3M5RA

Crystal structure of swine flu virus ns1 effector domain from h1n1 influenza a/california/07/2009
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
126
structure length
126
Chain Sequence
HMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title Crystal Structure of Swine Flu Virus NS1 Effector Domain from H1N1 Influenza A/California/07/2009
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 38
structure length 126
sequence length 126
chains with identical sequence B, D, E, F, G
ec nomenclature
pdb deposition date 2010-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3m5rA00
3O9RA 4OPAA 4OPHA 3O9UA 3D6RA 2KKZA 3P39A 3M5RA 3KWIA 3KWGA 3O9QA 3RVCA 3O9TA 3P31A 3O9SA 2RHKA 3OA9A 3P38A 3EE9A 2GX9A 3EE8A 3F5TA 3L4QA
chains in the Genus database with same CATH superfamily
2WUSA 4IFVA 3CPEA 3SJHA 3LDLA 4B08A 3LWMA 1RT1A 2YHAA 3CJAA 3CM5A 4LF4K 3V9UA 1EO1A 1L3SA 1YT3A 2YX6A 1SL0A 3K58A 3HPGA 4CGDA 4K25A 3BF3A 4DV4K 1NMNA 2E2PA 3LDSA 4U67L 4MQ3A 3TAGA 3CXCM 4ICLA 1LAWA 3WNFA 4RWTA 4CFAA 3LDOA 3LDPA 1QZ6A 3RMCA 3OJUA 3AA4A 4EFHA 5AQYA 4CBXA 4H5VA 2E2OA 3MX2A 3NDKA 1S3XA 3SYZA 4PUOA 5AQSA 3AV9A 3MWTA 4WQ4C 1HNIA 1W0HA 3JXUA 1TAQA 4BDPA 2F9TA 1K73O 1WN7A 1NGAA 1ATNA 2FSJA 4M7YA 3RTVA 4CJ5A 4JKGB 1JLEA 1C0MA 3RMBA 1SL2A 2YHYA 5EX5A 4BQZA 4LSLA 3T3FA 2QEXN 3UE5A 5BRFA 5C0YA 2VG7A 3VQ8A 3ZCMA 4TSXA 1RBVA 4RG8A 1VRUA 3DAWA 3FZKA 3C95A 2O8FB 3EKSA 1Q86O 4CJQA 2V7ZA 4RW7A 3TSUA 1KC8O 2RHKA 4I6MA 3WNHA 1OH6A 4ELTA 1JLCA 2HF3A 5C42A 3G6EN 3DLKA 2RN2A 3GOIA 3NF7A 4CGJA 1QQMA 4DWIA 2QXFA 1VHXA 1DLOA 3G71N 1YJNN 3J7AP 4JKDA 3HI0A 3VA0A 2KTQA 5JMVA 2D0PA 3NH1A 4RW9A 2BANA 1HJOA 3V9WA 4C8LA 2HHWA 4JS5A 1NJIO 4YOUA 2A5XA 3ZSVA 5IWAK 4C8MA 1VQKN 2Y1IA 4PHTX 1NGDA 3WQUA 3AVLA 4K41A 2WOMA 1HR0K 4FPBA 4JHDA 3VPZA 3H3OB 1NBWA 2X74A 2P9NB 4A61A 3QFUA 3MN6A 4Z4EA 3W3DA 5T7BA 3D2EB 5JLHA 1KRPA 3CMEN 3I8DA 5KPTA 3ASMA 3IRXA 4NLCA 4E7KA 1KFDA 1RILA 4M63C 2GUPA 3TTDA 3VERA 3UKUB 3SZ2A 1GLLO 3WQTA 3KK2A 4Q0BA 4ISFA 1RT7A 4CE9A 4O0JA 4DUYK 1S5JA 4H5WA 4RW4A 3BZCA 4DR4K 4LFBK 2YHBA 2NLXA 3FGUA 3HZ6A 1RDCA 2DY4A 4XH5A 4L8RB 5EU7A 3AVJA 4PA1A 4W5NA 3HOSA 1NKCA 5AQIA 5FPDA 3CJBA 4BE2A 3F5TA 4AQYK 3MK6A 1WAFA 3Q7BA 1SZ2A 2GEMA 4YOTA 3SMPA 4K8XA 5M1KA 1G99A 2H3GX 1NKBA 3A5LC 1TYQA 3HVRA 4B3SK 4DTSA 3LL3A 3QERA 1QE1A 4IDKA 3QB0A 3VGMA 3P4IA 3VN5A 5AZJA 1KVBA 1Q9YA 4YFUA 5F1XA 1UWBA 2G8FA 1S1UA 2I5JA 1OH7A 4PKHA 1QSSA 3MDQA 3ZT3A 3QO9A 2ZGYA 4EZ6A 1RGIA 2P9SA 1HYSA 4Y1DA 4XH4A 4H0VB 4IG0A 3QEXA 3MXJA 1TK8A 2VQEK 1FW6A 4CD3A 2YKMA 3ZEUA 3C7NA 1EKEA 1S1VA 2EX3A 3O80A 2W40A 1RBTA 3SMSA 4E7JA 2FF3B 1GLEG 1HJRA 3OYKA 3R8EA 2P9IA 5C12A 1OH5A 1NK0A 2FBTA 1ILYA 4F2SA 3QNOA 2QWPA 3CM6A 3F2KA 3HM8A 1TGOA 3ISNC 1Q18A 4FWSA 4XIUA 4M3UA 5E26A 3B6PA 1QVFM 3CCRN 1XC3A 3AVNA 1OVQA 1C0UA 5EVZA 4W5QA 2PYLA 2ZGZA 1BA1A 3AVKA 4C8KA 2P9LB 5BR9A 3LP3A 2KZZA 1XMOK 2VYPA 2HMPA 3NCIA 5EXWA 3OYAA 5KRSA 1W7AA 1D9DA 1DTQA 3CJ1A 4CEZA 2HF4A 4FJ8A 3EO3A 2DPNA 5C24A 3KK1A 4YOXA 3LP2A 3RMDA 4ISGA 3F9MA 1XI1A 4CHOA 2IS3A 1VSDA 2Q36A 1YTAA 4CHPA 1T8EA 4KH4A 3R6MA 1SKSA 4B3OA 4DU1A 4CF1A 3PO5A 3EKUA 3AO4A 1BHLA 5AZIA 2I7PA 2HMIA 4N41A 5HRRA 1NK8A 4V19S 1JL1A 3L2UA 1RBRA 1NWKA 3KKRA 3LP0A 2AJQA 3TWHA 4W5OA 1VQ4N 4KHWA 4QAGA 3KWIA 1UA1A 4IFEA 4M3TA 4DQIA 3OYJA 4GV9A 1NLVA 3EZWA 1TKTA 4B3TK 4CZMA 1RNHA 3J81O 5FPEA 3J7ZO 4DV7K 3MMVA 1KAYA 3IDHA 3L6QA 1NK4A 4N76A 1RT2A 2D0CA 4KHUA 1E4FT 1RDWX 4FM0A 2P5OA 4FWKA 1NJWA 2P9UB 3R9PA 4CVNE 4A2AA 3N4QA 4CGFA 1R59O 3E9PA 2QKBA 4Z0UA 1ASUA 4DUZK 2QWNA 1QQCA 1NGIA 3CG7A 3CCSN 3J80O 2UUAK 1S9EA 2BUPA 4ID5A 3T69A 3L8BA 4O55A 4CZKA 5ADXH 4DLEA 1IH7A 4H0TB 2QKKA 5BR8K 3V1OA 2CGLA 5BPMA 4DMNA 3DLLL 4KHQA 1XHZA 1VQ9N 3D7EO 2ZWHA 1ASWA 3NVKA 4KPYA 4X66K 3AA5X 1K6YA 3SUOA 1Q82O 4NLBA 5GAHP 3NF6A 3QNNA 4AM7A 3I33A 2D4WA 3KD1E 2IVOA 1YJWN 3OYEA 4CJLA 1VRTA 4DV3K 3AVMA 5M1QA 2A42A 4HHTA 4FVMA 3EYZA 1UAXA 3OHRA 5JLFA 5KPRA 3GE1A 3VQ5A 5J2PA 3SNNA 4OPKA 5JS2A 1NGCA 2OPQA 4DR6K 1L3VA 5M1PA 2Z1GA 4BWMA 3PY8A 3FLCO 3VEOA 5ADXA 2F8TA 4JI7K 4KAZA 4ID1A 3LDNA 5KGXA 3C6UA 3OS0A 1N5YA 5C25A 5LJVA 5M1NA 1X9WA 3ZETB 3ZSRA 2Q1NA 4DV1K 1IO2A 1U47A 2W6LA 4JRQA 2O8DB 4EAHD 1NM1A 1IKYA 1VSJA 4H5RA 3HSTB 2YCHA 1TL3A 3NVMA 1IJJA 4WQ5C 3QBWA 3IAYA 3QIPA 4RCHA 5AQKA 2IVPA 2D0AA 2OPRA 2UXCK 1TK0A 4ZHRA 4DCHA 1SKWA 1BIUA 2OA8A 4O0IA 2JWKA 2O8EA 2XY7A 1HUXA 1IG9A 3CCJN 4BVOA 2Y1JA 5HL7L 4E1MA 3AARA 2ATQA 1I3AA 3DXMA 4B9TA 2R7YA 4CJ4A 1Z6RA 4JLHA 5FPNA 1YVUA 1W2BM 5M1FA 5AQUA 4IXCA 3MCAB 2O8CB 3H1QA 2IGIA 3HO1A 4M3ZA 1NJZA 4JI4K 4BE0A 4J2DA 5HRPA 4OX9K 1A5XA 2CH5A 3C6TA 4WYBA 4A59A 3AAPA 3THXA 4CJEA 5BRHA 3WXIA 4H4MA 4BR5A 3ULDA 5FRNA 4FLZA 1ZBFA 3DRPA 1RT5A 4CFBA 3C6HA 3TTFA 5BN9A 4OPJA 1VSHA 2RKIA 2FF6A 5FLXO 1WNSA 3M8QA 2O8BB 4H5NA 3MECA 1S22A 1YUWA 3ULEB 4DU3A 3CC2N 3OTOK 3AO1A 2IIRA 3DYAA 1EP4A 3NGZA 1KVAA 5KTQA 4PKGA 3B8AX 3LPTA 3UB5A 4DLGA 1HQEA 3K57A 1BU6O 3RR8A 3KD5E 3HL8A 4BR4A 4CEAA 3M6GA 4BRCA 3QEIA 3WXLA 4F8RA 4AHVA 4DF8A 1WBDA 4YDUC 3QICA 3MXIA 1X3NA 4JD2B 3SCXA 1VQLN 4CGGA 1D9FA 3AVBA 1RBUA 4BY9C 3CPWM 3WUHA 1ATRA 5KQDA 4FLWA 3KLEA 4FWOA 4JI2K 4JK7A 3M8PA 2QWLA 3TTCA 4CK2A 5CY4A 1WSEA 3V6DA 2HNDA 4CZFA 4PQUA 2QWMA 1RDDA 2D5RA 3HTVA 2G8IA 4DR2K 2ZE2A 1LW0A 1RTDA 4I6MB 3ZYYX 2YHWA 4JI5K 1XMQK 4HUFA 1BI4A 4CEFA 1QQOA 1REVA 4CEQA 4LF6K 1Z05A 4IO9L 1RCHA 1LV5A 1HKGA 2OYQA 3RWUA 1T6CA 1RT3A 5IT9O 5BRDA 4RTFD 4BC5A 3BDPA 4XEIA 1MA9B 2ZQBA 4DG1A 5SZTA 5AJ3K 1ZBSA 4JI8K 1FK9A 2J4RA 2NRTA 4FOEA 2YJEA 2GWKA 5BREA 3HRGA 5FDLA 4J2EA 2HHQA 2Q3SA 4FW2A 1BGXT 1N36K 4FLXA 1EQYA 3FR0A 3CCLN 3G0ZA 1W9HA 3VENA 3WXMB 1VSEA 3RRHA 3DLGA 3VEVA 4FWRA 3VQCA 1B9FA 4Q5VA 4H4OA 4AHCA 1S72N 3OYBA 4EIAA 5E84A 1CZ9A 1NOYA 3AA2A 1GLDG 3KVGA 4DV2K 2Z1IA 4OKEA 2ZJRL 4M3XA 2ZJPL 3HPOA 1B9DA 3L3UA 4CGHA 3CFRA 3U9ZA 3PO4A 4C23A 4O8UA 2RPIA 3P31A 1YAGA 3ZSXA 4B9QA 1QZ5A 3S41A 1N34K 2D0OA 2NRVA 3ENBA 2Q0RA 4KH6A 3NGIA 1WUAA 4DTNA 4G9ZA 3VGLA 2KFNA 3VEYA 5AQRA 1EETA 4FSVA 3KLHA 1R0AA 4E0DA 1U2VA 2P9KB 2E1ZA 4CJFA 2WBNA 1VK0A 4EHTA 1O1WA 4FOIA 3V9XA 1QSLA 3VF6A 1K8AO 1D4XA 4ZTJA 3T19A 2QM1A 4FWQA 4CEEA 3SAGA 2X6SA 4CEBA 4BRLA 1GLCG 2V52B 3EZ5A 3RR7A 4NYFA 3V9SA 3VQQA 5I9EB 3K5LA 1C0GA 4H0PA 4FWLA 1Z26A 4IOCL 3TU5A 3NMUA 5AZJB 1ZC6A 3O9UA 3DOLA 4JYAK 4FWMA 2KFZA 2OANA 1J53A 1T7PA 3SUNA 3DRRA 1HNZK 4M3YA 2WONA 3QEWA 4NXNK 5TKWA 4CJRA 1WB9A 1NJYA 2P9SB 4WQ4A 4ILHA 4GKJK 3E1YA 2A3ZA 3E9OA 3VQAA 4DQPA 4JN4A 1WSJA 4M7XA 3AO2A 1Q81O 4BC2A 2GELA 4J8FA 3MAQA 4FZZA 4IOXA 3C7NB 5AQPA 5KQ8A 3CCUN 5DMRA 5HOOA 3QETA 5J1EA 3MEDA 1BQMA 2E88A 2FBXA 2F4VK 4DFMA 4M41A 3OYMA 3WNGA 4CBUA 3HXMA 2P9IB 1TL1A 1BDGA 4O5FA 1S1XA 1CZAN 3IS9A 3O1WA 4YHHK 5FRMA 4M3RA 3D2FA 4IDHA 3D6RA 3CQXA 3O1BA 1HKCA 2NRHA 4BRNA 4Z4HA 4N56A 4DFJA 1WSHA 4YORA 1RTJA 1N8RO 1ZBUA 4LF9K 4KH5A 2VWJA 3VETA 4B9VA 3SQ0A 4BRGA 3O3GA 2YNHA 4DTUA 3FZMA 3PIOL 1NJXA 3CFOA 4CEOA 3ZT0A 3L2VA 4W5TA 2HHVA 4WFAL 3BY5A 3KLFA 4M42A 5HRNA 4JKAA 2UUCK 2P51A 3H45C 2BTFA 3DXKA 4BRAA 2UU9K 4OLAA 2FBVA 4DTPA 2KW4A 2P9NA 1JLQA 1D5AA 1GLJO 1GLBG 3QMLA 3D2EA 3SBGA 2G8HA 1IKVA 5LL6Z 4JAXA 3U3GA 4OPHA 1K9MO 4YNQA 3MEGA 4X65K 4E3SA 3T1YK 3UKUA 3HOTA 4MFBA 1WBBA 3ZX2A 3L2QA 1KLMA 4DSKA 4AILC 2QWQA 2ZD1A 1L5UA 3HPHA 2WFBA 3OA9A 3ID8A 4ELVA 4CJTA 4M45A 1BL3A 4AHSA 2QTDA 1B92A 3O3FA 3L2WA 2PZSA 5K14A 1RBSA 2NUBA 1XWLA 2UUBK 3CCEN 1C6VA 1NGJA 4H03B 5DM7L 4F3TA 4CERA 3RVCA 4IJAA 4DV0K 4FJHA 4IKFA 1U45A 2ITMA 4FZYA 3O9SA 3V1QA 1XNRK 1S1WA 2YNIA 4BREA 4BRHA 5HRSA 2NRXA 4J2AA 3K2PA 3VQ4A 4R5PA 1JLGA 2GTDA 4KI4A 4PKIA 3QBXA 4FPAA 3BEXA 3JSMA 2XY6A 2E5LK 3QFPA 3FZHA 3IFRA 3SV4A 3EL2A 1KTQA 1D8YA 3KK3A 2NRZA 1QVGM 3VTIA 3CF5L 2PFUA 3DLRA 1TUUA 1BCOA 3RSEB 5HBMA 3K5OA 4J2BA 4CK3A 5TKYA 3JS6A 3EE8A 4HCCA 3GDQA 5JVHL 4FL9A 3TABA 1EWRA 5JS1A 3MN5A 2BH1A 4OJRA 1U49A 4B3MK 2EWSA 2I7NA 1NK7A 3KZBA 4JK9A 3TSPA 3DRSA 1NGEA 3ALYA 1YVNA 3ITHA 4DTMA 2GBZA 2Q31A 2HBKA 3DLBA 1NK9A 4FJXA 1VQ5N 4JRPA 4GV6A 3A5MC 4CJKA 5DM6L 3OYGA 4F9OA 3EN9A 5AQJA 3M5RA 2VG6A 2B4JA 4E19A 5H1SQ 1NU0A 3VQDA 4GNIA 2P9LA 3PIPL 3TAEA 4YOYA 4OLBA 2F96A 4HCBA 4IJNA 5GINA 3BGRA 3MN9A 1LWEA 4CZLA 1TKDA 5EY4A 1YJ9N 1GOBA 3I0RA 4PL7A 1T03A 3OYFA 4KI6A 2JGUA 4FJNA 4BDZA 3OVNA 4X64K 4BGBA 3L0QA 3PX4A 2PYJA 3UKRA 4BR2A 2OPPA 2KLAA 1M1KO 4QS8A 4BWJA 4JI3K 3AGKA 2YJFA 5EOYA 3O08A 3U9DA 1O13A 1HNXK 4BR0A 3W0LA 4F4KA 3VA3A 5D3GA 4KRFA 1TV6A 4GW6A 1QTMA 1BQNA 1OKJA 4BR7A 4BG9A 3WEEB 1VSMA 4B1UB 5JVGL 2NRWA 2D1KA 4B9MA 4E7LA 4XH1A 4KO0A 5BPNA 3LZIA 3ID6A 3O9TA 4OO1J 2D0BA 3L3VA 1JJ2M 2HOEA 4ZTFA 3GG4A 5AR0A 1QQNA 3DXMB 2X6NA 1E3MA 5MLCQ 3THYA 3V4IA 2QW9A 1Y64A 4A57A 4CJ3A 1KFSA 1X1PA 1RDBA 2P1JA 4YY3K 3P39A 1HRHA 3AY9A 2FXUA 2PBDA 4H8KA 2CGJA 4G1QA 5AQLA 2RE2A 4AF1A 1IG8A 4LH5A 1ZBHA 2VG5A 3C65A 4O44A 3SPYA 2KZMA 3THXB 4GY2B 4MO4A 5AFUH 1LCUA 3AVGA 4QOZB 4GVEA 1YITN 2P9PA 1NK6A 3CD6N 2UYTA 1K8KB 3CIPA 4RW8A 1JXBA 4CESA 4F3OA 3CJ9A 4KTQA 4IEEA 3CQYA 3N4PA 4JKBA 4C1NI 4MDBA 3U4LA 1QS4A 4KHPK 4B3RK 3KLGA 2XRIA 3J8AA 4ILJA 2E8AA 5J2MA 3VQ9A 2FSNA 5GAEP 4NO7A 1YTUA 4CF8A 2XY5A 4WF9L 1QHTA 4B8CA 1V4TA 3O9RA 4FJ9A 3LAMA 3NF9A 3OYIA 2W6KA 3U3YA 2Z1JA 4FM1A 1T3VA 3BZKA 4CF2A 3SBTA 1WAJA 2ETJA 5FPMA 2HB5A 4IG3A 3LDQA 5I3UA 4FK4A 3S9HA 4B9SA 1J6ZA 3OYNA 4BACA 3CJ7A 3ENOA 3LALA 4BG8A 4CZJA 2HHSA 3G10A 5GADP 4ILGB 3ZX0A 5HROA 3OBWA 1UOCA 3NAEA 4H0OA 5AQVA 5GAGP 1IV0A 1C0FA 3OJSA 5CR4A 4DQSA 3HT3A 4KB1A 1C1CA 4DTJA 4K8ZA 2W41A 1NG9A 1U6ZA 3O4WA 3GBTA 3ZT4A 5SWMA 4OKKA 4M3WA 2A1RA 3ZSQA 4DQQA 3RRGA 4Z4GA 3TAQA 4E89A 1FXXA 2ASMA 2E1YA 2O8DA 1VSLA 3AVCA 5AQWA 1TUYA 3TR8A 4EZ9A 1NGHA 3LP1A 3AA3A 1KAXA 3AVIA 3ATUA 3WT0A 3CJCA 1EX4A 1H1VA 5CHIA 3AVFA 4WE1A 2YI1A 3HYFA 3PLAA 1G15A 1I39A 4WFNL 1NGBA 3V81A 3KHYA 4EHUA 4WQ5A 4BRDA 4BDYA 5A2QO 4DSLA 1BWFO 2YNFA 4LY7A 3JYTA 3NF8A 3U6FA 1KQSM 4BROA 4LC9B 5F2RA 4B1ZA 3R3LA 5BPLA 3DM2A 2DTUA 5E41A 5ELZA 3TAMA 3OY9A 3SJJA 4FVUA 4DKWA 4IFYA 4GMJB 4JI1K 4IEIA 5J2NA 4DFPA 2HHUA 2VCPA 4U7BA 1RFQA 3MWPA 1SV5A 4NCBA 1CLQA 4CHQA 4W5RA 2B5JA 3H46O 4DV5K 1XC9A 4B9LA 1HPMA 3QLHA 4GKKK 2FC0A 3THWA 1QHAA 1NGFA 4NYNA 3MCPA 4JKFA 4CF9A 2VGNA 2IVNA 1BG3A 3KLIA 1TKZA 4ELUA 3OBYA 4KBOA 5CYQA 1N33K 1VQ7N 3NBPA 3CQ8A 3IUCA 1BOTO 3D0PA 1BUPA 4KREA 1C1BA 4FJLA 3DLEA 1U2VB 3AAQA 4F2RA 3DOKA 4DV6K 3THVA 1S6PA 3O4QA 1HYZA 3VQEA 5AQFA 3SAFA 4BQLA 4B1VA 2E2NA 1V4SA 1KSPA 4C1NK 2O8BA 3HBTA 1VQNN 4IZ9A 3ULEA 4E1NA 3ZSOA 5DK5A 5C15A 4FJIA 1KVCA 4Z4FA 2NRRA 4HVJA 1T44A 5C10A 4LFCK 4A62A 1LW2A 4DB3A 4DU4A 1SAZA 4CHZA 4JHDB 4NXMK 3LPUA 4CJVA 3AGRA 4FYDA 2F9WA 4C8NA 1JCGA 3ZSYA 1YHQN 4JD2A 4R79A 3PSIA 2XO7A 3K5MA 2QK9A 1C1AA 3TARA 3VF4A 4IOAL 4YDUA 1T6DA 2KHOA 3SAHA 2JLEA 3TSQA 5AQZA 1ESVA 3DJCA 4H0YB 4HWIA 5FROA 1I94K 1YI2N 2IC3A 4CW7B 4CJ7A 1BISA 5AQQA 3H1VX 4DR1K 4DQ8A 4BR9A 1RDAA 1Z25A 2HNYA 4CJUA 4JKCA 4DFKA 2GV9A 3GL1A 1U4BA 4JI0K 3QIOA 1ZXOA 1RDUA 1NK5A 3DMJA 1GLFO 3KKSA 3T7ZA 4I7FA 3D2FB 1RTHA 1N32K 2Z1HA 3HP9A 1J5EK 3KTQA 2B6AA 1TYQB 3FZLA 3NHGA 3F73A 4DS4A 3U8XA 3AVHA 3KJVA 2HNZA 4FJJA 4C8OA 1HYVA 3JAMO 3RMAA 5LMNK 1Q7YO 4KV8A 1WSGA 1WLJA 2HBJA 3NGYA 4MO5A 5LJWA 4H0XB 3P1GA 4CD1A 1DGKN 4CF0A 5AQXA 3SQ1A 1JKHA 4DSJA 3VTHA 1TVRA 2O4IA 4B8AB 3HJFA 4JKGA 3DXKB 4B1WB 4FZXC 4CFCA 4A2BA 3LANA 4FJGA 4FJMA 1SUQA 2CGKA 3ZEUB 4BRKA 3B6OA 3C6AA 4K43A 4LD0A 1HLUA 3OS1A 5AQHA 5I42A 5GIOA 2HHXA 2NZTA 1VSKA 3LZJA 2E6MA 3CETA 2O8FA 4IBNA 3DI6A 4YOVA 4JEPA 3PV8A 1NGGA 1J54A 3VQBA 1KD1O 3LM2A 1SL1A 1IKWA 5CYMA 1L3UA 1FJGK 1JL2A 3O8MA 3SV3A 3HVTA 5C2FA 4KTWA 3VQ7A 1W97L 2O4GA 1MU2A 2ZF5O 2UXDK 1YXQA 2P9KA 5GIPA 4BVPA 3TANA 1GOCA 1P8ZA 1LAVA 2HW3A 4L3QA 2LSNA 2A40A 3M3ZA 3BP8A 3IG1A 1C0TA 4DTRA 4OVLA 4PL8A 2GWJA 2OTLN 3DWLA 3MXMA 4O8KA 1XNQK 1GLAG 2WTUA 3ZX3A 3O9QA 3OYDA 2HSTA 4KHSA 4JNEA 4CECA 4AH9A 2Q0UA 4FLTA 4B1XB 4N47A 1EWQA 1E4GT 1ZYQA 3I8BA 4BC4A 2BE2A 1HKBA 1BIZA 1HNWK 2YKNA 2OZMA 3ATVA 2BDPA 2UXBK 1CZBA 3K5NA 4DSIA 1ZBIA 5AZIB 1JLAA 1JXEA 2YNGA 3A8YA 4KHNA 3L4IA 4JK8A 1YIJN 1T05A 1M90O 4GV3A 3K0SA 1KCFA 2V7YA 2QA4N 3CC4N 1ATSA 3OS2A 4FWPA 4I9QA 3NE6A 4I9LA 4I2PA 3P38A 1HX1A 2IAJA 5KI6A 3EY1A 5LY3A 4MDAA 2RF2A 4DSFA 1TKXA 3QEVA 3CERA 4BGAA 4CI6A 4IWVA 2A1SA 4CIEA 4CHNA 3SQ4A 3PX6A 1CXUA 3G25A 4ISEA 3P5JA 1IBKK 3QEPA 1HMVA 1Y97A 4MLEA 5B8HA 3TAFA 4FK0A 5CE3A 1J5OA 3LM9A 1DTTA 1JLBA 2GX9A 3FE1A 4QCLA 4RW6A 4CZIA 1LOTB 5JICA 2F7TA 4JI6K 3R1XA 3FZFA 5BN8A 1A5VA 3DLHA 2KKZA 3SUQA 1X9JA 1GOAA 4CHYA 1HPZA 2XHBA 3S3OA 4DQRA 4DS5A 4JKHA 1RTIA 4LSNA 2W42A 1NKEA 3BUZB 4LH4A 4X62K 4CK1A 4JS4A 3QESA 4DR3K 2HBLA 3IMXA 2HVIA 3MEEA 1OVYA 3UKRB 1NNEA 2DFHA 3HP6A 4Z94A 2HBMA 3S3NA 3UIQA 2AA4A 4PWDA 4AHTA 2GUIA 3O3HA 3VEWA 4AM6A 3LWLA 1X3MA 1IKXA 1IBMK 1VQPN 1CXQA 1U04A 3J7YP 3VF2A 3MN7A 1FKOA 1MWMA 4FJ7A 4DR7K 3SQ2A 2Q2RA 2QWOA 3VESA 3V9ZA 5LMUK 3VGKA 1RT4A 3A0IX 3NFAA 4FLVA 2QWRA 1RT6A 3Q7CA 4PY5A 2ZM6K 2FSKA 1U48A 5C2DA 3CFPA 3THYB 2G8KA 1LWCA 3OYHA 4A5AA 3K9JA 4OGEA 3C94A 4FCYA 1JLFA 1P90A 1HQUA 4BRQA 4CEDA 1N6QA 3D45A 1DT9A 2G8VA 4CJSA 1Q8IA 2HVHA 4HUGA 3MX5A 1VAZA 1NOZA 2V51B 4CZEA 3O6WA 4FJ5A 1NMDA 4BRMA 2P9PB 2VGMA 4CFDA 4KKOA 4O4GA 3M1FA 5M1OA 3NH0A 2WC9A 3G4SN 4CBWA 3CCQN 3NH2A 1XUPO 2ITGA 2ZJQL 2HHHK 4HTLA 1VSFA 4FXDA 4DF4A 1JCEA 3A5NC 4GVMA 3P83D 2IOCA 2F8SA 3RSEA 1TK5A 4CIGA 2FLOA 1XHXA 2O8EB 2QI2A 3C0BA 4JKEA 3PUFA 4DSEA 1BO5O 4E1JA 1A5WA 1VQ6N 4LF7K 4BRPA 3E66A 4HUEA 1Q9XA 3A2FA 1MWKA 2OCEA 1XQSC 4Y1CA 4FO0A 3M8SA 3OW2M 4Z4CA 3T1HK 4B1YB 1FKPA 1WSIA 2IDOA 4FK2A 2Q97A 2A6AA 1ITGA 4FLUA 1ASVA 3E01A 4WCEL 3WXJA 4FM2A 3ZT1A 4A5BA 4H5TA 4DR5K 1X9SA 1KAZA 3K9KA 3QDKA 1HNVA 1KXPA 2EHGA 2ASPA 1DEJA 4KFBA 4CJWA 3VEXA 3O4NA 3VQPA 2P9UA 3ZT2A 3H6EA 2JWLA 2X78A 2BGGA 1ZBLA 4DTXA 4BRFA 2YV0X 4EP4A 1WSFA 1S9GA 2XY8A 4I2QA 5AQOA 3ZSWA 4Z4IA 3ENHA 4JV5K 2CH6A 1VQON 3FFIA 2A41A 3AO5A 2E6LA 3I0SA 3CCMN 1MDUB 3F9KA 1OH8A 1YF5L 4E7IA 3KWGA 4CIFA 3M8RA 4LF8K 2FBYA 3CMAN 1TAUA 5KPZA 4LF5K 1EXQA 5KGWA 4O5BA 2P5GA 4FJKA 4HTUA 4KB0A 5J2QA 3I55N 3AVAA 3H08A 4QS9A 3BF1A 5AQMA 2E20A 1QSYA 3AO3A 4BRIA 2YHXA 4IO8A 1WOQA 4QS7A 3KIOA 4FLYA 1L3TA 2QXLA 2ASOA 3I56N 3OYLA 4MLHA 3VOVA 2NNWA 3WEEA 3HM9A 3FFKB 1KLNA 3CC7N 5AQGA 4CJPA 5HP1A 3HSCA 4NB4A 2VWBA 5AFUA 3VEZA 4BE1A 2KQ2A 3KK7A 1DKGD 3EEQA 4CZGA 3SLCA 3SUPA 4E7HA 3SPZA 3TI0A 2G8UA 4EP5A 1S6QA 3CYMA 3OYCA 4N5SA 3TPQA 3H3NO 3A5OC 4FW1A 5AQTA 3THWB 3K59A 1VSIA 3WXKA 3ZSZA 5F0XA 4KHYA 2OPSA 1BI4B 4YOWA 3ZETA 4OKJA 3WNEA 5CZ1A 4CZHA 4WFBL 3HK2A 3CHWA 1J9AA 3L4QA 4OPAA 3T1AA 3LAKA 1S1TA 4LFAK 3VQ6A 3CCVN 4KTZA 1LWFA 4CCHA 1SS6A 1K8KA 2DFEA 1VQ8N 3V1RA 4NCGA 5HLFA 1UA0A 2G8WA 4FWNA 4DTOA 2AP1A 4CGIA 3EE9A 3SI6A 5AQNA 4OGCA 3PX0A 1F21A 2PY5A 3PSFA 3VMFB 3QINA 2OTJN 4Y0WA 1JCFA 4B9UA 3S3MA 4DHYA 3IKMA 1BA0A 4K42A 1VQMN 3SK3A 2E2QA 1BCMA 5KRTA 4AHUA 3TAPA 2PAVA 5CZ2A 4NCAA 3CI5A 3E9LA 3L2RA 4B9NA 3O5BA 1IBLK 4UY8O 2E4LA 2OZSA 1X9MA 2VQFK 4BC3A 4AHRA 4UQGA 2VWKA 4K0KK 1SKRA 1SQKA 2DFFA 2HHTA 3ZLJA 2O8CA
chains in the Genus database with same CATH topology
2WUSA 4B1WB 3QFPA 3CPEA 3FZHA 4A2BA 3SJHA 3IFRA 2CGKA 3LDLA 3ZEUB 4BRKA 3EL2A 5LJVA 3C6AA 5M1NA 3ZETB 4K43A 1HLUA 2NRZA 2Q1NA 5AQHA 3CJAA 1QVGM 3VTIA 5GIOA 3CF5L 2NZTA 1EO1A 2PFUA 2YX6A 4EAHD 1NM1A 1TUUA 3RSEB 3CETA 4H5RA 5TKYA 4YOVA 4K25A 3JS6A 4JEPA 3BF3A 1NGGA 2E2PA 3EE8A 2YCHA 4U67L 1KD1O 3LM2A 3GDQA 3CXCM 3NVMA 4FL9A 1IJJA 5JVHL 4WQ5C 3MN5A 2BH1A 3QBWA 4RCHA 5AQKA 2IVPA 2EWSA 3O8MA 2I7NA 5C2FA 3KZBA 4JK9A 4RWTA 3TSPA 1NGEA 1W97L 3LDOA 3LDPA 1QZ6A 2ZF5O 4DCHA 1YVNA 1YXQA 2P9KA 5GIPA 4EFHA 4BVPA 5AQYA 1P8ZA 2Q31A 2HBKA 2JWKA 4CBXA 4H5VA 2E2OA 3MX2A 1HUXA 4L3QA 1S3XA 1VQ5N 3CCJN 2A40A 3M3ZA 3BP8A 4GV6A 3A5MC 4BVOA 5DM6L 5HL7L 4PL8A 4F9OA 2GWJA 5AQSA 3MWTA 2OTLN 3DWLA 3AARA 4WQ4C 3JXUA 3DXMA 4O8KA 1GLAG 3EN9A 2F9TA 5AQJA 3M5RA 3ZX3A 1K73O 3O9QA 1Z6RA 2HSTA 4JNEA 1NGAA 5FPNA 5H1SQ 1ATNA 1W2BM 2FSJA 4M7YA 2Q0UA 5M1FA 4B1XB 4JKGB 5AQUA 4IXCA 3MCAB 1E4GT 3H1QA 3I8BA 4GNIA 4BC4A 2P9LA 1HKBA 3PIPL 2YHYA 4YOYA 5EX5A 4BQZA 2QEXN 3UE5A 5BRFA 5C0YA 4IJNA 5GINA 3MN9A 3ATVA 4CZLA 2CH5A 5EY4A 4WYBA 4A59A 1YJ9N 3AAPA 5BRHA 4PL7A 5AZIB 3WXIA 3DAWA 3FZKA 3A8YA 4BR5A 3L4IA 4JK8A 1YIJN 3EKSA 4BGBA 1Q86O 3L0QA 1M90O 4GV3A 2V7ZA 3UKRA 4BR2A 1KC8O 2V7YA 3TSUA 2QA4N 2RHKA 3C6HA 1ATSA 4I6MA 4FWPA 3CC4N 2KLAA 3TTFA 5BN9A 1M1KO 4QS8A 3P38A 1HX1A 2YJFA 3AGKA 5EOYA 3O08A 3U9DA 2HF3A 3G6EN 2FF6A 1O13A 3GOIA 4BR0A 3W0LA 5LY3A 4MDAA 4H5NA 1QQMA 1S22A 1YUWA 3CERA 3ULEB 3G71N 1YJNN 3CC2N 4BGAA 4CI6A 1OKJA 4BR7A 4IWVA 4JKDA 2IIRA 4BG9A 3HI0A 3WEEB 4B1UB 5JVGL 5JMVA 2NRWA 2D1KA 2D0PA 3G25A 4ISEA 4XH1A 5BPNA 3ID6A 3O9TA 4OO1J 1HJOA 4PKGA 3B8AX 3UB5A 1JJ2M 2HOEA 1BU6O 4MLEA 3GG4A 5B8HA 5CE3A 4BR4A 1NJIO 5AR0A 1QQNA 3M6GA 4BRCA 4YOUA 3WXLA 2A5XA 3DXMB 3LM9A 2GX9A 3FE1A 4YDUC 3QICA 5MLCQ 2QW9A 4CZIA 1VQKN 1LOTB 1X3NA 5JICA 4JD2B 1Y64A 4A57A 2F7TA 1VQLN 4PHTX 1NGDA 3R1XA 3WQUA 3FZFA 5BN8A 4K41A 3P39A 2KKZA 4BY9C 4FPBA 1X9JA 3CPWM 4JHDA 3AY9A 3WUHA 2FXUA 2PBDA 1ATRA 3VPZA 3H3OB 1NBWA 2CGJA 2P9NB 5KQDA 4A61A 5AQLA 2RE2A 4AF1A 3QFUA 1IG8A 3MN6A 3W3DA 3D2EB 4FWOA 4JKHA 5JLHA 3C65A 4JK7A 2QWLA 3BUZB 3TTCA 3CMEN 5KPTA 4GY2B 4CZFA 4NLCA 4MO4A 5AFUH 4M63C 2QWMA 2HBLA 1LCUA 3HTVA 3IMXA 2GUPA 3TTDA 3VERA 3UKUB 4GVEA 1YITN 2P9PA 1GLLO 3WQTA 3CD6N 2UYTA 1K8KB 1OVYA 3CIPA 3UKRB 4ISFA 4I6MB 3ZYYX 2YHWA 4Z94A 2HBMA 3CJ9A 4H5WA 2AA4A 4IEEA 3CQYA 3N4PA 1QQOA 4JKBA 4C1NI 4MDBA 1Z05A 3U4LA 4IO9L 3VEWA 4AM6A 2NLXA 1HKGA 1X3MA 3FGUA 3HZ6A 1T6CA 3J8AA 1VQPN 4ILJA 2E8AA 4XH5A 5BRDA 4RTFD 4BC5A 3VF2A 2FSNA 3HOSA 3MN7A 5GAEP 4NO7A 5AQIA 1MWMA 4XEIA 5FPDA 1MA9B 3CJBA 2Q2RA 2QWOA 3F5TA 3VESA 4WF9L 1ZBSA 3MK6A 2J4RA 1V4TA 2NRTA 3A0IX 3O9RA 3VGKA 2QWRA 4FOEA 3Q7BA 3Q7CA 1SZ2A 2GEMA 4YOTA 2YJEA 3SMPA 2FSKA 5M1KA 1G99A 2H3GX 5C2DA 2GWKA 1TYQA 1T3VA 3A5LC 3HRGA 5BREA 3LL3A 3SBTA 3QB0A 3VGMA 3P4IA 1EQYA 3FR0A 4A5AA 5AZJA 3CCLN 5FPMA 3VENA 3WXMB 3K9JA 3LDQA 3VEVA 4FWRA 1P90A 1S72N 4EIAA 5F1XA 1J6ZA 4BRQA 5E84A 3CJ7A 3ENOA 1DT9A 1GLDG 3KVGA 4PKHA 4BG8A 4CZJA 3MDQA 5GADP 2ZGYA 1RGIA 4ILGB 2ZJRL 3ZX0A 2ZJPL 3OBWA 3MX5A 4H0OA 1VAZA 2P9SA 5AQVA 5GAGP 2V51B 4CZEA 1C0FA 3O6WA 5CR4A 4XH4A 1NMDA 4H0VB 3U9ZA 4C23A 4O8UA 4BRMA 3P31A 1YAGA 4B9QA 1QZ5A 3S41A 2P9PB 2VGMA 2D0OA 2NRVA 3ENBA 2W41A 4CD3A 2Q0RA 3M1FA 4KH6A 5M1OA 1WUAA 3ZEUA 1U6ZA 3O4WA 3GBTA 3C7NA 2WC9A 4G9ZA 3VGLA 3G4SN 4CBWA 3CCQN 3VEYA 5AQRA 1XUPO 4FSVA 2ZJQL 4HTLA 2ASMA 2E1YA 3O80A 1JCEA 2W40A 3A5NC 5AQWA 1TUYA 3RSEA 1U2VA 2P9KB 1NGHA 2E1ZA 2FLOA 3SMSA 3C0BA 2WBNA 2FF3B 1GLEG 1KAXA 2QI2A 4JKEA 3R8EA 2P9IA 3ATUA 4FOIA 3WT0A 4EHTA 3CJCA 1BO5O 4E1JA 5C12A 3VF6A 1K8AO 1VQ6N 1D4XA 1H1VA 5CHIA 4BRPA 3E66A 2YI1A 3PLAA 1ILYA 1MWKA 4WFNL 2QM1A 1XQSC 1NGBA 4FO0A 4FWQA 3SAGA 3KHYA 3OW2M 4EHUA 4BRLA 4B1YB 1GLCG 2QWPA 2V52B 4WQ5A 4BRDA 2Q97A 2A6AA 3F2KA 3HM8A 5I9EB 1C0GA 4WCEL 4H0PA 1Q18A 4FWSA 1BWFO 4FWLA 5E26A 3WXJA 4IOCL 1KQSM 1QVFM 3TU5A 3CCRN 3NMUA 1XC3A 4BROA 4LC9B 5F2RA 5AZJB 4A5BA 1ZC6A 3O9UA 5EVZA 4B1ZA 3R3LA 2ZGZA 1BA1A 4H5TA 5BPLA 1KAZA 2P9LB 3K9KA 3QDKA 4FWMA 3LDNA 5BR9A 5ELZA 1KXPA 2ASPA 2OANA 1DEJA 4FVUA 3VEXA 2VYPA 4DKWA 2HMPA 5EXWA 5TKWA 4IEIA 2P9UA 2VCPA 2JWLA 3H6EA 3CJ1A 1RFQA 2P9SB 3MWPA 4WQ4A 4U7BA 2HF4A 4BRFA 3EO3A 4ILHA 3E1YA 2DPNA 2A3ZA 3H46O 3E9OA 4JN4A 5AQOA 1HPMA 4M7XA 3ENHA 2CH6A 4BC2A 1Q81O 2GELA 4YOXA 1VQON 2A41A 1QHAA 4J8FA 1NGFA 4ISGA 3F9MA 3MCPA 4JKFA 3CCMN 1MDUB 2VGNA 4IOXA 1YF5L 3C7NB 2IVNA 5AQPA 3KWGA 5KQ8A 2Q36A 3CCUN 1BG3A 5HOOA 4KH4A 3R6MA 3CMAN 3OBYA 4KBOA 5KPZA 1VQ7N 2E88A 3EKUA 1BOTO 3IUCA 5AZIA 1BUPA 2I7PA 1U2VB 3AAQA 3I55N 4CBUA 4QS9A 1NWKA 2P9IB 5AQFA 3BF1A 5AQMA 1BDGA 4O5FA 3SAFA 2E20A 4BQLA 3O1WA 1CZAN 4B1VA 1VQ4N 2E2NA 1V4SA 4BRIA 2YHXA 3D2FA 3D6RA 3CQXA 3O1BA 1HKCA 2NRHA 4IDHA 4BRNA 4C1NK 4IO8A 3HBTA 1WOQA 3KWIA 1VQNN 4QS7A 4IFEA 4IZ9A 4YORA 3ULEA 1N8RO 2QXLA 2ASOA 3I56N 4MLHA 5C15A 4KH5A 3VETA 3VOVA 2NNWA 3WEEA 4GV9A 1NLVA 2NRRA 3EZWA 1T44A 5C10A 3FFKB 4CZMA 4BRGA 4A62A 4DB3A 3CC7N 1SAZA 5AQGA 5FPEA 3HSCA 3FZMA 4JHDB 4NB4A 3J7ZO 3PIOL 2VWBA 3AGRA 1KAYA 3MMVA 5AFUA 3VEZA 3IDHA 3L6QA 3KK7A 2F9WA 1DKGD 4CZGA 4WFAL 1JCGA 1YHQN 1E4FT 1RDWX 3SLCA 4FWKA 4JKAA 4JD2A 2P9UB 4R79A 3R9PA 3H45C 4A2AA 3N4QA 2BTFA 3VF4A 4IOAL 1R59O 1T6DA 2KHOA 3DXKA 3E9PA 4YDUA 4BRAA 3SAHA 3TSQA 1ESVA 2QWNA 3DJCA 3A5OC 3H3NO 4H0YB 5AQZA 1NGIA 3TPQA 3CCSN 5AQTA 4HWIA 2BUPA 3T69A 1YI2N 4CZKA 5ADXH 4H0TB 2P9NA 3WXKA 4CJ7A 5AQQA 3H1VX 5F0XA 2CGLA 5BPMA 4YOWA 1GLJO 3ZETA 4DQ8A 1GLBG 3QMLA 3D2EA 3SBGA 4CZHA 4BR9A 4WFBL 3CHWA 3L4QA 4OPAA 4JAXA 4OPHA 3DLLL 1K9MO 3CCVN 4JKCA 1VQ9N 3D7EO 2ZWHA 3NVKA 3UKUA 3HOTA 3ZX2A 1SS6A 3GL1A 1K8KA 1VQ8N 1ZXOA 1Q82O 1RDUA 2QWQA 4NLBA 5GAHP 1GLFO 4FWNA 2AP1A 3T7ZA 4AM7A 3I33A 2WFBA 2D4WA 3OA9A 3ID8A 2IVOA 3D2FB 3EE9A 1YJWN 5AQNA 2QTDA 5M1QA 2A42A 1TYQB 3VMFB 2OTJN 4Y0WA 1JCFA 3FZLA 4DHYA 3IKMA 3OHRA 1BA0A 4K42A 5JLFA 1VQMN 3SK3A 3GE1A 5KPRA 2E2QA 3CCEN 1NGJA 4H03B 3U8XA 5DM7L 3RVCA 2PAVA 4IJAA 3CI5A 2ITMA 3O9SA 3E9LA 1NGCA 1Q7YO 4BREA 3O5BA 2HBJA 5M1PA 4BRHA 4MO5A 4UY8O 2NRXA 5LJWA 4H0XB 4CD1A 1DGKN 5AQXA 4BC3A 3FLCO 3VEOA 3VTHA 5ADXA 2GTDA 4PKIA 1SQKA 3QBXA 4FPAA 3BEXA 4JKGA 3DXKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9R A;  4OPA A;  4OPH A;  3O9U A;  3D6R A;  2KKZ A;  3P39 A;  3M5R A;  3KWI A;  3KWG A;  3O9Q A;  3RVC A;  3O9T A;  3P31 A;  3O9S A;  2RHK A;  3OA9 A;  3P38 A;  3EE9 A;  2GX9 A;  3EE8 A;  3F5T A;  3L4Q A; 
#chains in the Genus database with same CATH topology
 2WUS A;  4IFV A;  3CPE A;  3SJH A;  3LDL A;  4B08 A;  3LWM A;  1RT1 A;  2YHA A;  3CJA A;  3CM5 A;  4LF4 K;  3V9U A;  1EO1 A;  1L3S A;  1YT3 A;  2YX6 A;  1SL0 A;  3K58 A;  3HPG A;  4CGD A;  4K25 A;  3BF3 A;  4DV4 K;  1NMN A;  2E2P A;  3LDS A;  4U67 L;  4MQ3 A;  3TAG A;  3CXC M;  4ICL A;  1LAW A;  3WNF A;  4RWT A;  4CFA A;  3LDO A;  3LDP A;  1QZ6 A;  3RMC A;  3OJU A;  3AA4 A;  4EFH A;  5AQY A;  4CBX A;  4H5V A;  2E2O A;  3MX2 A;  3NDK A;  1S3X A;  3SYZ A;  4PUO A;  5AQS A;  3AV9 A;  3MWT A;  4WQ4 C;  1HNI A;  1W0H A;  3JXU A;  1TAQ A;  4BDP A;  2F9T A;  1K73 O;  1WN7 A;  1NGA A;  1ATN A;  2FSJ A;  4M7Y A;  3RTV A;  4CJ5 A;  4JKG B;  1JLE A;  1C0M A;  3RMB A;  1SL2 A;  2YHY A;  5EX5 A;  4BQZ A;  4LSL A;  3T3F A;  2QEX N;  3UE5 A;  5BRF A;  5C0Y A;  2VG7 A;  3VQ8 A;  3ZCM A;  4TSX A;  1RBV A;  4RG8 A;  1VRU A;  3DAW A;  3FZK A;  3C95 A;  2O8F B;  3EKS A;  1Q86 O;  4CJQ A;  2V7Z A;  4RW7 A;  3TSU A;  1KC8 O;  2RHK A;  4I6M A;  3WNH A;  1OH6 A;  4ELT A;  1JLC A;  2HF3 A;  5C42 A;  3G6E N;  3DLK A;  2RN2 A;  3GOI A;  3NF7 A;  4CGJ A;  1QQM A;  4DWI A;  2QXF A;  1VHX A;  1DLO A;  3G71 N;  1YJN N;  3J7A P;  4JKD A;  3HI0 A;  3VA0 A;  2KTQ A;  5JMV A;  2D0P A;  3NH1 A;  4RW9 A;  2BAN A;  1HJO A;  3V9W A;  4C8L A;  2HHW A;  4JS5 A;  1NJI O;  4YOU A;  2A5X A;  3ZSV A;  5IWA K;  4C8M A;  1VQK N;  2Y1I A;  4PHT X;  1NGD A;  3WQU A;  3AVL A;  4K41 A;  2WOM A;  1HR0 K;  4FPB A;  4JHD A;  3VPZ A;  3H3O B;  1NBW A;  2X74 A;  2P9N B;  4A61 A;  3QFU A;  3MN6 A;  4Z4E A;  3W3D A;  5T7B A;  3D2E B;  5JLH A;  1KRP A;  3CME N;  3I8D A;  5KPT A;  3ASM A;  3IRX A;  4NLC A;  4E7K A;  1KFD A;  1RIL A;  4M63 C;  2GUP A;  3TTD A;  3VER A;  3UKU B;  3SZ2 A;  1GLL O;  3WQT A;  3KK2 A;  4Q0B A;  4ISF A;  1RT7 A;  4CE9 A;  4O0J A;  4DUY K;  1S5J A;  4H5W A;  4RW4 A;  3BZC A;  4DR4 K;  4LFB K;  2YHB A;  2NLX A;  3FGU A;  3HZ6 A;  1RDC A;  2DY4 A;  4XH5 A;  4L8R B;  5EU7 A;  3AVJ A;  4PA1 A;  4W5N A;  3HOS A;  1NKC A;  5AQI A;  5FPD A;  3CJB A;  4BE2 A;  3F5T A;  4AQY K;  3MK6 A;  1WAF A;  3Q7B A;  1SZ2 A;  2GEM A;  4YOT A;  3SMP A;  4K8X A;  5M1K A;  1G99 A;  2H3G X;  1NKB A;  3A5L C;  1TYQ A;  3HVR A;  4B3S K;  4DTS A;  3LL3 A;  3QER A;  1QE1 A;  4IDK A;  3QB0 A;  3VGM A;  3P4I A;  3VN5 A;  5AZJ A;  1KVB A;  1Q9Y A;  4YFU A;  5F1X A;  1UWB A;  2G8F A;  1S1U A;  2I5J A;  1OH7 A;  4PKH A;  1QSS A;  3MDQ A;  3ZT3 A;  3QO9 A;  2ZGY A;  4EZ6 A;  1RGI A;  2P9S A;  1HYS A;  4Y1D A;  4XH4 A;  4H0V B;  4IG0 A;  3QEX A;  3MXJ A;  1TK8 A;  2VQE K;  1FW6 A;  4CD3 A;  2YKM A;  3ZEU A;  3C7N A;  1EKE A;  1S1V A;  2EX3 A;  3O80 A;  2W40 A;  1RBT A;  3SMS A;  4E7J A;  2FF3 B;  1GLE G;  1HJR A;  3OYK A;  3R8E A;  2P9I A;  5C12 A;  1OH5 A;  1NK0 A;  2FBT A;  1ILY A;  4F2S A;  3QNO A;  2QWP A;  3CM6 A;  3F2K A;  3HM8 A;  1TGO A;  3ISN C;  1Q18 A;  4FWS A;  4XIU A;  4M3U A;  5E26 A;  3B6P A;  1QVF M;  3CCR N;  1XC3 A;  3AVN A;  1OVQ A;  1C0U A;  5EVZ A;  4W5Q A;  2PYL A;  2ZGZ A;  1BA1 A;  3AVK A;  4C8K A;  2P9L B;  5BR9 A;  3LP3 A;  2KZZ A;  1XMO K;  2VYP A;  2HMP A;  3NCI A;  5EXW A;  3OYA A;  5KRS A;  1W7A A;  1D9D A;  1DTQ A;  3CJ1 A;  4CEZ A;  2HF4 A;  4FJ8 A;  3EO3 A;  2DPN A;  5C24 A;  3KK1 A;  4YOX A;  3LP2 A;  3RMD A;  4ISG A;  3F9M A;  1XI1 A;  4CHO A;  2IS3 A;  1VSD A;  2Q36 A;  1YTA A;  4CHP A;  1T8E A;  4KH4 A;  3R6M A;  1SKS A;  4B3O A;  4DU1 A;  4CF1 A;  3PO5 A;  3EKU A;  3AO4 A;  1BHL A;  5AZI A;  2I7P A;  2HMI A;  4N41 A;  5HRR A;  1NK8 A;  4V19 S;  1JL1 A;  3L2U A;  1RBR A;  1NWK A;  3KKR A;  3LP0 A;  2AJQ A;  3TWH A;  4W5O A;  1VQ4 N;  4KHW A;  4QAG A;  3KWI A;  1UA1 A;  4IFE A;  4M3T A;  4DQI A;  3OYJ A;  4GV9 A;  1NLV A;  3EZW A;  1TKT A;  4B3T K;  4CZM A;  1RNH A;  3J81 O;  5FPE A;  3J7Z O;  4DV7 K;  3MMV A;  1KAY A;  3IDH A;  3L6Q A;  1NK4 A;  4N76 A;  1RT2 A;  2D0C A;  4KHU A;  1E4F T;  1RDW X;  4FM0 A;  2P5O A;  4FWK A;  1NJW A;  2P9U B;  3R9P A;  4CVN E;  4A2A A;  3N4Q A;  4CGF A;  1R59 O;  3E9P A;  2QKB A;  4Z0U A;  1ASU A;  4DUZ K;  2QWN A;  1QQC A;  1NGI A;  3CG7 A;  3CCS N;  3J80 O;  2UUA K;  1S9E A;  2BUP A;  4ID5 A;  3T69 A;  3L8B A;  4O55 A;  4CZK A;  5ADX H;  4DLE A;  1IH7 A;  4H0T B;  2QKK A;  5BR8 K;  3V1O A;  2CGL A;  5BPM A;  4DMN A;  3DLL L;  4KHQ A;  1XHZ A;  1VQ9 N;  3D7E O;  2ZWH A;  1ASW A;  3NVK A;  4KPY A;  4X66 K;  3AA5 X;  1K6Y A;  3SUO A;  1Q82 O;  4NLB A;  5GAH P;  3NF6 A;  3QNN A;  4AM7 A;  3I33 A;  2D4W A;  3KD1 E;  2IVO A;  1YJW N;  3OYE A;  4CJL A;  1VRT A;  4DV3 K;  3AVM A;  5M1Q A;  2A42 A;  4HHT A;  4FVM A;  3EYZ A;  1UAX A;  3OHR A;  5JLF A;  5KPR A;  3GE1 A;  3VQ5 A;  5J2P A;  3SNN A;  4OPK A;  5JS2 A;  1NGC A;  2OPQ A;  4DR6 K;  1L3V A;  5M1P A;  2Z1G A;  4BWM A;  3PY8 A;  3FLC O;  3VEO A;  5ADX A;  2F8T A;  4JI7 K;  4KAZ A;  4ID1 A;  3LDN A;  5KGX A;  3C6U A;  3OS0 A;  1N5Y A;  5C25 A;  5LJV A;  5M1N A;  1X9W A;  3ZET B;  3ZSR A;  2Q1N A;  4DV1 K;  1IO2 A;  1U47 A;  2W6L A;  4JRQ A;  2O8D B;  4EAH D;  1NM1 A;  1IKY A;  1VSJ A;  4H5R A;  3HST B;  2YCH A;  1TL3 A;  3NVM A;  1IJJ A;  4WQ5 C;  3QBW A;  3IAY A;  3QIP A;  4RCH A;  5AQK A;  2IVP A;  2D0A A;  2OPR A;  2UXC K;  1TK0 A;  4ZHR A;  4DCH A;  1SKW A;  1BIU A;  2OA8 A;  4O0I A;  2JWK A;  2O8E A;  2XY7 A;  1HUX A;  1IG9 A;  3CCJ N;  4BVO A;  2Y1J A;  5HL7 L;  4E1M A;  3AAR A;  2ATQ A;  1I3A A;  3DXM A;  4B9T A;  2R7Y A;  4CJ4 A;  1Z6R A;  4JLH A;  5FPN A;  1YVU A;  1W2B M;  5M1F A;  5AQU A;  4IXC A;  3MCA B;  2O8C B;  3H1Q A;  2IGI A;  3HO1 A;  4M3Z A;  1NJZ A;  4JI4 K;  4BE0 A;  4J2D A;  5HRP A;  4OX9 K;  1A5X A;  2CH5 A;  3C6T A;  4WYB A;  4A59 A;  3AAP A;  3THX A;  4CJE A;  5BRH A;  3WXI A;  4H4M A;  4BR5 A;  3ULD A;  5FRN A;  4FLZ A;  1ZBF A;  3DRP A;  1RT5 A;  4CFB A;  3C6H A;  3TTF A;  5BN9 A;  4OPJ A;  1VSH A;  2RKI A;  2FF6 A;  5FLX O;  1WNS A;  3M8Q A;  2O8B B;  4H5N A;  3MEC A;  1S22 A;  1YUW A;  3ULE B;  4DU3 A;  3CC2 N;  3OTO K;  3AO1 A;  2IIR A;  3DYA A;  1EP4 A;  3NGZ A;  1KVA A;  5KTQ A;  4PKG A;  3B8A X;  3LPT A;  3UB5 A;  4DLG A;  1HQE A;  3K57 A;  1BU6 O;  3RR8 A;  3KD5 E;  3HL8 A;  4BR4 A;  4CEA A;  3M6G A;  4BRC A;  3QEI A;  3WXL A;  4F8R A;  4AHV A;  4DF8 A;  1WBD A;  4YDU C;  3QIC A;  3MXI A;  1X3N A;  4JD2 B;  3SCX A;  1VQL N;  4CGG A;  1D9F A;  3AVB A;  1RBU A;  4BY9 C;  3CPW M;  3WUH A;  1ATR A;  5KQD A;  4FLW A;  3KLE A;  4FWO A;  4JI2 K;  4JK7 A;  3M8P A;  2QWL A;  3TTC A;  4CK2 A;  5CY4 A;  1WSE A;  3V6D A;  2HND A;  4CZF A;  4PQU A;  2QWM A;  1RDD A;  2D5R A;  3HTV A;  2G8I A;  4DR2 K;  2ZE2 A;  1LW0 A;  1RTD A;  4I6M B;  3ZYY X;  2YHW A;  4JI5 K;  1XMQ K;  4HUF A;  1BI4 A;  4CEF A;  1QQO A;  1REV A;  4CEQ A;  4LF6 K;  1Z05 A;  4IO9 L;  1RCH A;  1LV5 A;  1HKG A;  2OYQ A;  3RWU A;  1T6C A;  1RT3 A;  5IT9 O;  5BRD A;  4RTF D;  4BC5 A;  3BDP A;  4XEI A;  1MA9 B;  2ZQB A;  4DG1 A;  5SZT A;  5AJ3 K;  1ZBS A;  4JI8 K;  1FK9 A;  2J4R A;  2NRT A;  4FOE A;  2YJE A;  2GWK A;  5BRE A;  3HRG A;  5FDL A;  4J2E A;  2HHQ A;  2Q3S A;  4FW2 A;  1BGX T;  1N36 K;  4FLX A;  1EQY A;  3FR0 A;  3CCL N;  3G0Z A;  1W9H A;  3VEN A;  3WXM B;  1VSE A;  3RRH A;  3DLG A;  3VEV A;  4FWR A;  3VQC A;  1B9F A;  4Q5V A;  4H4O A;  4AHC A;  1S72 N;  3OYB A;  4EIA A;  5E84 A;  1CZ9 A;  1NOY A;  3AA2 A;  1GLD G;  3KVG A;  4DV2 K;  2Z1I A;  4OKE A;  2ZJR L;  4M3X A;  2ZJP L;  3HPO A;  1B9D A;  3L3U A;  4CGH A;  3CFR A;  3U9Z A;  3PO4 A;  4C23 A;  4O8U A;  2RPI A;  3P31 A;  1YAG A;  3ZSX A;  4B9Q A;  1QZ5 A;  3S41 A;  1N34 K;  2D0O A;  2NRV A;  3ENB A;  2Q0R A;  4KH6 A;  3NGI A;  1WUA A;  4DTN A;  4G9Z A;  3VGL A;  2KFN A;  3VEY A;  5AQR A;  1EET A;  4FSV A;  3KLH A;  1R0A A;  4E0D A;  1U2V A;  2P9K B;  2E1Z A;  4CJF A;  2WBN A;  1VK0 A;  4EHT A;  1O1W A;  4FOI A;  3V9X A;  1QSL A;  3VF6 A;  1K8A O;  1D4X A;  4ZTJ A;  3T19 A;  2QM1 A;  4FWQ A;  4CEE A;  3SAG A;  2X6S A;  4CEB A;  4BRL A;  1GLC G;  2V52 B;  3EZ5 A;  3RR7 A;  4NYF A;  3V9S A;  3VQQ A;  5I9E B;  3K5L A;  1C0G A;  4H0P A;  4FWL A;  1Z26 A;  4IOC L;  3TU5 A;  3NMU A;  5AZJ B;  1ZC6 A;  3O9U A;  3DOL A;  4JYA K;  4FWM A;  2KFZ A;  2OAN A;  1J53 A;  1T7P A;  3SUN A;  3DRR A;  1HNZ K;  4M3Y A;  2WON A;  3QEW A;  4NXN K;  5TKW A;  4CJR A;  1WB9 A;  1NJY A;  2P9S B;  4WQ4 A;  4ILH A;  4GKJ K;  3E1Y A;  2A3Z A;  3E9O A;  3VQA A;  4DQP A;  4JN4 A;  1WSJ A;  4M7X A;  3AO2 A;  1Q81 O;  4BC2 A;  2GEL A;  4J8F A;  3MAQ A;  4FZZ A;  4IOX A;  3C7N B;  5AQP A;  5KQ8 A;  3CCU N;  5DMR A;  5HOO A;  3QET A;  5J1E A;  3MED A;  1BQM A;  2E88 A;  2FBX A;  2F4V K;  4DFM A;  4M41 A;  3OYM A;  3WNG A;  4CBU A;  3HXM A;  2P9I B;  1TL1 A;  1BDG A;  4O5F A;  1S1X A;  1CZA N;  3IS9 A;  3O1W A;  4YHH K;  5FRM A;  4M3R A;  3D2F A;  4IDH A;  3D6R A;  3CQX A;  3O1B A;  1HKC A;  2NRH A;  4BRN A;  4Z4H A;  4N56 A;  4DFJ A;  1WSH A;  4YOR A;  1RTJ A;  1N8R O;  1ZBU A;  4LF9 K;  4KH5 A;  2VWJ A;  3VET A;  4B9V A;  3SQ0 A;  4BRG A;  3O3G A;  2YNH A;  4DTU A;  3FZM A;  3PIO L;  1NJX A;  3CFO A;  4CEO A;  3ZT0 A;  3L2V A;  4W5T A;  2HHV A;  4WFA L;  3BY5 A;  3KLF A;  4M42 A;  5HRN A;  4JKA A;  2UUC K;  2P51 A;  3H45 C;  2BTF A;  3DXK A;  4BRA A;  2UU9 K;  4OLA A;  2FBV A;  4DTP A;  2KW4 A;  2P9N A;  1JLQ A;  1D5A A;  1GLJ O;  1GLB G;  3QML A;  3D2E A;  3SBG A;  2G8H A;  1IKV A;  5LL6 Z;  4JAX A;  3U3G A;  4OPH A;  1K9M O;  4YNQ A;  3MEG A;  4X65 K;  4E3S A;  3T1Y K;  3UKU A;  3HOT A;  4MFB A;  1WBB A;  3ZX2 A;  3L2Q A;  1KLM A;  4DSK A;  4AIL C;  2QWQ A;  2ZD1 A;  1L5U A;  3HPH A;  2WFB A;  3OA9 A;  3ID8 A;  4ELV A;  4CJT A;  4M45 A;  1BL3 A;  4AHS A;  2QTD A;  1B92 A;  3O3F A;  3L2W A;  2PZS A;  5K14 A;  1RBS A;  2NUB A;  1XWL A;  2UUB K;  3CCE N;  1C6V A;  1NGJ A;  4H03 B;  5DM7 L;  4F3T A;  4CER A;  3RVC A;  4IJA A;  4DV0 K;  4FJH A;  4IKF A;  1U45 A;  2ITM A;  4FZY A;  3O9S A;  3V1Q A;  1XNR K;  1S1W A;  2YNI A;  4BRE A;  4BRH A;  5HRS A;  2NRX A;  4J2A A;  3K2P A;  3VQ4 A;  4R5P A;  1JLG A;  2GTD A;  4KI4 A;  4PKI A;  3QBX A;  4FPA A;  3BEX A;  3JSM A;  2XY6 A;  2E5L K;  3QFP A;  3FZH A;  3IFR A;  3SV4 A;  3EL2 A;  1KTQ A;  1D8Y A;  3KK3 A;  2NRZ A;  1QVG M;  3VTI A;  3CF5 L;  2PFU A;  3DLR A;  1TUU A;  1BCO A;  3RSE B;  5HBM A;  3K5O A;  4J2B A;  4CK3 A;  5TKY A;  3JS6 A;  3EE8 A;  4HCC A;  3GDQ A;  5JVH L;  4FL9 A;  3TAB A;  1EWR A;  5JS1 A;  3MN5 A;  2BH1 A;  4OJR A;  1U49 A;  4B3M K;  2EWS A;  2I7N A;  1NK7 A;  3KZB A;  4JK9 A;  3TSP A;  3DRS A;  1NGE A;  3ALY A;  1YVN A;  3ITH A;  4DTM A;  2GBZ A;  2Q31 A;  2HBK A;  3DLB A;  1NK9 A;  4FJX A;  1VQ5 N;  4JRP A;  4GV6 A;  3A5M C;  4CJK A;  5DM6 L;  3OYG A;  4F9O A;  3EN9 A;  5AQJ A;  3M5R A;  2VG6 A;  2B4J A;  4E19 A;  5H1S Q;  1NU0 A;  3VQD A;  4GNI A;  2P9L A;  3PIP L;  3TAE A;  4YOY A;  4OLB A;  2F96 A;  4HCB A;  4IJN A;  5GIN A;  3BGR A;  3MN9 A;  1LWE A;  4CZL A;  1TKD A;  5EY4 A;  1YJ9 N;  1GOB A;  3I0R A;  4PL7 A;  1T03 A;  3OYF A;  4KI6 A;  2JGU A;  4FJN A;  4BDZ A;  3OVN A;  4X64 K;  4BGB A;  3L0Q A;  3PX4 A;  2PYJ A;  3UKR A;  4BR2 A;  2OPP A;  2KLA A;  1M1K O;  4QS8 A;  4BWJ A;  4JI3 K;  3AGK A;  2YJF A;  5EOY A;  3O08 A;  3U9D A;  1O13 A;  1HNX K;  4BR0 A;  3W0L A;  4F4K A;  3VA3 A;  5D3G A;  4KRF A;  1TV6 A;  4GW6 A;  1QTM A;  1BQN A;  1OKJ A;  4BR7 A;  4BG9 A;  3WEE B;  1VSM A;  4B1U B;  5JVG L;  2NRW A;  2D1K A;  4B9M A;  4E7L A;  4XH1 A;  4KO0 A;  5BPN A;  3LZI A;  3ID6 A;  3O9T A;  4OO1 J;  2D0B A;  3L3V A;  1JJ2 M;  2HOE A;  4ZTF A;  3GG4 A;  5AR0 A;  1QQN A;  3DXM B;  2X6N A;  1E3M A;  5MLC Q;  3THY A;  3V4I A;  2QW9 A;  1Y64 A;  4A57 A;  4CJ3 A;  1KFS A;  1X1P A;  1RDB A;  2P1J A;  4YY3 K;  3P39 A;  1HRH A;  3AY9 A;  2FXU A;  2PBD A;  4H8K A;  2CGJ A;  4G1Q A;  5AQL A;  2RE2 A;  4AF1 A;  1IG8 A;  4LH5 A;  1ZBH A;  2VG5 A;  3C65 A;  4O44 A;  3SPY A;  2KZM A;  3THX B;  4GY2 B;  4MO4 A;  5AFU H;  1LCU A;  3AVG A;  4QOZ B;  4GVE A;  1YIT N;  2P9P A;  1NK6 A;  3CD6 N;  2UYT A;  1K8K B;  3CIP A;  4RW8 A;  1JXB A;  4CES A;  4F3O A;  3CJ9 A;  4KTQ A;  4IEE A;  3CQY A;  3N4P A;  4JKB A;  4C1N I;  4MDB A;  3U4L A;  1QS4 A;  4KHP K;  4B3R K;  3KLG A;  2XRI A;  3J8A A;  4ILJ A;  2E8A A;  5J2M A;  3VQ9 A;  2FSN A;  5GAE P;  4NO7 A;  1YTU A;  4CF8 A;  2XY5 A;  4WF9 L;  1QHT A;  4B8C A;  1V4T A;  3O9R A;  4FJ9 A;  3LAM A;  3NF9 A;  3OYI A;  2W6K A;  3U3Y A;  2Z1J A;  4FM1 A;  1T3V A;  3BZK A;  4CF2 A;  3SBT A;  1WAJ A;  2ETJ A;  5FPM A;  2HB5 A;  4IG3 A;  3LDQ A;  5I3U A;  4FK4 A;  3S9H A;  4B9S A;  1J6Z A;  3OYN A;  4BAC A;  3CJ7 A;  3ENO A;  3LAL A;  4BG8 A;  4CZJ A;  2HHS A;  3G10 A;  5GAD P;  4ILG B;  3ZX0 A;  5HRO A;  3OBW A;  1UOC A;  3NAE A;  4H0O A;  5AQV A;  5GAG P;  1IV0 A;  1C0F A;  3OJS A;  5CR4 A;  4DQS A;  3HT3 A;  4KB1 A;  1C1C A;  4DTJ A;  4K8Z A;  2W41 A;  1NG9 A;  1U6Z A;  3O4W A;  3GBT A;  3ZT4 A;  5SWM A;  4OKK A;  4M3W A;  2A1R A;  3ZSQ A;  4DQQ A;  3RRG A;  4Z4G A;  3TAQ A;  4E89 A;  1FXX A;  2ASM A;  2E1Y A;  2O8D A;  1VSL A;  3AVC A;  5AQW A;  1TUY A;  3TR8 A;  4EZ9 A;  1NGH A;  3LP1 A;  3AA3 A;  1KAX A;  3AVI A;  3ATU A;  3WT0 A;  3CJC A;  1EX4 A;  1H1V A;  5CHI A;  3AVF A;  4WE1 A;  2YI1 A;  3HYF A;  3PLA A;  1G15 A;  1I39 A;  4WFN L;  1NGB A;  3V81 A;  3KHY A;  4EHU A;  4WQ5 A;  4BRD A;  4BDY A;  5A2Q O;  4DSL A;  1BWF O;  2YNF A;  4LY7 A;  3JYT A;  3NF8 A;  3U6F A;  1KQS M;  4BRO A;  4LC9 B;  5F2R A;  4B1Z A;  3R3L A;  5BPL A;  3DM2 A;  2DTU A;  5E41 A;  5ELZ A;  3TAM A;  3OY9 A;  3SJJ A;  4FVU A;  4DKW A;  4IFY A;  4GMJ B;  4JI1 K;  4IEI A;  5J2N A;  4DFP A;  2HHU A;  2VCP A;  4U7B A;  1RFQ A;  3MWP A;  1SV5 A;  4NCB A;  1CLQ A;  4CHQ A;  4W5R A;  2B5J A;  3H46 O;  4DV5 K;  1XC9 A;  4B9L A;  1HPM A;  3QLH A;  4GKK K;  2FC0 A;  3THW A;  1QHA A;  1NGF A;  4NYN A;  3MCP A;  4JKF A;  4CF9 A;  2VGN A;  2IVN A;  1BG3 A;  3KLI A;  1TKZ A;  4ELU A;  3OBY A;  4KBO A;  5CYQ A;  1N33 K;  1VQ7 N;  3NBP A;  3CQ8 A;  3IUC A;  1BOT O;  3D0P A;  1BUP A;  4KRE A;  1C1B A;  4FJL A;  3DLE A;  1U2V B;  3AAQ A;  4F2R A;  3DOK A;  4DV6 K;  3THV A;  1S6P A;  3O4Q A;  1HYZ A;  3VQE A;  5AQF A;  3SAF A;  4BQL A;  4B1V A;  2E2N A;  1V4S A;  1KSP A;  4C1N K;  2O8B A;  3HBT A;  1VQN N;  4IZ9 A;  3ULE A;  4E1N A;  3ZSO A;  5DK5 A;  5C15 A;  4FJI A;  1KVC A;  4Z4F A;  2NRR A;  4HVJ A;  1T44 A;  5C10 A;  4LFC K;  4A62 A;  1LW2 A;  4DB3 A;  4DU4 A;  1SAZ A;  4CHZ A;  4JHD B;  4NXM K;  3LPU A;  4CJV A;  3AGR A;  4FYD A;  2F9W A;  4C8N A;  1JCG A;  3ZSY A;  1YHQ N;  4JD2 A;  4R79 A;  3PSI A;  2XO7 A;  3K5M A;  2QK9 A;  1C1A A;  3TAR A;  3VF4 A;  4IOA L;  4YDU A;  1T6D A;  2KHO A;  3SAH A;  2JLE A;  3TSQ A;  5AQZ A;  1ESV A;  3DJC A;  4H0Y B;  4HWI A;  5FRO A;  1I94 K;  1YI2 N;  2IC3 A;  4CW7 B;  4CJ7 A;  1BIS A;  5AQQ A;  3H1V X;  4DR1 K;  4DQ8 A;  4BR9 A;  1RDA A;  1Z25 A;  2HNY A;  4CJU A;  4JKC A;  4DFK A;  2GV9 A;  3GL1 A;  1U4B A;  4JI0 K;  3QIO A;  1ZXO A;  1RDU A;  1NK5 A;  3DMJ A;  1GLF O;  3KKS A;  3T7Z A;  4I7F A;  3D2F B;  1RTH A;  1N32 K;  2Z1H A;  3HP9 A;  1J5E K;  3KTQ A;  2B6A A;  1TYQ B;  3FZL A;  3NHG A;  3F73 A;  4DS4 A;  3U8X A;  3AVH A;  3KJV A;  2HNZ A;  4FJJ A;  4C8O A;  1HYV A;  3JAM O;  3RMA A;  5LMN K;  1Q7Y O;  4KV8 A;  1WSG A;  1WLJ A;  2HBJ A;  3NGY A;  4MO5 A;  5LJW A;  4H0X B;  3P1G A;  4CD1 A;  1DGK N;  4CF0 A;  5AQX A;  3SQ1 A;  1JKH A;  4DSJ A;  3VTH A;  1TVR A;  2O4I A;  4B8A B;  3HJF A;  4JKG A;  3DXK B;  4B1W B;  4FZX C;  4CFC A;  4A2B A;  3LAN A;  4FJG A;  4FJM A;  1SUQ A;  2CGK A;  3ZEU B;  4BRK A;  3B6O A;  3C6A A;  4K43 A;  4LD0 A;  1HLU A;  3OS1 A;  5AQH A;  5I42 A;  5GIO A;  2HHX A;  2NZT A;  1VSK A;  3LZJ A;  2E6M A;  3CET A;  2O8F A;  4IBN A;  3DI6 A;  4YOV A;  4JEP A;  3PV8 A;  1NGG A;  1J54 A;  3VQB A;  1KD1 O;  3LM2 A;  1SL1 A;  1IKW A;  5CYM A;  1L3U A;  1FJG K;  1JL2 A;  3O8M A;  3SV3 A;  3HVT A;  5C2F A;  4KTW A;  3VQ7 A;  1W97 L;  2O4G A;  1MU2 A;  2ZF5 O;  2UXD K;  1YXQ A;  2P9K A;  5GIP A;  4BVP A;  3TAN A;  1GOC A;  1P8Z A;  1LAV A;  2HW3 A;  4L3Q A;  2LSN A;  2A40 A;  3M3Z A;  3BP8 A;  3IG1 A;  1C0T A;  4DTR A;  4OVL A;  4PL8 A;  2GWJ A;  2OTL N;  3DWL A;  3MXM A;  4O8K A;  1XNQ K;  1GLA G;  2WTU A;  3ZX3 A;  3O9Q A;  3OYD A;  2HST A;  4KHS A;  4JNE A;  4CEC A;  4AH9 A;  2Q0U A;  4FLT A;  4B1X B;  4N47 A;  1EWQ A;  1E4G T;  1ZYQ A;  3I8B A;  4BC4 A;  2BE2 A;  1HKB A;  1BIZ A;  1HNW K;  2YKN A;  2OZM A;  3ATV A;  2BDP A;  2UXB K;  1CZB A;  3K5N A;  4DSI A;  1ZBI A;  5AZI B;  1JLA A;  1JXE A;  2YNG A;  3A8Y A;  4KHN A;  3L4I A;  4JK8 A;  1YIJ N;  1T05 A;  1M90 O;  4GV3 A;  3K0S A;  1KCF A;  2V7Y A;  2QA4 N;  3CC4 N;  1ATS A;  3OS2 A;  4FWP A;  4I9Q A;  3NE6 A;  4I9L A;  4I2P A;  3P38 A;  1HX1 A;  2IAJ A;  5KI6 A;  3EY1 A;  5LY3 A;  4MDA A;  2RF2 A;  4DSF A;  1TKX A;  3QEV A;  3CER A;  4BGA A;  4CI6 A;  4IWV A;  2A1S A;  4CIE A;  4CHN A;  3SQ4 A;  3PX6 A;  1CXU A;  3G25 A;  4ISE A;  3P5J A;  1IBK K;  3QEP A;  1HMV A;  1Y97 A;  4MLE A;  5B8H A;  3TAF A;  4FK0 A;  5CE3 A;  1J5O A;  3LM9 A;  1DTT A;  1JLB A;  2GX9 A;  3FE1 A;  4QCL A;  4RW6 A;  4CZI A;  1LOT B;  5JIC A;  2F7T A;  4JI6 K;  3R1X A;  3FZF A;  5BN8 A;  1A5V A;  3DLH A;  2KKZ A;  3SUQ A;  1X9J A;  1GOA A;  4CHY A;  1HPZ A;  2XHB A;  3S3O A;  4DQR A;  4DS5 A;  4JKH A;  1RTI A;  4LSN A;  2W42 A;  1NKE A;  3BUZ B;  4LH4 A;  4X62 K;  4CK1 A;  4JS4 A;  3QES A;  4DR3 K;  2HBL A;  3IMX A;  2HVI A;  3MEE A;  1OVY A;  3UKR B;  1NNE A;  2DFH A;  3HP6 A;  4Z94 A;  2HBM A;  3S3N A;  3UIQ A;  2AA4 A;  4PWD A;  4AHT A;  2GUI A;  3O3H A;  3VEW A;  4AM6 A;  3LWL A;  1X3M A;  1IKX A;  1IBM K;  1VQP N;  1CXQ A;  1U04 A;  3J7Y P;  3VF2 A;  3MN7 A;  1FKO A;  1MWM A;  4FJ7 A;  4DR7 K;  3SQ2 A;  2Q2R A;  2QWO A;  3VES A;  3V9Z A;  5LMU K;  3VGK A;  1RT4 A;  3A0I X;  3NFA A;  4FLV A;  2QWR A;  1RT6 A;  3Q7C A;  4PY5 A;  2ZM6 K;  2FSK A;  1U48 A;  5C2D A;  3CFP A;  3THY B;  2G8K A;  1LWC A;  3OYH A;  4A5A A;  3K9J A;  4OGE A;  3C94 A;  4FCY A;  1JLF A;  1P90 A;  1HQU A;  4BRQ A;  4CED A;  1N6Q A;  3D45 A;  1DT9 A;  2G8V A;  4CJS A;  1Q8I A;  2HVH A;  4HUG A;  3MX5 A;  1VAZ A;  1NOZ A;  2V51 B;  4CZE A;  3O6W A;  4FJ5 A;  1NMD A;  4BRM A;  2P9P B;  2VGM A;  4CFD A;  4KKO A;  4O4G A;  3M1F A;  5M1O A;  3NH0 A;  2WC9 A;  3G4S N;  4CBW A;  3CCQ N;  3NH2 A;  1XUP O;  2ITG A;  2ZJQ L;  2HHH K;  4HTL A;  1VSF A;  4FXD A;  4DF4 A;  1JCE A;  3A5N C;  4GVM A;  3P83 D;  2IOC A;  2F8S A;  3RSE A;  1TK5 A;  4CIG A;  2FLO A;  1XHX A;  2O8E B;  2QI2 A;  3C0B A;  4JKE A;  3PUF A;  4DSE A;  1BO5 O;  4E1J A;  1A5W A;  1VQ6 N;  4LF7 K;  4BRP A;  3E66 A;  4HUE A;  1Q9X A;  3A2F A;  1MWK A;  2OCE A;  1XQS C;  4Y1C A;  4FO0 A;  3M8S A;  3OW2 M;  4Z4C A;  3T1H K;  4B1Y B;  1FKP A;  1WSI A;  2IDO A;  4FK2 A;  2Q97 A;  2A6A A;  1ITG A;  4FLU A;  1ASV A;  3E01 A;  4WCE L;  3WXJ A;  4FM2 A;  3ZT1 A;  4A5B A;  4H5T A;  4DR5 K;  1X9S A;  1KAZ A;  3K9K A;  3QDK A;  1HNV A;  1KXP A;  2EHG A;  2ASP A;  1DEJ A;  4KFB A;  4CJW A;  3VEX A;  3O4N A;  3VQP A;  2P9U A;  3ZT2 A;  3H6E A;  2JWL A;  2X78 A;  2BGG A;  1ZBL A;  4DTX A;  4BRF A;  2YV0 X;  4EP4 A;  1WSF A;  1S9G A;  2XY8 A;  4I2Q A;  5AQO A;  3ZSW A;  4Z4I A;  3ENH A;  4JV5 K;  2CH6 A;  1VQO N;  3FFI A;  2A41 A;  3AO5 A;  2E6L A;  3I0S A;  3CCM N;  1MDU B;  3F9K A;  1OH8 A;  1YF5 L;  4E7I A;  3KWG A;  4CIF A;  3M8R A;  4LF8 K;  2FBY A;  3CMA N;  1TAU A;  5KPZ A;  4LF5 K;  1EXQ A;  5KGW A;  4O5B A;  2P5G A;  4FJK A;  4HTU A;  4KB0 A;  5J2Q A;  3I55 N;  3AVA A;  3H08 A;  4QS9 A;  3BF1 A;  5AQM A;  2E20 A;  1QSY A;  3AO3 A;  4BRI A;  2YHX A;  4IO8 A;  1WOQ A;  4QS7 A;  3KIO A;  4FLY A;  1L3T A;  2QXL A;  2ASO A;  3I56 N;  3OYL A;  4MLH A;  3VOV A;  2NNW A;  3WEE A;  3HM9 A;  3FFK B;  1KLN A;  3CC7 N;  5AQG A;  4CJP A;  5HP1 A;  3HSC A;  4NB4 A;  2VWB A;  5AFU A;  3VEZ A;  4BE1 A;  2KQ2 A;  3KK7 A;  1DKG D;  3EEQ A;  4CZG A;  3SLC A;  3SUP A;  4E7H A;  3SPZ A;  3TI0 A;  2G8U A;  4EP5 A;  1S6Q A;  3CYM A;  3OYC A;  4N5S A;  3TPQ A;  3H3N O;  3A5O C;  4FW1 A;  5AQT A;  3THW B;  3K59 A;  1VSI A;  3WXK A;  3ZSZ A;  5F0X A;  4KHY A;  2OPS A;  1BI4 B;  4YOW A;  3ZET A;  4OKJ A;  3WNE A;  5CZ1 A;  4CZH A;  4WFB L;  3HK2 A;  3CHW A;  1J9A A;  3L4Q A;  4OPA A;  3T1A A;  3LAK A;  1S1T A;  4LFA K;  3VQ6 A;  3CCV N;  4KTZ A;  1LWF A;  4CCH A;  1SS6 A;  1K8K A;  2DFE A;  1VQ8 N;  3V1R A;  4NCG A;  5HLF A;  1UA0 A;  2G8W A;  4FWN A;  4DTO A;  2AP1 A;  4CGI A;  3EE9 A;  3SI6 A;  5AQN A;  4OGC A;  3PX0 A;  1F21 A;  2PY5 A;  3PSF A;  3VMF B;  3QIN A;  2OTJ N;  4Y0W A;  1JCF A;  4B9U A;  3S3M A;  4DHY A;  3IKM A;  1BA0 A;  4K42 A;  1VQM N;  3SK3 A;  2E2Q A;  1BCM A;  5KRT A;  4AHU A;  3TAP A;  2PAV A;  5CZ2 A;  4NCA A;  3CI5 A;  3E9L A;  3L2R A;  4B9N A;  3O5B A;  1IBL K;  4UY8 O;  2E4L A;  2OZS A;  1X9M A;  2VQF K;  4BC3 A;  4AHR A;  4UQG A;  2VWK A;  4K0K K;  1SKR A;  1SQK A;  2DFF A;  2HHT A;  3ZLJ A;  2O8C A; 
#chains in the Genus database with same CATH homology
 2WUS A;  4B1W B;  3QFP A;  3CPE A;  3FZH A;  4A2B A;  3SJH A;  3IFR A;  2CGK A;  3LDL A;  3ZEU B;  4BRK A;  3EL2 A;  5LJV A;  3C6A A;  5M1N A;  3ZET B;  4K43 A;  1HLU A;  2NRZ A;  2Q1N A;  5AQH A;  3CJA A;  1QVG M;  3VTI A;  5GIO A;  3CF5 L;  2NZT A;  1EO1 A;  2PFU A;  2YX6 A;  4EAH D;  1NM1 A;  1TUU A;  3RSE B;  3CET A;  4H5R A;  5TKY A;  4YOV A;  4K25 A;  3JS6 A;  4JEP A;  3BF3 A;  1NGG A;  2E2P A;  3EE8 A;  2YCH A;  4U67 L;  1KD1 O;  3LM2 A;  3GDQ A;  3CXC M;  3NVM A;  4FL9 A;  1IJJ A;  5JVH L;  4WQ5 C;  3MN5 A;  2BH1 A;  3QBW A;  4RCH A;  5AQK A;  2IVP A;  2EWS A;  3O8M A;  2I7N A;  5C2F A;  3KZB A;  4JK9 A;  4RWT A;  3TSP A;  1NGE A;  1W97 L;  3LDO A;  3LDP A;  1QZ6 A;  2ZF5 O;  4DCH A;  1YVN A;  1YXQ A;  2P9K A;  5GIP A;  4EFH A;  4BVP A;  5AQY A;  1P8Z A;  2Q31 A;  2HBK A;  2JWK A;  4CBX A;  4H5V A;  2E2O A;  3MX2 A;  1HUX A;  4L3Q A;  1S3X A;  1VQ5 N;  3CCJ N;  2A40 A;  3M3Z A;  3BP8 A;  4GV6 A;  3A5M C;  4BVO A;  5DM6 L;  5HL7 L;  4PL8 A;  4F9O A;  2GWJ A;  5AQS A;  3MWT A;  2OTL N;  3DWL A;  3AAR A;  4WQ4 C;  3JXU A;  3DXM A;  4O8K A;  1GLA G;  3EN9 A;  2F9T A;  5AQJ A;  3M5R A;  3ZX3 A;  1K73 O;  3O9Q A;  1Z6R A;  2HST A;  4JNE A;  1NGA A;  5FPN A;  5H1S Q;  1ATN A;  1W2B M;  2FSJ A;  4M7Y A;  2Q0U A;  5M1F A;  4B1X B;  4JKG B;  5AQU A;  4IXC A;  3MCA B;  1E4G T;  3H1Q A;  3I8B A;  4GNI A;  4BC4 A;  2P9L A;  1HKB A;  3PIP L;  2YHY A;  4YOY A;  5EX5 A;  4BQZ A;  2QEX N;  3UE5 A;  5BRF A;  5C0Y A;  4IJN A;  5GIN A;  3MN9 A;  3ATV A;  4CZL A;  2CH5 A;  5EY4 A;  4WYB A;  4A59 A;  1YJ9 N;  3AAP A;  5BRH A;  4PL7 A;  5AZI B;  3WXI A;  3DAW A;  3FZK A;  3A8Y A;  4BR5 A;  3L4I A;  4JK8 A;  1YIJ N;  3EKS A;  4BGB A;  1Q86 O;  3L0Q A;  1M90 O;  4GV3 A;  2V7Z A;  3UKR A;  4BR2 A;  1KC8 O;  2V7Y A;  3TSU A;  2QA4 N;  2RHK A;  3C6H A;  1ATS A;  4I6M A;  4FWP A;  3CC4 N;  2KLA A;  3TTF A;  5BN9 A;  1M1K O;  4QS8 A;  3P38 A;  1HX1 A;  2YJF A;  3AGK A;  5EOY A;  3O08 A;  3U9D A;  2HF3 A;  3G6E N;  2FF6 A;  1O13 A;  3GOI A;  4BR0 A;  3W0L A;  5LY3 A;  4MDA A;  4H5N A;  1QQM A;  1S22 A;  1YUW A;  3CER A;  3ULE B;  3G71 N;  1YJN N;  3CC2 N;  4BGA A;  4CI6 A;  1OKJ A;  4BR7 A;  4IWV A;  4JKD A;  2IIR A;  4BG9 A;  3HI0 A;  3WEE B;  4B1U B;  5JVG L;  5JMV A;  2NRW A;  2D1K A;  2D0P A;  3G25 A;  4ISE A;  4XH1 A;  5BPN A;  3ID6 A;  3O9T A;  4OO1 J;  1HJO A;  4PKG A;  3B8A X;  3UB5 A;  1JJ2 M;  2HOE A;  1BU6 O;  4MLE A;  3GG4 A;  5B8H A;  5CE3 A;  4BR4 A;  1NJI O;  5AR0 A;  1QQN A;  3M6G A;  4BRC A;  4YOU A;  3WXL A;  2A5X A;  3DXM B;  3LM9 A;  2GX9 A;  3FE1 A;  4YDU C;  3QIC A;  5MLC Q;  2QW9 A;  4CZI A;  1VQK N;  1LOT B;  1X3N A;  5JIC A;  4JD2 B;  1Y64 A;  4A57 A;  2F7T A;  1VQL N;  4PHT X;  1NGD A;  3R1X A;  3WQU A;  3FZF A;  5BN8 A;  4K41 A;  3P39 A;  2KKZ A;  4BY9 C;  4FPB A;  1X9J A;  3CPW M;  4JHD A;  3AY9 A;  3WUH A;  2FXU A;  2PBD A;  1ATR A;  3VPZ A;  3H3O B;  1NBW A;  2CGJ A;  2P9N B;  5KQD A;  4A61 A;  5AQL A;  2RE2 A;  4AF1 A;  3QFU A;  1IG8 A;  3MN6 A;  3W3D A;  3D2E B;  4FWO A;  4JKH A;  5JLH A;  3C65 A;  4JK7 A;  2QWL A;  3BUZ B;  3TTC A;  3CME N;  5KPT A;  4GY2 B;  4CZF A;  4NLC A;  4MO4 A;  5AFU H;  4M63 C;  2QWM A;  2HBL A;  1LCU A;  3HTV A;  3IMX A;  2GUP A;  3TTD A;  3VER A;  3UKU B;  4GVE A;  1YIT N;  2P9P A;  1GLL O;  3WQT A;  3CD6 N;  2UYT A;  1K8K B;  1OVY A;  3CIP A;  3UKR B;  4ISF A;  4I6M B;  3ZYY X;  2YHW A;  4Z94 A;  2HBM A;  3CJ9 A;  4H5W A;  2AA4 A;  4IEE A;  3CQY A;  3N4P A;  1QQO A;  4JKB A;  4C1N I;  4MDB A;  1Z05 A;  3U4L A;  4IO9 L;  3VEW A;  4AM6 A;  2NLX A;  1HKG A;  1X3M A;  3FGU A;  3HZ6 A;  1T6C A;  3J8A A;  1VQP N;  4ILJ A;  2E8A A;  4XH5 A;  5BRD A;  4RTF D;  4BC5 A;  3VF2 A;  2FSN A;  3HOS A;  3MN7 A;  5GAE P;  4NO7 A;  5AQI A;  1MWM A;  4XEI A;  5FPD A;  1MA9 B;  3CJB A;  2Q2R A;  2QWO A;  3F5T A;  3VES A;  4WF9 L;  1ZBS A;  3MK6 A;  2J4R A;  1V4T A;  2NRT A;  3A0I X;  3O9R A;  3VGK A;  2QWR A;  4FOE A;  3Q7B A;  3Q7C A;  1SZ2 A;  2GEM A;  4YOT A;  2YJE A;  3SMP A;  2FSK A;  5M1K A;  1G99 A;  2H3G X;  5C2D A;  2GWK A;  1TYQ A;  1T3V A;  3A5L C;  3HRG A;  5BRE A;  3LL3 A;  3SBT A;  3QB0 A;  3VGM A;  3P4I A;  1EQY A;  3FR0 A;  4A5A A;  5AZJ A;  3CCL N;  5FPM A;  3VEN A;  3WXM B;  3K9J A;  3LDQ A;  3VEV A;  4FWR A;  1P90 A;  1S72 N;  4EIA A;  5F1X A;  1J6Z A;  4BRQ A;  5E84 A;  3CJ7 A;  3ENO A;  1DT9 A;  1GLD G;  3KVG A;  4PKH A;  4BG8 A;  4CZJ A;  3MDQ A;  5GAD P;  2ZGY A;  1RGI A;  4ILG B;  2ZJR L;  3ZX0 A;  2ZJP L;  3OBW A;  3MX5 A;  4H0O A;  1VAZ A;  2P9S A;  5AQV A;  5GAG P;  2V51 B;  4CZE A;  1C0F A;  3O6W A;  5CR4 A;  4XH4 A;  1NMD A;  4H0V B;  3U9Z A;  4C23 A;  4O8U A;  4BRM A;  3P31 A;  1YAG A;  4B9Q A;  1QZ5 A;  3S41 A;  2P9P B;  2VGM A;  2D0O A;  2NRV A;  3ENB A;  2W41 A;  4CD3 A;  2Q0R A;  3M1F A;  4KH6 A;  5M1O A;  1WUA A;  3ZEU A;  1U6Z A;  3O4W A;  3GBT A;  3C7N A;  2WC9 A;  4G9Z A;  3VGL A;  3G4S N;  4CBW A;  3CCQ N;  3VEY A;  5AQR A;  1XUP O;  4FSV A;  2ZJQ L;  4HTL A;  2ASM A;  2E1Y A;  3O80 A;  1JCE A;  2W40 A;  3A5N C;  5AQW A;  1TUY A;  3RSE A;  1U2V A;  2P9K B;  1NGH A;  2E1Z A;  2FLO A;  3SMS A;  3C0B A;  2WBN A;  2FF3 B;  1GLE G;  1KAX A;  2QI2 A;  4JKE A;  3R8E A;  2P9I A;  3ATU A;  4FOI A;  3WT0 A;  4EHT A;  3CJC A;  1BO5 O;  4E1J A;  5C12 A;  3VF6 A;  1K8A O;  1VQ6 N;  1D4X A;  1H1V A;  5CHI A;  4BRP A;  3E66 A;  2YI1 A;  3PLA A;  1ILY A;  1MWK A;  4WFN L;  2QM1 A;  1XQS C;  1NGB A;  4FO0 A;  4FWQ A;  3SAG A;  3KHY A;  3OW2 M;  4EHU A;  4BRL A;  4B1Y B;  1GLC G;  2QWP A;  2V52 B;  4WQ5 A;  4BRD A;  2Q97 A;  2A6A A;  3F2K A;  3HM8 A;  5I9E B;  1C0G A;  4WCE L;  4H0P A;  1Q18 A;  4FWS A;  1BWF O;  4FWL A;  5E26 A;  3WXJ A;  4IOC L;  1KQS M;  1QVF M;  3TU5 A;  3CCR N;  3NMU A;  1XC3 A;  4BRO A;  4LC9 B;  5F2R A;  5AZJ B;  4A5B A;  1ZC6 A;  3O9U A;  5EVZ A;  4B1Z A;  3R3L A;  2ZGZ A;  1BA1 A;  4H5T A;  5BPL A;  1KAZ A;  2P9L B;  3K9K A;  3QDK A;  4FWM A;  3LDN A;  5BR9 A;  5ELZ A;  1KXP A;  2ASP A;  2OAN A;  1DEJ A;  4FVU A;  3VEX A;  2VYP A;  4DKW A;  2HMP A;  5EXW A;  5TKW A;  4IEI A;  2P9U A;  2VCP A;  2JWL A;  3H6E A;  3CJ1 A;  1RFQ A;  2P9S B;  3MWP A;  4WQ4 A;  4U7B A;  2HF4 A;  4BRF A;  3EO3 A;  4ILH A;  3E1Y A;  2DPN A;  2A3Z A;  3H46 O;  3E9O A;  4JN4 A;  5AQO A;  1HPM A;  4M7X A;  3ENH A;  2CH6 A;  4BC2 A;  1Q81 O;  2GEL A;  4YOX A;  1VQO N;  2A41 A;  1QHA A;  4J8F A;  1NGF A;  4ISG A;  3F9M A;  3MCP A;  4JKF A;  3CCM N;  1MDU B;  2VGN A;  4IOX A;  1YF5 L;  3C7N B;  2IVN A;  5AQP A;  3KWG A;  5KQ8 A;  2Q36 A;  3CCU N;  1BG3 A;  5HOO A;  4KH4 A;  3R6M A;  3CMA N;  3OBY A;  4KBO A;  5KPZ A;  1VQ7 N;  2E88 A;  3EKU A;  1BOT O;  3IUC A;  5AZI A;  1BUP A;  2I7P A;  1U2V B;  3AAQ A;  3I55 N;  4CBU A;  4QS9 A;  1NWK A;  2P9I B;  5AQF A;  3BF1 A;  5AQM A;  1BDG A;  4O5F A;  3SAF A;  2E20 A;  4BQL A;  3O1W A;  1CZA N;  4B1V A;  1VQ4 N;  2E2N A;  1V4S A;  4BRI A;  2YHX A;  3D2F A;  3D6R A;  3CQX A;  3O1B A;  1HKC A;  2NRH A;  4IDH A;  4BRN A;  4C1N K;  4IO8 A;  3HBT A;  1WOQ A;  3KWI A;  1VQN N;  4QS7 A;  4IFE A;  4IZ9 A;  4YOR A;  3ULE A;  1N8R O;  2QXL A;  2ASO A;  3I56 N;  4MLH A;  5C15 A;  4KH5 A;  3VET A;  3VOV A;  2NNW A;  3WEE A;  4GV9 A;  1NLV A;  2NRR A;  3EZW A;  1T44 A;  5C10 A;  3FFK B;  4CZM A;  4BRG A;  4A62 A;  4DB3 A;  3CC7 N;  1SAZ A;  5AQG A;  5FPE A;  3HSC A;  3FZM A;  4JHD B;  4NB4 A;  3J7Z O;  3PIO L;  2VWB A;  3AGR A;  1KAY A;  3MMV A;  5AFU A;  3VEZ A;  3IDH A;  3L6Q A;  3KK7 A;  2F9W A;  1DKG D;  4CZG A;  4WFA L;  1JCG A;  1YHQ N;  1E4F T;  1RDW X;  3SLC A;  4FWK A;  4JKA A;  4JD2 A;  2P9U B;  4R79 A;  3R9P A;  3H45 C;  4A2A A;  3N4Q A;  2BTF A;  3VF4 A;  4IOA L;  1R59 O;  1T6D A;  2KHO A;  3DXK A;  3E9P A;  4YDU A;  4BRA A;  3SAH A;  3TSQ A;  1ESV A;  2QWN A;  3DJC A;  3A5O C;  3H3N O;  4H0Y B;  5AQZ A;  1NGI A;  3TPQ A;  3CCS N;  5AQT A;  4HWI A;  2BUP A;  3T69 A;  1YI2 N;  4CZK A;  5ADX H;  4H0T B;  2P9N A;  3WXK A;  4CJ7 A;  5AQQ A;  3H1V X;  5F0X A;  2CGL A;  5BPM A;  4YOW A;  1GLJ O;  3ZET A;  4DQ8 A;  1GLB G;  3QML A;  3D2E A;  3SBG A;  4CZH A;  4BR9 A;  4WFB L;  3CHW A;  3L4Q A;  4OPA A;  4JAX A;  4OPH A;  3DLL L;  1K9M O;  3CCV N;  4JKC A;  1VQ9 N;  3D7E O;  2ZWH A;  3NVK A;  3UKU A;  3HOT A;  3ZX2 A;  1SS6 A;  3GL1 A;  1K8K A;  1VQ8 N;  1ZXO A;  1Q82 O;  1RDU A;  2QWQ A;  4NLB A;  5GAH P;  1GLF O;  4FWN A;  2AP1 A;  3T7Z A;  4AM7 A;  3I33 A;  2WFB A;  2D4W A;  3OA9 A;  3ID8 A;  2IVO A;  3D2F B;  3EE9 A;  1YJW N;  5AQN A;  2QTD A;  5M1Q A;  2A42 A;  1TYQ B;  3VMF B;  2OTJ N;  4Y0W A;  1JCF A;  3FZL A;  4DHY A;  3IKM A;  3OHR A;  1BA0 A;  4K42 A;  5JLF A;  1VQM N;  3SK3 A;  3GE1 A;  5KPR A;  2E2Q A;  3CCE N;  1NGJ A;  4H03 B;  3U8X A;  5DM7 L;  3RVC A;  2PAV A;  4IJA A;  3CI5 A;  2ITM A;  3O9S A;  3E9L A;  1NGC A;  1Q7Y O;  4BRE A;  3O5B A;  2HBJ A;  5M1P A;  4BRH A;  4MO5 A;  4UY8 O;  2NRX A;  5LJW A;  4H0X B;  4CD1 A;  1DGK N;  5AQX A;  4BC3 A;  3FLC O;  3VEO A;  3VTH A;  5ADX A;  2GTD A;  4PKI A;  1SQK A;  3QBX A;  4FPA A;  3BEX A;  4JKG A;  3DXK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...