3M5RA

Crystal structure of swine flu virus ns1 effector domain from h1n1 influenza a/california/07/2009
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
126
structure length
126
Chain Sequence
HMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Swine Flu Virus NS1 Effector Domain from H1N1 Influenza A/California/07/2009
rcsb
source organism Influenza a virus
molecule tags Viral protein
molecule keywords Nonstructural protein 1
total genus 38
structure length 126
sequence length 126
chains with identical sequence B, D, E, F, G
ec nomenclature
pdb deposition date 2010-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3m5rA00
3EE8A 3KWIA 2RHKA 2KKZA 3P39A 4OPHA 3M5RA 3F5TA 3P38A 3OA9A 3KWGA 3O9TA 2GX9A 3D6RA 3RVCA 3O9QA 3L4QA 3O9SA 3O9UA 4OPAA 3P31A 3O9RA 3EE9A
chains in the Genus database with same CATH superfamily
2J4RA 3QDKA 4J2EA 4FSVA 5LL6Z 1NJWA 4M3RA 4DF8A 3HOSA 2O8FA 3AVFA 4CJEA 4LC9B 2D0AA 3K57A 1HNVA 3CJ1A 3L3UA 1BA1A 3WXKA 4MLEA 1XC9A 3NF7A 1MWKA 4GKKK 4H0XB 1VQ8N 4ID1A 3OJSA 3PX6A 1UWBA 1S9GA 3CC7N 3WNHA 3CCSN 3CFOA 3HM8A 4W5TA 3CCLN 1TK5A 4IBNA 1RBSA 3VTIA 2ZJQL 4BR5A 4IWVA 3VQPA 3ZX3A 4BDPA 4FWRA 2KHOA 3U9DA 4DU3A 1IH7A 1BI4A 2A6AA 3KLHA 2ZQBA 1HYVA 3S41A 3U4LA 3OS1A 3TANA 1OVQA 1JCFA 5AQMA 1D5AA 4I6MB 3TAQA 1DKGD 1MU2A 1HYZA 4CJVA 4OPAA 4FCYA 1JKHA 3QNOA 4BQZA 1J54A 2X6SA 3BDPA 1BIUA 1T3VA 2WC9A 1OH7A 4BRPA 4HUEA 4EZ6A 4BRHA 4K8XA 2X6NA 2IC3A 4BRKA 2VWJA 4HCBA 4FK0A 2QWOA 1YUWA 1EP4A 3V1OA 3RMCA 1U6ZA 4IOXA 3K59A 1FKPA 3IMXA 4LF4K 2O8CA 4H0OA 5C10A 3CF5L 5FRNA 4CGJA 2OTLN 1GOBA 3AY9A 5C15A 3SQ4A 3FR0A 1SS6A 4FJIA 4OLBA 4YOXA 1U04A 4OKKA 5DK5A 4YNQA 3ENOA 2FLOA 4CHYA 4BRQA 2Q1NA 4DV4K 3DLKA 2HSTA 4M7YA 4BR7A 4CEFA 4DV3K 3V9SA 3ZT0A 4M7XA 3CC4N 1OH6A 3OYKA 4FM0A 1YJNN 3O9RA 4X64K 4CJLA 4YFUA 1NJIO 1NKCA 3SQ1A 1A5VA 4B9MA 2DFFA 1WSGA 4O0JA 1DTQA 3DMJA 3A5LC 3OYEA 2G8HA 4FW2A 4Y0WA 3QERA 4CF0A 3A2FA 2DFEA 4ILJA 4FO0A 4PKGA 1X1PA 3NH1A 2BUPA 1DGKN 3T1AA 4QS9A 3CD6N 4HUFA 4YOYA 3T3FA 1T8EA 2PAVA 3VEOA 4WYBA 3LP3A 4CK2A 1OVYA 3V81A 2VQEK 3O9QA 3TWHA 4FJHA 1E3MA 1RDWX 4H0TB 3CC2N 4JKGA 1V4SA 3ATVA 1Y97A 4I2PA 3TPQA 3THYA 1KAZA 2PYLA 1EXQA 4DS4A 2W40A 2O4GA 3R3LA 3K0SA 4JS4A 3AGRA 4FWSA 5M1PA 3ZT3A 1FW6A 2NRVA 3F5TA 1RBTA 4CEQA 3UKUA 1RT6A 3BZCA 1JLQA 3VF4A 4XIUA 1IG9A 1Q86O 3WXIA 3C0BA 3DXMB 1C1AA 4IO8A 2O8EA 3EEQA 5C24A 2LSNA 2QTDA 2QA4N 4CEZA 3GDQA 5FPNA 4FZXC 2A42A 4OX9K 1NBWA 4LY7A 1NNEA 1JLBA 3CIPA 3VQCA 3P38A 4BQLA 2XY7A 4KTWA 4RW9A 4CGFA 4E7IA 4LFCK 2F7TA 3ZSRA 3EKSA 3U8XA 2YCHA 2YJEA 2GTDA 3OYNA 3H45C 3MWTA 3DXKA 5EX5A 1CZ9A 3KK3A 3LDSA 5CYQA 1XHXA 4CGIA 2BH1A 5E41A 4KKOA 1GLDG 2RHKA 4FPBA 4DFPA 3CPWM 4IXCA 4BDZA 3LPUA 1ITGA 4WQ5A 1WSFA 1WSHA 1I39A 3AA2A 1ZXOA 3M8SA 2NRXA 1GOCA 2QXLA 5LY3A 4M63C 4HCCA 1WSEA 1SV5A 3OBYA 3TU5A 3RR8A 1TKTA 2ASMA 4RCHA 3ENHA 5LJVA 1WN7A 4JHDB 4O8UA 3KWIA 5JLFA 2D0BA 4IG0A 1RILA 5FDLA 1HKGA 2Y1IA 3AAPA 3AO1A 1N36K 3ZX2A 4V19S 4Z4IA 3W3DA 1HNXK 3A5MC 4DTXA 2YHXA 3DWLA 3RMDA 1U2VB 3V1RA 1JL1A 1RT5A 1VQ6N 1NK8A 2O8BA 1A5XA 3LP1A 4H4OA 1ZC6A 1XHZA 3VN5A 4E0DA 2YHAA 3ATUA 1RT2A 3HOTA 2W42A 2KZMA 4EP4A 1OH5A 4X66K 3NF6A 4DU1A 1EWQA 4H5WA 3U3YA 3S3NA 5AQTA 5EVZA 4AHRA 3OYIA 1TV6A 1HYSA 5A2QO 1VQMN 1SAZA 1RCHA 3P4IA 3RSEA 5IWAK 3HL8A 5HROA 1P90A 4A57A 4GVEA 2E2QA 4CJPA 3VQAA 5DM6L 2OPSA 4C1NK 3OYHA 1TKXA 4M3ZA 1RT1A 5HP1A 2A41A 3D2EB 4KH5A 4OLAA 4X62K 2Q0RA 3F9MA 1EETA 1VQ9N 1JLGA 4KO0A 1JCEA 5CR4A 3KKSA 3HRGA 4K0KK 2CH6A 1VSDA 4EHTA 1REVA 1VSEA 5AZIA 2QWPA 4LF7K 1DT9A 4B1YB 4WFAL 1NU0A 1S22A 3G0ZA 2B4JA 2F96A 3SBGA 3MX5A 1JLCA 4O5FA 2HHSA 2B6AA 2HVIA 3HSTB 3TI0A 2OZMA 1U2VA 1ILYA 2CH5A 2VWBA 2ASPA 1B92A 3QB0A 2P9PA 4JD2A 2PZSA 3K58A 4GNIA 5SWMA 1NGIA 2HBJA 4H5RA 1ATNA 2GWJA 2VQFK 3MN7A 2GELA 4FJGA 2YKNA 5AQNA 3QESA 4PUOA 2JWLA 3CCQN 3LDLA 4CI6A 1MWMA 2HBMA 1S72N 3MEDA 4GKJK 2FXUA 1E4FT 4O44A 1KAXA 1C1CA 3LWMA 3TTCA 1NJYA 2PYJA 1XC3A 4K8ZA 2EX3A 1QSSA 1I3AA 2FSKA 1VHXA 2P9UB 3A5OC 1YF5L 3CQ8A 1QTMA 3AV9A 3UKUB 4CEBA 5AQRA 4F4KA 3O4WA 3M1FA 4QAGA 2X78A 3E1YA 3HPHA 4H0YB 4I7FA 4B9NA 4BC5A 4CFCA 3I8BA 5J2MA 4H0PA 1TVRA 1L3SA 3OY9A 1JXEA 4H4MA 4E89A 5GAEP 1LAWA 3NF8A 4XH1A 3L3VA 3OYAA 2V7YA 1RFQA 1UAXA 3KLEA 2IGIA 4EHUA 5EXWA 5AZIB 4DTJA 1HKBA 1NGDA 4DTNA 4JKHA 3CJBA 4HWIA 3KKRA 4ISEA 4B8AB 4DR4K 4DR5K 3Q7BA 5KQ8A 3VERA 3VQ5A 3VA0A 4CHZA 4FWKA 4DV5K 1KC8O 3ULDA 3M5RA 5C0YA 3DLEA 3R6MA 4A2AA 4ILHA 4M3YA 3DAWA 1I94K 4RW7A 4G9ZA 2A5XA 1BOTO 4DR6K 1VRUA 2E5LK 3NBPA 3QMLA 3V9WA 3EY1A 4M3XA 3VGMA 1VK0A 1JXBA 1YIJN 3VQEA 2QWLA 4DR2K 4IDHA 4JYAK 4C8KA 1LCUA 3TSQA 3VOVA 3AVGA 3EZWA 4B9SA 2A3ZA 4CJFA 4DUYK 2JWKA 3AVJA 3RTVA 4BR2A 1CZBA 3OYMA 4HTLA 1X9MA 3AVBA 5AQFA 3AVMA 4CZJA 2D0OA 3FFIA 2XHBA 1S3XA 3MWPA 1K8KA 3L4QA 4CZGA 1D4XA 1TKDA 3O9UA 1QHTA 3CXCM 4DSIA 1YT3A 2PBDA 4JKDA 3DLBA 4BE1A 1KVBA 3I33A 5BN9A 4NYFA 3WNGA 1QSLA 3O3GA 4WCEL 4R5PA 3MEGA 5M1NA 4CK1A 1EWRA 2BE2A 4PL8A 2O8DB 1X9SA 1WOQA 3D2EA 1L3VA 2ITMA 1T03A 4BROA 2ZGZA 3MN9A 4F2SA 1NWKA 2Q2RA 4IOCL 4B08A 3KK1A 3TAFA 4B1ZA 3LWLA 4BG8A 5F2RA 4MQ3A 2P1JA 3TAGA 3ZSQA 3T1YK 4N76A 1RT4A 3VQ9A 1VQ5N 3CI5A 3L4IA 4GW6A 3A8YA 3CYMA 2E2OA 4EP5A 4CFDA 2WONA 4NLBA 2HW3A 3G10A 4JKBA 3AA5X 1VSKA 3PLAA 3IDHA 4FLYA 1LV5A 3TAEA 2FBTA 3SPZA 4CESA 3FZLA 1NGEA 3ISNC 1GOAA 2QI2A 2RF2A 5JICA 3CM5A 1UA1A 5ADXH 1KQSM 2FSJA 5EOYA 3SYZA 1KSPA 4W5OA 1RTJA 2QW9A 1NK9A 1XNRK 4FW1A 3RMBA 2NRHA 2P51A 3R8EA 4AHVA 1GLAG 1LOTB 4ISFA 5CZ1A 5BN8A 3ZEUB 3C94A 4FLXA 4JKAA 1U48A 1NM1A 1W2BM 2GBZA 1WSIA 5DMRA 3L2RA 3QIOA 4IJAA 2W6KA 4BRNA 3WT0A 3FZKA 3MXIA 3KK7A 5HRRA 1N8RO 1X3MA 4OGEA 5FPMA 1BDGA 4M3TA 3OW2M 5KRTA 1QSYA 3ID6A 3VA3A 3QIPA 1CLQA 3RVCA 3THXA 4KV8A 3QBWA 2YNIA 4CJRA 3CCVN 4A62A 1CXUA 1M90O 3UE5A 2KKZA 2HHUA 3QEXA 3L2VA 4YOVA 4E3SA 4JK7A 1TGOA 1VSIA 5GADP 3ZCMA 2DTUA 1FK9A 4WQ4A 3QINA 3CFRA 3E01A 3VF2A 4CHNA 2OPPA 4NCAA 1S5JA 3L2UA 4FLZA 3J7AP 3OYJA 3IS9A 4CF2A 4DV2K 3E66A 3NH2A 3HVRA 3H1VX 2I7NA 3IAYA 3SBTA 2NRWA 4E7HA 1IBMK 5HL7L 3OYDA 2ZGYA 1IG8A 4LH4A 1XNQK 4FWNA 4FK2A 3TSPA 2Z1IA 4I9LA 5AQXA 3I8DA 2HHXA 2HHTA 1NK5A 5J2QA 4JN4A 4NO7A 4ZTFA 4KH4A 4WFNL 5JS2A 1MA9B 2O8CB 1VQLN 3QBXA 3G25A 4AM7A 5FRMA 3LDPA 4HTUA 1IBKK 4KREA 3TTDA 4DS5A 4DV7K 3FZFA 2RKIA 3I56N 3QEIA 2HBKA 2XRIA 5M1OA 1VQ4N 1LW0A 3HXMA 3B6PA 1KD1O 4DQQA 2AJQA 4CZKA 3MK6A 3RR7A 3DLLL 4E19A 3QFPA 1RDAA 3C95A 3VQ6A 1SUQA 1IKYA 4F9OA 1Q82O 3QEPA 3S9HA 1UA0A 5BR9A 1T05A 4B1XB 2UXCK 1EKEA 4B8CA 1VSJA 3J81O 5HRSA 4FJLA 5BRFA 4OO1J 3SZ2A 3T1HK 1NOZA 3ULEB 1RDCA 3CETA 5AZJB 1WSJA 4A2BA 4R79A 2OYQA 4KB1A 2P9SB 4TSXA 5F1XA 1B9FA 1S1XA 3ZSVA 3PIPL 3RRGA 3D2FA 1NGAA 2HB5A 4FL9A 3VPZA 4DQPA 4DB3A 5E84A 2HNZA 4FLTA 3MN6A 4B1UB 4U7BA 5FROA 4DFJA 1BL3A 4I9QA 1ZBSA 3N4QA 3TAMA 3NVMA 4PQUA 1N34K 5CYMA 4KHPK 2V52B 1MDUB 4CJTA 2O4IA 1E4GT 4KBOA 2P9UA 2ZM6K 4BDYA 4Q0BA 2YHWA 2P9LB 3P83D 1A5WA 3KIOA 3OS2A 2P9SA 3S3OA 3SAFA 3TARA 3DJCA 3NH0A 3UIQA 3O3HA 5GIPA 4FK4A 4KH6A 5KRSA 4ISGA 4FLVA 3QLHA 1ZYQA 4YHHK 2O8BB 3EE9A 4BC2A 1VQNN 4CJ7A 3F9KA 1TYQA 2NRZA 3Q7CA 4FWOA 5CE3A 3H1QA 3AVHA 2FBYA 3SQ0A 1T6CA 1VQPN 1LW2A 2P9IB 2RE2A 3OYBA 1T6DA 2QXFA 1K6YA 3DXKB 3O9SA 4RG8A 4DQ8A 3AVLA 4NCBA 2P9NB 1GLLO 2IVPA 1DTTA 4BC4A 1ZBIA 3VEYA 5M1QA 2OANA 1C1BA 1D8YA 2A40A 4H8KA 2Q0UA 3VMFB 3SK3A 4FXDA 4PKIA 2Y1JA 4F8RA 1LWCA 1Q81O 4FJNA 2QM1A 3KVGA 1NGJA 4WFBL 4CECA 1G99A 4KHQA 4JD2B 3WEEB 2KZZA 5C2DA 2ZD1A 1N5YA 4MO5A 4CZEA 5T7BA 4JHDA 1BCMA 2GUIA 3VQ8A 4UY8O 4AH9A 2IOCA 4LF6K 5F0XA 3E9LA 1NGGA 3CFPA 4QS7A 3HSCA 4CGGA 5JMVA 2D0PA 3KWGA 4JI5K 5CZ2A 3WXLA 4BY9C 2BTFA 4XEIA 3ENBA 1S1VA 3J80O 4MDAA 3ZSZA 1ESVA 1JLAA 3GG4A 3MMVA 1KFSA 3MN5A 1K8AO 3BEXA 4BR9A 4CD1A 1RDBA 4B3TK 3V4IA 3K9KA 4G1QA 4LSLA 2VG7A 4DMNA 3MDQA 2QK9A 2HNYA 2YHBA 4YORA 1QQMA 4DQRA 4B3MK 1TK0A 3HVTA 5I3UA 4OVLA 2V7ZA 4JKCA 3KD5E 2CGLA 1N32K 1BIZA 1ZBHA 4CJUA 3H46O 4CVNE 4CZFA 4NB4A 4A61A 3MCAB 1J53A 3CPEA 3VQQA 3AA3A 2GWKA 1BQMA 1RT3A 4AHCA 3DLGA 3O80A 4RWTA 4BG9A 4W5QA 2VG5A 2UXDK 4CJSA 4N41A 1F21A 2UUAK 5BREA 4AF1A 1C0TA 3NVKA 4JKEA 3CG7A 4I6MA 4AM6A 3OYFA 1J9AA 4F3TA 1VSHA 3DOKA 5I9EB 4BRIA 3CHWA 4JV5K 3CQXA 5KI6A 3L0QA 1BCOA 3A0IX 3CJ7A 2E2NA 3TSUA 3JXUA 4DV1K 4IEIA 3ALYA 4N56A 1WUAA 4O55A 3ZSYA 5LJWA 3NMUA 5FPDA 3SJHA 1X9WA 5J2NA 3ITHA 3CJCA 1Q8IA 2GUPA 4IDKA 5AQJA 3HM9A 1CXQA 1FJGK 1WLJA 4YY3K 2E20A 1KAYA 5AQIA 5HRPA 3HPGA 1TL1A 5JLHA 4ELTA 4CJQA 3SUOA 3VTHA 4DTSA 2WUSA 3OYCA 2UXBK 2UU9K 3LM2A 4NCGA 3OBWA 1YTAA 3F2KA 1SKRA 5CY4A 2VWKA 5BRDA 5HOOA 3J7YP 1NG9A 3HI0A 2QWQA 1BU6O 3D45A 1L3TA 4MDBA 3E9OA 4Z0UA 1LWEA 2IAJA 2XY6A 3ZSWA 1IV0A 3QO9A 1J5OA 1KLMA 4IKFA 4CZHA 4YDUA 1QZ6A 3BZKA 3R9PA 3LM9A 4JI0K 4M45A 4BREA 1NKBA 3I55N 5D3GA 3D7EO 1VQ7N 5BPMA 1RNHA 3O8MA 1TAUA 5AQZA 3SMPA 3NF9A 4AHUA 4JI6K 4BGBA 5AQYA 2ASOA 3PIOL 4MO4A 5KPZA 5AQQA 4Z94A 4CK3A 1KVAA 3RWUA 1R0AA 3V6DA 4DSFA 1JJ2M 4W5RA 4BR0A 1KXPA 4CCHA 3DRSA 3I0SA 4CGHA 1VQON 5SZTA 1BISA 3MAQA 4DR7K 2OCEA 1Z26A 3C6UA 3DYAA 4DR3K 4KTZA 1EQYA 4M3WA 1C0MA 3CCUN 4DF4A 5H1SQ 3ZT2A 4C8LA 3K5MA 4JKGB 3LP2A 1S6QA 1QQOA 4B9QA 3EZ5A 1K9MO 3ULEA 5KPTA 4CJ5A 2YNFA 1RBVA 4PL7A 4DTMA 2UUBK 3AVAA 4FOEA 4DCHA 4ICLA 4DV0K 3M6GA 2YI1A 4C8MA 4Z4CA 2E8AA 4QS8A 3JSMA 3SUNA 4C8OA 5AZJA 4JRQA 4BRLA 1QVFM 3RRHA 5BPLA 1J5EK 4B3SK 4ZTJA 2RPIA 4K25A 3KK2A 1WAJA 2ZF5O 4N47A 4GV9A 4K42A 4DSJA 2NRTA 3M8RA 4DUZK 4CJ3A 3LALA 3NE6A 2E6MA 3PSFA 3M3ZA 4FZYA 3AO2A 4LSNA 3O3FA 3QFUA 4O4GA 2G8FA 3SQ2A 2YJFA 3K9JA 4OGCA 3NAEA 1NMDA 3VENA 1HPMA 4C1NI 3CQYA 2IVNA 4PA1A 4CGDA 2VG6A 4CHOA 3V9XA 5KPRA 4HHTA 4IJNA 1TUUA 2D4WA 3LAKA 4FWQA 4KB0A 1NK6A 4FYDA 4CF8A 3VQ4A 5KTQA 3ZSOA 3AVIA 3UKRA 4DQIA 4DLEA 3O6WA 2HHWA 4DU4A 2UYTA 4FM2A 3NGZA 3VQDA 2GEMA 4BE2A 1NGFA 2KTQA 4A59A 3PX4A 4JI4K 1X3NA 4JI2K 5AQOA 2EWSA 3JAMO 5AQSA 3MECA 3JYTA 1WAFA 5JS1A 3TTFA 3ZT1A 3SAHA 1W0HA 3U3GA 4O0IA 2HHQA 4F3OA 5JVGL 2FC0A 1WNSA 4DQSA 3U6FA 3AVNA 2NUBA 5AQVA 3HPOA 1NK0A 2FF3B 1KVCA 2OZSA 4GY2B 4FVMA 3WQUA 1DLOA 4GMJB 3EN9A 4BVPA 1QQNA 1YAGA 4J2BA 1Q18A 1O13A 4X65K 2NNWA 3KLIA 5TKWA 1LAVA 4CHPA 1FKOA 4IEEA 2KW4A 3P31A 5AQHA 3O4QA 4WF9L 1G15A 3E9PA 3BF3A 4DTUA 4CJ4A 1WB9A 3SMSA 4JKFA 4BRFA 5BR8K 3SJJA 5C12A 3SCXA 5AR0A 4RW4A 4CZIA 2NZTA 4JS5A 1S6PA 1QVGM 3OTOK 1JL2A 3AA4A 2CGJA 5AFUH 3SUPA 4CJKA 2Z1JA 3OYGA 3HP6A 3L2QA 4BRMA 2PY5A 4RW8A 1J6ZA 3EO3A 2FSNA 1KRPA 1YXQA 3EKUA 4A5AA 3AARA 3C65A 4IFYA 3KLFA 3AO5A 4BRGA 3IRXA 4AILC 3SV3A 3PX0A 4KTQA 3D6RA 3PUFA 3HBTA 1M1KO 2FBVA 5ELZA 1BGXT 2FF6A 3MCPA 3M8PA 2F8SA 1S1UA 3LZIA 4CEEA 4DFMA 2G8WA 1SQKA 3MEEA 1RT7A 2O8EB 1R59O 3DXMA 4RTFD 3WQTA 4Z4GA 4EFHA 5B8HA 4KI4A 4ELUA 3ZEUA 2ZJPL 3CCEN 4J2AA 3P5JA 4DR1K 3AGKA 3HT3A 1EO1A 4LF5K 4B9TA 3ZETA 3EYZA 4QOZB 3BP8A 4E1NA 2F8TA 3THWB 2VCPA 4OKJA 4DFKA 3QEWA 2QKKA 3G6EN 4YDUC 1U45A 4JI3K 4BRDA 3ZLJA 1NGBA 1UOCA 1NK4A 1N6QA 3KTQA 1IJJA 1KFDA 2RN2A 3P1GA 5DM7L 3NHGA 3AO3A 1BWFO 3HZ6A 2BDPA 4FJJA 2DPNA 3O5BA 2XO7A 4FJKA 1VRTA 4BWMA 3V1QA 4DTRA 3O1BA 4K43A 1W7AA 2V51B 2AA4A 2OPRA 3P39A 4B3RK 2HMPA 4YOUA 1HNWK 4UQGA 3ID8A 1QZ5A 2QEXN 4CERA 3UB5A 3I0RA 1TAQA 3T7ZA 3WXMB 3DLHA 1YHQN 1NMNA 3FE1A 3SV4A 1ATSA 2A1SA 1RBUA 1SZ2A 1SKSA 3R1XA 1HJOA 5M1FA 4MFBA 3U9ZA 3PY8A 2I5JA 3FFKB 2G8UA 1P8ZA 4M41A 1VSLA 3EE8A 4ZHRA 4BE0A 2Q97A 1ZBUA 2O8FB 2E4LA 4KI6A 4B9VA 3MXMA 1IO2A 2QWMA 1QHAA 1D9FA 1TL3A 3LDQA 3MX2A 4FOIA 2XY8A 4XH5A 3THWA 5KGWA 4GVMA 2AP1A 4JEPA 1T7PA 1YITN 1C6VA 1VQKN 2VGNA 4W5NA 3ZX0A 1HPZA 5HLFA 1W9HA 1QS4A 2KLAA 3VEZA 3O08A 4H5VA 4NXNK 4MLHA 1D9DA 1HMVA 4B1WB 1BI4B 2VYPA 1SL1A 3VGLA 4CIGA 2E88A 3C6AA 1NGHA 2E2PA 4U67L 4CE9A 4CEOA 4FWLA 4LF8K 1RTIA 3DI6A 5HBMA 4CIEA 2ZWHA 4Y1DA 3AVCA 4FPAA 3H08A 1RGIA 1Q7YO 4E1JA 3DRRA 4DTOA 1O1WA 2IDOA 2E1YA 3O9TA 4RW6A 3K5NA 4F2RA 4M3UA 3HYFA 4O5BA 4B9UA 3BUZB 4JI7K 3KLGA 2HBLA 3B6OA 2FBXA 1KCFA 3AVKA 5ADXA 1X9JA 4OJRA 3QETA 4CD3A 2P9PB 3SAGA 1NLVA 4JK9A 4DHYA 4Q5VA 3SLCA 3DM2A 1NOYA 4FJ9A 1W97L 4H0VB 3W0LA 3G4SN 4DKWA 4FJ8A 1JLEA 1HKCA 3SPYA 1U4BA 4J2DA 4CBWA 3LPTA 4K41A 2HNDA 2HOEA 3NCIA 1NGCA 3BGRA 4GV3A 4IG3A 3FZMA 1SKWA 3ZT4A 1WBDA 5AJ3K 4BACA 1WBBA 3MXJA 2JGUA 4KFBA 1HQUA 4O8KA 1XWLA 1IBLK 4FJ7A 5JVHL 1BUPA 4CBUA 3VEWA 2IVOA 3IKMA 3O4NA 4CBXA 1BHLA 4LFBK 3HO1A 4E7LA 4JRPA 1K8KB 3LDOA 3QEVA 4HUGA 1GLFO 4NLCA 5LMUK 4C23A 5HRNA 4E7KA 2P9NA 4A5BA 3CMEN 2WTUA 2Z1HA 1TYQB 3DOLA 1GLJO 2KFNA 5AFUA 3SNNA 2OA8A 4NXMK 4H03B 4DSEA 3KD1E 1TUYA 3H3OB 4BRCA 2O8DA 3WNFA 1ASWA 4CZLA 2YNHA 2WBNA 1GLCG 4DSLA 4IO9L 2HMIA 3LL3A 1ZBLA 2WFBA 2P9KB 4JNEA 4NYNA 3HTVA 1SL0A 3SI6A 4WQ5C 3BY5A 1YVNA 1HLUA 1XUPO 3LDNA 3VQBA 2YKMA 2ZE2A 4FWMA 1XQSC 2QKBA 2F4VK 2G8IA 4M42A 4B3OA 2YNGA 2YHYA 3C7NB 1K73O 5FPEA 2HVHA 4CFBA 4DLGA 2R7YA 1YJWN 1KLNA 2W6LA 3WNEA 1HQEA 5GINA 3C6HA 4DTPA 1VSFA 1CZAN 2OTJN 3K5OA 3LANA 3CERA 1V4TA 4PWDA 3THVA 4C8NA 5C42A 4CJWA 3OJUA 3FGUA 4LH5A 3HK2A 3FLCO 3D0PA 4DSKA 3JS6A 4KHSA 3IUCA 2P5GA 2E6LA 1Y64A 3V9ZA 2G8KA 1GLBG 3L8BA 1TK8A 4LD0A 5AQUA 5J1EA 3KHYA 1S1WA 3H3NO 4FM1A 1RTHA 2ZJRL 3PO4A 2ETJA 2Q3SA 5GIOA 1NKEA 3L2WA 1RBRA 2WOMA 2CGKA 3THXB 3AAQA 3OA9A 1QE1A 5AQLA 5AQWA 1FXXA 1C0GA 5LMNK 2D5RA 4FLWA 2HF3A 4FJXA 3TABA 2P9KA 1ZBFA 1RDUA 1HNZK 2D0CA 3GL1A 2E1ZA 4EZ9A 2D1KA 1XI1A 1YTUA 3GOIA 1YI2N 1YJ9N 4CFAA 4YOTA 1RDDA 2ITGA 4H5TA 1BA0A 1OH8A 1ASVA 4XH4A 3NGIA 5C2FA 2BGGA 4IFVA 2HF4A 2NRRA 4DWIA 1IKWA 5IT9O 1IKXA 1L5UA 4PKHA 4L3QA 2Q31A 3WUHA 2KQ2A 1N33K 2Q36A 1SL2A 1BO5O 4BGAA 3OS0A 1RTDA 1XMOK 3WEEA 2X74A 1Z05A 3GBTA 2P9IA 3BF1A 3O1WA 4FJ5A 5EU7A 3B8AX 3DRPA 4HVJA 5K14A 2IIRA 4B1VA 2P5OA 1ASUA 3K5LA 4CZMA 4CEAA 1JLFA 3TAPA 4JI8K 3HP9A 4JLHA 4ILGB 5GAHP 3D2FB 5E26A 4BWJA 3CMAN 4CF9A 3ZETB 4ID5A 3IG1A 3RSEB 3J8AA 4WQ4C 2HHVA 1LWFA 3EL2A 1Z6RA 1VSMA 3THYB 5J2PA 4OPKA 4IOAL 3VETA 4FLUA 1HRHA 1U47A 2G8VA 1S1TA 3ZYYX 3ZSXA 5GAGP 3OYLA 3CCMN 3A5NC 3SUQA 1HNIA 2P9LA 3C6TA 3OHRA 4Z4FA 3F73A 4AHTA 3T19A 5BRHA 5CHIA 3VESA 4JK8A 3TR8A 1GLEG 4BR4A 5AQPA 4KHUA 3WXJA 4FZZA 1HX1A 2B5JA 2YV0X 2XY5A 3HJFA 4H5NA 4EIAA 2DY4A 4IFEA 3QICA 2PFUA 3J7ZO 1KTQA 4BVOA 5M1KA 1L3UA 4Z4EA 3G71N 5BPNA 1C0UA 3CCRN 3RMAA 4JI1K 4J8FA 1H1VA 2KFZA 4ELVA 4KAZA 5EY4A 5TKYA 2GX9A 1HJRA 4Z4HA 4AQYK 1TKZA 3DLRA 4FJMA 3C7NA 4L8RB 4E7JA 4FWPA 4CF1A 1Q9YA 1HR0K 4IZ9A 3PO5A 5AQKA 3VF6A 1QQCA 3M8QA 4CW7B 4YOWA 2Z1GA 3VEXA 3H6EA 4KHNA 3T69A 4CHQA 4PY5A 1OKJA 3PV8A 2HHHK 1B9DA 1T44A 1VAZA 4BRAA 1YVUA 3S3MA 2ATQA 3VGKA 4PHTX 4WE1A 3K2PA 1BG3A 2F9TA 1S9EA 4B9LA 4AHSA 1EX4A 2A1RA 3LZJA 3V9UA 4I2QA 2OPQA 1HUXA 1Q9XA 5FLXO 3FZHA 4QCLA 3NFAA 4KPYA 4JAXA 3UKRB 4DV6K 1BQNA 1XMQK 2H3GX 3LAMA 3CJAA 1C0FA 4BC3A 2GV9A 4EAHD 4LFAK 4Y1CA 3VEVA 3PSIA 3GE1A 3CCJN 4CEDA 2EHGA 2QWRA 4LF9K 2VGMA 3CM6A 4OPHA 3NDKA 3LP0A 2QWNA 4CIFA 1DEJA 1Z25A 3KZBA 4FVUA 2I7PA 3ASMA 5MLCQ 2DFHA 2BANA 4OPJA 4KRFA 4KHYA 4DG1A 5KGXA 3OVNA 5AQGA 3QNNA 5I42A 4E1MA 4KHWA 3VQ7A 3IFRA 5KQDA 1NJZA 4N5SA 3L6QA 5C25A 2NLXA 3KJVA 2F9WA 3CJ9A 2JLEA 1NK7A 3AO4A 3NGYA 1NJXA 1U49A 2IS3A 3N4PA 4OKEA 2UUCK 1IKVA 4GV6A 1JCGA 1ATRA 2W41A 2YX6A
chains in the Genus database with same CATH topology
2ZWHA 4FWKA 3O80A 2J4RA 3QDKA 4RWTA 4BG9A 4FSVA 4FPAA 1KC8O 1RGIA 3M5RA 1Q7YO 5C0YA 4E1JA 3HOSA 3R6MA 5BREA 4A2AA 4ILHA 4LC9B 4AF1A 3DAWA 3CJ1A 3NVKA 4JKEA 4G9ZA 1BA1A 4I6MA 2A5XA 3WXKA 4AM6A 4MLEA 1BOTO 2E1YA 1MWKA 3QMLA 3O9TA 4H0XB 3VGMA 5I9EB 1VQ8N 4BRIA 3CHWA 1YIJN 3CC7N 2QWLA 3CQXA 3CCSN 3L0QA 4IDHA 3A0IX 3CJ7A 3HM8A 1LCUA 2E2NA 3TSUA 3TSQA 3JXUA 3EZWA 3VOVA 3VTIA 2A3ZA 3CCLN 4IEIA 4BR5A 2ZJQL 4IWVA 2JWKA 3BUZB 3ZX3A 4BR2A 2HBLA 1WUAA 4HTLA 5ADXA 5LJWA 3NMUA 1X9JA 5FPDA 4FWRA 3SJHA 2KHOA 3U9DA 5AQFA 2A6AA 4CD3A 3CJCA 2GUPA 2P9PB 5AQJA 4CZJA 3SAGA 3S41A 2D0OA 1NLVA 4JK9A 3U4LA 4DHYA 3SLCA 1JCFA 1S3XA 3MWPA 5AQMA 2E20A 4I6MB 1KAYA 5AQIA 1W97L 1K8KA 1DKGD 3L4QA 4H0VB 3W0LA 4CZGA 4DKWA 3G4SN 1D4XA 1HKCA 3O9UA 4OPAA 5JLHA 3CXCM 3VTHA 4BQZA 4CBWA 1T3VA 2WC9A 4K41A 2WUSA 4BRPA 2PBDA 2HOEA 3LM2A 1NGCA 4JKDA 4BRHA 3OBWA 4GV3A 3I33A 3F2KA 5BN9A 3FZMA 4BRKA 2QWOA 1YUWA 1U6ZA 4IOXA 4WCEL 5BRDA 5HOOA 3HI0A 4O8KA 5M1NA 3IMXA 2QWQA 1BU6O 5JVHL 4H0OA 1BUPA 4PL8A 4CBUA 1WOQA 3D2EA 2IVOA 3E9OA 3IKMA 4MDBA 3VEWA 2ITMA 5C10A 3CF5L 4CBXA 4BROA 2OTLN 2ZGZA 1K8KB 4CZHA 3MN9A 3AY9A 1NWKA 1QZ6A 2Q2RA 3LDOA 4YDUA 3R9PA 5C15A 1GLFO 3LM9A 4NLCA 4IOCL 4B1ZA 4BREA 4C23A 3FR0A 4BG8A 3I55N 5F2RA 1SS6A 3D7EO 2P9NA 4A5BA 1VQ7N 3CMEN 5BPMA 3O8MA 1TYQB 5AQZA 4YOXA 1GLJO 3SMPA 5AFUA 1VQ5N 3CI5A 4H03B 3L4IA 4BGBA 1TUYA 3H3OB 3A8YA 2ASOA 5AQYA 4BRCA 4MO4A 3PIOL 3ENOA 5KPZA 2E2OA 5AQQA 4CZLA 2FLOA 4Z94A 4NLBA 4JKBA 1JJ2M 4BRQA 2WBNA 2Q1NA 2HSTA 1GLCG 4M7YA 4IO9L 4BR7A 3LL3A 4M7XA 1KXPA 2WFBA 2P9KB 3IDHA 4JNEA 4BR0A 3HTVA 3CC4N 3PLAA 4WQ5C 3FZLA 1NGEA 2QI2A 1YVNA 1HLUA 1YJNN 3O9RA 1VQON 5JICA 1XUPO 3LDNA 1NJIO 5ADXH 1KQSM 2FSJA 4FWMA 1XQSC 5EOYA 1EQYA 3CCUN 2QW9A 3A5LC 2NRHA 5H1SQ 3R8EA 2YHYA 1GLAG 1LOTB 3C7NB 4ISFA 4JKGB 5BN8A 5FPEA 4Y0WA 3ZEUB 1K73O 4JKAA 1QQOA 4B9QA 1K9MO 1NM1A 3ULEA 1W2BM 1YJWN 5KPTA 4ILJA 4FO0A 4IJAA 4PKGA 4PL7A 5GINA 3C6HA 4BRNA 4FOEA 3WT0A 3FZKA 2BUPA 4DCHA 3KK7A 1CZAN 1N8RO 2OTJN 1DGKN 1X3MA 4QS9A 3M6GA 2YI1A 3CERA 1BDGA 1V4TA 5FPMA 2E8AA 4QS8A 3CD6N 4YOYA 3OW2M 2PAVA 3FGUA 3ID6A 3FLCO 4WYBA 3VEOA 4BRLA 5AZJA 1QVFM 5BPLA 1OVYA 3JS6A 3RVCA 3O9QA 3IUCA 4K25A 1Y64A 3QBWA 2ZF5O 1RDWX 4H0TB 4GV9A 1GLBG 4K42A 3CC2N 2NRTA 1V4SA 3ATVA 4JKGA 4A62A 3CCVN 3TPQA 5AQUA 1KAZA 1M90O 2W40A 3UE5A 3R3LA 3KHYA 2KKZA 3H3NO 3M3ZA 2ZJRL 3AGRA 3QFUA 5GIOA 4FWSA 5M1PA 4YOVA 4JK7A 2YJFA 5GADP 2NRVA 3F5TA 2CGKA 3K9JA 4WQ4A 3AAQA 3OA9A 5AQLA 5AQWA 3UKUA 1NMDA 3VENA 1HPMA 4C1NI 3CQYA 1C0GA 2IVNA 3VF4A 5KPRA 3VF2A 4IJNA 2HF3A 1Q86O 3WXIA 1TUUA 2D4WA 2P9KA 4FWQA 1RDUA 3C0BA 3DXMB 4IO8A 3UKRA 3GL1A 2E1ZA 2QTDA 3E66A 2QA4N 2D1KA 3O6WA 2UYTA 3GDQA 3GOIA 3H1VX 5FPNA 1YI2N 2A42A 2I7NA 2GEMA 1YJ9N 1NGFA 1NBWA 2NRWA 4YOTA 3SBTA 4A59A 3CIPA 4H5TA 5HL7L 1BA0A 2ZGYA 1IG8A 1X3NA 3P38A 4XH4A 4BQLA 5C2FA 4FWNA 5AQOA 2EWSA 2F7TA 5AQSA 3TSPA 2HF4A 5AQXA 3EKSA 3TTFA 3SAHA 3U8XA 2YCHA 2YJEA 2GTDA 2NRRA 3H45C 3MWTA 3DXKA 5EX5A 5JVGL 4JN4A 4NO7A 4PKHA 4L3QA 4KH4A 4WFNL 2BH1A 2Q31A 3WUHA 1MA9B 5AQVA 2Q36A 1VQLN 3QBXA 1BO5O 3G25A 4BGAA 1GLDG 4AM7A 2RHKA 3LDPA 4FPBA 3CPWM 2FF3B 4IXCA 3TTDA 3WEEA 3FZFA 3O1WA 1Z05A 3GBTA 2P9IA 3BF1A 4GY2B 3WQUA 3I56N 2HBKA 3EN9A 4BVPA 5M1OA 4WQ5A 1VQ4N 3B8AX 1ZXOA 1QQNA 1YAGA 4B1VA 2IIRA 1KD1O 2NRXA 2QXLA 1Q18A 5LY3A 4M63C 1O13A 2NNWA 4CZMA 5TKWA 4CZKA 3OBYA 3TU5A 3MK6A 3DLLL 4IEEA 2ASMA 4RCHA 3ENHA 5LJVA 3QFPA 4ILGB 4JHDB 3P31A 4O8UA 5AQHA 4F9OA 5GAHP 3KWIA 4WF9L 3E9PA 1Q82O 3BF3A 3D2FB 5JLFA 5E26A 3CMAN 5BR9A 3ZETB 3RSEB 3J8AA 4B1XB 1HKGA 4WQ4C 3SMSA 3AAPA 4JKFA 4BRFA 3EL2A 5BRFA 1Z6RA 5C12A 5AR0A 3ZX2A 4CZIA 4IOAL 3VETA 2NZTA 4OO1J 3ULEB 1QVGM 3W3DA 2CGJA 3A5MC 5AFUH 3CETA 3ZYYX 5AZJB 2YHXA 3DWLA 5GAGP 1U2VB 4A2BA 4R79A 4BRMA 2P9SB 5F1XA 3CCMN 1VQ6N 3A5NC 1J6ZA 2P9LA 2FSNA 3EO3A 3OHRA 1YXQA 3EKUA 4A5AA 3PIPL 1ZC6A 3AARA 5BRHA 3D2FA 1NGAA 3VPZA 4FL9A 5CHIA 3ATUA 3VESA 3C65A 3HOTA 4JK8A 4DB3A 4BRGA 5E84A 1GLEG 4BR4A 5AQPA 3WXJA 1HX1A 3MN6A 4B1UB 4U7BA 3D6RA 3HBTA 1M1KO 4H5NA 4EIAA 5ELZA 4IFEA 1ZBSA 3N4QA 3QICA 2PFUA 3NVMA 4H5WA 3J7ZO 2FF6A 4BVOA 5M1KA 3MCPA 5AQTA 3G71N 5EVZA 2V52B 1MDUB 1E4GT 5BPNA 1SQKA 4KBOA 2P9UA 3CCRN 1VQMN 1SAZA 1R59O 3DXMA 3P4IA 3RSEA 4RTFD 4J8FA 3WQTA 2YHWA 1H1VA 4EFHA 5B8HA 2P9LB 3ZEUA 1P90A 4A57A 2P9SA 2ZJPL 3CCEN 4GVEA 2E2QA 5EY4A 5TKYA 3SAFA 3AGKA 3DJCA 5DM6L 4WFBL 2GX9A 5GIPA 1EO1A 4C1NK 3ZETA 4KH6A 3BP8A 4ISGA 2A41A 4U67L 3D2EB 4KH5A 3C7NA 2VCPA 4FWPA 2Q0RA 3EE9A 4BC2A 3F9MA 1VQNN 4CJ7A 4IZ9A 3G6EN 1VQ9N 5AQKA 1JCEA 1TYQA 2NRZA 3Q7CA 5CR4A 4YDUC 3VF6A 4FWOA 3HRGA 5CE3A 4YOWA 3H1QA 2CH6A 3VEXA 3H6EA 4BRDA 4EHTA 3T69A 1NGBA 5AZIA 2QWPA 1T6CA 1OKJA 1IJJA 1DT9A 4B1YB 4WFAL 5DM7L 1VQPN 1S22A 2P9IB 1BWFO 3HZ6A 2RE2A 1T6DA 2DPNA 3DXKB 3MX5A 3O5BA 3O9SA 4O5FA 3SBGA 1T44A 4DQ8A 1VAZA 4BRAA 2P9NB 1GLLO 1U2VA 2IVPA 1ILYA 3O1BA 4K43A 2CH5A 4BC4A 2VWBA 2ASPA 2AA4A 2V51B 3VGKA 3P39A 4PHTX 2HMPA 3QB0A 3VEYA 2P9PA 4YOUA 4JD2A 5M1QA 1BG3A 2F9TA 3ID8A 1QZ5A 2OANA 4GNIA 1NGIA 2A40A 2HBJA 4H5RA 3UB5A 2QEXN 2Q0UA 3VMFB 1ATNA 3SK3A 3T7ZA 3WXMB 2GWJA 1HUXA 4PKIA 3MN7A 2GELA 5AQNA 3FZHA 1YHQN 4JAXA 3FE1A 3UKRB 1Q81O 2JWLA 2H3GX 3CJAA 2QM1A 1C0FA 1ATSA 3KVGA 4BC3A 3CCQN 1NGJA 1SZ2A 4EAHD 3LDLA 4CI6A 1G99A 1MWMA 1HJOA 2HBMA 3R1XA 4JD2B 3WEEB 5C2DA 1S72N 3VEVA 5M1FA 3U9ZA 3GE1A 3CCJN 4MO5A 4CZEA 3FFKB 4JHDA 1P8ZA 2FXUA 1E4FT 2QWRA 4UY8O 1KAXA 3EE8A 2VGMA 5F0XA 4OPHA 3TTCA 3E9LA 2QWNA 1XC3A 1DEJA 2Q97A 2FSKA 1NGGA 2P9UB 4QS7A 3KZBA 3A5OC 3HSCA 4FVUA 2I7PA 1YF5L 5MLCQ 3UKUB 5AQRA 3O4WA 2D0PA 3M1FA 5JMVA 3KWGA 3E1YA 4H0YB 3WXLA 4BY9C 2BTFA 2QWMA 1QHAA 4XEIA 3ENBA 4MDAA 4BC5A 1ESVA 3GG4A 3I8BA 3LDQA 3MMVA 3MX2A 4FOIA 4H0PA 5AQGA 4XH5A 3MN5A 1K8AO 3BEXA 4BR9A 2AP1A 3IFRA 4JEPA 4CD1A 5KQDA 5GAEP 1YITN 3K9KA 3L6QA 2VGNA 1VQKN 4XH1A 3MDQA 3ZX0A 2NLXA 4YORA 1QQMA 2V7YA 1RFQA 2F9WA 2KLAA 3O08A 3VEZA 4H5VA 5EXWA 4MLHA 4EHUA 5AZIB 3CJ9A 2V7ZA 4JKCA 4B1WB 2VYPA 2CGLA 3VGLA 1HKBA 2E88A 1NGDA 1NGHA 2E2PA 3C6AA 3H46O 3N4PA 4JKHA 4CZFA 3CJBA 4NB4A 4A61A 3MCAB 4HWIA 4ISEA 4FWLA 4GV6A 1JCGA 3CPEA 1ATRA 3Q7BA 2W41A 5KQ8A 3VERA 2GWKA 2YX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE8 A;  3KWI A;  2RHK A;  2KKZ A;  3P39 A;  4OPH A;  3M5R A;  3F5T A;  3P38 A;  3OA9 A;  3KWG A;  3O9T A;  2GX9 A;  3D6R A;  3RVC A;  3O9Q A;  3L4Q A;  3O9S A;  3O9U A;  4OPA A;  3P31 A;  3O9R A;  3EE9 A; 
#chains in the Genus database with same CATH topology
 2J4R A;  3QDK A;  4J2E A;  4FSV A;  5LL6 Z;  1NJW A;  4M3R A;  4DF8 A;  3HOS A;  2O8F A;  3AVF A;  4CJE A;  4LC9 B;  2D0A A;  3K57 A;  1HNV A;  3CJ1 A;  3L3U A;  1BA1 A;  3WXK A;  4MLE A;  1XC9 A;  3NF7 A;  1MWK A;  4GKK K;  4H0X B;  1VQ8 N;  4ID1 A;  3OJS A;  3PX6 A;  1UWB A;  1S9G A;  3CC7 N;  3WNH A;  3CCS N;  3CFO A;  3HM8 A;  4W5T A;  3CCL N;  1TK5 A;  4IBN A;  1RBS A;  3VTI A;  2ZJQ L;  4BR5 A;  4IWV A;  3VQP A;  3ZX3 A;  4BDP A;  4FWR A;  2KHO A;  3U9D A;  4DU3 A;  1IH7 A;  1BI4 A;  2A6A A;  3KLH A;  2ZQB A;  1HYV A;  3S41 A;  3U4L A;  3OS1 A;  3TAN A;  1OVQ A;  1JCF A;  5AQM A;  1D5A A;  4I6M B;  3TAQ A;  1DKG D;  1MU2 A;  1HYZ A;  4CJV A;  4OPA A;  4FCY A;  1JKH A;  3QNO A;  4BQZ A;  1J54 A;  2X6S A;  3BDP A;  1BIU A;  1T3V A;  2WC9 A;  1OH7 A;  4BRP A;  4HUE A;  4EZ6 A;  4BRH A;  4K8X A;  2X6N A;  2IC3 A;  4BRK A;  2VWJ A;  4HCB A;  4FK0 A;  2QWO A;  1YUW A;  1EP4 A;  3V1O A;  3RMC A;  1U6Z A;  4IOX A;  3K59 A;  1FKP A;  3IMX A;  4LF4 K;  2O8C A;  4H0O A;  5C10 A;  3CF5 L;  5FRN A;  4CGJ A;  2OTL N;  1GOB A;  3AY9 A;  5C15 A;  3SQ4 A;  3FR0 A;  1SS6 A;  4FJI A;  4OLB A;  4YOX A;  1U04 A;  4OKK A;  5DK5 A;  4YNQ A;  3ENO A;  2FLO A;  4CHY A;  4BRQ A;  2Q1N A;  4DV4 K;  3DLK A;  2HST A;  4M7Y A;  4BR7 A;  4CEF A;  4DV3 K;  3V9S A;  3ZT0 A;  4M7X A;  3CC4 N;  1OH6 A;  3OYK A;  4FM0 A;  1YJN N;  3O9R A;  4X64 K;  4CJL A;  4YFU A;  1NJI O;  1NKC A;  3SQ1 A;  1A5V A;  4B9M A;  2DFF A;  1WSG A;  4O0J A;  1DTQ A;  3DMJ A;  3A5L C;  3OYE A;  2G8H A;  4FW2 A;  4Y0W A;  3QER A;  4CF0 A;  3A2F A;  2DFE A;  4ILJ A;  4FO0 A;  4PKG A;  1X1P A;  3NH1 A;  2BUP A;  1DGK N;  3T1A A;  4QS9 A;  3CD6 N;  4HUF A;  4YOY A;  3T3F A;  1T8E A;  2PAV A;  3VEO A;  4WYB A;  3LP3 A;  4CK2 A;  1OVY A;  3V81 A;  2VQE K;  3O9Q A;  3TWH A;  4FJH A;  1E3M A;  1RDW X;  4H0T B;  3CC2 N;  4JKG A;  1V4S A;  3ATV A;  1Y97 A;  4I2P A;  3TPQ A;  3THY A;  1KAZ A;  2PYL A;  1EXQ A;  4DS4 A;  2W40 A;  2O4G A;  3R3L A;  3K0S A;  4JS4 A;  3AGR A;  4FWS A;  5M1P A;  3ZT3 A;  1FW6 A;  2NRV A;  3F5T A;  1RBT A;  4CEQ A;  3UKU A;  1RT6 A;  3BZC A;  1JLQ A;  3VF4 A;  4XIU A;  1IG9 A;  1Q86 O;  3WXI A;  3C0B A;  3DXM B;  1C1A A;  4IO8 A;  2O8E A;  3EEQ A;  5C24 A;  2LSN A;  2QTD A;  2QA4 N;  4CEZ A;  3GDQ A;  5FPN A;  4FZX C;  2A42 A;  4OX9 K;  1NBW A;  4LY7 A;  1NNE A;  1JLB A;  3CIP A;  3VQC A;  3P38 A;  4BQL A;  2XY7 A;  4KTW A;  4RW9 A;  4CGF A;  4E7I A;  4LFC K;  2F7T A;  3ZSR A;  3EKS A;  3U8X A;  2YCH A;  2YJE A;  2GTD A;  3OYN A;  3H45 C;  3MWT A;  3DXK A;  5EX5 A;  1CZ9 A;  3KK3 A;  3LDS A;  5CYQ A;  1XHX A;  4CGI A;  2BH1 A;  5E41 A;  4KKO A;  1GLD G;  2RHK A;  4FPB A;  4DFP A;  3CPW M;  4IXC A;  4BDZ A;  3LPU A;  1ITG A;  4WQ5 A;  1WSF A;  1WSH A;  1I39 A;  3AA2 A;  1ZXO A;  3M8S A;  2NRX A;  1GOC A;  2QXL A;  5LY3 A;  4M63 C;  4HCC A;  1WSE A;  1SV5 A;  3OBY A;  3TU5 A;  3RR8 A;  1TKT A;  2ASM A;  4RCH A;  3ENH A;  5LJV A;  1WN7 A;  4JHD B;  4O8U A;  3KWI A;  5JLF A;  2D0B A;  4IG0 A;  1RIL A;  5FDL A;  1HKG A;  2Y1I A;  3AAP A;  3AO1 A;  1N36 K;  3ZX2 A;  4V19 S;  4Z4I A;  3W3D A;  1HNX K;  3A5M C;  4DTX A;  2YHX A;  3DWL A;  3RMD A;  1U2V B;  3V1R A;  1JL1 A;  1RT5 A;  1VQ6 N;  1NK8 A;  2O8B A;  1A5X A;  3LP1 A;  4H4O A;  1ZC6 A;  1XHZ A;  3VN5 A;  4E0D A;  2YHA A;  3ATU A;  1RT2 A;  3HOT A;  2W42 A;  2KZM A;  4EP4 A;  1OH5 A;  4X66 K;  3NF6 A;  4DU1 A;  1EWQ A;  4H5W A;  3U3Y A;  3S3N A;  5AQT A;  5EVZ A;  4AHR A;  3OYI A;  1TV6 A;  1HYS A;  5A2Q O;  1VQM N;  1SAZ A;  1RCH A;  3P4I A;  3RSE A;  5IWA K;  3HL8 A;  5HRO A;  1P90 A;  4A57 A;  4GVE A;  2E2Q A;  4CJP A;  3VQA A;  5DM6 L;  2OPS A;  4C1N K;  3OYH A;  1TKX A;  4M3Z A;  1RT1 A;  5HP1 A;  2A41 A;  3D2E B;  4KH5 A;  4OLA A;  4X62 K;  2Q0R A;  3F9M A;  1EET A;  1VQ9 N;  1JLG A;  4KO0 A;  1JCE A;  5CR4 A;  3KKS A;  3HRG A;  4K0K K;  2CH6 A;  1VSD A;  4EHT A;  1REV A;  1VSE A;  5AZI A;  2QWP A;  4LF7 K;  1DT9 A;  4B1Y B;  4WFA L;  1NU0 A;  1S22 A;  3G0Z A;  2B4J A;  2F96 A;  3SBG A;  3MX5 A;  1JLC A;  4O5F A;  2HHS A;  2B6A A;  2HVI A;  3HST B;  3TI0 A;  2OZM A;  1U2V A;  1ILY A;  2CH5 A;  2VWB A;  2ASP A;  1B92 A;  3QB0 A;  2P9P A;  4JD2 A;  2PZS A;  3K58 A;  4GNI A;  5SWM A;  1NGI A;  2HBJ A;  4H5R A;  1ATN A;  2GWJ A;  2VQF K;  3MN7 A;  2GEL A;  4FJG A;  2YKN A;  5AQN A;  3QES A;  4PUO A;  2JWL A;  3CCQ N;  3LDL A;  4CI6 A;  1MWM A;  2HBM A;  1S72 N;  3MED A;  4GKJ K;  2FXU A;  1E4F T;  4O44 A;  1KAX A;  1C1C A;  3LWM A;  3TTC A;  1NJY A;  2PYJ A;  1XC3 A;  4K8Z A;  2EX3 A;  1QSS A;  1I3A A;  2FSK A;  1VHX A;  2P9U B;  3A5O C;  1YF5 L;  3CQ8 A;  1QTM A;  3AV9 A;  3UKU B;  4CEB A;  5AQR A;  4F4K A;  3O4W A;  3M1F A;  4QAG A;  2X78 A;  3E1Y A;  3HPH A;  4H0Y B;  4I7F A;  4B9N A;  4BC5 A;  4CFC A;  3I8B A;  5J2M A;  4H0P A;  1TVR A;  1L3S A;  3OY9 A;  1JXE A;  4H4M A;  4E89 A;  5GAE P;  1LAW A;  3NF8 A;  4XH1 A;  3L3V A;  3OYA A;  2V7Y A;  1RFQ A;  1UAX A;  3KLE A;  2IGI A;  4EHU A;  5EXW A;  5AZI B;  4DTJ A;  1HKB A;  1NGD A;  4DTN A;  4JKH A;  3CJB A;  4HWI A;  3KKR A;  4ISE A;  4B8A B;  4DR4 K;  4DR5 K;  3Q7B A;  5KQ8 A;  3VER A;  3VQ5 A;  3VA0 A;  4CHZ A;  4FWK A;  4DV5 K;  1KC8 O;  3ULD A;  3M5R A;  5C0Y A;  3DLE A;  3R6M A;  4A2A A;  4ILH A;  4M3Y A;  3DAW A;  1I94 K;  4RW7 A;  4G9Z A;  2A5X A;  1BOT O;  4DR6 K;  1VRU A;  2E5L K;  3NBP A;  3QML A;  3V9W A;  3EY1 A;  4M3X A;  3VGM A;  1VK0 A;  1JXB A;  1YIJ N;  3VQE A;  2QWL A;  4DR2 K;  4IDH A;  4JYA K;  4C8K A;  1LCU A;  3TSQ A;  3VOV A;  3AVG A;  3EZW A;  4B9S A;  2A3Z A;  4CJF A;  4DUY K;  2JWK A;  3AVJ A;  3RTV A;  4BR2 A;  1CZB A;  3OYM A;  4HTL A;  1X9M A;  3AVB A;  5AQF A;  3AVM A;  4CZJ A;  2D0O A;  3FFI A;  2XHB A;  1S3X A;  3MWP A;  1K8K A;  3L4Q A;  4CZG A;  1D4X A;  1TKD A;  3O9U A;  1QHT A;  3CXC M;  4DSI A;  1YT3 A;  2PBD A;  4JKD A;  3DLB A;  4BE1 A;  1KVB A;  3I33 A;  5BN9 A;  4NYF A;  3WNG A;  1QSL A;  3O3G A;  4WCE L;  4R5P A;  3MEG A;  5M1N A;  4CK1 A;  1EWR A;  2BE2 A;  4PL8 A;  2O8D B;  1X9S A;  1WOQ A;  3D2E A;  1L3V A;  2ITM A;  1T03 A;  4BRO A;  2ZGZ A;  3MN9 A;  4F2S A;  1NWK A;  2Q2R A;  4IOC L;  4B08 A;  3KK1 A;  3TAF A;  4B1Z A;  3LWL A;  4BG8 A;  5F2R A;  4MQ3 A;  2P1J A;  3TAG A;  3ZSQ A;  3T1Y K;  4N76 A;  1RT4 A;  3VQ9 A;  1VQ5 N;  3CI5 A;  3L4I A;  4GW6 A;  3A8Y A;  3CYM A;  2E2O A;  4EP5 A;  4CFD A;  2WON A;  4NLB A;  2HW3 A;  3G10 A;  4JKB A;  3AA5 X;  1VSK A;  3PLA A;  3IDH A;  4FLY A;  1LV5 A;  3TAE A;  2FBT A;  3SPZ A;  4CES A;  3FZL A;  1NGE A;  3ISN C;  1GOA A;  2QI2 A;  2RF2 A;  5JIC A;  3CM5 A;  1UA1 A;  5ADX H;  1KQS M;  2FSJ A;  5EOY A;  3SYZ A;  1KSP A;  4W5O A;  1RTJ A;  2QW9 A;  1NK9 A;  1XNR K;  4FW1 A;  3RMB A;  2NRH A;  2P51 A;  3R8E A;  4AHV A;  1GLA G;  1LOT B;  4ISF A;  5CZ1 A;  5BN8 A;  3ZEU B;  3C94 A;  4FLX A;  4JKA A;  1U48 A;  1NM1 A;  1W2B M;  2GBZ A;  1WSI A;  5DMR A;  3L2R A;  3QIO A;  4IJA A;  2W6K A;  4BRN A;  3WT0 A;  3FZK A;  3MXI A;  3KK7 A;  5HRR A;  1N8R O;  1X3M A;  4OGE A;  5FPM A;  1BDG A;  4M3T A;  3OW2 M;  5KRT A;  1QSY A;  3ID6 A;  3VA3 A;  3QIP A;  1CLQ A;  3RVC A;  3THX A;  4KV8 A;  3QBW A;  2YNI A;  4CJR A;  3CCV N;  4A62 A;  1CXU A;  1M90 O;  3UE5 A;  2KKZ A;  2HHU A;  3QEX A;  3L2V A;  4YOV A;  4E3S A;  4JK7 A;  1TGO A;  1VSI A;  5GAD P;  3ZCM A;  2DTU A;  1FK9 A;  4WQ4 A;  3QIN A;  3CFR A;  3E01 A;  3VF2 A;  4CHN A;  2OPP A;  4NCA A;  1S5J A;  3L2U A;  4FLZ A;  3J7A P;  3OYJ A;  3IS9 A;  4CF2 A;  4DV2 K;  3E66 A;  3NH2 A;  3HVR A;  3H1V X;  2I7N A;  3IAY A;  3SBT A;  2NRW A;  4E7H A;  1IBM K;  5HL7 L;  3OYD A;  2ZGY A;  1IG8 A;  4LH4 A;  1XNQ K;  4FWN A;  4FK2 A;  3TSP A;  2Z1I A;  4I9L A;  5AQX A;  3I8D A;  2HHX A;  2HHT A;  1NK5 A;  5J2Q A;  4JN4 A;  4NO7 A;  4ZTF A;  4KH4 A;  4WFN L;  5JS2 A;  1MA9 B;  2O8C B;  1VQL N;  3QBX A;  3G25 A;  4AM7 A;  5FRM A;  3LDP A;  4HTU A;  1IBK K;  4KRE A;  3TTD A;  4DS5 A;  4DV7 K;  3FZF A;  2RKI A;  3I56 N;  3QEI A;  2HBK A;  2XRI A;  5M1O A;  1VQ4 N;  1LW0 A;  3HXM A;  3B6P A;  1KD1 O;  4DQQ A;  2AJQ A;  4CZK A;  3MK6 A;  3RR7 A;  3DLL L;  4E19 A;  3QFP A;  1RDA A;  3C95 A;  3VQ6 A;  1SUQ A;  1IKY A;  4F9O A;  1Q82 O;  3QEP A;  3S9H A;  1UA0 A;  5BR9 A;  1T05 A;  4B1X B;  2UXC K;  1EKE A;  4B8C A;  1VSJ A;  3J81 O;  5HRS A;  4FJL A;  5BRF A;  4OO1 J;  3SZ2 A;  3T1H K;  1NOZ A;  3ULE B;  1RDC A;  3CET A;  5AZJ B;  1WSJ A;  4A2B A;  4R79 A;  2OYQ A;  4KB1 A;  2P9S B;  4TSX A;  5F1X A;  1B9F A;  1S1X A;  3ZSV A;  3PIP L;  3RRG A;  3D2F A;  1NGA A;  2HB5 A;  4FL9 A;  3VPZ A;  4DQP A;  4DB3 A;  5E84 A;  2HNZ A;  4FLT A;  3MN6 A;  4B1U B;  4U7B A;  5FRO A;  4DFJ A;  1BL3 A;  4I9Q A;  1ZBS A;  3N4Q A;  3TAM A;  3NVM A;  4PQU A;  1N34 K;  5CYM A;  4KHP K;  2V52 B;  1MDU B;  4CJT A;  2O4I A;  1E4G T;  4KBO A;  2P9U A;  2ZM6 K;  4BDY A;  4Q0B A;  2YHW A;  2P9L B;  3P83 D;  1A5W A;  3KIO A;  3OS2 A;  2P9S A;  3S3O A;  3SAF A;  3TAR A;  3DJC A;  3NH0 A;  3UIQ A;  3O3H A;  5GIP A;  4FK4 A;  4KH6 A;  5KRS A;  4ISG A;  4FLV A;  3QLH A;  1ZYQ A;  4YHH K;  2O8B B;  3EE9 A;  4BC2 A;  1VQN N;  4CJ7 A;  3F9K A;  1TYQ A;  2NRZ A;  3Q7C A;  4FWO A;  5CE3 A;  3H1Q A;  3AVH A;  2FBY A;  3SQ0 A;  1T6C A;  1VQP N;  1LW2 A;  2P9I B;  2RE2 A;  3OYB A;  1T6D A;  2QXF A;  1K6Y A;  3DXK B;  3O9S A;  4RG8 A;  4DQ8 A;  3AVL A;  4NCB A;  2P9N B;  1GLL O;  2IVP A;  1DTT A;  4BC4 A;  1ZBI A;  3VEY A;  5M1Q A;  2OAN A;  1C1B A;  1D8Y A;  2A40 A;  4H8K A;  2Q0U A;  3VMF B;  3SK3 A;  4FXD A;  4PKI A;  2Y1J A;  4F8R A;  1LWC A;  1Q81 O;  4FJN A;  2QM1 A;  3KVG A;  1NGJ A;  4WFB L;  4CEC A;  1G99 A;  4KHQ A;  4JD2 B;  3WEE B;  2KZZ A;  5C2D A;  2ZD1 A;  1N5Y A;  4MO5 A;  4CZE A;  5T7B A;  4JHD A;  1BCM A;  2GUI A;  3VQ8 A;  4UY8 O;  4AH9 A;  2IOC A;  4LF6 K;  5F0X A;  3E9L A;  1NGG A;  3CFP A;  4QS7 A;  3HSC A;  4CGG A;  5JMV A;  2D0P A;  3KWG A;  4JI5 K;  5CZ2 A;  3WXL A;  4BY9 C;  2BTF A;  4XEI A;  3ENB A;  1S1V A;  3J80 O;  4MDA A;  3ZSZ A;  1ESV A;  1JLA A;  3GG4 A;  3MMV A;  1KFS A;  3MN5 A;  1K8A O;  3BEX A;  4BR9 A;  4CD1 A;  1RDB A;  4B3T K;  3V4I A;  3K9K A;  4G1Q A;  4LSL A;  2VG7 A;  4DMN A;  3MDQ A;  2QK9 A;  2HNY A;  2YHB A;  4YOR A;  1QQM A;  4DQR A;  4B3M K;  1TK0 A;  3HVT A;  5I3U A;  4OVL A;  2V7Z A;  4JKC A;  3KD5 E;  2CGL A;  1N32 K;  1BIZ A;  1ZBH A;  4CJU A;  3H46 O;  4CVN E;  4CZF A;  4NB4 A;  4A61 A;  3MCA B;  1J53 A;  3CPE A;  3VQQ A;  3AA3 A;  2GWK A;  1BQM A;  1RT3 A;  4AHC A;  3DLG A;  3O80 A;  4RWT A;  4BG9 A;  4W5Q A;  2VG5 A;  2UXD K;  4CJS A;  4N41 A;  1F21 A;  2UUA K;  5BRE A;  4AF1 A;  1C0T A;  3NVK A;  4JKE A;  3CG7 A;  4I6M A;  4AM6 A;  3OYF A;  1J9A A;  4F3T A;  1VSH A;  3DOK A;  5I9E B;  4BRI A;  3CHW A;  4JV5 K;  3CQX A;  5KI6 A;  3L0Q A;  1BCO A;  3A0I X;  3CJ7 A;  2E2N A;  3TSU A;  3JXU A;  4DV1 K;  4IEI A;  3ALY A;  4N56 A;  1WUA A;  4O55 A;  3ZSY A;  5LJW A;  3NMU A;  5FPD A;  3SJH A;  1X9W A;  5J2N A;  3ITH A;  3CJC A;  1Q8I A;  2GUP A;  4IDK A;  5AQJ A;  3HM9 A;  1CXQ A;  1FJG K;  1WLJ A;  4YY3 K;  2E20 A;  1KAY A;  5AQI A;  5HRP A;  3HPG A;  1TL1 A;  5JLH A;  4ELT A;  4CJQ A;  3SUO A;  3VTH A;  4DTS A;  2WUS A;  3OYC A;  2UXB K;  2UU9 K;  3LM2 A;  4NCG A;  3OBW A;  1YTA A;  3F2K A;  1SKR A;  5CY4 A;  2VWK A;  5BRD A;  5HOO A;  3J7Y P;  1NG9 A;  3HI0 A;  2QWQ A;  1BU6 O;  3D45 A;  1L3T A;  4MDB A;  3E9O A;  4Z0U A;  1LWE A;  2IAJ A;  2XY6 A;  3ZSW A;  1IV0 A;  3QO9 A;  1J5O A;  1KLM A;  4IKF A;  4CZH A;  4YDU A;  1QZ6 A;  3BZK A;  3R9P A;  3LM9 A;  4JI0 K;  4M45 A;  4BRE A;  1NKB A;  3I55 N;  5D3G A;  3D7E O;  1VQ7 N;  5BPM A;  1RNH A;  3O8M A;  1TAU A;  5AQZ A;  3SMP A;  3NF9 A;  4AHU A;  4JI6 K;  4BGB A;  5AQY A;  2ASO A;  3PIO L;  4MO4 A;  5KPZ A;  5AQQ A;  4Z94 A;  4CK3 A;  1KVA A;  3RWU A;  1R0A A;  3V6D A;  4DSF A;  1JJ2 M;  4W5R A;  4BR0 A;  1KXP A;  4CCH A;  3DRS A;  3I0S A;  4CGH A;  1VQO N;  5SZT A;  1BIS A;  3MAQ A;  4DR7 K;  2OCE A;  1Z26 A;  3C6U A;  3DYA A;  4DR3 K;  4KTZ A;  1EQY A;  4M3W A;  1C0M A;  3CCU N;  4DF4 A;  5H1S Q;  3ZT2 A;  4C8L A;  3K5M A;  4JKG B;  3LP2 A;  1S6Q A;  1QQO A;  4B9Q A;  3EZ5 A;  1K9M O;  3ULE A;  5KPT A;  4CJ5 A;  2YNF A;  1RBV A;  4PL7 A;  4DTM A;  2UUB K;  3AVA A;  4FOE A;  4DCH A;  4ICL A;  4DV0 K;  3M6G A;  2YI1 A;  4C8M A;  4Z4C A;  2E8A A;  4QS8 A;  3JSM A;  3SUN A;  4C8O A;  5AZJ A;  4JRQ A;  4BRL A;  1QVF M;  3RRH A;  5BPL A;  1J5E K;  4B3S K;  4ZTJ A;  2RPI A;  4K25 A;  3KK2 A;  1WAJ A;  2ZF5 O;  4N47 A;  4GV9 A;  4K42 A;  4DSJ A;  2NRT A;  3M8R A;  4DUZ K;  4CJ3 A;  3LAL A;  3NE6 A;  2E6M A;  3PSF A;  3M3Z A;  4FZY A;  3AO2 A;  4LSN A;  3O3F A;  3QFU A;  4O4G A;  2G8F A;  3SQ2 A;  2YJF A;  3K9J A;  4OGC A;  3NAE A;  1NMD A;  3VEN A;  1HPM A;  4C1N I;  3CQY A;  2IVN A;  4PA1 A;  4CGD A;  2VG6 A;  4CHO A;  3V9X A;  5KPR A;  4HHT A;  4IJN A;  1TUU A;  2D4W A;  3LAK A;  4FWQ A;  4KB0 A;  1NK6 A;  4FYD A;  4CF8 A;  3VQ4 A;  5KTQ A;  3ZSO A;  3AVI A;  3UKR A;  4DQI A;  4DLE A;  3O6W A;  2HHW A;  4DU4 A;  2UYT A;  4FM2 A;  3NGZ A;  3VQD A;  2GEM A;  4BE2 A;  1NGF A;  2KTQ A;  4A59 A;  3PX4 A;  4JI4 K;  1X3N A;  4JI2 K;  5AQO A;  2EWS A;  3JAM O;  5AQS A;  3MEC A;  3JYT A;  1WAF A;  5JS1 A;  3TTF A;  3ZT1 A;  3SAH A;  1W0H A;  3U3G A;  4O0I A;  2HHQ A;  4F3O A;  5JVG L;  2FC0 A;  1WNS A;  4DQS A;  3U6F A;  3AVN A;  2NUB A;  5AQV A;  3HPO A;  1NK0 A;  2FF3 B;  1KVC A;  2OZS A;  4GY2 B;  4FVM A;  3WQU A;  1DLO A;  4GMJ B;  3EN9 A;  4BVP A;  1QQN A;  1YAG A;  4J2B A;  1Q18 A;  1O13 A;  4X65 K;  2NNW A;  3KLI A;  5TKW A;  1LAV A;  4CHP A;  1FKO A;  4IEE A;  2KW4 A;  3P31 A;  5AQH A;  3O4Q A;  4WF9 L;  1G15 A;  3E9P A;  3BF3 A;  4DTU A;  4CJ4 A;  1WB9 A;  3SMS A;  4JKF A;  4BRF A;  5BR8 K;  3SJJ A;  5C12 A;  3SCX A;  5AR0 A;  4RW4 A;  4CZI A;  2NZT A;  4JS5 A;  1S6P A;  1QVG M;  3OTO K;  1JL2 A;  3AA4 A;  2CGJ A;  5AFU H;  3SUP A;  4CJK A;  2Z1J A;  3OYG A;  3HP6 A;  3L2Q A;  4BRM A;  2PY5 A;  4RW8 A;  1J6Z A;  3EO3 A;  2FSN A;  1KRP A;  1YXQ A;  3EKU A;  4A5A A;  3AAR A;  3C65 A;  4IFY A;  3KLF A;  3AO5 A;  4BRG A;  3IRX A;  4AIL C;  3SV3 A;  3PX0 A;  4KTQ A;  3D6R A;  3PUF A;  3HBT A;  1M1K O;  2FBV A;  5ELZ A;  1BGX T;  2FF6 A;  3MCP A;  3M8P A;  2F8S A;  1S1U A;  3LZI A;  4CEE A;  4DFM A;  2G8W A;  1SQK A;  3MEE A;  1RT7 A;  2O8E B;  1R59 O;  3DXM A;  4RTF D;  3WQT A;  4Z4G A;  4EFH A;  5B8H A;  4KI4 A;  4ELU A;  3ZEU A;  2ZJP L;  3CCE N;  4J2A A;  3P5J A;  4DR1 K;  3AGK A;  3HT3 A;  1EO1 A;  4LF5 K;  4B9T A;  3ZET A;  3EYZ A;  4QOZ B;  3BP8 A;  4E1N A;  2F8T A;  3THW B;  2VCP A;  4OKJ A;  4DFK A;  3QEW A;  2QKK A;  3G6E N;  4YDU C;  1U45 A;  4JI3 K;  4BRD A;  3ZLJ A;  1NGB A;  1UOC A;  1NK4 A;  1N6Q A;  3KTQ A;  1IJJ A;  1KFD A;  2RN2 A;  3P1G A;  5DM7 L;  3NHG A;  3AO3 A;  1BWF O;  3HZ6 A;  2BDP A;  4FJJ A;  2DPN A;  3O5B A;  2XO7 A;  4FJK A;  1VRT A;  4BWM A;  3V1Q A;  4DTR A;  3O1B A;  4K43 A;  1W7A A;  2V51 B;  2AA4 A;  2OPR A;  3P39 A;  4B3R K;  2HMP A;  4YOU A;  1HNW K;  4UQG A;  3ID8 A;  1QZ5 A;  2QEX N;  4CER A;  3UB5 A;  3I0R A;  1TAQ A;  3T7Z A;  3WXM B;  3DLH A;  1YHQ N;  1NMN A;  3FE1 A;  3SV4 A;  1ATS A;  2A1S A;  1RBU A;  1SZ2 A;  1SKS A;  3R1X A;  1HJO A;  5M1F A;  4MFB A;  3U9Z A;  3PY8 A;  2I5J A;  3FFK B;  2G8U A;  1P8Z A;  4M41 A;  1VSL A;  3EE8 A;  4ZHR A;  4BE0 A;  2Q97 A;  1ZBU A;  2O8F B;  2E4L A;  4KI6 A;  4B9V A;  3MXM A;  1IO2 A;  2QWM A;  1QHA A;  1D9F A;  1TL3 A;  3LDQ A;  3MX2 A;  4FOI A;  2XY8 A;  4XH5 A;  3THW A;  5KGW A;  4GVM A;  2AP1 A;  4JEP A;  1T7P A;  1YIT N;  1C6V A;  1VQK N;  2VGN A;  4W5N A;  3ZX0 A;  1HPZ A;  5HLF A;  1W9H A;  1QS4 A;  2KLA A;  3VEZ A;  3O08 A;  4H5V A;  4NXN K;  4MLH A;  1D9D A;  1HMV A;  4B1W B;  1BI4 B;  2VYP A;  1SL1 A;  3VGL A;  4CIG A;  2E88 A;  3C6A A;  1NGH A;  2E2P A;  4U67 L;  4CE9 A;  4CEO A;  4FWL A;  4LF8 K;  1RTI A;  3DI6 A;  5HBM A;  4CIE A;  2ZWH A;  4Y1D A;  3AVC A;  4FPA A;  3H08 A;  1RGI A;  1Q7Y O;  4E1J A;  3DRR A;  4DTO A;  1O1W A;  2IDO A;  2E1Y A;  3O9T A;  4RW6 A;  3K5N A;  4F2R A;  4M3U A;  3HYF A;  4O5B A;  4B9U A;  3BUZ B;  4JI7 K;  3KLG A;  2HBL A;  3B6O A;  2FBX A;  1KCF A;  3AVK A;  5ADX A;  1X9J A;  4OJR A;  3QET A;  4CD3 A;  2P9P B;  3SAG A;  1NLV A;  4JK9 A;  4DHY A;  4Q5V A;  3SLC A;  3DM2 A;  1NOY A;  4FJ9 A;  1W97 L;  4H0V B;  3W0L A;  3G4S N;  4DKW A;  4FJ8 A;  1JLE A;  1HKC A;  3SPY A;  1U4B A;  4J2D A;  4CBW A;  3LPT A;  4K41 A;  2HND A;  2HOE A;  3NCI A;  1NGC A;  3BGR A;  4GV3 A;  4IG3 A;  3FZM A;  1SKW A;  3ZT4 A;  1WBD A;  5AJ3 K;  4BAC A;  1WBB A;  3MXJ A;  2JGU A;  4KFB A;  1HQU A;  4O8K A;  1XWL A;  1IBL K;  4FJ7 A;  5JVH L;  1BUP A;  4CBU A;  3VEW A;  2IVO A;  3IKM A;  3O4N A;  4CBX A;  1BHL A;  4LFB K;  3HO1 A;  4E7L A;  4JRP A;  1K8K B;  3LDO A;  3QEV A;  4HUG A;  1GLF O;  4NLC A;  5LMU K;  4C23 A;  5HRN A;  4E7K A;  2P9N A;  4A5B A;  3CME N;  2WTU A;  2Z1H A;  1TYQ B;  3DOL A;  1GLJ O;  2KFN A;  5AFU A;  3SNN A;  2OA8 A;  4NXM K;  4H03 B;  4DSE A;  3KD1 E;  1TUY A;  3H3O B;  4BRC A;  2O8D A;  3WNF A;  1ASW A;  4CZL A;  2YNH A;  2WBN A;  1GLC G;  4DSL A;  4IO9 L;  2HMI A;  3LL3 A;  1ZBL A;  2WFB A;  2P9K B;  4JNE A;  4NYN A;  3HTV A;  1SL0 A;  3SI6 A;  4WQ5 C;  3BY5 A;  1YVN A;  1HLU A;  1XUP O;  3LDN A;  3VQB A;  2YKM A;  2ZE2 A;  4FWM A;  1XQS C;  2QKB A;  2F4V K;  2G8I A;  4M42 A;  4B3O A;  2YNG A;  2YHY A;  3C7N B;  1K73 O;  5FPE A;  2HVH A;  4CFB A;  4DLG A;  2R7Y A;  1YJW N;  1KLN A;  2W6L A;  3WNE A;  1HQE A;  5GIN A;  3C6H A;  4DTP A;  1VSF A;  1CZA N;  2OTJ N;  3K5O A;  3LAN A;  3CER A;  1V4T A;  4PWD A;  3THV A;  4C8N A;  5C42 A;  4CJW A;  3OJU A;  3FGU A;  4LH5 A;  3HK2 A;  3FLC O;  3D0P A;  4DSK A;  3JS6 A;  4KHS A;  3IUC A;  2P5G A;  2E6L A;  1Y64 A;  3V9Z A;  2G8K A;  1GLB G;  3L8B A;  1TK8 A;  4LD0 A;  5AQU A;  5J1E A;  3KHY A;  1S1W A;  3H3N O;  4FM1 A;  1RTH A;  2ZJR L;  3PO4 A;  2ETJ A;  2Q3S A;  5GIO A;  1NKE A;  3L2W A;  1RBR A;  2WOM A;  2CGK A;  3THX B;  3AAQ A;  3OA9 A;  1QE1 A;  5AQL A;  5AQW A;  1FXX A;  1C0G A;  5LMN K;  2D5R A;  4FLW A;  2HF3 A;  4FJX A;  3TAB A;  2P9K A;  1ZBF A;  1RDU A;  1HNZ K;  2D0C A;  3GL1 A;  2E1Z A;  4EZ9 A;  2D1K A;  1XI1 A;  1YTU A;  3GOI A;  1YI2 N;  1YJ9 N;  4CFA A;  4YOT A;  1RDD A;  2ITG A;  4H5T A;  1BA0 A;  1OH8 A;  1ASV A;  4XH4 A;  3NGI A;  5C2F A;  2BGG A;  4IFV A;  2HF4 A;  2NRR A;  4DWI A;  1IKW A;  5IT9 O;  1IKX A;  1L5U A;  4PKH A;  4L3Q A;  2Q31 A;  3WUH A;  2KQ2 A;  1N33 K;  2Q36 A;  1SL2 A;  1BO5 O;  4BGA A;  3OS0 A;  1RTD A;  1XMO K;  3WEE A;  2X74 A;  1Z05 A;  3GBT A;  2P9I A;  3BF1 A;  3O1W A;  4FJ5 A;  5EU7 A;  3B8A X;  3DRP A;  4HVJ A;  5K14 A;  2IIR A;  4B1V A;  2P5O A;  1ASU A;  3K5L A;  4CZM A;  4CEA A;  1JLF A;  3TAP A;  4JI8 K;  3HP9 A;  4JLH A;  4ILG B;  5GAH P;  3D2F B;  5E26 A;  4BWJ A;  3CMA N;  4CF9 A;  3ZET B;  4ID5 A;  3IG1 A;  3RSE B;  3J8A A;  4WQ4 C;  2HHV A;  1LWF A;  3EL2 A;  1Z6R A;  1VSM A;  3THY B;  5J2P A;  4OPK A;  4IOA L;  3VET A;  4FLU A;  1HRH A;  1U47 A;  2G8V A;  1S1T A;  3ZYY X;  3ZSX A;  5GAG P;  3OYL A;  3CCM N;  3A5N C;  3SUQ A;  1HNI A;  2P9L A;  3C6T A;  3OHR A;  4Z4F A;  3F73 A;  4AHT A;  3T19 A;  5BRH A;  5CHI A;  3VES A;  4JK8 A;  3TR8 A;  1GLE G;  4BR4 A;  5AQP A;  4KHU A;  3WXJ A;  4FZZ A;  1HX1 A;  2B5J A;  2YV0 X;  2XY5 A;  3HJF A;  4H5N A;  4EIA A;  2DY4 A;  4IFE A;  3QIC A;  2PFU A;  3J7Z O;  1KTQ A;  4BVO A;  5M1K A;  1L3U A;  4Z4E A;  3G71 N;  5BPN A;  1C0U A;  3CCR N;  3RMA A;  4JI1 K;  4J8F A;  1H1V A;  2KFZ A;  4ELV A;  4KAZ A;  5EY4 A;  5TKY A;  2GX9 A;  1HJR A;  4Z4H A;  4AQY K;  1TKZ A;  3DLR A;  4FJM A;  3C7N A;  4L8R B;  4E7J A;  4FWP A;  4CF1 A;  1Q9Y A;  1HR0 K;  4IZ9 A;  3PO5 A;  5AQK A;  3VF6 A;  1QQC A;  3M8Q A;  4CW7 B;  4YOW A;  2Z1G A;  3VEX A;  3H6E A;  4KHN A;  3T69 A;  4CHQ A;  4PY5 A;  1OKJ A;  3PV8 A;  2HHH K;  1B9D A;  1T44 A;  1VAZ A;  4BRA A;  1YVU A;  3S3M A;  2ATQ A;  3VGK A;  4PHT X;  4WE1 A;  3K2P A;  1BG3 A;  2F9T A;  1S9E A;  4B9L A;  4AHS A;  1EX4 A;  2A1R A;  3LZJ A;  3V9U A;  4I2Q A;  2OPQ A;  1HUX A;  1Q9X A;  5FLX O;  3FZH A;  4QCL A;  3NFA A;  4KPY A;  4JAX A;  3UKR B;  4DV6 K;  1BQN A;  1XMQ K;  2H3G X;  3LAM A;  3CJA A;  1C0F A;  4BC3 A;  2GV9 A;  4EAH D;  4LFA K;  4Y1C A;  3VEV A;  3PSI A;  3GE1 A;  3CCJ N;  4CED A;  2EHG A;  2QWR A;  4LF9 K;  2VGM A;  3CM6 A;  4OPH A;  3NDK A;  3LP0 A;  2QWN A;  4CIF A;  1DEJ A;  1Z25 A;  3KZB A;  4FVU A;  2I7P A;  3ASM A;  5MLC Q;  2DFH A;  2BAN A;  4OPJ A;  4KRF A;  4KHY A;  4DG1 A;  5KGX A;  3OVN A;  5AQG A;  3QNN A;  5I42 A;  4E1M A;  4KHW A;  3VQ7 A;  3IFR A;  5KQD A;  1NJZ A;  4N5S A;  3L6Q A;  5C25 A;  2NLX A;  3KJV A;  2F9W A;  3CJ9 A;  2JLE A;  1NK7 A;  3AO4 A;  3NGY A;  1NJX A;  1U49 A;  2IS3 A;  3N4P A;  4OKE A;  2UUC K;  1IKV A;  4GV6 A;  1JCG A;  1ATR A;  2W41 A;  2YX6 A; 
#chains in the Genus database with same CATH homology
 2ZWH A;  4FWK A;  3O80 A;  2J4R A;  3QDK A;  4RWT A;  4BG9 A;  4FSV A;  4FPA A;  1KC8 O;  1RGI A;  3M5R A;  1Q7Y O;  5C0Y A;  4E1J A;  3HOS A;  3R6M A;  5BRE A;  4A2A A;  4ILH A;  4LC9 B;  4AF1 A;  3DAW A;  3CJ1 A;  3NVK A;  4JKE A;  4G9Z A;  1BA1 A;  4I6M A;  2A5X A;  3WXK A;  4AM6 A;  4MLE A;  1BOT O;  2E1Y A;  1MWK A;  3QML A;  3O9T A;  4H0X B;  3VGM A;  5I9E B;  1VQ8 N;  4BRI A;  3CHW A;  1YIJ N;  3CC7 N;  2QWL A;  3CQX A;  3CCS N;  3L0Q A;  4IDH A;  3A0I X;  3CJ7 A;  3HM8 A;  1LCU A;  2E2N A;  3TSU A;  3TSQ A;  3JXU A;  3EZW A;  3VOV A;  3VTI A;  2A3Z A;  3CCL N;  4IEI A;  4BR5 A;  2ZJQ L;  4IWV A;  2JWK A;  3BUZ B;  3ZX3 A;  4BR2 A;  2HBL A;  1WUA A;  4HTL A;  5ADX A;  5LJW A;  3NMU A;  1X9J A;  5FPD A;  4FWR A;  3SJH A;  2KHO A;  3U9D A;  5AQF A;  2A6A A;  4CD3 A;  3CJC A;  2GUP A;  2P9P B;  5AQJ A;  4CZJ A;  3SAG A;  3S41 A;  2D0O A;  1NLV A;  4JK9 A;  3U4L A;  4DHY A;  3SLC A;  1JCF A;  1S3X A;  3MWP A;  5AQM A;  2E20 A;  4I6M B;  1KAY A;  5AQI A;  1W97 L;  1K8K A;  1DKG D;  3L4Q A;  4H0V B;  3W0L A;  4CZG A;  4DKW A;  3G4S N;  1D4X A;  1HKC A;  3O9U A;  4OPA A;  5JLH A;  3CXC M;  3VTH A;  4BQZ A;  4CBW A;  1T3V A;  2WC9 A;  4K41 A;  2WUS A;  4BRP A;  2PBD A;  2HOE A;  3LM2 A;  1NGC A;  4JKD A;  4BRH A;  3OBW A;  4GV3 A;  3I33 A;  3F2K A;  5BN9 A;  3FZM A;  4BRK A;  2QWO A;  1YUW A;  1U6Z A;  4IOX A;  4WCE L;  5BRD A;  5HOO A;  3HI0 A;  4O8K A;  5M1N A;  3IMX A;  2QWQ A;  1BU6 O;  5JVH L;  4H0O A;  1BUP A;  4PL8 A;  4CBU A;  1WOQ A;  3D2E A;  2IVO A;  3E9O A;  3IKM A;  4MDB A;  3VEW A;  2ITM A;  5C10 A;  3CF5 L;  4CBX A;  4BRO A;  2OTL N;  2ZGZ A;  1K8K B;  4CZH A;  3MN9 A;  3AY9 A;  1NWK A;  1QZ6 A;  2Q2R A;  3LDO A;  4YDU A;  3R9P A;  5C15 A;  1GLF O;  3LM9 A;  4NLC A;  4IOC L;  4B1Z A;  4BRE A;  4C23 A;  3FR0 A;  4BG8 A;  3I55 N;  5F2R A;  1SS6 A;  3D7E O;  2P9N A;  4A5B A;  1VQ7 N;  3CME N;  5BPM A;  3O8M A;  1TYQ B;  5AQZ A;  4YOX A;  1GLJ O;  3SMP A;  5AFU A;  1VQ5 N;  3CI5 A;  4H03 B;  3L4I A;  4BGB A;  1TUY A;  3H3O B;  3A8Y A;  2ASO A;  5AQY A;  4BRC A;  4MO4 A;  3PIO L;  3ENO A;  5KPZ A;  2E2O A;  5AQQ A;  4CZL A;  2FLO A;  4Z94 A;  4NLB A;  4JKB A;  1JJ2 M;  4BRQ A;  2WBN A;  2Q1N A;  2HST A;  1GLC G;  4M7Y A;  4IO9 L;  4BR7 A;  3LL3 A;  4M7X A;  1KXP A;  2WFB A;  2P9K B;  3IDH A;  4JNE A;  4BR0 A;  3HTV A;  3CC4 N;  3PLA A;  4WQ5 C;  3FZL A;  1NGE A;  2QI2 A;  1YVN A;  1HLU A;  1YJN N;  3O9R A;  1VQO N;  5JIC A;  1XUP O;  3LDN A;  1NJI O;  5ADX H;  1KQS M;  2FSJ A;  4FWM A;  1XQS C;  5EOY A;  1EQY A;  3CCU N;  2QW9 A;  3A5L C;  2NRH A;  5H1S Q;  3R8E A;  2YHY A;  1GLA G;  1LOT B;  3C7N B;  4ISF A;  4JKG B;  5BN8 A;  5FPE A;  4Y0W A;  3ZEU B;  1K73 O;  4JKA A;  1QQO A;  4B9Q A;  1K9M O;  1NM1 A;  3ULE A;  1W2B M;  1YJW N;  5KPT A;  4ILJ A;  4FO0 A;  4IJA A;  4PKG A;  4PL7 A;  5GIN A;  3C6H A;  4BRN A;  4FOE A;  3WT0 A;  3FZK A;  2BUP A;  4DCH A;  3KK7 A;  1CZA N;  1N8R O;  2OTJ N;  1DGK N;  1X3M A;  4QS9 A;  3M6G A;  2YI1 A;  3CER A;  1BDG A;  1V4T A;  5FPM A;  2E8A A;  4QS8 A;  3CD6 N;  4YOY A;  3OW2 M;  2PAV A;  3FGU A;  3ID6 A;  3FLC O;  4WYB A;  3VEO A;  4BRL A;  5AZJ A;  1QVF M;  5BPL A;  1OVY A;  3JS6 A;  3RVC A;  3O9Q A;  3IUC A;  4K25 A;  1Y64 A;  3QBW A;  2ZF5 O;  1RDW X;  4H0T B;  4GV9 A;  1GLB G;  4K42 A;  3CC2 N;  2NRT A;  1V4S A;  3ATV A;  4JKG A;  4A62 A;  3CCV N;  3TPQ A;  5AQU A;  1KAZ A;  1M90 O;  2W40 A;  3UE5 A;  3R3L A;  3KHY A;  2KKZ A;  3H3N O;  3M3Z A;  2ZJR L;  3AGR A;  3QFU A;  5GIO A;  4FWS A;  5M1P A;  4YOV A;  4JK7 A;  2YJF A;  5GAD P;  2NRV A;  3F5T A;  2CGK A;  3K9J A;  4WQ4 A;  3AAQ A;  3OA9 A;  5AQL A;  5AQW A;  3UKU A;  1NMD A;  3VEN A;  1HPM A;  4C1N I;  3CQY A;  1C0G A;  2IVN A;  3VF4 A;  5KPR A;  3VF2 A;  4IJN A;  2HF3 A;  1Q86 O;  3WXI A;  1TUU A;  2D4W A;  2P9K A;  4FWQ A;  1RDU A;  3C0B A;  3DXM B;  4IO8 A;  3UKR A;  3GL1 A;  2E1Z A;  2QTD A;  3E66 A;  2QA4 N;  2D1K A;  3O6W A;  2UYT A;  3GDQ A;  3GOI A;  3H1V X;  5FPN A;  1YI2 N;  2A42 A;  2I7N A;  2GEM A;  1YJ9 N;  1NGF A;  1NBW A;  2NRW A;  4YOT A;  3SBT A;  4A59 A;  3CIP A;  4H5T A;  5HL7 L;  1BA0 A;  2ZGY A;  1IG8 A;  1X3N A;  3P38 A;  4XH4 A;  4BQL A;  5C2F A;  4FWN A;  5AQO A;  2EWS A;  2F7T A;  5AQS A;  3TSP A;  2HF4 A;  5AQX A;  3EKS A;  3TTF A;  3SAH A;  3U8X A;  2YCH A;  2YJE A;  2GTD A;  2NRR A;  3H45 C;  3MWT A;  3DXK A;  5EX5 A;  5JVG L;  4JN4 A;  4NO7 A;  4PKH A;  4L3Q A;  4KH4 A;  4WFN L;  2BH1 A;  2Q31 A;  3WUH A;  1MA9 B;  5AQV A;  2Q36 A;  1VQL N;  3QBX A;  1BO5 O;  3G25 A;  4BGA A;  1GLD G;  4AM7 A;  2RHK A;  3LDP A;  4FPB A;  3CPW M;  2FF3 B;  4IXC A;  3TTD A;  3WEE A;  3FZF A;  3O1W A;  1Z05 A;  3GBT A;  2P9I A;  3BF1 A;  4GY2 B;  3WQU A;  3I56 N;  2HBK A;  3EN9 A;  4BVP A;  5M1O A;  4WQ5 A;  1VQ4 N;  3B8A X;  1ZXO A;  1QQN A;  1YAG A;  4B1V A;  2IIR A;  1KD1 O;  2NRX A;  2QXL A;  1Q18 A;  5LY3 A;  4M63 C;  1O13 A;  2NNW A;  4CZM A;  5TKW A;  4CZK A;  3OBY A;  3TU5 A;  3MK6 A;  3DLL L;  4IEE A;  2ASM A;  4RCH A;  3ENH A;  5LJV A;  3QFP A;  4ILG B;  4JHD B;  3P31 A;  4O8U A;  5AQH A;  4F9O A;  5GAH P;  3KWI A;  4WF9 L;  3E9P A;  1Q82 O;  3BF3 A;  3D2F B;  5JLF A;  5E26 A;  3CMA N;  5BR9 A;  3ZET B;  3RSE B;  3J8A A;  4B1X B;  1HKG A;  4WQ4 C;  3SMS A;  3AAP A;  4JKF A;  4BRF A;  3EL2 A;  5BRF A;  1Z6R A;  5C12 A;  5AR0 A;  3ZX2 A;  4CZI A;  4IOA L;  3VET A;  2NZT A;  4OO1 J;  3ULE B;  1QVG M;  3W3D A;  2CGJ A;  3A5M C;  5AFU H;  3CET A;  3ZYY X;  5AZJ B;  2YHX A;  3DWL A;  5GAG P;  1U2V B;  4A2B A;  4R79 A;  4BRM A;  2P9S B;  5F1X A;  3CCM N;  1VQ6 N;  3A5N C;  1J6Z A;  2P9L A;  2FSN A;  3EO3 A;  3OHR A;  1YXQ A;  3EKU A;  4A5A A;  3PIP L;  1ZC6 A;  3AAR A;  5BRH A;  3D2F A;  1NGA A;  3VPZ A;  4FL9 A;  5CHI A;  3ATU A;  3VES A;  3C65 A;  3HOT A;  4JK8 A;  4DB3 A;  4BRG A;  5E84 A;  1GLE G;  4BR4 A;  5AQP A;  3WXJ A;  1HX1 A;  3MN6 A;  4B1U B;  4U7B A;  3D6R A;  3HBT A;  1M1K O;  4H5N A;  4EIA A;  5ELZ A;  4IFE A;  1ZBS A;  3N4Q A;  3QIC A;  2PFU A;  3NVM A;  4H5W A;  3J7Z O;  2FF6 A;  4BVO A;  5M1K A;  3MCP A;  5AQT A;  3G71 N;  5EVZ A;  2V52 B;  1MDU B;  1E4G T;  5BPN A;  1SQK A;  4KBO A;  2P9U A;  3CCR N;  1VQM N;  1SAZ A;  1R59 O;  3DXM A;  3P4I A;  3RSE A;  4RTF D;  4J8F A;  3WQT A;  2YHW A;  1H1V A;  4EFH A;  5B8H A;  2P9L B;  3ZEU A;  1P90 A;  4A57 A;  2P9S A;  2ZJP L;  3CCE N;  4GVE A;  2E2Q A;  5EY4 A;  5TKY A;  3SAF A;  3AGK A;  3DJC A;  5DM6 L;  4WFB L;  2GX9 A;  5GIP A;  1EO1 A;  4C1N K;  3ZET A;  4KH6 A;  3BP8 A;  4ISG A;  2A41 A;  4U67 L;  3D2E B;  4KH5 A;  3C7N A;  2VCP A;  4FWP A;  2Q0R A;  3EE9 A;  4BC2 A;  3F9M A;  1VQN N;  4CJ7 A;  4IZ9 A;  3G6E N;  1VQ9 N;  5AQK A;  1JCE A;  1TYQ A;  2NRZ A;  3Q7C A;  5CR4 A;  4YDU C;  3VF6 A;  4FWO A;  3HRG A;  5CE3 A;  4YOW A;  3H1Q A;  2CH6 A;  3VEX A;  3H6E A;  4BRD A;  4EHT A;  3T69 A;  1NGB A;  5AZI A;  2QWP A;  1T6C A;  1OKJ A;  1IJJ A;  1DT9 A;  4B1Y B;  4WFA L;  5DM7 L;  1VQP N;  1S22 A;  2P9I B;  1BWF O;  3HZ6 A;  2RE2 A;  1T6D A;  2DPN A;  3DXK B;  3MX5 A;  3O5B A;  3O9S A;  4O5F A;  3SBG A;  1T44 A;  4DQ8 A;  1VAZ A;  4BRA A;  2P9N B;  1GLL O;  1U2V A;  2IVP A;  1ILY A;  3O1B A;  4K43 A;  2CH5 A;  4BC4 A;  2VWB A;  2ASP A;  2AA4 A;  2V51 B;  3VGK A;  3P39 A;  4PHT X;  2HMP A;  3QB0 A;  3VEY A;  2P9P A;  4YOU A;  4JD2 A;  5M1Q A;  1BG3 A;  2F9T A;  3ID8 A;  1QZ5 A;  2OAN A;  4GNI A;  1NGI A;  2A40 A;  2HBJ A;  4H5R A;  3UB5 A;  2QEX N;  2Q0U A;  3VMF B;  1ATN A;  3SK3 A;  3T7Z A;  3WXM B;  2GWJ A;  1HUX A;  4PKI A;  3MN7 A;  2GEL A;  5AQN A;  3FZH A;  1YHQ N;  4JAX A;  3FE1 A;  3UKR B;  1Q81 O;  2JWL A;  2H3G X;  3CJA A;  2QM1 A;  1C0F A;  1ATS A;  3KVG A;  4BC3 A;  3CCQ N;  1NGJ A;  1SZ2 A;  4EAH D;  3LDL A;  4CI6 A;  1G99 A;  1MWM A;  1HJO A;  2HBM A;  3R1X A;  4JD2 B;  3WEE B;  5C2D A;  1S72 N;  3VEV A;  5M1F A;  3U9Z A;  3GE1 A;  3CCJ N;  4MO5 A;  4CZE A;  3FFK B;  4JHD A;  1P8Z A;  2FXU A;  1E4F T;  2QWR A;  4UY8 O;  1KAX A;  3EE8 A;  2VGM A;  5F0X A;  4OPH A;  3TTC A;  3E9L A;  2QWN A;  1XC3 A;  1DEJ A;  2Q97 A;  2FSK A;  1NGG A;  2P9U B;  4QS7 A;  3KZB A;  3A5O C;  3HSC A;  4FVU A;  2I7P A;  1YF5 L;  5MLC Q;  3UKU B;  5AQR A;  3O4W A;  2D0P A;  3M1F A;  5JMV A;  3KWG A;  3E1Y A;  4H0Y B;  3WXL A;  4BY9 C;  2BTF A;  2QWM A;  1QHA A;  4XEI A;  3ENB A;  4MDA A;  4BC5 A;  1ESV A;  3GG4 A;  3I8B A;  3LDQ A;  3MMV A;  3MX2 A;  4FOI A;  4H0P A;  5AQG A;  4XH5 A;  3MN5 A;  1K8A O;  3BEX A;  4BR9 A;  2AP1 A;  3IFR A;  4JEP A;  4CD1 A;  5KQD A;  5GAE P;  1YIT N;  3K9K A;  3L6Q A;  2VGN A;  1VQK N;  4XH1 A;  3MDQ A;  3ZX0 A;  2NLX A;  4YOR A;  1QQM A;  2V7Y A;  1RFQ A;  2F9W A;  2KLA A;  3O08 A;  3VEZ A;  4H5V A;  5EXW A;  4MLH A;  4EHU A;  5AZI B;  3CJ9 A;  2V7Z A;  4JKC A;  4B1W B;  2VYP A;  2CGL A;  3VGL A;  1HKB A;  2E88 A;  1NGD A;  1NGH A;  2E2P A;  3C6A A;  3H46 O;  3N4P A;  4JKH A;  4CZF A;  3CJB A;  4NB4 A;  4A61 A;  3MCA B;  4HWI A;  4ISE A;  4FWL A;  4GV6 A;  1JCG A;  3CPE A;  1ATR A;  3Q7B A;  2W41 A;  5KQ8 A;  3VER A;  2GWK A;  2YX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...