3M4OK

Rna polymerase ii elongation complex b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3m4oK00
4A3EK 4YFNA 3I4MC 2R7ZC 1TWHC 1Y1VK 3HOXC 2E2HK 3PO3K 4A3JC 1Y1WK 2E2IC 5C4JK 3S1QC 2WB1D 3M3YK 3CQZK 5IYBK 2YU9C 4LLGA 4BBSK 1HQMA 3S14K 3S1NK 4BBRC 4MEXA 4BXXC 1ZYRA 2JA6K 4OIQA 3RZDK 3I4NK 5IYBC 1R9TC 4A3IC 2O5IA 1I6VA 5C3EC 1TWCC 4A3KK 3GTOC 1TWGC 4OIPA 2E2JC 3S17C 5IYDK 4Y52K 2NVTK 5M3MK 3H0GK 3CQZC 3K7AK 2NVYC 3HOYK 2R92C 3S2DC 2JA5C 2R93K 3H0GC 4Y7NK 2E2HC 2E2IK 4NOIA 4Y52C 4A3MC 4KN4A 2A68A 4YFKA 5IYCC 2JA7K 4KN7A 4BY7C 2PA8D 4XSXA 2JA6C 2PPBA 4Q5SA 4C2MK 3M3YC 4BBRK 1YNNA 4A3CK 3HOZC 1K83K 4GZYA 4BY7K 4LK0A 5FLMC 5C3EK 1I50K 4A3KC 4YFXA 2A6HA 1TWHK 1Y1VC 3WODA 5D4DA 5FJ8K 2NVTC 3GTGC 4A3GC 2NVXK 1I3QC 3GTQC 5FLMK 2R92K 3DXJA 4G7ZA 3S2DK 1SMYA 5IP7K 2BE5A 3RZDC 5M5WK 3M4OK 5IP9K 3HOVK 2WAQD 3HOUC 4QJVB 5IYCK 1YNJA 3HKZL 4ZH4A 4BY1K 4OINA 3GTLC 3HOWC 4A3DC 3S1RK 3I4MK 3PO3C 4OIRA 3HOZK 2PMZD 4G7HA 2JA8K 3HOVC 4Y7NC 4A3LC 4QIWL 3RZOC 3S1RC 2YU9K 3GTLK 2JA7C 3RZOK 3GTPK 1I3QK 4XLNA 4G7OA 3GTQK 2R7ZK 4YG2A 4A3EC 1TWAC 3FKIK 1I6HC 3GTPC 2WAQL 3HKZD 3H3VL 3PO2K 4KMUA 5C44K 2B63K 3S16C 4MEYA 2PMZL 3GTJK 4BXXK 4A3GK 3HOWK 4QIWD 4QJVA 4A3DK 2CW0A 3GTOK 4XSZA 4BY1C 3S1QK 4OIOA 3GTKC 3S15C 1Y1WC 3GTJC 3M4OC 1WCMC 3S1NC 5IP7C 4A3FC 5TMFA 3EQLA 2NVYK 2NVQK 1WCMK 1TWFC 2VUMC 4A3FK 1I6HK 3H3VD 5M5YK 3S17K 1I50C 1TWFK 4AYBL 2VUMK 3GTGK 4MQ9A 4LJZA 4C3JK 5M5XK 4A93C 3HOYC 4A3BK 4X6AK 4A3CC 3PO2C 2A6EA 3S16K 2B63C 4BBSC 4A93K 3S14C 4A3BC 4X6AC 3S2HC 1TWAK 3FKIC 2NVXC 2Y0SD 3HOUK 3I4NC 3S1MC 5C44C 1TWGK 2E2JK 3S2HK 5TMCA 2NVQC 4AYBD 4C3HK 1K83C 2PA8L 4C3IK 5IYDC 5M3FK 1SFOC 3S1MK 1BDFA 3GTMC 3S15K 2WB1L 3GTKK 4JK1A 1TWCK 1XPPA 1R9TK 4A3IK 4XLPA 4A3MK 1SFOK 4LK1A 3GTMK 2O5JA 2Y0SL 2JA8C 4A3LK 5IP9C 5C4XC 4Q4ZA 2JA5K 2R93C 5C4JC 2A69A 1IW7A 3K7AC 3HOXK 5C4XK 4A3JK
chains in the Genus database with same CATH superfamily
4A3EK 3I4MC 2R7ZC 5CJ9A 2E2HK 4GTFA 3JSTA 4BBSK 1IL2A 4BBRC 4OIQA 3RZDK 3I4NK 5IYBC 2V6UA 1R9TC 3GTOC 1J6WA 1TWGC 1JQWA 3VA7A 1TWFA 5IYDK 1ZVUA 2NVTK 3H0GK 3HOYK 2R92C 3H0GC 4KM8A 4Y7NK 3TFJA 2A68A 4C3JC 4WJ3M 1WQGA 1YNNA 1K83K 1XZPB 1F93A 4BY7K 4LK0A 5FLMC 3L4KA 4YFXA 2A6HA 1TWHK 3WODA 1V5VA 1DCOA 1EK8A 3A8IA 5FLMK 3FKIA 3DXJA 1WOOA 4QJVB 4ZH4A 4A3DC 3S1RK 1O27A 2FQOA 4OIRA 1O2AA 1Y1WA 4Y7NC 3RZOC 1L0WA 3GTLK 3RZOK 4YG2A 3CAGA 1I6HC 3GTPC 2WAQL 4LOWA 2RGRA 1EI6A 1B4AA 4GTEA 3N0CA 4A3GK 4A3DK 4QIWD 3GTOK 3CQZA 4BY1C 4OIOA 1XZQB 1O2BA 5TMFA 1O29A 1TWHA 4LR2A 1J6VA 3N0BA 5M5YK 2PHCB 4C3JK 4RMFA 4A3BK 4P9SA 2P5MA 4A93K 3S14C 4X6AC 2NVYA 3S2HC 1VGXA 3S1MC 1EQRA 1TWGK 4AYBD 1XZQA 5IYDC 2JA6A 4JK1A 1R9TK 4XLPA 3NUHA 1WQFA 4LK1A 4A3LK 5IP9C 2CFAA 4Q4ZA 2R93C 2A69A 3K7AC 1Y1WC 3GDZA 4GTDA 4YFNA 3PO3K 1TWHC 2E2IC 2WB1D 1ZQ1C 3M3YK 1F7VA 4LLGA 2ZUFA 1HQMA 3S14K 1JVIA 3GTKA 3FOFA 1WOSA 4A3IC 1TWCC 3OPFA 2VUMA 3AD8C 1ZXOA 2NVYC 3S2DC 1I50A 4P5AA 5EGEA 4AH6A 4NOIA 4GTCA 1K83A 5E68A 4C2MK 4BBRK 2NVXA 4A3CK 1O2FB 3AH5A 1WCMA 5C3EK 4FZBA 1I50K 3GTGC 1AB4A 3FOEA 1I3QC 4KMAA 2R93A 1PJ6A 3GIRA 4KMHA 4G0WA 1SMYA 5IP7K 2BE5A 3M4OK 1BS2A 2WAQD 2GSOA 2YU9A 1YNJA 4ILDA 3HOWC 3PO3C 3N3YA 3HOZK 1XZPA 3SZZA 1O28A 2JA7C 4G7OA 1I3QK 4GTBA 1R9TA 3HKZD 3S16C 4KMUA 3MMLB 2B63K 4BXXK 2PMZL 4QJVA 4XSZA 4G0VA 3S15C 4BLAA 1VJEA 3S1NC 1IQ0A 2NVYK 1PJ5A 4J3NA 1WCMK 2VUMC 3T02A 4A3FK 1I6HK 3H3VD 5HL8A 4AYBL 1TWFK 4LJZA 3QX3A 4X6AK 3AD7C 3TTGA 4A3BC 1DD5A 1TWAK 3FKIC 2Y0SD 3A8KA 5TJ3A 3L4JA 4KARA 1ZBSA 5C44C 2E2JK 5TMCA 5IORA 2FQTA 3OREA 3T00A 3GTQA 1BDFA 3S15K 4WJ4A 5EGHA 2WB1L 2KWAA 4KB2A 4GFQA 3GTMK 2JA8C 5C4XC 1VRQC 5C4JC 1IW7A 1JOEA 4A3JK 3BUEA 1Y1VK 3HOXC 3S1QC 4A3JC 2JA7A 3GEHA 1ZYRA 2JA6K 4KMDA 1KQ4A 1WQHA 3A8JA 2O5IA 1GE9A 1I6VA 4A3KK 2W7VA 3GEEA 3TFIA 3S17C 3AQPA 4Y52K 1VLOA 3K7AK 2CFAB 4KM9A 2R93K 3GTJA 1USMA 3AQOA 2E2HC 4Y52C 4YFKA 5JFEA 5IYCC 4KN7A 2PA8D 1YCLA 1J6XA 4Q5SA 3BP8C 2D6FC 4GZYA 1VH2A 4A3KC 5FJ8K 5D4DA 2NVTC 4A3GC 3S2DK 3ADAC 3RZDC 5M5WK 2RH6A 2R7ZA 3HOVK 3HOUC 2B63A 3GEIA 5IYCK 1YX2A 4OINA 3GTLC 5L46A 3I4MK 1UV7A 2JA8K 4C3IC 1O24A 4M1XA 4QIWL 3S1RC 2GAHC 3GTQK 2R7ZK 1EH1A 4A3EC 2R92A 1SFOA 1B4BA 4XCHA 3H3VL 1TWCA 3PO2K 5C44K 4MEYA 3GTJK 3IPJA 1X31C 2CW0A 3S1QK 2GSUA 2JA5A 2ZFZA 2Y3PA 4A3FC 3GTOA 3G4AA 4GTLA 1TWGA 2V6TA 3EQLA 2EBBA 1TWFC 2VUMK 3GTGK 1J98A 3H0GA 3LAJA 3FHZA 4A93C 3HOYC 4A3CC 3PO2C 2B63C 4BBSC 1XXCA 4KC6A 1O25A 1ISEA 1HI9A 3I4NC 4C3HK 1K83C 3Q3QA 2PA8L 4C3IK 4PABA 5M3FK 1SFOC 3GTPA 3LAPA 3GTKK 1TWCK 4BLBA 4A3IK 3M3YC 3HOXK 5C4XK 2E2IK 2JH3A 2XCQA 4GT9A 4O2DA 1Y1WK 5C4JK 5IOSA 5IYBK 2YU9C 3AD9C 4BXXC 3S1NK 4MEXA 5JVOA 4C2MC 5C3EC 3BP3A 4OIPA 5IOTA 2E2JC 2GSNA 5M3MK 3CQZC 1TWAA 4KDDA 4WILA 2GAGC 2JA5C 4C45A 4P5BA 4A3MC 4KN4A 3G4CA 2JA7K 1WSRA 4BY7C 1USOA 4XSXA 2PPBA 2JA6C 1DCPA 3GSIA 3HOZC 3TFHA 1BGWA 3V4GA 2P8TA 1Y1VC 1C0AA 2NVXK 3GTQC 2R92K 3HXAA 4BKWA 4G7ZA 4LQYA 1IBAA 5IP9K 4FM9A 2E2IA 3HKZL 2V6SA 4BY1K 2XCOA 2PMZD 4G7HA 4A3LC 3HOVC 2YU9K 3GTPK 4XLNA 1TWAC 1RU0A 3FKIK 1BJTA 3GTMA 1XXBA 3HOWK 4KASA 3GTKC 3LPXA 3GTJC 3M4OC 1WCMC 5IP7C 1DCHA 4KAWX 1EFWA 3GTGA 4C3HC 4DDQA 2NVQK 2XCRB 3OEPA 1WSVA 1IE0A 3S17K 1O26A 1I50C 5IOQA 1WORA 4MQ9A 3S0XA 5CHPA 5M5XK 1F7UA 3ERED 2A6EA 3S16K 1INNA 1G51A 1IS1A 2NVXC 3HOUK 2E2HA 3S2HK 2NVQC 3T01A 1WOPA 1Y1VA 4PAAA 3GTLA 1I3QA 3S1MK 3GTMC 4KB4A 2ZUEA 1XPPA 4KATA 4A3MK 1SFOK 1F9NA 2O5JA 2Y0SL 1PJ7A 1XXAA 4GTAA 2JA5K 4G0UA 3CQZK 3SZYA 1WIHA
chains in the Genus database with same CATH topology
4A3EK 4YFNA 3I4MC 2R7ZC 1TWHC 1Y1VK 3HOXC 2E2HK 3PO3K 4A3JC 1Y1WK 2E2IC 5C4JK 3S1QC 2WB1D 3M3YK 3CQZK 5IYBK 2YU9C 4LLGA 4BBSK 1HQMA 3S14K 3S1NK 4BBRC 4MEXA 4BXXC 1ZYRA 2JA6K 4OIQA 3RZDK 3I4NK 5IYBC 1R9TC 4A3IC 2O5IA 1I6VA 5C3EC 1TWCC 4A3KK 3GTOC 1TWGC 4OIPA 2E2JC 3S17C 5IYDK 4Y52K 2NVTK 5M3MK 3H0GK 3CQZC 3K7AK 2NVYC 3HOYK 2R92C 3S2DC 2JA5C 2R93K 3H0GC 4Y7NK 2E2HC 2E2IK 4NOIA 4Y52C 4A3MC 4KN4A 2A68A 4YFKA 5IYCC 2JA7K 4KN7A 4BY7C 2PA8D 4XSXA 2JA6C 2PPBA 4Q5SA 4C2MK 3M3YC 4BBRK 1YNNA 4A3CK 3HOZC 1K83K 4GZYA 4BY7K 4LK0A 5FLMC 5C3EK 1I50K 4A3KC 4YFXA 2A6HA 1TWHK 1Y1VC 3WODA 5D4DA 5FJ8K 2NVTC 3GTGC 4A3GC 2NVXK 1I3QC 3GTQC 5FLMK 2R92K 3DXJA 4G7ZA 3S2DK 1SMYA 5IP7K 2BE5A 3RZDC 5M5WK 3M4OK 5IP9K 3HOVK 2WAQD 3HOUC 4QJVB 5IYCK 1YNJA 3HKZL 4ZH4A 4BY1K 4OINA 3GTLC 3HOWC 4A3DC 3S1RK 3I4MK 3PO3C 4OIRA 3HOZK 2PMZD 4G7HA 2JA8K 3HOVC 4Y7NC 4A3LC 4QIWL 3RZOC 3S1RC 2YU9K 3GTLK 2JA7C 3RZOK 3GTPK 1I3QK 4XLNA 4G7OA 3GTQK 2R7ZK 4YG2A 4A3EC 1TWAC 3FKIK 1I6HC 3GTPC 2WAQL 3HKZD 3H3VL 3PO2K 4KMUA 5C44K 2B63K 3S16C 4MEYA 2PMZL 3GTJK 4BXXK 4A3GK 3HOWK 4QIWD 4QJVA 4A3DK 2CW0A 3GTOK 4XSZA 4BY1C 3S1QK 4OIOA 3GTKC 3S15C 1Y1WC 3GTJC 3M4OC 1WCMC 3S1NC 5IP7C 4A3FC 5TMFA 3EQLA 2NVYK 2NVQK 1WCMK 1TWFC 2VUMC 4A3FK 1I6HK 3H3VD 5M5YK 3S17K 1I50C 1TWFK 4AYBL 2VUMK 3GTGK 4MQ9A 4LJZA 4C3JK 5M5XK 4A93C 3HOYC 4A3BK 4X6AK 4A3CC 3PO2C 2A6EA 3S16K 2B63C 4BBSC 4A93K 3S14C 4A3BC 4X6AC 3S2HC 1TWAK 3FKIC 2NVXC 2Y0SD 3HOUK 3I4NC 3S1MC 5C44C 1TWGK 2E2JK 3S2HK 5TMCA 2NVQC 4AYBD 4C3HK 1K83C 2PA8L 4C3IK 5IYDC 5M3FK 1SFOC 3S1MK 1BDFA 3GTMC 3S15K 2WB1L 3GTKK 4JK1A 1TWCK 1XPPA 1R9TK 4A3IK 4XLPA 4A3MK 1SFOK 4LK1A 3GTMK 2O5JA 2Y0SL 2JA8C 4A3LK 5IP9C 5C4XC 4Q4ZA 2JA5K 2R93C 5C4JC 2A69A 1IW7A 3K7AC 3HOXK 5C4XK 4A3JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E K;  4YFN A;  3I4M C;  2R7Z C;  1TWH C;  1Y1V K;  3HOX C;  2E2H K;  3PO3 K;  4A3J C;  1Y1W K;  2E2I C;  5C4J K;  3S1Q C;  2WB1 D;  3M3Y K;  3CQZ K;  5IYB K;  2YU9 C;  4LLG A;  4BBS K;  1HQM A;  3S14 K;  3S1N K;  4BBR C;  4MEX A;  4BXX C;  1ZYR A;  2JA6 K;  4OIQ A;  3RZD K;  3I4N K;  5IYB C;  1R9T C;  4A3I C;  2O5I A;  1I6V A;  5C3E C;  1TWC C;  4A3K K;  3GTO C;  1TWG C;  4OIP A;  2E2J C;  3S17 C;  5IYD K;  4Y52 K;  2NVT K;  5M3M K;  3H0G K;  3CQZ C;  3K7A K;  2NVY C;  3HOY K;  2R92 C;  3S2D C;  2JA5 C;  2R93 K;  3H0G C;  4Y7N K;  2E2H C;  2E2I K;  4NOI A;  4Y52 C;  4A3M C;  4KN4 A;  2A68 A;  4YFK A;  5IYC C;  2JA7 K;  4KN7 A;  4BY7 C;  2PA8 D;  4XSX A;  2JA6 C;  2PPB A;  4Q5S A;  4C2M K;  3M3Y C;  4BBR K;  1YNN A;  4A3C K;  3HOZ C;  1K83 K;  4GZY A;  4BY7 K;  4LK0 A;  5FLM C;  5C3E K;  1I50 K;  4A3K C;  4YFX A;  2A6H A;  1TWH K;  1Y1V C;  3WOD A;  5D4D A;  5FJ8 K;  2NVT C;  3GTG C;  4A3G C;  2NVX K;  1I3Q C;  3GTQ C;  5FLM K;  2R92 K;  3DXJ A;  4G7Z A;  3S2D K;  1SMY A;  5IP7 K;  2BE5 A;  3RZD C;  5M5W K;  3M4O K;  5IP9 K;  3HOV K;  2WAQ D;  3HOU C;  4QJV B;  5IYC K;  1YNJ A;  3HKZ L;  4ZH4 A;  4BY1 K;  4OIN A;  3GTL C;  3HOW C;  4A3D C;  3S1R K;  3I4M K;  3PO3 C;  4OIR A;  3HOZ K;  2PMZ D;  4G7H A;  2JA8 K;  3HOV C;  4Y7N C;  4A3L C;  4QIW L;  3RZO C;  3S1R C;  2YU9 K;  3GTL K;  2JA7 C;  3RZO K;  3GTP K;  1I3Q K;  4XLN A;  4G7O A;  3GTQ K;  2R7Z K;  4YG2 A;  4A3E C;  1TWA C;  3FKI K;  1I6H C;  3GTP C;  2WAQ L;  3HKZ D;  3H3V L;  3PO2 K;  4KMU A;  5C44 K;  2B63 K;  3S16 C;  4MEY A;  2PMZ L;  3GTJ K;  4BXX K;  4A3G K;  3HOW K;  4QIW D;  4QJV A;  4A3D K;  2CW0 A;  3GTO K;  4XSZ A;  4BY1 C;  3S1Q K;  4OIO A;  3GTK C;  3S15 C;  1Y1W C;  3GTJ C;  3M4O C;  1WCM C;  3S1N C;  5IP7 C;  4A3F C;  5TMF A;  3EQL A;  2NVY K;  2NVQ K;  1WCM K;  1TWF C;  2VUM C;  4A3F K;  1I6H K;  3H3V D;  5M5Y K;  3S17 K;  1I50 C;  1TWF K;  4AYB L;  2VUM K;  3GTG K;  4MQ9 A;  4LJZ A;  4C3J K;  5M5X K;  4A93 C;  3HOY C;  4A3B K;  4X6A K;  4A3C C;  3PO2 C;  2A6E A;  3S16 K;  2B63 C;  4BBS C;  4A93 K;  3S14 C;  4A3B C;  4X6A C;  3S2H C;  1TWA K;  3FKI C;  2NVX C;  2Y0S D;  3HOU K;  3I4N C;  3S1M C;  5C44 C;  1TWG K;  2E2J K;  3S2H K;  5TMC A;  2NVQ C;  4AYB D;  4C3H K;  1K83 C;  2PA8 L;  4C3I K;  5IYD C;  5M3F K;  1SFO C;  3S1M K;  1BDF A;  3GTM C;  3S15 K;  2WB1 L;  3GTK K;  4JK1 A;  1TWC K;  1XPP A;  1R9T K;  4A3I K;  4XLP A;  4A3M K;  1SFO K;  4LK1 A;  3GTM K;  2O5J A;  2Y0S L;  2JA8 C;  4A3L K;  5IP9 C;  5C4X C;  4Q4Z A;  2JA5 K;  2R93 C;  5C4J C;  2A69 A;  1IW7 A;  3K7A C;  3HOX K;  5C4X K;  4A3J K; 
#chains in the Genus database with same CATH topology
 4A3E K;  3I4M C;  2R7Z C;  5CJ9 A;  2E2H K;  4GTF A;  3JST A;  4BBS K;  1IL2 A;  4BBR C;  4OIQ A;  3RZD K;  3I4N K;  5IYB C;  2V6U A;  1R9T C;  3GTO C;  1J6W A;  1TWG C;  1JQW A;  3VA7 A;  1TWF A;  5IYD K;  1ZVU A;  2NVT K;  3H0G K;  3HOY K;  2R92 C;  3H0G C;  4KM8 A;  4Y7N K;  3TFJ A;  2A68 A;  4C3J C;  4WJ3 M;  1WQG A;  1YNN A;  1K83 K;  1XZP B;  1F93 A;  4BY7 K;  4LK0 A;  5FLM C;  3L4K A;  4YFX A;  2A6H A;  1TWH K;  3WOD A;  1V5V A;  1DCO A;  1EK8 A;  3A8I A;  5FLM K;  3FKI A;  3DXJ A;  1WOO A;  4QJV B;  4ZH4 A;  4A3D C;  3S1R K;  1O27 A;  2FQO A;  4OIR A;  1O2A A;  1Y1W A;  4Y7N C;  3RZO C;  1L0W A;  3GTL K;  3RZO K;  4YG2 A;  3CAG A;  1I6H C;  3GTP C;  2WAQ L;  4LOW A;  2RGR A;  1EI6 A;  1B4A A;  4GTE A;  3N0C A;  4A3G K;  4A3D K;  4QIW D;  3GTO K;  3CQZ A;  4BY1 C;  4OIO A;  1XZQ B;  1O2B A;  5TMF A;  1O29 A;  1TWH A;  4LR2 A;  1J6V A;  3N0B A;  5M5Y K;  2PHC B;  4C3J K;  4RMF A;  4A3B K;  4P9S A;  2P5M A;  4A93 K;  3S14 C;  4X6A C;  2NVY A;  3S2H C;  1VGX A;  3S1M C;  1EQR A;  1TWG K;  4AYB D;  1XZQ A;  5IYD C;  2JA6 A;  4JK1 A;  1R9T K;  4XLP A;  3NUH A;  1WQF A;  4LK1 A;  4A3L K;  5IP9 C;  2CFA A;  4Q4Z A;  2R93 C;  2A69 A;  3K7A C;  1Y1W C;  3GDZ A;  4GTD A;  4YFN A;  3PO3 K;  1TWH C;  2E2I C;  2WB1 D;  1ZQ1 C;  3M3Y K;  1F7V A;  4LLG A;  2ZUF A;  1HQM A;  3S14 K;  1JVI A;  3GTK A;  3FOF A;  1WOS A;  4A3I C;  1TWC C;  3OPF A;  2VUM A;  3AD8 C;  1ZXO A;  2NVY C;  3S2D C;  1I50 A;  4P5A A;  5EGE A;  4AH6 A;  4NOI A;  4GTC A;  1K83 A;  5E68 A;  4C2M K;  4BBR K;  2NVX A;  4A3C K;  1O2F B;  3AH5 A;  1WCM A;  5C3E K;  4FZB A;  1I50 K;  3GTG C;  1AB4 A;  3FOE A;  1I3Q C;  4KMA A;  2R93 A;  1PJ6 A;  3GIR A;  4KMH A;  4G0W A;  1SMY A;  5IP7 K;  2BE5 A;  3M4O K;  1BS2 A;  2WAQ D;  2GSO A;  2YU9 A;  1YNJ A;  4ILD A;  3HOW C;  3PO3 C;  3N3Y A;  3HOZ K;  1XZP A;  3SZZ A;  1O28 A;  2JA7 C;  4G7O A;  1I3Q K;  4GTB A;  1R9T A;  3HKZ D;  3S16 C;  4KMU A;  3MML B;  2B63 K;  4BXX K;  2PMZ L;  4QJV A;  4XSZ A;  4G0V A;  3S15 C;  4BLA A;  1VJE A;  3S1N C;  1IQ0 A;  2NVY K;  1PJ5 A;  4J3N A;  1WCM K;  2VUM C;  3T02 A;  4A3F K;  1I6H K;  3H3V D;  5HL8 A;  4AYB L;  1TWF K;  4LJZ A;  3QX3 A;  4X6A K;  3AD7 C;  3TTG A;  4A3B C;  1DD5 A;  1TWA K;  3FKI C;  2Y0S D;  3A8K A;  5TJ3 A;  3L4J A;  4KAR A;  1ZBS A;  5C44 C;  2E2J K;  5TMC A;  5IOR A;  2FQT A;  3ORE A;  3T00 A;  3GTQ A;  1BDF A;  3S15 K;  4WJ4 A;  5EGH A;  2WB1 L;  2KWA A;  4KB2 A;  4GFQ A;  3GTM K;  2JA8 C;  5C4X C;  1VRQ C;  5C4J C;  1IW7 A;  1JOE A;  4A3J K;  3BUE A;  1Y1V K;  3HOX C;  3S1Q C;  4A3J C;  2JA7 A;  3GEH A;  1ZYR A;  2JA6 K;  4KMD A;  1KQ4 A;  1WQH A;  3A8J A;  2O5I A;  1GE9 A;  1I6V A;  4A3K K;  2W7V A;  3GEE A;  3TFI A;  3S17 C;  3AQP A;  4Y52 K;  1VLO A;  3K7A K;  2CFA B;  4KM9 A;  2R93 K;  3GTJ A;  1USM A;  3AQO A;  2E2H C;  4Y52 C;  4YFK A;  5JFE A;  5IYC C;  4KN7 A;  2PA8 D;  1YCL A;  1J6X A;  4Q5S A;  3BP8 C;  2D6F C;  4GZY A;  1VH2 A;  4A3K C;  5FJ8 K;  5D4D A;  2NVT C;  4A3G C;  3S2D K;  3ADA C;  3RZD C;  5M5W K;  2RH6 A;  2R7Z A;  3HOV K;  3HOU C;  2B63 A;  3GEI A;  5IYC K;  1YX2 A;  4OIN A;  3GTL C;  5L46 A;  3I4M K;  1UV7 A;  2JA8 K;  4C3I C;  1O24 A;  4M1X A;  4QIW L;  3S1R C;  2GAH C;  3GTQ K;  2R7Z K;  1EH1 A;  4A3E C;  2R92 A;  1SFO A;  1B4B A;  4XCH A;  3H3V L;  1TWC A;  3PO2 K;  5C44 K;  4MEY A;  3GTJ K;  3IPJ A;  1X31 C;  2CW0 A;  3S1Q K;  2GSU A;  2JA5 A;  2ZFZ A;  2Y3P A;  4A3F C;  3GTO A;  3G4A A;  4GTL A;  1TWG A;  2V6T A;  3EQL A;  2EBB A;  1TWF C;  2VUM K;  3GTG K;  1J98 A;  3H0G A;  3LAJ A;  3FHZ A;  4A93 C;  3HOY C;  4A3C C;  3PO2 C;  2B63 C;  4BBS C;  1XXC A;  4KC6 A;  1O25 A;  1ISE A;  1HI9 A;  3I4N C;  4C3H K;  1K83 C;  3Q3Q A;  2PA8 L;  4C3I K;  4PAB A;  5M3F K;  1SFO C;  3GTP A;  3LAP A;  3GTK K;  1TWC K;  4BLB A;  4A3I K;  3M3Y C;  3HOX K;  5C4X K;  2E2I K;  2JH3 A;  2XCQ A;  4GT9 A;  4O2D A;  1Y1W K;  5C4J K;  5IOS A;  5IYB K;  2YU9 C;  3AD9 C;  4BXX C;  3S1N K;  4MEX A;  5JVO A;  4C2M C;  5C3E C;  3BP3 A;  4OIP A;  5IOT A;  2E2J C;  2GSN A;  5M3M K;  3CQZ C;  1TWA A;  4KDD A;  4WIL A;  2GAG C;  2JA5 C;  4C45 A;  4P5B A;  4A3M C;  4KN4 A;  3G4C A;  2JA7 K;  1WSR A;  4BY7 C;  1USO A;  4XSX A;  2PPB A;  2JA6 C;  1DCP A;  3GSI A;  3HOZ C;  3TFH A;  1BGW A;  3V4G A;  2P8T A;  1Y1V C;  1C0A A;  2NVX K;  3GTQ C;  2R92 K;  3HXA A;  4BKW A;  4G7Z A;  4LQY A;  1IBA A;  5IP9 K;  4FM9 A;  2E2I A;  3HKZ L;  2V6S A;  4BY1 K;  2XCO A;  2PMZ D;  4G7H A;  4A3L C;  3HOV C;  2YU9 K;  3GTP K;  4XLN A;  1TWA C;  1RU0 A;  3FKI K;  1BJT A;  3GTM A;  1XXB A;  3HOW K;  4KAS A;  3GTK C;  3LPX A;  3GTJ C;  3M4O C;  1WCM C;  5IP7 C;  1DCH A;  4KAW X;  1EFW A;  3GTG A;  4C3H C;  4DDQ A;  2NVQ K;  2XCR B;  3OEP A;  1WSV A;  1IE0 A;  3S17 K;  1O26 A;  1I50 C;  5IOQ A;  1WOR A;  4MQ9 A;  3S0X A;  5CHP A;  5M5X K;  1F7U A;  3ERE D;  2A6E A;  3S16 K;  1INN A;  1G51 A;  1IS1 A;  2NVX C;  3HOU K;  2E2H A;  3S2H K;  2NVQ C;  3T01 A;  1WOP A;  1Y1V A;  4PAA A;  3GTL A;  1I3Q A;  3S1M K;  3GTM C;  4KB4 A;  2ZUE A;  1XPP A;  4KAT A;  4A3M K;  1SFO K;  1F9N A;  2O5J A;  2Y0S L;  1PJ7 A;  1XXA A;  4GTA A;  2JA5 K;  4G0U A;  3CQZ K;  3SZY A;  1WIH A; 
#chains in the Genus database with same CATH homology
 4A3E K;  4YFN A;  3I4M C;  2R7Z C;  1TWH C;  1Y1V K;  3HOX C;  2E2H K;  3PO3 K;  4A3J C;  1Y1W K;  2E2I C;  5C4J K;  3S1Q C;  2WB1 D;  3M3Y K;  3CQZ K;  5IYB K;  2YU9 C;  4LLG A;  4BBS K;  1HQM A;  3S14 K;  3S1N K;  4BBR C;  4MEX A;  4BXX C;  1ZYR A;  2JA6 K;  4OIQ A;  3RZD K;  3I4N K;  5IYB C;  1R9T C;  4A3I C;  2O5I A;  1I6V A;  5C3E C;  1TWC C;  4A3K K;  3GTO C;  1TWG C;  4OIP A;  2E2J C;  3S17 C;  5IYD K;  4Y52 K;  2NVT K;  5M3M K;  3H0G K;  3CQZ C;  3K7A K;  2NVY C;  3HOY K;  2R92 C;  3S2D C;  2JA5 C;  2R93 K;  3H0G C;  4Y7N K;  2E2H C;  2E2I K;  4NOI A;  4Y52 C;  4A3M C;  4KN4 A;  2A68 A;  4YFK A;  5IYC C;  2JA7 K;  4KN7 A;  4BY7 C;  2PA8 D;  4XSX A;  2JA6 C;  2PPB A;  4Q5S A;  4C2M K;  3M3Y C;  4BBR K;  1YNN A;  4A3C K;  3HOZ C;  1K83 K;  4GZY A;  4BY7 K;  4LK0 A;  5FLM C;  5C3E K;  1I50 K;  4A3K C;  4YFX A;  2A6H A;  1TWH K;  1Y1V C;  3WOD A;  5D4D A;  5FJ8 K;  2NVT C;  3GTG C;  4A3G C;  2NVX K;  1I3Q C;  3GTQ C;  5FLM K;  2R92 K;  3DXJ A;  4G7Z A;  3S2D K;  1SMY A;  5IP7 K;  2BE5 A;  3RZD C;  5M5W K;  3M4O K;  5IP9 K;  3HOV K;  2WAQ D;  3HOU C;  4QJV B;  5IYC K;  1YNJ A;  3HKZ L;  4ZH4 A;  4BY1 K;  4OIN A;  3GTL C;  3HOW C;  4A3D C;  3S1R K;  3I4M K;  3PO3 C;  4OIR A;  3HOZ K;  2PMZ D;  4G7H A;  2JA8 K;  3HOV C;  4Y7N C;  4A3L C;  4QIW L;  3RZO C;  3S1R C;  2YU9 K;  3GTL K;  2JA7 C;  3RZO K;  3GTP K;  1I3Q K;  4XLN A;  4G7O A;  3GTQ K;  2R7Z K;  4YG2 A;  4A3E C;  1TWA C;  3FKI K;  1I6H C;  3GTP C;  2WAQ L;  3HKZ D;  3H3V L;  3PO2 K;  4KMU A;  5C44 K;  2B63 K;  3S16 C;  4MEY A;  2PMZ L;  3GTJ K;  4BXX K;  4A3G K;  3HOW K;  4QIW D;  4QJV A;  4A3D K;  2CW0 A;  3GTO K;  4XSZ A;  4BY1 C;  3S1Q K;  4OIO A;  3GTK C;  3S15 C;  1Y1W C;  3GTJ C;  3M4O C;  1WCM C;  3S1N C;  5IP7 C;  4A3F C;  5TMF A;  3EQL A;  2NVY K;  2NVQ K;  1WCM K;  1TWF C;  2VUM C;  4A3F K;  1I6H K;  3H3V D;  5M5Y K;  3S17 K;  1I50 C;  1TWF K;  4AYB L;  2VUM K;  3GTG K;  4MQ9 A;  4LJZ A;  4C3J K;  5M5X K;  4A93 C;  3HOY C;  4A3B K;  4X6A K;  4A3C C;  3PO2 C;  2A6E A;  3S16 K;  2B63 C;  4BBS C;  4A93 K;  3S14 C;  4A3B C;  4X6A C;  3S2H C;  1TWA K;  3FKI C;  2NVX C;  2Y0S D;  3HOU K;  3I4N C;  3S1M C;  5C44 C;  1TWG K;  2E2J K;  3S2H K;  5TMC A;  2NVQ C;  4AYB D;  4C3H K;  1K83 C;  2PA8 L;  4C3I K;  5IYD C;  5M3F K;  1SFO C;  3S1M K;  1BDF A;  3GTM C;  3S15 K;  2WB1 L;  3GTK K;  4JK1 A;  1TWC K;  1XPP A;  1R9T K;  4A3I K;  4XLP A;  4A3M K;  1SFO K;  4LK1 A;  3GTM K;  2O5J A;  2Y0S L;  2JA8 C;  4A3L K;  5IP9 C;  5C4X C;  4Q4Z A;  2JA5 K;  2R93 C;  5C4J C;  2A69 A;  1IW7 A;  3K7A C;  3HOX K;  5C4X K;  4A3J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...