OC 2A69A 5TMFA 5TMCA 4BY7K 4Q4ZA 5M5YK 3S15K 1BDFA 1I6HK 1Y1VC 4A3KK 3M4OK 4A3EC 2R93C 1YNJA 2PMZD 3HKZD 1I6VA 1Y1VK 4A3DC 4A3EK 4A3IK 1TWFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZY A;  4A3G C;  4C3H K;  2JA5 K;  3H3V D;  4A3D K;  2NVY C;  4Q5S A;  1TWF K;  1TWH C;  1TWA C;  4G7Z A;  4YFK A;  2WAQ D;  4A3J C;  3S1Q C;  2JA5 C;  2NVY K;  4LLG A;  1TWH K;  1TWA K;  4QJV B;  2R92 C;  4BBS C;  4YFX A;  4A3J K;  3S1Q K;  3GTQ C;  3HOV C;  5FLM C;  2R92 K;  3RZD C;  4BBS K;  1I3Q C;  5M5X K;  4A3F C;  4G7O A;  5C4J C;  2BE5 A;  2WB1 L;  4LK0 A;  3GTQ K;  5FLM K;  3HOV K;  4C3J K;  3RZD K;  1I3Q K;  3S1R C;  4A3F K;  4XSX A;  3S2D C;  4OIQ A;  5C4J K;  5IP9 C;  5C3E C;  3GTG C;  4Y52 K;  1YNN A;  3S1R K;  3S2D K;  4LK1 A;  4YG2 A;  5IP9 K;  1I50 C;  5C3E K;  5IP7 C;  3GTG K;  2NVQ C;  4AYB D;  4A3M C;  3PO3 C;  2VUM C;  2YU9 C;  2PA8 L;  5IP7 K;  3PO3 K;  1I50 K;  2A68 A;  1TWG C;  2NVQ K;  4A3M K;  3HOZ C;  3HOU C;  2YU9 K;  4BXX C;  3DXJ A;  1XPP A;  1TWG K;  3HOZ K;  3HOU K;  4BXX K;  4OIR A;  3GTM C;  3K7A C;  2JA6 C;  3GTK C;  2R7Z C;  1R9T C;  3GTM K;  2PA8 D;  4ZH4 A;  3K7A K;  2JA6 K;  3GTK K;  2A6E A;  5IYC C;  4QIW L;  1SMY A;  2R7Z K;  2O5J A;  2Y0S L;  4A3L C;  1R9T K;  3S17 C;  4OIN A;  3HOY C;  3RZO C;  3PO2 C;  5IYC K;  1HQM A;  2CW0 A;  4XSZ A;  2JA7 C;  4A3L K;  3S17 K;  3HOY K;  3S2H C;  3M3Y C;  2NVT C;  1TWC C;  4XLP A;  2E2H C;  3PO2 K;  3GTO C;  2JA7 K;  3S1N C;  4MEX A;  4JK1 A;  4BY1 C;  3M3Y K;  3S2H K;  1TWC K;  3EQL A;  2E2H K;  3S1M C;  3GTO K;  4NOI A;  2VUM K;  3S1N K;  2NVX C;  2PMZ L;  4BY1 K;  2WB1 D;  3S1M K;  3GTJ C;  5M3M K;  5M5W K;  3GTP C;  2NVX K;  4X6A C;  4KN7 A;  4C2M K;  3H3V L;  4MEY A;  3GTJ K;  4BY7 C;  1Y1W C;  5C44 C;  3S16 C;  3GTP K;  4YFN A;  4G7H A;  2R93 K;  4X6A K;  2WAQ L;  5M3F K;  5IYD C;  1Y1W K;  5C44 K;  5D4D A;  3S16 K;  4QJV A;  5IYB C;  2E2J C;  3I4N C;  4A3I C;  5IYD K;  5FJ8 K;  2E2I C;  1ZYR A;  4KN4 A;  3GTL C;  1SFO C;  5IYB K;  2E2J K;  3I4N K;  3S14 C;  3HOX C;  2E2I K;  3RZO K;  3GTL K;  1SFO K;  3CQZ C;  2JA8 C;  2A6H A;  3I4M C;  3S14 K;  1WCM C;  3HOX K;  3HOW C;  4MQ9 A;  3FKI C;  2NVT K;  2O5I A;  3CQZ K;  4KMU A;  2JA8 K;  4Y7N C;  4XLN A;  3I4M K;  1WCM K;  4A3C C;  3HOW K;  1K83 C;  5C4X C;  3FKI K;  3HKZ L;  4AYB L;  3WOD A;  4A3B C;  4QIW D;  5C4X K;  4Y7N K;  2B63 C;  2Y0S D;  4A3C K;  4A93 C;  3H0G C;  1K83 K;  4LJZ A;  4BBR C;  1IW7 A;  4A3B K;  4A3G K;  2B63 K;  4OIO A;  4OIP A;  4A93 K;  4Y52 C;  3H0G K;  4BBR K;  3S15 C;  1I6H C;  4C3I K;  4A3K C;  2PPB A;  3M4O C;  2A69 A;  5TMF A;  5TMC A;  4BY7 K;  4Q4Z A;  5M5Y K;  3S15 K;  1BDF A;  1I6H K;  1Y1V C;  4A3K K;  3M4O K;  4A3E C;  2R93 C;  1YNJ A;  2PMZ D;  3HKZ D;  1I6V A;  1Y1V K;  4A3D C;  4A3E K;  4A3I K;  1TWF C; 
#chains in the Genus database with same CATH topology
 4GZY A;  1WSR A;  4A3D K;  2V6S A;  2NVY C;  4Q5S A;  3AQO A;  4XCH A;  3TFI A;  2B63 A;  3S1Q C;  2EBB A;  1TWH K;  1F7V A;  4BBS C;  4PAB A;  1DCH A;  3SZY A;  2XCO A;  5C4J C;  2WB1 L;  3GTQ K;  3AQP A;  1I3Q K;  4OIQ A;  2PHC B;  4Y52 K;  3N0B A;  2V6U A;  1O27 A;  1YNN A;  5CHP A;  3PO3 C;  5IP9 K;  5C3E K;  1XXA A;  2VUM C;  2PA8 L;  1WOS A;  1TWH A;  3JST A;  5IP7 K;  1TWG C;  2NVQ K;  3LAP A;  3TFH A;  4FZB A;  1VLO A;  3GTQ A;  3HXA A;  1I3Q A;  3K7A C;  1XZP A;  1R9T C;  3GTM K;  2PA8 D;  4ZH4 A;  2FQT A;  3SZZ A;  2JA6 K;  2O5J A;  2RH6 A;  4OIN A;  3HOY C;  3RZO C;  5IYC K;  4XSZ A;  4A3L K;  3S17 K;  3PO2 K;  1HI9 A;  3AD9 C;  3GTO C;  2JA7 K;  4JK1 A;  4BY1 C;  3S2H K;  1WSV A;  3EQL A;  4BLA A;  2E2H K;  1IBA A;  3T00 A;  1PJ5 A;  3S1N K;  2NVX C;  2PMZ L;  4C2M C;  3FHZ A;  3GTM A;  4O2D A;  2JA6 A;  4KN7 A;  4MEY A;  5L46 A;  5M3F K;  4KMD A;  1Y1W K;  4G0V A;  3S16 K;  3I4N C;  2JA7 A;  4P9S A;  2E2H A;  3Q3Q A;  3GEE A;  3ORE A;  1SFO K;  2JA8 C;  1WCM C;  3HOW C;  4KMU A;  3I4M K;  1WQG A;  3HKZ L;  4GT9 A;  1Y1W A;  4WIL A;  4Y7N K;  4A3C K;  1K83 K;  1IW7 A;  4C45 A;  4C3I C;  4A3B K;  5IOS A;  4OIP A;  4KB2 A;  2RGR A;  5M5Y K;  3S15 K;  1SFO A;  1I6H K;  1Y1V C;  4KC6 A;  2R93 C;  3TTG A;  1RU0 A;  3HKZ D;  2JA5 C;  4LOW A;  3BP3 A;  3AD8 C;  1B4A A;  1VRQ C;  4C3H K;  3H3V D;  1VGX A;  1K83 A;  1TWA C;  4YFK A;  1EH1 A;  5IOQ A;  3GTJ A;  2NVY K;  4QJV B;  2R92 C;  4YFX A;  3S1Q K;  2CFA B;  3HOV C;  3RZD C;  4BBS K;  2JH3 A;  4G7O A;  2BE5 A;  4FM9 A;  3S2D C;  5C4J K;  1VJE A;  3A8J A;  4AH6 A;  3L4J A;  4LK1 A;  4YG2 A;  1I50 C;  4A3M C;  3T01 A;  2NVY A;  2YU9 C;  3PO3 K;  3HOU C;  4BXX C;  1WQF A;  1TWG K;  4OIR A;  2GSO A;  3GTK C;  1O2F B;  1O25 A;  3K7A K;  1ZQ1 C;  1INN A;  1R9T K;  1IS1 A;  1DCO A;  1C0A A;  3HOY K;  4XLP A;  1VH2 A;  2XCQ A;  4GTE A;  5E68 A;  5JFE A;  1ISE A;  1B4B A;  3S1M C;  1YCL A;  4BLB A;  3GTO K;  4NOI A;  4BY1 K;  2WB1 D;  2NVX K;  4X6A C;  4C2M K;  1ZBS A;  1R9T A;  4BY7 C;  5C44 C;  3N3Y A;  3AH5 A;  4YFN A;  2WAQ L;  1DCP A;  1J6X A;  5IYB C;  2KWA A;  1V5V A;  4A3I C;  2E2J C;  1ZVU A;  2E2I C;  1ZYR A;  3LPX A;  2ZFZ A;  3BP8 C;  4ILD A;  3I4N K;  3GTO A;  3HOX C;  1YX2 A;  3CQZ C;  1XZQ A;  2A6H A;  2NVX A;  3FKI C;  1XZP B;  2NVT K;  2O5I A;  2JA8 K;  3A8I A;  1WCM K;  2ZUF A;  3HOW K;  4AYB L;  1IL2 A;  3WOD A;  5JVO A;  4LQY A;  4A3G C;  4A93 C;  3H0G C;  5HL8 A;  1WIH A;  4OIO A;  4Y52 C;  4C3I K;  2PPB A;  3M4O C;  4KB4 A;  4Q4Z A;  4KAR A;  1BDF A;  1O28 A;  1F93 A;  5EGH A;  3MML B;  2PMZ D;  3FOF A;  1Y1V K;  1JQW A;  1WCM A;  2GSU A;  2R93 K;  1JOE A;  1TWF C;  1F7U A;  4BKW A;  4DDQ A;  1WQH A;  3G4C A;  2JA5 K;  4G7Z A;  1O24 A;  4A3J C;  3ADA C;  1TWA K;  2ZUE A;  1IE0 A;  1PJ7 A;  5FLM C;  4C3J C;  2R92 K;  5M5X K;  4A3F C;  4GTA A;  4LK0 A;  3HOV K;  1Y1V A;  3RZD K;  2R93 A;  3S1R C;  4XSX A;  3N0C A;  3GTG C;  4J3N A;  2JA5 A;  3S2D K;  1L0W A;  4GTL A;  1TWA A;  4PAA A;  1I50 K;  4A3M K;  3HOZ C;  2YU9 K;  3G4A A;  1BJT A;  4GTC A;  3HOU K;  4BXX K;  1F9N A;  2R7Z C;  2XCR B;  3GTK K;  2A6E A;  4QIW L;  1SMY A;  2Y0S L;  1J6V A;  1ZXO A;  1WOP A;  1HQM A;  2CW0 A;  2GAH C;  2YU9 A;  2FQO A;  1EI6 A;  3M3Y C;  1TWC C;  1GE9 A;  4WJ3 M;  2GSN A;  2VUM K;  1EQR A;  1XXB A;  3S1M K;  5TJ3 A;  3GTJ C;  2P5M A;  3GTK A;  5M5W K;  3GTP C;  4GTF A;  1WOR A;  4G7H A;  4X6A K;  5IYD C;  5C44 K;  5D4D A;  1KQ4 A;  1O2A A;  4G0W A;  1WOO A;  3GTL C;  5IYB K;  2E2J K;  3S14 C;  2VUM A;  4KAW X;  3OPF A;  2E2I K;  3RZO K;  1IQ0 A;  1TWG A;  3HOX K;  3GEI A;  3CQZ K;  5C4X C;  4XLN A;  3FKI K;  1PJ6 A;  3IPJ A;  2B63 C;  1O29 A;  3GEH A;  4BBR C;  4LJZ A;  1USO A;  4KAS A;  4A3G K;  4A93 K;  3H0G K;  4A3K C;  1G51 A;  2A69 A;  5TMC A;  2E2I A;  3FOE A;  3M4O K;  4A3E C;  3CQZ A;  4A3D C;  2P8T A;  3FKI A;  4KMH A;  3L4K A;  1TWF K;  1TWH C;  1EK8 A;  3VA7 A;  2WAQ D;  3OEP A;  4LLG A;  3H0G A;  4RMF A;  3A8K A;  4A3J K;  3GTQ C;  1I3Q C;  5IOR A;  1XZQ B;  5FLM K;  1X31 C;  4C3J K;  4A3F K;  3QX3 A;  5IP9 C;  3AD7 C;  5C3E C;  1BS2 A;  3TFJ A;  3V4G A;  1TWF A;  3S1R K;  4KAT A;  5IP7 C;  3GTG K;  2NVQ C;  4AYB D;  3LAJ A;  2A68 A;  3T02 A;  1J98 A;  3DXJ A;  1XPP A;  4G0U A;  3HOZ K;  1XXC A;  3S0X A;  3GTM C;  1BGW A;  2JA6 C;  4P5A A;  3CAG A;  3GTG A;  5IYC C;  2R7Z K;  5EGE A;  4A3L C;  3S17 C;  3GIR A;  3GDZ A;  3PO2 C;  1JVI A;  3GSI A;  2JA7 C;  1DD5 A;  3S2H C;  2NVT C;  2E2H C;  4M1X A;  4KM9 A;  3S1N C;  4MEX A;  3M3Y K;  1TWC K;  4KDD A;  4KMA A;  1EFW A;  2R92 A;  3BUE A;  5M3M K;  2R7Z A;  2Y3P A;  3H3V L;  4KM8 A;  5CJ9 A;  3GTJ K;  1Y1W C;  1O26 A;  3S16 C;  3GTP K;  4GFQ A;  4QJV A;  5IYD K;  5FJ8 K;  4P5B A;  2CFA A;  1J6W A;  1TWC A;  4KN4 A;  1I50 A;  1SFO C;  1AB4 A;  4GTD A;  2V6T A;  3GTL K;  4WJ4 A;  3S14 K;  3I4M C;  4MQ9 A;  4Y7N C;  2D6F C;  4A3C C;  3GTP A;  1K83 C;  4A3B C;  2GAG C;  4QIW D;  5C4X K;  2Y0S D;  5IOT A;  1O2B A;  2B63 K;  4BBR K;  3S15 C;  1I6H C;  4LR2 A;  5TMF A;  4BY7 K;  4GTB A;  1UV7 A;  3GTL A;  2W7V A;  4A3K K;  1USM A;  3NUH A;  1YNJ A;  4C3H C;  1I6V A;  3ERE D;  4A3E K;  4A3I K; 
#chains in the Genus database with same CATH homology
 4GZY A;  4A3G C;  4C3H K;  2JA5 K;  3H3V D;  4A3D K;  2NVY C;  4Q5S A;  1TWF K;  1TWH C;  1TWA C;  4G7Z A;  4YFK A;  2WAQ D;  4A3J C;  3S1Q C;  2JA5 C;  2NVY K;  4LLG A;  1TWH K;  1TWA K;  4QJV B;  2R92 C;  4BBS C;  4YFX A;  4A3J K;  3S1Q K;  3GTQ C;  3HOV C;  5FLM C;  2R92 K;  3RZD C;  4BBS K;  1I3Q C;  5M5X K;  4A3F C;  4G7O A;  5C4J C;  2BE5 A;  2WB1 L;  4LK0 A;  3GTQ K;  5FLM K;  3HOV K;  4C3J K;  3RZD K;  1I3Q K;  3S1R C;  4A3F K;  4XSX A;  3S2D C;  4OIQ A;  5C4J K;  5IP9 C;  5C3E C;  3GTG C;  4Y52 K;  1YNN A;  3S1R K;  3S2D K;  4LK1 A;  4YG2 A;  5IP9 K;  1I50 C;  5C3E K;  5IP7 C;  3GTG K;  2NVQ C;  4AYB D;  4A3M C;  3PO3 C;  2VUM C;  2YU9 C;  2PA8 L;  5IP7 K;  3PO3 K;  1I50 K;  2A68 A;  1TWG C;  2NVQ K;  4A3M K;  3HOZ C;  3HOU C;  2YU9 K;  4BXX C;  3DXJ A;  1XPP A;  1TWG K;  3HOZ K;  3HOU K;  4BXX K;  4OIR A;  3GTM C;  3K7A C;  2JA6 C;  3GTK C;  2R7Z C;  1R9T C;  3GTM K;  2PA8 D;  4ZH4 A;  3K7A K;  2JA6 K;  3GTK K;  2A6E A;  5IYC C;  4QIW L;  1SMY A;  2R7Z K;  2O5J A;  2Y0S L;  4A3L C;  1R9T K;  3S17 C;  4OIN A;  3HOY C;  3RZO C;  3PO2 C;  5IYC K;  1HQM A;  2CW0 A;  4XSZ A;  2JA7 C;  4A3L K;  3S17 K;  3HOY K;  3S2H C;  3M3Y C;  2NVT C;  1TWC C;  4XLP A;  2E2H C;  3PO2 K;  3GTO C;  2JA7 K;  3S1N C;  4MEX A;  4JK1 A;  4BY1 C;  3M3Y K;  3S2H K;  1TWC K;  3EQL A;  2E2H K;  3S1M C;  3GTO K;  4NOI A;  2VUM K;  3S1N K;  2NVX C;  2PMZ L;  4BY1 K;  2WB1 D;  3S1M K;  3GTJ C;  5M3M K;  5M5W K;  3GTP C;  2NVX K;  4X6A C;  4KN7 A;  4C2M K;  3H3V L;  4MEY A;  3GTJ K;  4BY7 C;  1Y1W C;  5C44 C;  3S16 C;  3GTP K;  4YFN A;  4G7H A;  2R93 K;  4X6A K;  2WAQ L;  5M3F K;  5IYD C;  1Y1W K;  5C44 K;  5D4D A;  3S16 K;  4QJV A;  5IYB C;  2E2J C;  3I4N C;  4A3I C;  5IYD K;  5FJ8 K;  2E2I C;  1ZYR A;  4KN4 A;  3GTL C;  1SFO C;  5IYB K;  2E2J K;  3I4N K;  3S14 C;  3HOX C;  2E2I K;  3RZO K;  3GTL K;  1SFO K;  3CQZ C;  2JA8 C;  2A6H A;  3I4M C;  3S14 K;  1WCM C;  3HOX K;  3HOW C;  4MQ9 A;  3FKI C;  2NVT K;  2O5I A;  3CQZ K;  4KMU A;  2JA8 K;  4Y7N C;  4XLN A;  3I4M K;  1WCM K;  4A3C C;  3HOW K;  1K83 C;  5C4X C;  3FKI K;  3HKZ L;  4AYB L;  3WOD A;  4A3B C;  4QIW D;  5C4X K;  4Y7N K;  2B63 C;  2Y0S D;  4A3C K;  4A93 C;  3H0G C;  1K83 K;  4LJZ A;  4BBR C;  1IW7 A;  4A3B K;  4A3G K;  2B63 K;  4OIO A;  4OIP A;  4A93 K;  4Y52 C;  3H0G K;  4BBR K;  3S15 C;  1I6H C;  4C3I K;  4A3K C;  2PPB A;  3M4O C;  2A69 A;  5TMF A;  5TMC A;  4BY7 K;  4Q4Z A;  5M5Y K;  3S15 K;  1BDF A;  1I6H K;  1Y1V C;  4A3K K;  3M4O K;  4A3E C;  2R93 C;  1YNJ A;  2PMZ D;  3HKZ D;  1I6V A;  1Y1V K;  4A3D C;  4A3E K;  4A3I K;  1TWF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...