3M5RA

Crystal structure of swine flu virus ns1 effector domain from h1n1 influenza a/california/07/2009
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
126
structure length
126
Chain Sequence
HMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title Crystal Structure of Swine Flu Virus NS1 Effector Domain from H1N1 Influenza A/California/07/2009
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 38
structure length 126
sequence length 126
chains with identical sequence B, D, E, F, G
ec nomenclature
pdb deposition date 2010-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3m5rA00
3EE9A 4OPAA 3P38A 3O9SA 3OA9A 3F5TA 3KWGA 3EE8A 3O9QA 2GX9A 2RHKA 3O9TA 3P31A 2KKZA 3M5RA 3RVCA 3D6RA 3KWIA 3O9RA 3L4QA 3P39A 3O9UA 4OPHA
chains in the Genus database with same CATH superfamily
4Z4GA 3HM9A 1N5YA 4LF6K 3KVGA 4IG0A 3BGRA 3O9QA 1GLCG 4IWVA 4CHQA 3DXKB 4CHPA 4KH4A 1NJZA 1JLEA 3CQXA 2E2QA 4JS5A 3I33A 3VEVA 4DV7K 3PY8A 1VSKA 2IVOA 4KTWA 1WAFA 4IOXA 1T44A 4CJFA 4DSIA 4OPKA 5AQWA 4DB3A 1YF5L 2QK9A 2P9UA 5HL7L 4H5WA 4EAHD 2VGMA 3SQ1A 3QERA 4DUZK 3THWB 1RDAA 3PIOL 3AAQA 3I55N 4PWDA 3B6OA 3CETA 2G8FA 3OBWA 3K0SA 4HCCA 4DV3K 3ZLJA 3ZCMA 3OVNA 3SI6A 2RKIA 4E19A 1YJWN 1RDBA 4YORA 1OH5A 2OPQA 3CJBA 4CJSA 3C94A 4DHYA 2Y1JA 1YIJN 1KVCA 2IC3A 3KWGA 4MO4A 1ZXOA 3ZEUB 1NGFA 4CFBA 1BA1A 3VQ8A 4V19S 4G9ZA 2V52B 4AHVA 4NCGA 3VTHA 1KQSM 4BRLA 3RSEA 4DFJA 1LAWA 4FLXA 2HMPA 4JAXA 4KAZA 4FLUA 5HRNA 4B9MA 4M3XA 2HOEA 1NGAA 1IBMK 2O8DB 1JCGA 4LF9K 2VYPA 4JRPA 1YI2N 1UA0A 4X62K 2PYJA 4FZYA 3LP2A 4CGDA 1TK0A 2QWRA 1XNRK 1KTQA 3EZ5A 3PO4A 4CIFA 5B8HA 2A1RA 1L3UA 3D2FA 1IKVA 2HBJA 3VGLA 4OPAA 3WXIA 3QNOA 3KJVA 1RCHA 1E4GT 5GIPA 1X9MA 1JLBA 3ZSWA 2ZQBA 4PKGA 1YTAA 4X66K 1S9GA 5C10A 4DTPA 4B8CA 1HQEA 4IG3A 2ASOA 3P5JA 1RBVA 4DQQA 2D1KA 4CESA 4DQIA 2B6AA 2F9TA 4JD2B 3KD5E 1QQMA 3DI6A 4CZHA 3D2EA 4CBXA 5JLFA 4IOAL 2PZSA 4IFYA 1CZAN 3VQCA 1Y97A 1JL2A 3HPHA 3SCXA 2P5OA 3QEXA 3CCVN 3KLEA 2F7TA 3O9RA 1HR0K 4Y1CA 4KRFA 4MLEA 4BR0A 2F4VK 2UUBK 3IG1A 5JS2A 2BGGA 4PL7A 2OTJN 5CZ1A 4I9QA 1EWQA 1J6ZA 5AZJA 3FZLA 3P83D 3QLHA 4CD1A 3HL8A 4DQ8A 1GLDG 2O8FA 1NGDA 1ITGA 3K58A 3SMPA 4HTUA 1ILYA 3VETA 3OBYA 2Q1NA 4YOWA 3B8AX 3ULEB 4KHNA 3Q7CA 4ISFA 4YNQA 1EETA 1KC8O 4PKIA 3ZT2A 4CJWA 2HW3A 2E1ZA 3HVRA 1BU6O 1GOCA 4QAGA 3ZSOA 3CM5A 3MEDA 5TKWA 3VGKA 2KZMA 1D9DA 4BRKA 3QNNA 1Q18A 3AVAA 3WNGA 5GINA 1VQMN 4R5PA 5LL6Z 3P4IA 2W6KA 1GOBA 4OVLA 3UKRB 3TAPA 4JK7A 5CYQA 4AHTA 2E20A 4N76A 2P9NA 2QXLA 2VWJA 3DLKA 1HKCA 1GLEG 3CXCM 3MN5A 4JYAK 4E1JA 4KHYA 4CGIA 4KHSA 3O4QA 2X74A 3THYB 5HRRA 1QTMA 1L3VA 4YDUC 4KH6A 4DV6K 2FBXA 1ASUA 3M8PA 3TABA 5HROA 2O8CA 5M1PA 4LF8K 1Z25A 3R9PA 2DFEA 3A2FA 3V6DA 2GTDA 3VQ9A 1F21A 4B9SA 4KB0A 1BUPA 4ILGB 4K8XA 3B6PA 3CFOA 1S5JA 3G10A 3MN7A 4BRCA 3NH2A 4GY2B 1BCOA 1WSEA 2HSTA 2RPIA 2XY7A 2O4GA 5EOYA 3UKUA 2P9LB 1NMNA 1B9FA 4OLAA 4J2BA 4B8AB 3H3NO 2FXUA 3HSCA 5DK5A 3PX4A 4CEEA 3NCIA 4IEEA 4H4MA 5AJ3K 3MN9A 3OYJA 4CEZA 4B1UB 4R79A 4DCHA 3P1GA 4LF7K 5HBMA 3HZ6A 4DFKA 5AQIA 3EY1A 2D0AA 3VEZA 2YI1A 3NGYA 2W40A 4KTZA 4J2AA 3SV4A 3EE9A 4U7BA 3BY5A 1DEJA 4N41A 3GE1A 4CGFA 4RW6A 2YJFA 3ZX3A 4CEAA 4NXNK 3FFIA 1VQLN 3HK2A 3ATUA 4DTRA 3AO5A 4H5NA 4CJTA 5BRDA 4FOIA 3TU5A 1RBRA 4DR3K 2BUPA 1J54A 4ISGA 4KTQA 4LD0A 3VTIA 3T1HK 4H0VB 4RW4A 4BRNA 2E4LA 4CF9A 3CI5A 3ENHA 3ZSXA 1JLFA 4M3WA 5KPRA 4DLGA 1IH7A 1ZYQA 1JCEA 3MMVA 2KFZA 1K6YA 4B3SK 1TKZA 1XNQK 2LSNA 1YJNN 2HBMA 3QINA 1TKDA 1M90O 1B92A 3LP3A 3BF3A 4PUOA 2P1JA 3EO3A 2HHXA 4AM6A 3LWMA 4BC4A 4YFUA 3HPOA 5LJWA 4RW9A 3WUHA 2HVHA 1UA1A 3VA3A 3OS2A 5JMVA 1BQMA 1HMVA 2QW9A 2WOMA 1WSHA 3PIPL 2RF2A 1TUYA 2UUCK 3PLAA 1MWMA 1SZ2A 3VQEA 3VERA 1WLJA 5FLXO 3AVKA 4Z4CA 3R6MA 3CG7A 4CHZA 1BG3A 3CCRN 2Q36A 2UXBK 4JI3K 5BRHA 4DF8A 3WXLA 3NAEA 1EKEA 1JXEA 5FROA 4BRHA 3LM9A 4LFBK 4BC5A 1BIUA 4E3SA 2JLEA 4B1WB 4XEIA 4W5NA 4RG8A 4DS5A 3WXKA 1NKCA 4B3RK 3IAYA 1NK8A 1IV0A 1XHXA 3U9ZA 3VMFB 2J4RA 4CI6A 3K5OA 1HPZA 3QESA 5F1XA 1LWCA 3F5TA 2AA4A 1BI4A 3H45C 3FLCO 1KFDA 2HF4A 4JHDB 1KAXA 1U04A 1N36K 2DFFA 4DTXA 2GELA 1V4TA 1HNZK 3AA5X 4H0OA 1T6CA 2P9KB 3MECA 2A1SA 1J5OA 4E1NA 3AA3A 3LANA 3C6AA 3ID6A 3EEQA 4E7LA 2CH5A 3C7NA 2ETJA 5FRMA 1NBWA 2JWKA 4I7FA 3RMCA 3A5OC 1W2BM 1VQON 3D0PA 1JLCA 4CK1A 3HBTA 4CZGA 1XC9A 2W41A 1X3NA 3IDHA 4CEOA 2H3GX 3JSMA 3O9SA 2WTUA 1O1WA 3E1YA 3EZWA 1NK5A 3G0ZA 1NM1A 3NH1A 5DM7L 4DKWA 2JGUA 3ZT3A 3HT3A 4FVUA 3AVMA 3DJCA 5KPZA 4BRFA 3O3GA 3KLGA 3ID8A 2I7NA 1C1AA 4OJRA 3ZT1A 4JI4K 2OZSA 4OKJA 5CR4A 5AZIA 3E9PA 2O8BA 3MWTA 4XH5A 4M7XA 3CM6A 1KAYA 4G1QA 3AVFA 4WCEL 3LDSA 3AO1A 4KI4A 1EQYA 3HTVA 3L4IA 3U3YA 3BP8A 4ILJA 4FK2A 3HVTA 3VQPA 2ZE2A 4M42A 3CJAA 5FPDA 3ZSYA 4AHRA 2D0PA 2YHWA 4JKCA 4BRGA 1YXQA 2Z1JA 1NLVA 1S1WA 3EYZA 4DTOA 1NG9A 3T1AA 4DQRA 3LDQA 4RW7A 4Z4HA 1BISA 3PUFA 2EWSA 1BWFO 1IKYA 2P9IB 1JL1A 2F9WA 5HOOA 3CFRA 1UOCA 5AR0A 4BROA 3NHGA 4PY5A 5J1EA 1LW2A 3CFPA 2P9PA 4JI8K 4UY8O 3WQUA 2X6NA 4HTLA 4BRIA 2XY5A 4CK3A 3OA9A 3HJFA 1KFSA 4JKHA 1KD1O 2FSKA 4FJHA 3C95A 2YHYA 4O8UA 1RDDA 4FL9A 3M5RA 3F73A 3T7ZA 4DLEA 5AQLA 3OYMA 1MU2A 2BH1A 3CCLN 2VWKA 3MCPA 3K5MA 1RDWX 3PSFA 5JLHA 3DAWA 1E4FT 4JN4A 3AGKA 3F9MA 4B1YB 2HBLA 4H0TB 2O8EB 3CERA 3ZX0A 3U4LA 3HYFA 3V9ZA 2NUBA 3HSTB 2AP1A 4LC9B 1Y64A 1FXXA 2QM1A 3RVCA 3RMDA 3SJJA 1YJ9N 5K14A 4GW6A 4K42A 1U48A 1BA0A 2VWBA 1VHXA 3M8SA 3H6EA 3P38A 1M1KO 3V81A 1NU0A 1R0AA 3MXIA 3WNFA 2IS3A 4L3QA 3HPGA 1RTIA 5AQXA 3V1QA 1NJYA 5D3GA 4DV0K 4DSKA 1T03A 4WQ5A 4KH5A 2UU9K 4JV5K 3CC2N 4ELTA 4QCLA 2ZJRL 2DTUA 1NK4A 4C1NK 2ZJPL 4A2BA 3O1WA 4XIUA 4DUYK 3IS9A 4A5AA 4CF2A 3H46O 4OPHA 1XMQK 1TYQA 2QWQA 1CZBA 4BRMA 3J81O 1YHQN 4CIGA 1XQSC 1DT9A 5BPNA 1VQ7N 5AQJA 2E5LK 3NE6A 5HRPA 1IO2A 3ENOA 1RBUA 4FWPA 4AM7A 3SYZA 2OANA 4YOXA 3SQ2A 1NK9A 1C0TA 3H3OB 1U6ZA 3K59A 4BVOA 4BRPA 1X9SA 2G8HA 4C23A 3CJCA 4DV1K 3SQ4A 2OYQA 4CVNE 5KQ8A 1SV5A 3QMLA 1HJRA 4BRDA 5HLFA 1REVA 5MLCQ 3DM2A 2RN2A 4Y1DA 2FC0A 3M1FA 3NF9A 1ZBHA 1RT6A 4DU4A 4EP5A 4O8KA 3MXJA 1G99A 3NBPA 2HHQA 4AQYK 2JWLA 5DMRA 4YDUA 1DTTA 3JXUA 4M3TA 3LZIA 2E6MA 4OGCA 2YNFA 4H0PA 4IDHA 5KGXA 5BREA 2XY8A 4JI7K 4AF1A 2VQFK 2Y1IA 4E1MA 4OKKA 3C0BA 3ZETA 4FXDA 3SLCA 4DS4A 1D5AA 4QS9A 3OYBA 1ZBFA 1IKWA 2P9UB 1T8EA 5AQGA 1Q7YO 1L3SA 2VG6A 1SKRA 3E66A 3VQQA 3U6FA 3EKUA 2G8VA 1QS4A 3GL1A 2X78A 3TAEA 4E7JA 1S6PA 3EE8A 5F0XA 2D4WA 4FZZA 2HNDA 2KFNA 1Q9YA 4BRAA 4B08A 1KAZA 3ZSRA 3OYFA 1IBKK 3RRHA 2YNIA 1DTQA 4CF0A 1SUQA 3DYAA 3LP1A 1BHLA 3MK6A 3J7YP 3SBTA 4F2RA 4O5BA 1VQ6N 3WT0A 1L5UA 2ATQA 2HHHK 3MWPA 3RSEB 2CH6A 2D0CA 4K0KK 1TL1A 5KPTA 4O0IA 4GMJB 4WQ5C 3VEXA 1KVAA 1QSYA 4C8LA 1RT5A 2ZWHA 2IDOA 4B9QA 4JRQA 1NGBA 2FF3B 2VCPA 3AGRA 3Q7BA 4DV4K 3TSPA 3GDQA 4KO0A 3KK3A 2YNHA 5AQVA 3I56N 2WUSA 4JKFA 3AV9A 3KHYA 2ITGA 3AA4A 4CHNA 4C8KA 3TARA 4NLCA 4I9LA 3I8DA 3ZT4A 2YKNA 5FPNA 3L6QA 1C0FA 3WEEA 3EL2A 1QE1A 1GLFO 3HP9A 3CQYA 3D2FB 3THXA 3FZHA 3O4NA 3KTQA 3GBTA 1K8AO 5LMNK 1BQNA 1QZ6A 4FLTA 2NRWA 1BCMA 4OPJA 1FKOA 4W5RA 1XHZA 3V9XA 3PO5A 3AO4A 4CECA 5LY3A 4EP4A 4CGJA 4BE0A 4BR5A 3DXMA 4IZ9A 4BDYA 4J2EA 1YAGA 4H8KA 4ZTFA 3G71N 1S22A 1RBSA 4JLHA 4JI2K 2YHXA 2QKBA 4HVJA 3SUQA 3D2EB 4LH4A 4DR1K 2QA4N 3C65A 4CJRA 4A61A 1VQNN 1NGGA 3AAPA 1NK0A 1JKHA 3AVCA 3D6RA 2E1YA 4JKDA 2G8UA 5EX5A 4Z0UA 4EZ9A 3GG4A 4E89A 3V1OA 4B1VA 3ATVA 3MEEA 1GLJO 1N34K 2XO7A 3KK1A 4BACA 4HHTA 3J8AA 1HJOA 3QB0A 2YHAA 4M41A 1IBLK 3QEIA 5FPEA 1GOAA 3DLLL 4BC3A 3IUCA 2O8FB 3K9KA 3TTFA 4DU3A 1A5XA 4FLZA 2YV0X 3O6WA 4OKEA 2KQ2A 3M8RA 4H4OA 3A0IX 4W5TA 4BR4A 1VSIA 5AQMA 4EHUA 3SBGA 3FZMA 5M1FA 4IJAA 1QQNA 3S3OA 1HNWK 2KLAA 1S3XA 1VSEA 2IVPA 3VQBA 1C0MA 2PAVA 3F9KA 3CPWM 1GLLO 4DR2K 1TAUA 2Z1GA 4ID5A 2HB5A 2V51B 1H1VA 1V4SA 4M7YA 3SPYA 4K43A 1WB9A 4GNIA 1S9EA 4I6MA 1MWKA 3QIOA 4Y0WA 4C8OA 2YNGA 3TAMA 3LDPA 4DR6K 1X9WA 4NYNA 3CIPA 4FSVA 2GBZA 3CCMN 5AQKA 1HKGA 4JKGA 3OJUA 2P9SA 3AVJA 4CZMA 4EFHA 4FLYA 2P9NB 4DFPA 5FPMA 3QFPA 1WSGA 4DV2K 5C42A 1IKXA 2QKKA 4Z4FA 1S72N 3KLFA 4FJIA 3VOVA 4FWLA 1J9AA 4FM0A 4ELUA 3RMBA 1EP4A 1UAXA 2O8CB 3T3FA 5C2DA 4CJUA 3CCJN 4ISEA 3NF8A 2AJQA 3E9OA 2IIRA 2FLOA 1Q8IA 2B5JA 4E7HA 3BF1A 3ZSZA 3PX0A 5C2FA 1N8RO 5BN8A 3AY9A 5C25A 1L3TA 3UKUB 2GV9A 2ZF5O 3EN9A 3O80A 2Q31A 4F8RA 5GAGP 3VEYA 3SAHA 1VQ9N 4CJLA 5CE3A 4CEQA 4LFAK 3DRPA 2HHVA 1CXQA 4BG9A 2IGIA 3V9WA 1DKGD 1VQPN 1VAZA 4ELVA 5GIOA 4E7KA 2HNYA 1U2VA 3LAKA 3KD1E 4CJ3A 1X1PA 4IO9L 3O5BA 3PSIA 3LALA 5CZ2A 2ASMA 1ATNA 4OO1J 4IO8A 4MDAA 1LV5A 5CHIA 4FM2A 1WSIA 1NGJA 2IVNA 4F2SA 1HNXK 4FJMA 1RBTA 3JYTA 1VSHA 3DRSA 4Q0BA 3JAMO 3L4QA 3SNNA 3FFKB 4NCAA 4BG8A 3WNEA 3AVNA 2Z1HA 4WYBA 1HPMA 5T7BA 3QEVA 3KK7A 1S1XA 3KLIA 4FVMA 3I0RA 1Z05A 2RE2A 3H08A 1J53A 1NKEA 4BREA 1TV6A 1C1CA 4FWRA 1OH8A 1IG8A 1HX1A 4B9NA 4CJ4A 4FJNA 3TAGA 3AVGA 2EHGA 1LOTB 3A5MC 3OYNA 1ATRA 1VSDA 1Z6RA 5E84A 5AQOA 3LDOA 4I2QA 4A5BA 4YOYA 2F8TA 1BDGA 3LZJA 4RTFD 2G8IA 3OHRA 3SUNA 2UXCK 5GAEP 3GOIA 1P8ZA 3DMJA 1RTDA 5DM6L 1P90A 1OH6A 3LDNA 3ENBA 1RTJA 1NMDA 1CXUA 1RNHA 4HUGA 2PYLA 4DQPA 4FJGA 2GWJA 1K8KB 5M1NA 3AVBA 4CBUA 4B1XB 3MX5A 4BWMA 1J5EK 2BTFA 4B3TK 1SKSA 4HUEA 3KKSA 4AHCA 2UXDK 1VSFA 4JI5K 2BE2A 1HKBA 5SWMA 3LAMA 2OTLN 2FBYA 5JS1A 1Z26A 4QOZB 1WSJA 4F4KA 4QS7A 3OW2M 4IEIA 4DU1A 4CJVA 4K8ZA 1YT3A 2Z1IA 4XH1A 4N5SA 3DXKA 3L2UA 4J2DA 1NGCA 3KZBA 1TK5A 1FK9A 5KGWA 3R1XA 5M1KA 5C12A 4FWKA 3LPTA 4LH5A 1QSLA 1VK0A 3HM8A 4KPYA 2GEMA 4DQSA 3VQ4A 1NKBA 1BI4B 2QWMA 2DPNA 1ATSA 4BDZA 4B3OA 1S1UA 3THWA 4QS8A 3E9LA 4BR2A 1QQOA 4CZFA 4CFAA 1RDCA 4JS4A 4KV8A 3SMSA 4BVPA 4DWIA 4U67L 3VEWA 2YKMA 2CGLA 1YTUA 3N4PA 5KRTA 1NNEA 3P39A 5J2QA 1VSJA 5JVGL 2A5XA 4CBWA 3M3ZA 4B3MK 4CGGA 2Q3SA 1RT2A 3TSQA 5C15A 3K2PA 1Q82O 4FJLA 4NB4A 4FJXA 3SJHA 1ZBUA 4A2AA 5BRFA 4KB1A 3ZEUA 3MXMA 1X9JA 4H0YB 1K73O 3C7NB 3V4IA 3SAFA 4JEPA 1G15A 1RDUA 4ID1A 4FYDA 4H5RA 3WQTA 3HXMA 3QBXA 4DSEA 2Q0RA 3IMXA 4KHWA 1ESVA 4B9LA 3R3LA 2A6AA 3NGZA 1XC3A 4BY9C 4CHOA 4TSXA 3NDKA 1B9DA 5F2RA 4B9UA 2O8DA 5BPLA 3CJ7A 4B1ZA 5FDLA 1BO5O 2RHKA 1HNIA 2Q97A 5ADXA 4FJ9A 4RW8A 3PX6A 4C1NI 4DSFA 2FF6A 3A5LC 5J2PA 1FKPA 5AQZA 3ASMA 3FGUA 3OYIA 5KQDA 4GV9A 4EIAA 1GLAG 1XMOK 3L2QA 3AARA 3TTCA 1FJGK 3ZSVA 4WFBL 2QXFA 5AZIB 4GV3A 3CC7N 3SK3A 2O8BB 3ZSQA 2GUPA 3QEPA 4PA1A 1QSSA 1TK8A 4YOUA 3VF4A 5KI6A 1NGIA 1QVFM 5AFUA 3KWIA 4FWQA 3AA2A 1NJIO 4F3TA 4W5QA 4I2PA 1ASWA 4RCHA 1CZ9A 1IG9A 2PBDA 5ADXH 4LY7A 4DSLA 3V9SA 4JD2A 1RTHA 1C6VA 3ULDA 3HOTA 1HYSA 1NWKA 4J8FA 1SKWA 3U9DA 4DG1A 3QEWA 1QHTA 3UB5A 2HHUA 1D4XA 4YOVA 1VQ4N 4JKBA 3MAQA 2P9PB 3DRRA 4FO0A 4IXCA 3LM2A 4H5VA 1U47A 4BDPA 5AFUH 3BUZB 2WC9A 4Q5VA 1ASVA 2NNWA 1BOTO 4K25A 3ZX2A 3TANA 1NGEA 3M8QA 3WXJA 3TTDA 1TAQA 4O0JA 3TWHA 4BGBA 2FBVA 3L0QA 3TSUA 4YHHK 1DGKN 3L3UA 4PKHA 3TAFA 2QWLA 3OS0A 2DY4A 1EXQA 4MFBA 4BWJA 4MDBA 3T1YK 3ULEA 5BR8K 4CF1A 3K57A 5CY4A 1HYVA 5SZTA 1SS6A 2OPPA 3THVA 4WQ4C 4FWNA 3S3NA 1TL3A 4K41A 3V9UA 1T6DA 4M63C 3RTVA 3VF6A 3O9TA 1C0GA 3RR8A 4CK2A 3HOSA 4YY3K 1TGOA 1D9FA 4IDKA 3T69A 3TI0A 4JI0K 1RT1A 3CPEA 4CFDA 3OS1A 3OYLA 4H5TA 4A62A 1BIZA 4BE2A 1K9MO 2B4JA 4NXMK 4B9VA 4JNEA 4BGAA 4X65K 1W0HA 2BDPA 3OY9A 4BQLA 2D5RA 3UKRA 1WNSA 3TR8A 4FJ8A 2G8KA 3L3VA 2KKZA 2A42A 3D45A 2DFHA 3RMAA 3J7ZO 1W9HA 3U3GA 3SUOA 4LF4K 2FSNA 2NRHA 3OYAA 1NOYA 4DMNA 1JCFA 1HYZA 4CE9A 1WBDA 2HF3A 4CGHA 1TKXA 1TYQB 4CIEA 3CCUN 1A5WA 5C0YA 1N6QA 4GV6A 2FBTA 3THYA 1VQKN 3VQ7A 4OX9K 3CJ1A 4NLBA 4ILHA 4WFAL 2ASPA 4NYFA 3G6EN 4CZKA 4UQGA 1Q86O 1W7AA 2NRVA 2W42A 4JKAA 4AHSA 4KI6A 3LP0A 4JKEA 4HUFA 1HUXA 5E41A 4E0DA 1U4BA 3O8MA 4M45A 4DTSA 3OTOK 2UUAK 2P9LA 3KKRA 5M1QA 1YVUA 1XUPO 2E2PA 1RT3A 2PFUA 3WXMB 4AH9A 2UYTA 2XRIA 1W97L 4CFCA 4KBOA 2IOCA 5JICA 4CJ7A 2KTQA 2QEXN 3FR0A 2VGNA 4GKKK 2KW4A 3A5NC 4MQ3A 2PY5A 3SQ0A 1O13A 4CZIA 1JJ2M 3SZ2A 3CQ8A 1SL1A 4MO5A 4CEBA 3G25A 3VQDA 1IJJA 1RT7A 3CCEN 4WF9L 2ITMA 3QETA 3ZETB 3W0LA 2I7PA 3O1BA 3RWUA 3DLRA 3CCSN 2E8AA 4BRQA 2ZGZA 1S6QA 4EHTA 1VRTA 3CD6N 1RILA 4FOEA 4FW2A 3OYCA 4A57A 3C6HA 2VQEK 4FJ5A 5EVZA 3FE1A 3IFRA 2YCHA 1I94K 3S3MA 3DLBA 2HBKA 5I42A 2IAJA 1ZBIA 2NRRA 3VEOA 4CD3A 4FWMA 3WNHA 4KHPK 4BQZA 4PQUA 1YUWA 4FJJA 1NOZA 1U49A 4CEDA 2D0OA 4W5OA 2ZGYA 4YOTA 3ITHA 1ZBSA 5AZJB 3SV3A 3N4QA 4KFBA 2WBNA 4H03B 4NO7A 3HRGA 3MEGA 1EWRA 4ICLA 4DTJA 2QI2A 4ZTJA 5I9EB 1KVBA 3DOKA 4KREA 3H1QA 5AQRA 3VF2A 3VQ6A 1DLOA 4OGEA 1EO1A 5EU7A 4CF8A 3H1VX 3HP6A 3L2VA 3DLGA 4LSNA 3CMAN 4AHUA 3J80O 3CCQN 2HHWA 3DOLA 3S9HA 1SQKA 3MCAB 4FLWA 2QWNA 3NMUA 1C0UA 2ZJQL 2E2NA 4A59A 1Q9XA 3LDLA 4JI6K 1TVRA 3VQAA 3VA0A 1BL3A 5FRNA 1WOQA 4FK4A 1EX4A 2Q2RA 2D0BA 3NF6A 2A3ZA 3W3DA 3L2WA 1WUAA 3TPQA 3WEEB 1WAJA 4CJKA 4CJPA 1FW6A 4IFEA 4Z4EA 3THXB 2XY6A 2V7YA 1MA9B 1OH7A 5AQYA 3QIPA 2HHSA 4PHTX 5JVHL 5IT9O 3OYKA 4N56A 1KSPA 2QTDA 4DTUA 3AO3A 4N47A 3O3FA 1SL2A 4IOCL 4FWOA 4XH4A 1WSFA 3DXMB 4JHDA 5C24A 1YITN 3BEXA 3OYEA 2V7ZA 2OZMA 4DTNA 1VQ5N 4CJQA 3HO1A 1KXPA 1I3AA 4FPBA 4NCBA 4KHUA 1XWLA 4GVMA 4O4GA 3OYDA 1LAVA 2YHBA 3V1RA 4LFCK 1BGXT 3QFUA 3K5LA 1JLQA 2P9KA 4BC2A 4FLVA 1UWBA 3ZYYX 1JXBA 4CJ5A 1QHAA 3JS6A 3MX2A 3S41A 4C8MA 4BE1A 1NK6A 3DWLA 3QICA 1A5VA 1SAZA 4H0XB 4JK9A 4MLHA 3BZCA 1GLBG 4O44A 3CHWA 5AQPA 3OYHA 1QQCA 4IKFA 3CMEN 4CEFA 4CW7B 1K8KA 2HHTA 4M3RA 1S1VA 4DR7K 3CC4N 3ALYA 1T7PA 1KCFA 1HQUA 2R7YA 4M3YA 3NF7A 1VSMA 4FCYA 3RR7A 1JLAA 5BPMA 3QDKA 1TKTA 5LJVA 3CYMA 4DR4K 3UE5A 5TKYA 5AQSA 1NJWA 3MDQA 3VGMA 3DLHA 4GKJK 4HWIA 2VG5A 5AQQA 5AQFA 2Q0UA 4F9OA 3QBWA 2FSJA 2NLXA 4I6MB 5BR9A 4Z94A 3K9JA 3VESA 3LWLA 2EX3A 4E7IA 3E01A 4FJKA 1HNVA 3VENA 2NRXA 4JKGB 3IKMA 1KLNA 4O55A 4FZXC 2P9SB 3BZKA 2OA8A 3NVMA 1WBBA 4IFVA 3VPZA 3HI0A 4C8NA 5H1SQ 3O08A 2HMIA 1D8YA 4BR7A 3NGIA 3LL3A 5BN9A 3BDPA 1LCUA 3L2RA 1RGIA 1XI1A 4M3ZA 2P9IA 1S1TA 1I39A 1VQ8N 4FPAA 3D7EO 4CCHA 1WN7A 3QO9A 5AQUA 4JI1K 3FZFA 2G8WA 4F3OA 1QZ5A 3O9UA 3FZKA 2GWKA 2BANA 2ZM6K 1X3MA 3CF5L 3VQ5A 1LW0A 3NH0A 4DTMA 3M6GA 1NK7A 5J2NA 2HVIA 2GX9A 4BR9A 1N33K 2F8SA 4GVEA 3UIQA 4DSJA 2OCEA 2WFBA 3P31A 4AILC 2F96A 3I0SA 2NZTA 3ISNC 3SAGA 3MN6A 5AQHA 4FK0A 5GADP 2ZD1A 3I8BA 1T3VA 2QWPA 3RRGA 1ZBLA 5EY4A 1KRPA 1JLGA 5EXWA 3KLHA 2WONA 2OPRA 3PV8A 2O8EA 1CLQA 4HCBA 3O3HA 1RFQA 1TUUA 4FW1A 5AQNA 5HP1A 3AVIA 4RWTA 5KTQA 1U2VB 4FWSA 3C6UA 3KIOA 4IBNA 4CHYA 4LSLA 3OJSA 3ZT0A 4O5FA 2E6LA 2KHOA 4KHQA 2O4IA 5CYMA 1VRUA 2W6LA 3IRXA 2KZZA 1ZC6A 3G4SN 3LPUA 5KRSA 4FM1A 3O4WA 4PL8A 1T05A 4OLBA 2CGJA 5AQTA 3EKSA 3F2KA 1OKJA 3L8BA 5ELZA 3TAQA 3A8YA 5LMUK 2CGKA 3DLEA 4DR5K 3NVKA 1OVYA 4WFNL 4X64K 4CZEA 1E3MA 1NGHA 1QVGM 2QWOA 1N32K 1Q81O 3OYGA 4JK8A 2YJEA 1OVQA 1RT4A 2YX6A 4KKOA 4WQ4A 3KK2A 3AVHA 4ZHRA 2HNZA 4Z4IA 3VN5A 4CERA 4CZJA 4FJ7A 3J7AP 2A41A 1MDUB 1R59O 3C6TA 2P51A 3SUPA 2X6SA 1SL0A 5IWAK 3T19A 4IJNA 1C1BA 2I5JA 4DF4A 1U45A 1HLUA 1LWEA 3AO2A 1VSLA 3CJ9A 4DFMA 4WE1A 5I3UA 1HRHA 3U8XA 2E88A 3NFAA 3K5NA 5HRSA 5A2QO 3AVLA 5E26A 2GUIA 1NJXA 2E2OA 4CJEA 1KLMA 5M1OA 5J2MA 2NRTA 1LWFA 4EZ6A 3SPZA 5GAHP 2VG7A 4CZLA 1YVNA 4DV5K 4LF5K 3R8EA 2NRZA 4B9TA 4L8RB 2A40A 2OPSA 4M3UA 2XHBA 2P5GA
chains in the Genus database with same CATH topology
4IJAA 2P9KB 1QQNA 2KLAA 3KVGA 1S3XA 1VQKN 2IVPA 2PAVA 3CPWM 3O9QA 1GLCG 4IWVA 1GLLO 3CJ1A 3DXKB 4NLBA 3C6AA 3ID6A 4ILHA 2V51B 2ASPA 4KH4A 4WFAL 1H1VA 1V4SA 4M7YA 3CQXA 2E2QA 2CH5A 3C7NA 3I33A 4K43A 3VEVA 3G6EN 4CZKA 1NBWA 2IVOA 2JWKA 4GNIA 4IOXA 4I6MA 1MWKA 1T44A 3A5OC 1W2BM 1Q86O 2NRVA 4JKAA 1VQON 5AQWA 4DB3A 1YF5L 4Y0WA 3HBTA 2P9UA 4JKEA 2W41A 1HUXA 4CZGA 3LDPA 4H5WA 5HL7L 1X3NA 3IDHA 3O8MA 4EAHD 2H3GX 3CIPA 3O9SA 4FSVA 2P9LA 2VGMA 5M1QA 3E1YA 1XUPO 3EZWA 3CCMN 5AQKA 1HKGA 1NM1A 2E2PA 2PFUA 4JKGA 3WXMB 5DM7L 3AAQA 3PIOL 3I55N 4DKWA 2P9SA 3CETA 4CZMA 3OBWA 4EFHA 2UYTA 2P9NB 1W97L 5FPMA 3QFPA 4KBOA 5JICA 4FVUA 4CJ7A 3DJCA 3FR0A 2VGNA 5KPZA 2QEXN 3A5NC 4BRFA 1YJWN 3ID8A 1O13A 4CZIA 2I7NA 4YORA 1S72N 3VOVA 4FWLA 3CJBA 1JJ2M 4DHYA 1YIJN 5CR4A 5AZIA 3E9PA 4MO5A 3KWGA 3MWTA 4MO4A 1ZXOA 4XH5A 3G25A 3ZEUB 4M7XA 5C2DA 3CCJN 1IJJA 1NGFA 4ISEA 1BA1A 3CCEN 4G9ZA 2V52B 4WF9L 1KAYA 3E9OA 2ITMA 3VTHA 2IIRA 2FLOA 4WCEL 1KQSM 3ZETB 4BRLA 3RSEA 3W0LA 3BF1A 1EQYA 2I7PA 5C2FA 3O1BA 1N8RO 5BN8A 5M1FA 2HMPA 3HTVA 3CCSN 3L4IA 4JAXA 3AY9A 2E8AA 3BP8A 4ILJA 2ZGZA 4BRQA 3UKUB 4EHTA 3CD6N 2HOEA 2ZF5O 3EN9A 4FOEA 1NGAA 3CJAA 5FPDA 3O80A 1JCGA 2D0PA 2Q31A 2YHWA 4JKCA 4BRGA 4A57A 2VYPA 5GAGP 3C6HA 3VEYA 1YXQA 3SAHA 1VQ9N 1YI2N 5EVZA 1NLVA 3FE1A 3IFRA 2YCHA 5CE3A 2HBKA 3LDQA 2NRRA 2EWSA 2QWRA 3VEOA 4BG9A 4CD3A 1BWFO 2P9IB 1DKGD 2F9WA 4FWMA 1VQPN 1VAZA 5HOOA 5AR0A 4BROA 4BQZA 5GIOA 1YUWA 5B8HA 1U2VA 3D2FA 2D0OA 2P9PA 2HBJA 3VGLA 4UY8O 2ZGYA 3WQUA 4OPAA 4IO9L 4YOTA 3WXIA 1ZBSA 3O5BA 4HTLA 4BRIA 3OA9A 5AZJB 3N4QA 1E4GT 2WBNA 4H03B 4NO7A 5GIPA 4JKHA 2ASMA 3HRGA 1ATNA 1KD1O 4IO8A 4MDAA 4OO1J 2FSKA 2QI2A 2YHYA 4O8UA 5I9EB 5CHIA 4FL9A 1NGJA 4PKGA 2IVNA 3H1QA 3M5RA 5AQRA 3T7ZA 3VF2A 5C10A 5AQLA 1EO1A 2BH1A 2ASOA 3CCLN 3H1VX 3L4QA 3FFKB 4BG8A 2D1KA 3CMAN 4WYBA 3CCQN 1HPMA 3MCPA 3KK7A 1SQKA 3MCAB 1RDWX 5JLHA 2F9TA 4JD2B 1Z05A 2RE2A 1QQMA 1E4FT 2QWNA 3DAWA 4JN4A 3NMUA 3AGKA 3F9MA 4B1YB 2HBLA 4H0TB 4BREA 3CERA 3D2EA 4FWRA 3ZX0A 4CZHA 3U4LA 4CBXA 2E2NA 4A59A 2ZJQL 1IG8A 1HX1A 5JLFA 3LDLA 4IOAL 2AP1A 4LC9B 1Y64A 1WOQA 1CZAN 1LOTB 2Q2RA 3A5MC 2A3ZA 2QM1A 3RVCA 1ATRA 3W3DA 1WUAA 3TPQA 3WEEB 1Z6RA 5E84A 5AQOA 1YJ9N 3LDOA 3CCVN 2F7TA 3O9RA 4K42A 4IFEA 4A5BA 4YOYA 4MLEA 2V7YA 4BR0A 1BA0A 1MA9B 1BDGA 4RTFD 2VWBA 3OHRA 5GAEP 3GOIA 1P8ZA 5AQYA 3H6EA 4PHTX 3P38A 4PL7A 5DM6L 1P90A 1M1KO 5JVHL 2OTJN 3LDNA 3ENBA 1NMDA 1J6ZA 5AZJA 3FZLA 4L3QA 2QTDA 4CD1A 2GWJA 5AQXA 4DQ8A 1K8KB 1GLDG 4IOCL 1NGDA 4FWOA 4XH4A 5M1NA 4CBUA 4B1XB 4WQ5A 4KH5A 3DXMB 3MX5A 4JHDA 2BTFA 3BEXA 3SMPA 1YITN 2V7ZA 1ILYA 3CC2N 3VETA 1VQ5N 3OBYA 2Q1NA 2ZJRL 1KXPA 4FPBA 4YOWA 3B8AX 4C1NK 2ZJPL 1HKBA 3ULEB 4A2BA 3O1WA 3Q7CA 4ISFA 2OTLN 1KC8O 4A5AA 3H46O 4OPHA 1TYQA 4PKIA 2QWQA 4BRMA 1YHQN 3QFUA 2P9KA 4BC2A 1XQSC 1DT9A 4QS7A 3ZYYX 4IEIA 5BPNA 3OW2M 1VQ7N 2E1ZA 5AQJA 1BU6O 1QHAA 3JS6A 3MX2A 3S41A 4XH1A 3DXKA 1NGCA 3DWLA 3QICA 3KZBA 5TKWA 3VGKA 3ENOA 1SAZA 4H0XB 4BRKA 4JK9A 4MLHA 4FWPA 1GLBG 1Q18A 3R1XA 4AM7A 5M1KA 5C12A 4FWKA 5GINA 1VQMN 2OANA 4YOXA 3HM8A 2GEMA 3CHWA 5AQPA 3H3OB 3P4IA 1U6ZA 4BVOA 4BRPA 2QWMA 2DPNA 1ATSA 3CJCA 3UKRB 4C23A 4JK7A 4QS8A 3CMEN 3E9LA 5KQ8A 2E20A 3QMLA 4BR2A 1QQOA 4CZFA 4BRDA 1K8KA 2P9NA 5MLCQ 2QXLA 3CC4N 3SMSA 1HKCA 3M1FA 4BVPA 4U67L 1GLEG 3VEWA 2CGLA 3CXCM 3MN5A 4O8KA 3N4PA 3P39A 4E1JA 1G99A 5JVGL 2A5XA 4CBWA 3M3ZA 2JWLA 3QDKA 5BPMA 3TSQA 4YDUA 5C15A 5LJVA 1Q82O 3JXUA 4NB4A 4YDUC 3UE5A 5TKYA 4KH6A 5AQSA 4IDHA 4H0PA 3SJHA 5BREA 3MDQA 3VGMA 4A2AA 5BRFA 3ZEUA 4HWIA 1X9JA 4H0YB 5M1PA 3R9PA 5AQQA 4AF1A 3C7NB 1K73O 3SAFA 5AQFA 4JEPA 2GTDA 2Q0UA 4F9OA 3QBWA 2FSJA 2NLXA 4I6MB 5BR9A 4Z94A 3C0BA 1BUPA 1RDUA 3K9JA 4ILGB 3ZETA 3SLCA 3VESA 4H5RA 3MN7A 3WQTA 4BRCA 4QS9A 3QBXA 2Q0RA 3IMXA 2P9UB 4GY2B 5AQGA 2HSTA 1Q7YO 1ESVA 3R3LA 2A6AA 3E66A 5EOYA 3UKUA 2P9LB 3EKUA 1XC3A 3VENA 2NRXA 3GL1A 3IKMA 4JKGB 4BY9C 5F2RA 3H3NO 2P9SB 2FXUA 3EE8A 3HSCA 3NVMA 5F0XA 5BPLA 3VPZA 3CJ7A 3HI0A 2D4WA 3MN9A 4IEEA 4B1ZA 5H1SQ 1BO5O 2RHKA 4B1UB 3O08A 2Q97A 4R79A 4DCHA 5ADXA 4BRAA 3HZ6A 4BR7A 3LL3A 4C1NI 1KAZA 5BN9A 2FF6A 1LCUA 3A5LC 5AQIA 1RGIA 2P9IA 5AQZA 3FGUA 3VEZA 1VQ8N 2YI1A 5KQDA 4FPAA 4EIAA 2W40A 3D7EO 4GV9A 1GLAG 5AQUA 3FZFA 3AARA 3TTCA 1QZ5A 3O9UA 4WFBL 4GV3A 3EE9A 3FZKA 5AZIB 4U7BA 2GWKA 3SK3A 3CC7N 1DEJA 2GUPA 1X3MA 3MK6A 3SBTA 3CF5L 3GE1A 3M6GA 1VQ6N 2YJFA 3ZX3A 1VQLN 2GX9A 4BR9A 3ATUA 4YOUA 3VF4A 3WT0A 4GVEA 3MWPA 1NGIA 2WFBA 4H5NA 3RSEB 1QVFM 2CH6A 3P31A 4FOIA 3TU5A 3KWIA 4FWQA 2NZTA 5AFUA 5BRDA 2BUPA 1NJIO 3SAGA 5KPTA 3MN6A 4ISGA 4RCHA 4WQ5C 3VEXA 3VTIA 5AQHA 4H0VB 2ZWHA 2PBDA 5GADP 3I8BA 4BRNA 1T3VA 2QWPA 5ADXH 4B9QA 1NGBA 2FF3B 3CI5A 5EY4A 2VCPA 3AGRA 3Q7BA 3TSPA 5EXWA 3ENHA 3GDQA 4JD2A 5AQVA 3I56N 2WUSA 4JKFA 5KPRA 3HOTA 3KHYA 1NWKA 1JCEA 3MMVA 4J8FA 1RFQA 4NLCA 1TUUA 3U9DA 5AQNA 1YJNN 2HBMA 1M90O 5FPNA 3UB5A 3L6QA 1C0FA 1D4XA 3EL2A 3WEEA 4RWTA 1GLFO 3BF3A 4YOVA 1VQ4N 4JKBA 1U2VB 3EO3A 4FWSA 3CQYA 3D2FB 4AM6A 2P9PB 4FO0A 4IXCA 3FZHA 2KHOA 3LM2A 4H5VA 4O5FA 4BC4A 3GBTA 5AFUH 3BUZB 2WC9A 1K8AO 5LJWA 2NNWA 1QZ6A 3WUHA 1BOTO 2NRWA 4K25A 5JMVA 3ZX2A 1ZC6A 2QW9A 3G4SN 1NGEA 3O4WA 4PL8A 3WXJA 3TTDA 5LY3A 2CGJA 4BGBA 3L0QA 3TSUA 3PIPL 5AQTA 3EKSA 4BR5A 1TUYA 3F2KA 3PLAA 1OKJA 3DXMA 1MWMA 4IZ9A 1DGKN 1SZ2A 4PKHA 1YAGA 5ELZA 3VERA 2QWLA 3A8YA 2CGKA 3NVKA 1OVYA 4WFNL 1S22A 4CZEA 3G71N 1NGHA 1QVGM 2YHXA 4MDBA 3R6MA 2QWOA 1BG3A 3ULEA 3CCRN 1Q81O 2Q36A 4JK8A 5BRHA 2YJEA 2YX6A 3D2EB 3WXLA 4WQ4A 1SS6A 4WQ4C 4BRHA 4FWNA 2QA4N 3C65A 4A61A 1VQNN 3LM9A 4K41A 1NGGA 3AAPA 4CZJA 1T6DA 4BC5A 4M63C 3VF6A 3O9TA 1C0GA 4B1WB 2A41A 1MDUB 1R59O 4XEIA 3D6RA 3HOSA 2E1YA 4JKDA 5EX5A 3WXKA 3T69A 3GG4A 3CPEA 3U9ZA 4IJNA 3VMFB 4B1VA 1HLUA 3ATVA 4H5TA 2J4RA 1GLJO 4CI6A 4A62A 1K9MO 3CJ9A 3J8AA 1HJOA 4JNEA 5F1XA 3QB0A 3U8XA 4BGAA 2E88A 5FPEA 3F5TA 2AA4A 5E26A 3DLLL 3H45C 4BC3A 2E2OA 4BQLA 3FLCO 3IUCA 3UKRA 3K9KA 3TTFA 5M1OA 2NRTA 2HF4A 4JHDB 1KAXA 3O6WA 2KKZA 2A42A 5GAHP 4CZLA 1YVNA 3J7ZO 3A0IX 2GELA 1V4TA 4BR4A 2FSNA 2NRHA 5AQMA 2NRZA 3R8EA 4EHUA 1JCFA 2A40A 3SBGA 5C0YA 2HF3A 3CCUN 1TYQB 4H0OA 3FZMA 1T6CA 4GV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE9 A;  4OPA A;  3P38 A;  3O9S A;  3OA9 A;  3F5T A;  3KWG A;  3EE8 A;  3O9Q A;  2GX9 A;  2RHK A;  3O9T A;  3P31 A;  2KKZ A;  3M5R A;  3RVC A;  3D6R A;  3KWI A;  3O9R A;  3L4Q A;  3P39 A;  3O9U A;  4OPH A; 
#chains in the Genus database with same CATH topology
 4Z4G A;  3HM9 A;  1N5Y A;  4LF6 K;  3KVG A;  4IG0 A;  3BGR A;  3O9Q A;  1GLC G;  4IWV A;  4CHQ A;  3DXK B;  4CHP A;  4KH4 A;  1NJZ A;  1JLE A;  3CQX A;  2E2Q A;  4JS5 A;  3I33 A;  3VEV A;  4DV7 K;  3PY8 A;  1VSK A;  2IVO A;  4KTW A;  1WAF A;  4IOX A;  1T44 A;  4CJF A;  4DSI A;  4OPK A;  5AQW A;  4DB3 A;  1YF5 L;  2QK9 A;  2P9U A;  5HL7 L;  4H5W A;  4EAH D;  2VGM A;  3SQ1 A;  3QER A;  4DUZ K;  3THW B;  1RDA A;  3PIO L;  3AAQ A;  3I55 N;  4PWD A;  3B6O A;  3CET A;  2G8F A;  3OBW A;  3K0S A;  4HCC A;  4DV3 K;  3ZLJ A;  3ZCM A;  3OVN A;  3SI6 A;  2RKI A;  4E19 A;  1YJW N;  1RDB A;  4YOR A;  1OH5 A;  2OPQ A;  3CJB A;  4CJS A;  3C94 A;  4DHY A;  2Y1J A;  1YIJ N;  1KVC A;  2IC3 A;  3KWG A;  4MO4 A;  1ZXO A;  3ZEU B;  1NGF A;  4CFB A;  1BA1 A;  3VQ8 A;  4V19 S;  4G9Z A;  2V52 B;  4AHV A;  4NCG A;  3VTH A;  1KQS M;  4BRL A;  3RSE A;  4DFJ A;  1LAW A;  4FLX A;  2HMP A;  4JAX A;  4KAZ A;  4FLU A;  5HRN A;  4B9M A;  4M3X A;  2HOE A;  1NGA A;  1IBM K;  2O8D B;  1JCG A;  4LF9 K;  2VYP A;  4JRP A;  1YI2 N;  1UA0 A;  4X62 K;  2PYJ A;  4FZY A;  3LP2 A;  4CGD A;  1TK0 A;  2QWR A;  1XNR K;  1KTQ A;  3EZ5 A;  3PO4 A;  4CIF A;  5B8H A;  2A1R A;  1L3U A;  3D2F A;  1IKV A;  2HBJ A;  3VGL A;  4OPA A;  3WXI A;  3QNO A;  3KJV A;  1RCH A;  1E4G T;  5GIP A;  1X9M A;  1JLB A;  3ZSW A;  2ZQB A;  4PKG A;  1YTA A;  4X66 K;  1S9G A;  5C10 A;  4DTP A;  4B8C A;  1HQE A;  4IG3 A;  2ASO A;  3P5J A;  1RBV A;  4DQQ A;  2D1K A;  4CES A;  4DQI A;  2B6A A;  2F9T A;  4JD2 B;  3KD5 E;  1QQM A;  3DI6 A;  4CZH A;  3D2E A;  4CBX A;  5JLF A;  4IOA L;  2PZS A;  4IFY A;  1CZA N;  3VQC A;  1Y97 A;  1JL2 A;  3HPH A;  3SCX A;  2P5O A;  3QEX A;  3CCV N;  3KLE A;  2F7T A;  3O9R A;  1HR0 K;  4Y1C A;  4KRF A;  4MLE A;  4BR0 A;  2F4V K;  2UUB K;  3IG1 A;  5JS2 A;  2BGG A;  4PL7 A;  2OTJ N;  5CZ1 A;  4I9Q A;  1EWQ A;  1J6Z A;  5AZJ A;  3FZL A;  3P83 D;  3QLH A;  4CD1 A;  3HL8 A;  4DQ8 A;  1GLD G;  2O8F A;  1NGD A;  1ITG A;  3K58 A;  3SMP A;  4HTU A;  1ILY A;  3VET A;  3OBY A;  2Q1N A;  4YOW A;  3B8A X;  3ULE B;  4KHN A;  3Q7C A;  4ISF A;  4YNQ A;  1EET A;  1KC8 O;  4PKI A;  3ZT2 A;  4CJW A;  2HW3 A;  2E1Z A;  3HVR A;  1BU6 O;  1GOC A;  4QAG A;  3ZSO A;  3CM5 A;  3MED A;  5TKW A;  3VGK A;  2KZM A;  1D9D A;  4BRK A;  3QNN A;  1Q18 A;  3AVA A;  3WNG A;  5GIN A;  1VQM N;  4R5P A;  5LL6 Z;  3P4I A;  2W6K A;  1GOB A;  4OVL A;  3UKR B;  3TAP A;  4JK7 A;  5CYQ A;  4AHT A;  2E20 A;  4N76 A;  2P9N A;  2QXL A;  2VWJ A;  3DLK A;  1HKC A;  1GLE G;  3CXC M;  3MN5 A;  4JYA K;  4E1J A;  4KHY A;  4CGI A;  4KHS A;  3O4Q A;  2X74 A;  3THY B;  5HRR A;  1QTM A;  1L3V A;  4YDU C;  4KH6 A;  4DV6 K;  2FBX A;  1ASU A;  3M8P A;  3TAB A;  5HRO A;  2O8C A;  5M1P A;  4LF8 K;  1Z25 A;  3R9P A;  2DFE A;  3A2F A;  3V6D A;  2GTD A;  3VQ9 A;  1F21 A;  4B9S A;  4KB0 A;  1BUP A;  4ILG B;  4K8X A;  3B6P A;  3CFO A;  1S5J A;  3G10 A;  3MN7 A;  4BRC A;  3NH2 A;  4GY2 B;  1BCO A;  1WSE A;  2HST A;  2RPI A;  2XY7 A;  2O4G A;  5EOY A;  3UKU A;  2P9L B;  1NMN A;  1B9F A;  4OLA A;  4J2B A;  4B8A B;  3H3N O;  2FXU A;  3HSC A;  5DK5 A;  3PX4 A;  4CEE A;  3NCI A;  4IEE A;  4H4M A;  5AJ3 K;  3MN9 A;  3OYJ A;  4CEZ A;  4B1U B;  4R79 A;  4DCH A;  3P1G A;  4LF7 K;  5HBM A;  3HZ6 A;  4DFK A;  5AQI A;  3EY1 A;  2D0A A;  3VEZ A;  2YI1 A;  3NGY A;  2W40 A;  4KTZ A;  4J2A A;  3SV4 A;  3EE9 A;  4U7B A;  3BY5 A;  1DEJ A;  4N41 A;  3GE1 A;  4CGF A;  4RW6 A;  2YJF A;  3ZX3 A;  4CEA A;  4NXN K;  3FFI A;  1VQL N;  3HK2 A;  3ATU A;  4DTR A;  3AO5 A;  4H5N A;  4CJT A;  5BRD A;  4FOI A;  3TU5 A;  1RBR A;  4DR3 K;  2BUP A;  1J54 A;  4ISG A;  4KTQ A;  4LD0 A;  3VTI A;  3T1H K;  4H0V B;  4RW4 A;  4BRN A;  2E4L A;  4CF9 A;  3CI5 A;  3ENH A;  3ZSX A;  1JLF A;  4M3W A;  5KPR A;  4DLG A;  1IH7 A;  1ZYQ A;  1JCE A;  3MMV A;  2KFZ A;  1K6Y A;  4B3S K;  1TKZ A;  1XNQ K;  2LSN A;  1YJN N;  2HBM A;  3QIN A;  1TKD A;  1M90 O;  1B92 A;  3LP3 A;  3BF3 A;  4PUO A;  2P1J A;  3EO3 A;  2HHX A;  4AM6 A;  3LWM A;  4BC4 A;  4YFU A;  3HPO A;  5LJW A;  4RW9 A;  3WUH A;  2HVH A;  1UA1 A;  3VA3 A;  3OS2 A;  5JMV A;  1BQM A;  1HMV A;  2QW9 A;  2WOM A;  1WSH A;  3PIP L;  2RF2 A;  1TUY A;  2UUC K;  3PLA A;  1MWM A;  1SZ2 A;  3VQE A;  3VER A;  1WLJ A;  5FLX O;  3AVK A;  4Z4C A;  3R6M A;  3CG7 A;  4CHZ A;  1BG3 A;  3CCR N;  2Q36 A;  2UXB K;  4JI3 K;  5BRH A;  4DF8 A;  3WXL A;  3NAE A;  1EKE A;  1JXE A;  5FRO A;  4BRH A;  3LM9 A;  4LFB K;  4BC5 A;  1BIU A;  4E3S A;  2JLE A;  4B1W B;  4XEI A;  4W5N A;  4RG8 A;  4DS5 A;  3WXK A;  1NKC A;  4B3R K;  3IAY A;  1NK8 A;  1IV0 A;  1XHX A;  3U9Z A;  3VMF B;  2J4R A;  4CI6 A;  3K5O A;  1HPZ A;  3QES A;  5F1X A;  1LWC A;  3F5T A;  2AA4 A;  1BI4 A;  3H45 C;  3FLC O;  1KFD A;  2HF4 A;  4JHD B;  1KAX A;  1U04 A;  1N36 K;  2DFF A;  4DTX A;  2GEL A;  1V4T A;  1HNZ K;  3AA5 X;  4H0O A;  1T6C A;  2P9K B;  3MEC A;  2A1S A;  1J5O A;  4E1N A;  3AA3 A;  3LAN A;  3C6A A;  3ID6 A;  3EEQ A;  4E7L A;  2CH5 A;  3C7N A;  2ETJ A;  5FRM A;  1NBW A;  2JWK A;  4I7F A;  3RMC A;  3A5O C;  1W2B M;  1VQO N;  3D0P A;  1JLC A;  4CK1 A;  3HBT A;  4CZG A;  1XC9 A;  2W41 A;  1X3N A;  3IDH A;  4CEO A;  2H3G X;  3JSM A;  3O9S A;  2WTU A;  1O1W A;  3E1Y A;  3EZW A;  1NK5 A;  3G0Z A;  1NM1 A;  3NH1 A;  5DM7 L;  4DKW A;  2JGU A;  3ZT3 A;  3HT3 A;  4FVU A;  3AVM A;  3DJC A;  5KPZ A;  4BRF A;  3O3G A;  3KLG A;  3ID8 A;  2I7N A;  1C1A A;  4OJR A;  3ZT1 A;  4JI4 K;  2OZS A;  4OKJ A;  5CR4 A;  5AZI A;  3E9P A;  2O8B A;  3MWT A;  4XH5 A;  4M7X A;  3CM6 A;  1KAY A;  4G1Q A;  3AVF A;  4WCE L;  3LDS A;  3AO1 A;  4KI4 A;  1EQY A;  3HTV A;  3L4I A;  3U3Y A;  3BP8 A;  4ILJ A;  4FK2 A;  3HVT A;  3VQP A;  2ZE2 A;  4M42 A;  3CJA A;  5FPD A;  3ZSY A;  4AHR A;  2D0P A;  2YHW A;  4JKC A;  4BRG A;  1YXQ A;  2Z1J A;  1NLV A;  1S1W A;  3EYZ A;  4DTO A;  1NG9 A;  3T1A A;  4DQR A;  3LDQ A;  4RW7 A;  4Z4H A;  1BIS A;  3PUF A;  2EWS A;  1BWF O;  1IKY A;  2P9I B;  1JL1 A;  2F9W A;  5HOO A;  3CFR A;  1UOC A;  5AR0 A;  4BRO A;  3NHG A;  4PY5 A;  5J1E A;  1LW2 A;  3CFP A;  2P9P A;  4JI8 K;  4UY8 O;  3WQU A;  2X6N A;  4HTL A;  4BRI A;  2XY5 A;  4CK3 A;  3OA9 A;  3HJF A;  1KFS A;  4JKH A;  1KD1 O;  2FSK A;  4FJH A;  3C95 A;  2YHY A;  4O8U A;  1RDD A;  4FL9 A;  3M5R A;  3F73 A;  3T7Z A;  4DLE A;  5AQL A;  3OYM A;  1MU2 A;  2BH1 A;  3CCL N;  2VWK A;  3MCP A;  3K5M A;  1RDW X;  3PSF A;  5JLH A;  3DAW A;  1E4F T;  4JN4 A;  3AGK A;  3F9M A;  4B1Y B;  2HBL A;  4H0T B;  2O8E B;  3CER A;  3ZX0 A;  3U4L A;  3HYF A;  3V9Z A;  2NUB A;  3HST B;  2AP1 A;  4LC9 B;  1Y64 A;  1FXX A;  2QM1 A;  3RVC A;  3RMD A;  3SJJ A;  1YJ9 N;  5K14 A;  4GW6 A;  4K42 A;  1U48 A;  1BA0 A;  2VWB A;  1VHX A;  3M8S A;  3H6E A;  3P38 A;  1M1K O;  3V81 A;  1NU0 A;  1R0A A;  3MXI A;  3WNF A;  2IS3 A;  4L3Q A;  3HPG A;  1RTI A;  5AQX A;  3V1Q A;  1NJY A;  5D3G A;  4DV0 K;  4DSK A;  1T03 A;  4WQ5 A;  4KH5 A;  2UU9 K;  4JV5 K;  3CC2 N;  4ELT A;  4QCL A;  2ZJR L;  2DTU A;  1NK4 A;  4C1N K;  2ZJP L;  4A2B A;  3O1W A;  4XIU A;  4DUY K;  3IS9 A;  4A5A A;  4CF2 A;  3H46 O;  4OPH A;  1XMQ K;  1TYQ A;  2QWQ A;  1CZB A;  4BRM A;  3J81 O;  1YHQ N;  4CIG A;  1XQS C;  1DT9 A;  5BPN A;  1VQ7 N;  5AQJ A;  2E5L K;  3NE6 A;  5HRP A;  1IO2 A;  3ENO A;  1RBU A;  4FWP A;  4AM7 A;  3SYZ A;  2OAN A;  4YOX A;  3SQ2 A;  1NK9 A;  1C0T A;  3H3O B;  1U6Z A;  3K59 A;  4BVO A;  4BRP A;  1X9S A;  2G8H A;  4C23 A;  3CJC A;  4DV1 K;  3SQ4 A;  2OYQ A;  4CVN E;  5KQ8 A;  1SV5 A;  3QML A;  1HJR A;  4BRD A;  5HLF A;  1REV A;  5MLC Q;  3DM2 A;  2RN2 A;  4Y1D A;  2FC0 A;  3M1F A;  3NF9 A;  1ZBH A;  1RT6 A;  4DU4 A;  4EP5 A;  4O8K A;  3MXJ A;  1G99 A;  3NBP A;  2HHQ A;  4AQY K;  2JWL A;  5DMR A;  4YDU A;  1DTT A;  3JXU A;  4M3T A;  3LZI A;  2E6M A;  4OGC A;  2YNF A;  4H0P A;  4IDH A;  5KGX A;  5BRE A;  2XY8 A;  4JI7 K;  4AF1 A;  2VQF K;  2Y1I A;  4E1M A;  4OKK A;  3C0B A;  3ZET A;  4FXD A;  3SLC A;  4DS4 A;  1D5A A;  4QS9 A;  3OYB A;  1ZBF A;  1IKW A;  2P9U B;  1T8E A;  5AQG A;  1Q7Y O;  1L3S A;  2VG6 A;  1SKR A;  3E66 A;  3VQQ A;  3U6F A;  3EKU A;  2G8V A;  1QS4 A;  3GL1 A;  2X78 A;  3TAE A;  4E7J A;  1S6P A;  3EE8 A;  5F0X A;  2D4W A;  4FZZ A;  2HND A;  2KFN A;  1Q9Y A;  4BRA A;  4B08 A;  1KAZ A;  3ZSR A;  3OYF A;  1IBK K;  3RRH A;  2YNI A;  1DTQ A;  4CF0 A;  1SUQ A;  3DYA A;  3LP1 A;  1BHL A;  3MK6 A;  3J7Y P;  3SBT A;  4F2R A;  4O5B A;  1VQ6 N;  3WT0 A;  1L5U A;  2ATQ A;  2HHH K;  3MWP A;  3RSE B;  2CH6 A;  2D0C A;  4K0K K;  1TL1 A;  5KPT A;  4O0I A;  4GMJ B;  4WQ5 C;  3VEX A;  1KVA A;  1QSY A;  4C8L A;  1RT5 A;  2ZWH A;  2IDO A;  4B9Q A;  4JRQ A;  1NGB A;  2FF3 B;  2VCP A;  3AGR A;  3Q7B A;  4DV4 K;  3TSP A;  3GDQ A;  4KO0 A;  3KK3 A;  2YNH A;  5AQV A;  3I56 N;  2WUS A;  4JKF A;  3AV9 A;  3KHY A;  2ITG A;  3AA4 A;  4CHN A;  4C8K A;  3TAR A;  4NLC A;  4I9L A;  3I8D A;  3ZT4 A;  2YKN A;  5FPN A;  3L6Q A;  1C0F A;  3WEE A;  3EL2 A;  1QE1 A;  1GLF O;  3HP9 A;  3CQY A;  3D2F B;  3THX A;  3FZH A;  3O4N A;  3KTQ A;  3GBT A;  1K8A O;  5LMN K;  1BQN A;  1QZ6 A;  4FLT A;  2NRW A;  1BCM A;  4OPJ A;  1FKO A;  4W5R A;  1XHZ A;  3V9X A;  3PO5 A;  3AO4 A;  4CEC A;  5LY3 A;  4EP4 A;  4CGJ A;  4BE0 A;  4BR5 A;  3DXM A;  4IZ9 A;  4BDY A;  4J2E A;  1YAG A;  4H8K A;  4ZTF A;  3G71 N;  1S22 A;  1RBS A;  4JLH A;  4JI2 K;  2YHX A;  2QKB A;  4HVJ A;  3SUQ A;  3D2E B;  4LH4 A;  4DR1 K;  2QA4 N;  3C65 A;  4CJR A;  4A61 A;  1VQN N;  1NGG A;  3AAP A;  1NK0 A;  1JKH A;  3AVC A;  3D6R A;  2E1Y A;  4JKD A;  2G8U A;  5EX5 A;  4Z0U A;  4EZ9 A;  3GG4 A;  4E89 A;  3V1O A;  4B1V A;  3ATV A;  3MEE A;  1GLJ O;  1N34 K;  2XO7 A;  3KK1 A;  4BAC A;  4HHT A;  3J8A A;  1HJO A;  3QB0 A;  2YHA A;  4M41 A;  1IBL K;  3QEI A;  5FPE A;  1GOA A;  3DLL L;  4BC3 A;  3IUC A;  2O8F B;  3K9K A;  3TTF A;  4DU3 A;  1A5X A;  4FLZ A;  2YV0 X;  3O6W A;  4OKE A;  2KQ2 A;  3M8R A;  4H4O A;  3A0I X;  4W5T A;  4BR4 A;  1VSI A;  5AQM A;  4EHU A;  3SBG A;  3FZM A;  5M1F A;  4IJA A;  1QQN A;  3S3O A;  1HNW K;  2KLA A;  1S3X A;  1VSE A;  2IVP A;  3VQB A;  1C0M A;  2PAV A;  3F9K A;  3CPW M;  1GLL O;  4DR2 K;  1TAU A;  2Z1G A;  4ID5 A;  2HB5 A;  2V51 B;  1H1V A;  1V4S A;  4M7Y A;  3SPY A;  4K43 A;  1WB9 A;  4GNI A;  1S9E A;  4I6M A;  1MWK A;  3QIO A;  4Y0W A;  4C8O A;  2YNG A;  3TAM A;  3LDP A;  4DR6 K;  1X9W A;  4NYN A;  3CIP A;  4FSV A;  2GBZ A;  3CCM N;  5AQK A;  1HKG A;  4JKG A;  3OJU A;  2P9S A;  3AVJ A;  4CZM A;  4EFH A;  4FLY A;  2P9N B;  4DFP A;  5FPM A;  3QFP A;  1WSG A;  4DV2 K;  5C42 A;  1IKX A;  2QKK A;  4Z4F A;  1S72 N;  3KLF A;  4FJI A;  3VOV A;  4FWL A;  1J9A A;  4FM0 A;  4ELU A;  3RMB A;  1EP4 A;  1UAX A;  2O8C B;  3T3F A;  5C2D A;  4CJU A;  3CCJ N;  4ISE A;  3NF8 A;  2AJQ A;  3E9O A;  2IIR A;  2FLO A;  1Q8I A;  2B5J A;  4E7H A;  3BF1 A;  3ZSZ A;  3PX0 A;  5C2F A;  1N8R O;  5BN8 A;  3AY9 A;  5C25 A;  1L3T A;  3UKU B;  2GV9 A;  2ZF5 O;  3EN9 A;  3O80 A;  2Q31 A;  4F8R A;  5GAG P;  3VEY A;  3SAH A;  1VQ9 N;  4CJL A;  5CE3 A;  4CEQ A;  4LFA K;  3DRP A;  2HHV A;  1CXQ A;  4BG9 A;  2IGI A;  3V9W A;  1DKG D;  1VQP N;  1VAZ A;  4ELV A;  5GIO A;  4E7K A;  2HNY A;  1U2V A;  3LAK A;  3KD1 E;  4CJ3 A;  1X1P A;  4IO9 L;  3O5B A;  3PSI A;  3LAL A;  5CZ2 A;  2ASM A;  1ATN A;  4OO1 J;  4IO8 A;  4MDA A;  1LV5 A;  5CHI A;  4FM2 A;  1WSI A;  1NGJ A;  2IVN A;  4F2S A;  1HNX K;  4FJM A;  1RBT A;  3JYT A;  1VSH A;  3DRS A;  4Q0B A;  3JAM O;  3L4Q A;  3SNN A;  3FFK B;  4NCA A;  4BG8 A;  3WNE A;  3AVN A;  2Z1H A;  4WYB A;  1HPM A;  5T7B A;  3QEV A;  3KK7 A;  1S1X A;  3KLI A;  4FVM A;  3I0R A;  1Z05 A;  2RE2 A;  3H08 A;  1J53 A;  1NKE A;  4BRE A;  1TV6 A;  1C1C A;  4FWR A;  1OH8 A;  1IG8 A;  1HX1 A;  4B9N A;  4CJ4 A;  4FJN A;  3TAG A;  3AVG A;  2EHG A;  1LOT B;  3A5M C;  3OYN A;  1ATR A;  1VSD A;  1Z6R A;  5E84 A;  5AQO A;  3LDO A;  4I2Q A;  4A5B A;  4YOY A;  2F8T A;  1BDG A;  3LZJ A;  4RTF D;  2G8I A;  3OHR A;  3SUN A;  2UXC K;  5GAE P;  3GOI A;  1P8Z A;  3DMJ A;  1RTD A;  5DM6 L;  1P90 A;  1OH6 A;  3LDN A;  3ENB A;  1RTJ A;  1NMD A;  1CXU A;  1RNH A;  4HUG A;  2PYL A;  4DQP A;  4FJG A;  2GWJ A;  1K8K B;  5M1N A;  3AVB A;  4CBU A;  4B1X B;  3MX5 A;  4BWM A;  1J5E K;  2BTF A;  4B3T K;  1SKS A;  4HUE A;  3KKS A;  4AHC A;  2UXD K;  1VSF A;  4JI5 K;  2BE2 A;  1HKB A;  5SWM A;  3LAM A;  2OTL N;  2FBY A;  5JS1 A;  1Z26 A;  4QOZ B;  1WSJ A;  4F4K A;  4QS7 A;  3OW2 M;  4IEI A;  4DU1 A;  4CJV A;  4K8Z A;  1YT3 A;  2Z1I A;  4XH1 A;  4N5S A;  3DXK A;  3L2U A;  4J2D A;  1NGC A;  3KZB A;  1TK5 A;  1FK9 A;  5KGW A;  3R1X A;  5M1K A;  5C12 A;  4FWK A;  3LPT A;  4LH5 A;  1QSL A;  1VK0 A;  3HM8 A;  4KPY A;  2GEM A;  4DQS A;  3VQ4 A;  1NKB A;  1BI4 B;  2QWM A;  2DPN A;  1ATS A;  4BDZ A;  4B3O A;  1S1U A;  3THW A;  4QS8 A;  3E9L A;  4BR2 A;  1QQO A;  4CZF A;  4CFA A;  1RDC A;  4JS4 A;  4KV8 A;  3SMS A;  4BVP A;  4DWI A;  4U67 L;  3VEW A;  2YKM A;  2CGL A;  1YTU A;  3N4P A;  5KRT A;  1NNE A;  3P39 A;  5J2Q A;  1VSJ A;  5JVG L;  2A5X A;  4CBW A;  3M3Z A;  4B3M K;  4CGG A;  2Q3S A;  1RT2 A;  3TSQ A;  5C15 A;  3K2P A;  1Q82 O;  4FJL A;  4NB4 A;  4FJX A;  3SJH A;  1ZBU A;  4A2A A;  5BRF A;  4KB1 A;  3ZEU A;  3MXM A;  1X9J A;  4H0Y B;  1K73 O;  3C7N B;  3V4I A;  3SAF A;  4JEP A;  1G15 A;  1RDU A;  4ID1 A;  4FYD A;  4H5R A;  3WQT A;  3HXM A;  3QBX A;  4DSE A;  2Q0R A;  3IMX A;  4KHW A;  1ESV A;  4B9L A;  3R3L A;  2A6A A;  3NGZ A;  1XC3 A;  4BY9 C;  4CHO A;  4TSX A;  3NDK A;  1B9D A;  5F2R A;  4B9U A;  2O8D A;  5BPL A;  3CJ7 A;  4B1Z A;  5FDL A;  1BO5 O;  2RHK A;  1HNI A;  2Q97 A;  5ADX A;  4FJ9 A;  4RW8 A;  3PX6 A;  4C1N I;  4DSF A;  2FF6 A;  3A5L C;  5J2P A;  1FKP A;  5AQZ A;  3ASM A;  3FGU A;  3OYI A;  5KQD A;  4GV9 A;  4EIA A;  1GLA G;  1XMO K;  3L2Q A;  3AAR A;  3TTC A;  1FJG K;  3ZSV A;  4WFB L;  2QXF A;  5AZI B;  4GV3 A;  3CC7 N;  3SK3 A;  2O8B B;  3ZSQ A;  2GUP A;  3QEP A;  4PA1 A;  1QSS A;  1TK8 A;  4YOU A;  3VF4 A;  5KI6 A;  1NGI A;  1QVF M;  5AFU A;  3KWI A;  4FWQ A;  3AA2 A;  1NJI O;  4F3T A;  4W5Q A;  4I2P A;  1ASW A;  4RCH A;  1CZ9 A;  1IG9 A;  2PBD A;  5ADX H;  4LY7 A;  4DSL A;  3V9S A;  4JD2 A;  1RTH A;  1C6V A;  3ULD A;  3HOT A;  1HYS A;  1NWK A;  4J8F A;  1SKW A;  3U9D A;  4DG1 A;  3QEW A;  1QHT A;  3UB5 A;  2HHU A;  1D4X A;  4YOV A;  1VQ4 N;  4JKB A;  3MAQ A;  2P9P B;  3DRR A;  4FO0 A;  4IXC A;  3LM2 A;  4H5V A;  1U47 A;  4BDP A;  5AFU H;  3BUZ B;  2WC9 A;  4Q5V A;  1ASV A;  2NNW A;  1BOT O;  4K25 A;  3ZX2 A;  3TAN A;  1NGE A;  3M8Q A;  3WXJ A;  3TTD A;  1TAQ A;  4O0J A;  3TWH A;  4BGB A;  2FBV A;  3L0Q A;  3TSU A;  4YHH K;  1DGK N;  3L3U A;  4PKH A;  3TAF A;  2QWL A;  3OS0 A;  2DY4 A;  1EXQ A;  4MFB A;  4BWJ A;  4MDB A;  3T1Y K;  3ULE A;  5BR8 K;  4CF1 A;  3K57 A;  5CY4 A;  1HYV A;  5SZT A;  1SS6 A;  2OPP A;  3THV A;  4WQ4 C;  4FWN A;  3S3N A;  1TL3 A;  4K41 A;  3V9U A;  1T6D A;  4M63 C;  3RTV A;  3VF6 A;  3O9T A;  1C0G A;  3RR8 A;  4CK2 A;  3HOS A;  4YY3 K;  1TGO A;  1D9F A;  4IDK A;  3T69 A;  3TI0 A;  4JI0 K;  1RT1 A;  3CPE A;  4CFD A;  3OS1 A;  3OYL A;  4H5T A;  4A62 A;  1BIZ A;  4BE2 A;  1K9M O;  2B4J A;  4NXM K;  4B9V A;  4JNE A;  4BGA A;  4X65 K;  1W0H A;  2BDP A;  3OY9 A;  4BQL A;  2D5R A;  3UKR A;  1WNS A;  3TR8 A;  4FJ8 A;  2G8K A;  3L3V A;  2KKZ A;  2A42 A;  3D45 A;  2DFH A;  3RMA A;  3J7Z O;  1W9H A;  3U3G A;  3SUO A;  4LF4 K;  2FSN A;  2NRH A;  3OYA A;  1NOY A;  4DMN A;  1JCF A;  1HYZ A;  4CE9 A;  1WBD A;  2HF3 A;  4CGH A;  1TKX A;  1TYQ B;  4CIE A;  3CCU N;  1A5W A;  5C0Y A;  1N6Q A;  4GV6 A;  2FBT A;  3THY A;  1VQK N;  3VQ7 A;  4OX9 K;  3CJ1 A;  4NLB A;  4ILH A;  4WFA L;  2ASP A;  4NYF A;  3G6E N;  4CZK A;  4UQG A;  1Q86 O;  1W7A A;  2NRV A;  2W42 A;  4JKA A;  4AHS A;  4KI6 A;  3LP0 A;  4JKE A;  4HUF A;  1HUX A;  5E41 A;  4E0D A;  1U4B A;  3O8M A;  4M45 A;  4DTS A;  3OTO K;  2UUA K;  2P9L A;  3KKR A;  5M1Q A;  1YVU A;  1XUP O;  2E2P A;  1RT3 A;  2PFU A;  3WXM B;  4AH9 A;  2UYT A;  2XRI A;  1W97 L;  4CFC A;  4KBO A;  2IOC A;  5JIC A;  4CJ7 A;  2KTQ A;  2QEX N;  3FR0 A;  2VGN A;  4GKK K;  2KW4 A;  3A5N C;  4MQ3 A;  2PY5 A;  3SQ0 A;  1O13 A;  4CZI A;  1JJ2 M;  3SZ2 A;  3CQ8 A;  1SL1 A;  4MO5 A;  4CEB A;  3G25 A;  3VQD A;  1IJJ A;  1RT7 A;  3CCE N;  4WF9 L;  2ITM A;  3QET A;  3ZET B;  3W0L A;  2I7P A;  3O1B A;  3RWU A;  3DLR A;  3CCS N;  2E8A A;  4BRQ A;  2ZGZ A;  1S6Q A;  4EHT A;  1VRT A;  3CD6 N;  1RIL A;  4FOE A;  4FW2 A;  3OYC A;  4A57 A;  3C6H A;  2VQE K;  4FJ5 A;  5EVZ A;  3FE1 A;  3IFR A;  2YCH A;  1I94 K;  3S3M A;  3DLB A;  2HBK A;  5I42 A;  2IAJ A;  1ZBI A;  2NRR A;  3VEO A;  4CD3 A;  4FWM A;  3WNH A;  4KHP K;  4BQZ A;  4PQU A;  1YUW A;  4FJJ A;  1NOZ A;  1U49 A;  4CED A;  2D0O A;  4W5O A;  2ZGY A;  4YOT A;  3ITH A;  1ZBS A;  5AZJ B;  3SV3 A;  3N4Q A;  4KFB A;  2WBN A;  4H03 B;  4NO7 A;  3HRG A;  3MEG A;  1EWR A;  4ICL A;  4DTJ A;  2QI2 A;  4ZTJ A;  5I9E B;  1KVB A;  3DOK A;  4KRE A;  3H1Q A;  5AQR A;  3VF2 A;  3VQ6 A;  1DLO A;  4OGE A;  1EO1 A;  5EU7 A;  4CF8 A;  3H1V X;  3HP6 A;  3L2V A;  3DLG A;  4LSN A;  3CMA N;  4AHU A;  3J80 O;  3CCQ N;  2HHW A;  3DOL A;  3S9H A;  1SQK A;  3MCA B;  4FLW A;  2QWN A;  3NMU A;  1C0U A;  2ZJQ L;  2E2N A;  4A59 A;  1Q9X A;  3LDL A;  4JI6 K;  1TVR A;  3VQA A;  3VA0 A;  1BL3 A;  5FRN A;  1WOQ A;  4FK4 A;  1EX4 A;  2Q2R A;  2D0B A;  3NF6 A;  2A3Z A;  3W3D A;  3L2W A;  1WUA A;  3TPQ A;  3WEE B;  1WAJ A;  4CJK A;  4CJP A;  1FW6 A;  4IFE A;  4Z4E A;  3THX B;  2XY6 A;  2V7Y A;  1MA9 B;  1OH7 A;  5AQY A;  3QIP A;  2HHS A;  4PHT X;  5JVH L;  5IT9 O;  3OYK A;  4N56 A;  1KSP A;  2QTD A;  4DTU A;  3AO3 A;  4N47 A;  3O3F A;  1SL2 A;  4IOC L;  4FWO A;  4XH4 A;  1WSF A;  3DXM B;  4JHD A;  5C24 A;  1YIT N;  3BEX A;  3OYE A;  2V7Z A;  2OZM A;  4DTN A;  1VQ5 N;  4CJQ A;  3HO1 A;  1KXP A;  1I3A A;  4FPB A;  4NCB A;  4KHU A;  1XWL A;  4GVM A;  4O4G A;  3OYD A;  1LAV A;  2YHB A;  3V1R A;  4LFC K;  1BGX T;  3QFU A;  3K5L A;  1JLQ A;  2P9K A;  4BC2 A;  4FLV A;  1UWB A;  3ZYY X;  1JXB A;  4CJ5 A;  1QHA A;  3JS6 A;  3MX2 A;  3S41 A;  4C8M A;  4BE1 A;  1NK6 A;  3DWL A;  3QIC A;  1A5V A;  1SAZ A;  4H0X B;  4JK9 A;  4MLH A;  3BZC A;  1GLB G;  4O44 A;  3CHW A;  5AQP A;  3OYH A;  1QQC A;  4IKF A;  3CME N;  4CEF A;  4CW7 B;  1K8K A;  2HHT A;  4M3R A;  1S1V A;  4DR7 K;  3CC4 N;  3ALY A;  1T7P A;  1KCF A;  1HQU A;  2R7Y A;  4M3Y A;  3NF7 A;  1VSM A;  4FCY A;  3RR7 A;  1JLA A;  5BPM A;  3QDK A;  1TKT A;  5LJV A;  3CYM A;  4DR4 K;  3UE5 A;  5TKY A;  5AQS A;  1NJW A;  3MDQ A;  3VGM A;  3DLH A;  4GKJ K;  4HWI A;  2VG5 A;  5AQQ A;  5AQF A;  2Q0U A;  4F9O A;  3QBW A;  2FSJ A;  2NLX A;  4I6M B;  5BR9 A;  4Z94 A;  3K9J A;  3VES A;  3LWL A;  2EX3 A;  4E7I A;  3E01 A;  4FJK A;  1HNV A;  3VEN A;  2NRX A;  4JKG B;  3IKM A;  1KLN A;  4O55 A;  4FZX C;  2P9S B;  3BZK A;  2OA8 A;  3NVM A;  1WBB A;  4IFV A;  3VPZ A;  3HI0 A;  4C8N A;  5H1S Q;  3O08 A;  2HMI A;  1D8Y A;  4BR7 A;  3NGI A;  3LL3 A;  5BN9 A;  3BDP A;  1LCU A;  3L2R A;  1RGI A;  1XI1 A;  4M3Z A;  2P9I A;  1S1T A;  1I39 A;  1VQ8 N;  4FPA A;  3D7E O;  4CCH A;  1WN7 A;  3QO9 A;  5AQU A;  4JI1 K;  3FZF A;  2G8W A;  4F3O A;  1QZ5 A;  3O9U A;  3FZK A;  2GWK A;  2BAN A;  2ZM6 K;  1X3M A;  3CF5 L;  3VQ5 A;  1LW0 A;  3NH0 A;  4DTM A;  3M6G A;  1NK7 A;  5J2N A;  2HVI A;  2GX9 A;  4BR9 A;  1N33 K;  2F8S A;  4GVE A;  3UIQ A;  4DSJ A;  2OCE A;  2WFB A;  3P31 A;  4AIL C;  2F96 A;  3I0S A;  2NZT A;  3ISN C;  3SAG A;  3MN6 A;  5AQH A;  4FK0 A;  5GAD P;  2ZD1 A;  3I8B A;  1T3V A;  2QWP A;  3RRG A;  1ZBL A;  5EY4 A;  1KRP A;  1JLG A;  5EXW A;  3KLH A;  2WON A;  2OPR A;  3PV8 A;  2O8E A;  1CLQ A;  4HCB A;  3O3H A;  1RFQ A;  1TUU A;  4FW1 A;  5AQN A;  5HP1 A;  3AVI A;  4RWT A;  5KTQ A;  1U2V B;  4FWS A;  3C6U A;  3KIO A;  4IBN A;  4CHY A;  4LSL A;  3OJS A;  3ZT0 A;  4O5F A;  2E6L A;  2KHO A;  4KHQ A;  2O4I A;  5CYM A;  1VRU A;  2W6L A;  3IRX A;  2KZZ A;  1ZC6 A;  3G4S N;  3LPU A;  5KRS A;  4FM1 A;  3O4W A;  4PL8 A;  1T05 A;  4OLB A;  2CGJ A;  5AQT A;  3EKS A;  3F2K A;  1OKJ A;  3L8B A;  5ELZ A;  3TAQ A;  3A8Y A;  5LMU K;  2CGK A;  3DLE A;  4DR5 K;  3NVK A;  1OVY A;  4WFN L;  4X64 K;  4CZE A;  1E3M A;  1NGH A;  1QVG M;  2QWO A;  1N32 K;  1Q81 O;  3OYG A;  4JK8 A;  2YJE A;  1OVQ A;  1RT4 A;  2YX6 A;  4KKO A;  4WQ4 A;  3KK2 A;  3AVH A;  4ZHR A;  2HNZ A;  4Z4I A;  3VN5 A;  4CER A;  4CZJ A;  4FJ7 A;  3J7A P;  2A41 A;  1MDU B;  1R59 O;  3C6T A;  2P51 A;  3SUP A;  2X6S A;  1SL0 A;  5IWA K;  3T19 A;  4IJN A;  1C1B A;  2I5J A;  4DF4 A;  1U45 A;  1HLU A;  1LWE A;  3AO2 A;  1VSL A;  3CJ9 A;  4DFM A;  4WE1 A;  5I3U A;  1HRH A;  3U8X A;  2E88 A;  3NFA A;  3K5N A;  5HRS A;  5A2Q O;  3AVL A;  5E26 A;  2GUI A;  1NJX A;  2E2O A;  4CJE A;  1KLM A;  5M1O A;  5J2M A;  2NRT A;  1LWF A;  4EZ6 A;  3SPZ A;  5GAH P;  2VG7 A;  4CZL A;  1YVN A;  4DV5 K;  4LF5 K;  3R8E A;  2NRZ A;  4B9T A;  4L8R B;  2A40 A;  2OPS A;  4M3U A;  2XHB A;  2P5G A; 
#chains in the Genus database with same CATH homology
 4IJA A;  2P9K B;  1QQN A;  2KLA A;  3KVG A;  1S3X A;  1VQK N;  2IVP A;  2PAV A;  3CPW M;  3O9Q A;  1GLC G;  4IWV A;  1GLL O;  3CJ1 A;  3DXK B;  4NLB A;  3C6A A;  3ID6 A;  4ILH A;  2V51 B;  2ASP A;  4KH4 A;  4WFA L;  1H1V A;  1V4S A;  4M7Y A;  3CQX A;  2E2Q A;  2CH5 A;  3C7N A;  3I33 A;  4K43 A;  3VEV A;  3G6E N;  4CZK A;  1NBW A;  2IVO A;  2JWK A;  4GNI A;  4IOX A;  4I6M A;  1MWK A;  1T44 A;  3A5O C;  1W2B M;  1Q86 O;  2NRV A;  4JKA A;  1VQO N;  5AQW A;  4DB3 A;  1YF5 L;  4Y0W A;  3HBT A;  2P9U A;  4JKE A;  2W41 A;  1HUX A;  4CZG A;  3LDP A;  4H5W A;  5HL7 L;  1X3N A;  3IDH A;  3O8M A;  4EAH D;  2H3G X;  3CIP A;  3O9S A;  4FSV A;  2P9L A;  2VGM A;  5M1Q A;  3E1Y A;  1XUP O;  3EZW A;  3CCM N;  5AQK A;  1HKG A;  1NM1 A;  2E2P A;  2PFU A;  4JKG A;  3WXM B;  5DM7 L;  3AAQ A;  3PIO L;  3I55 N;  4DKW A;  2P9S A;  3CET A;  4CZM A;  3OBW A;  4EFH A;  2UYT A;  2P9N B;  1W97 L;  5FPM A;  3QFP A;  4KBO A;  5JIC A;  4FVU A;  4CJ7 A;  3DJC A;  3FR0 A;  2VGN A;  5KPZ A;  2QEX N;  3A5N C;  4BRF A;  1YJW N;  3ID8 A;  1O13 A;  4CZI A;  2I7N A;  4YOR A;  1S72 N;  3VOV A;  4FWL A;  3CJB A;  1JJ2 M;  4DHY A;  1YIJ N;  5CR4 A;  5AZI A;  3E9P A;  4MO5 A;  3KWG A;  3MWT A;  4MO4 A;  1ZXO A;  4XH5 A;  3G25 A;  3ZEU B;  4M7X A;  5C2D A;  3CCJ N;  1IJJ A;  1NGF A;  4ISE A;  1BA1 A;  3CCE N;  4G9Z A;  2V52 B;  4WF9 L;  1KAY A;  3E9O A;  2ITM A;  3VTH A;  2IIR A;  2FLO A;  4WCE L;  1KQS M;  3ZET B;  4BRL A;  3RSE A;  3W0L A;  3BF1 A;  1EQY A;  2I7P A;  5C2F A;  3O1B A;  1N8R O;  5BN8 A;  5M1F A;  2HMP A;  3HTV A;  3CCS N;  3L4I A;  4JAX A;  3AY9 A;  2E8A A;  3BP8 A;  4ILJ A;  2ZGZ A;  4BRQ A;  3UKU B;  4EHT A;  3CD6 N;  2HOE A;  2ZF5 O;  3EN9 A;  4FOE A;  1NGA A;  3CJA A;  5FPD A;  3O80 A;  1JCG A;  2D0P A;  2Q31 A;  2YHW A;  4JKC A;  4BRG A;  4A57 A;  2VYP A;  5GAG P;  3C6H A;  3VEY A;  1YXQ A;  3SAH A;  1VQ9 N;  1YI2 N;  5EVZ A;  1NLV A;  3FE1 A;  3IFR A;  2YCH A;  5CE3 A;  2HBK A;  3LDQ A;  2NRR A;  2EWS A;  2QWR A;  3VEO A;  4BG9 A;  4CD3 A;  1BWF O;  2P9I B;  1DKG D;  2F9W A;  4FWM A;  1VQP N;  1VAZ A;  5HOO A;  5AR0 A;  4BRO A;  4BQZ A;  5GIO A;  1YUW A;  5B8H A;  1U2V A;  3D2F A;  2D0O A;  2P9P A;  2HBJ A;  3VGL A;  4UY8 O;  2ZGY A;  3WQU A;  4OPA A;  4IO9 L;  4YOT A;  3WXI A;  1ZBS A;  3O5B A;  4HTL A;  4BRI A;  3OA9 A;  5AZJ B;  3N4Q A;  1E4G T;  2WBN A;  4H03 B;  4NO7 A;  5GIP A;  4JKH A;  2ASM A;  3HRG A;  1ATN A;  1KD1 O;  4IO8 A;  4MDA A;  4OO1 J;  2FSK A;  2QI2 A;  2YHY A;  4O8U A;  5I9E B;  5CHI A;  4FL9 A;  1NGJ A;  4PKG A;  2IVN A;  3H1Q A;  3M5R A;  5AQR A;  3T7Z A;  3VF2 A;  5C10 A;  5AQL A;  1EO1 A;  2BH1 A;  2ASO A;  3CCL N;  3H1V X;  3L4Q A;  3FFK B;  4BG8 A;  2D1K A;  3CMA N;  4WYB A;  3CCQ N;  1HPM A;  3MCP A;  3KK7 A;  1SQK A;  3MCA B;  1RDW X;  5JLH A;  2F9T A;  4JD2 B;  1Z05 A;  2RE2 A;  1QQM A;  1E4F T;  2QWN A;  3DAW A;  4JN4 A;  3NMU A;  3AGK A;  3F9M A;  4B1Y B;  2HBL A;  4H0T B;  4BRE A;  3CER A;  3D2E A;  4FWR A;  3ZX0 A;  4CZH A;  3U4L A;  4CBX A;  2E2N A;  4A59 A;  2ZJQ L;  1IG8 A;  1HX1 A;  5JLF A;  3LDL A;  4IOA L;  2AP1 A;  4LC9 B;  1Y64 A;  1WOQ A;  1CZA N;  1LOT B;  2Q2R A;  3A5M C;  2A3Z A;  2QM1 A;  3RVC A;  1ATR A;  3W3D A;  1WUA A;  3TPQ A;  3WEE B;  1Z6R A;  5E84 A;  5AQO A;  1YJ9 N;  3LDO A;  3CCV N;  2F7T A;  3O9R A;  4K42 A;  4IFE A;  4A5B A;  4YOY A;  4MLE A;  2V7Y A;  4BR0 A;  1BA0 A;  1MA9 B;  1BDG A;  4RTF D;  2VWB A;  3OHR A;  5GAE P;  3GOI A;  1P8Z A;  5AQY A;  3H6E A;  4PHT X;  3P38 A;  4PL7 A;  5DM6 L;  1P90 A;  1M1K O;  5JVH L;  2OTJ N;  3LDN A;  3ENB A;  1NMD A;  1J6Z A;  5AZJ A;  3FZL A;  4L3Q A;  2QTD A;  4CD1 A;  2GWJ A;  5AQX A;  4DQ8 A;  1K8K B;  1GLD G;  4IOC L;  1NGD A;  4FWO A;  4XH4 A;  5M1N A;  4CBU A;  4B1X B;  4WQ5 A;  4KH5 A;  3DXM B;  3MX5 A;  4JHD A;  2BTF A;  3BEX A;  3SMP A;  1YIT N;  2V7Z A;  1ILY A;  3CC2 N;  3VET A;  1VQ5 N;  3OBY A;  2Q1N A;  2ZJR L;  1KXP A;  4FPB A;  4YOW A;  3B8A X;  4C1N K;  2ZJP L;  1HKB A;  3ULE B;  4A2B A;  3O1W A;  3Q7C A;  4ISF A;  2OTL N;  1KC8 O;  4A5A A;  3H46 O;  4OPH A;  1TYQ A;  4PKI A;  2QWQ A;  4BRM A;  1YHQ N;  3QFU A;  2P9K A;  4BC2 A;  1XQS C;  1DT9 A;  4QS7 A;  3ZYY X;  4IEI A;  5BPN A;  3OW2 M;  1VQ7 N;  2E1Z A;  5AQJ A;  1BU6 O;  1QHA A;  3JS6 A;  3MX2 A;  3S41 A;  4XH1 A;  3DXK A;  1NGC A;  3DWL A;  3QIC A;  3KZB A;  5TKW A;  3VGK A;  3ENO A;  1SAZ A;  4H0X B;  4BRK A;  4JK9 A;  4MLH A;  4FWP A;  1GLB G;  1Q18 A;  3R1X A;  4AM7 A;  5M1K A;  5C12 A;  4FWK A;  5GIN A;  1VQM N;  2OAN A;  4YOX A;  3HM8 A;  2GEM A;  3CHW A;  5AQP A;  3H3O B;  3P4I A;  1U6Z A;  4BVO A;  4BRP A;  2QWM A;  2DPN A;  1ATS A;  3CJC A;  3UKR B;  4C23 A;  4JK7 A;  4QS8 A;  3CME N;  3E9L A;  5KQ8 A;  2E20 A;  3QML A;  4BR2 A;  1QQO A;  4CZF A;  4BRD A;  1K8K A;  2P9N A;  5MLC Q;  2QXL A;  3CC4 N;  3SMS A;  1HKC A;  3M1F A;  4BVP A;  4U67 L;  1GLE G;  3VEW A;  2CGL A;  3CXC M;  3MN5 A;  4O8K A;  3N4P A;  3P39 A;  4E1J A;  1G99 A;  5JVG L;  2A5X A;  4CBW A;  3M3Z A;  2JWL A;  3QDK A;  5BPM A;  3TSQ A;  4YDU A;  5C15 A;  5LJV A;  1Q82 O;  3JXU A;  4NB4 A;  4YDU C;  3UE5 A;  5TKY A;  4KH6 A;  5AQS A;  4IDH A;  4H0P A;  3SJH A;  5BRE A;  3MDQ A;  3VGM A;  4A2A A;  5BRF A;  3ZEU A;  4HWI A;  1X9J A;  4H0Y B;  5M1P A;  3R9P A;  5AQQ A;  4AF1 A;  3C7N B;  1K73 O;  3SAF A;  5AQF A;  4JEP A;  2GTD A;  2Q0U A;  4F9O A;  3QBW A;  2FSJ A;  2NLX A;  4I6M B;  5BR9 A;  4Z94 A;  3C0B A;  1BUP A;  1RDU A;  3K9J A;  4ILG B;  3ZET A;  3SLC A;  3VES A;  4H5R A;  3MN7 A;  3WQT A;  4BRC A;  4QS9 A;  3QBX A;  2Q0R A;  3IMX A;  2P9U B;  4GY2 B;  5AQG A;  2HST A;  1Q7Y O;  1ESV A;  3R3L A;  2A6A A;  3E66 A;  5EOY A;  3UKU A;  2P9L B;  3EKU A;  1XC3 A;  3VEN A;  2NRX A;  3GL1 A;  3IKM A;  4JKG B;  4BY9 C;  5F2R A;  3H3N O;  2P9S B;  2FXU A;  3EE8 A;  3HSC A;  3NVM A;  5F0X A;  5BPL A;  3VPZ A;  3CJ7 A;  3HI0 A;  2D4W A;  3MN9 A;  4IEE A;  4B1Z A;  5H1S Q;  1BO5 O;  2RHK A;  4B1U B;  3O08 A;  2Q97 A;  4R79 A;  4DCH A;  5ADX A;  4BRA A;  3HZ6 A;  4BR7 A;  3LL3 A;  4C1N I;  1KAZ A;  5BN9 A;  2FF6 A;  1LCU A;  3A5L C;  5AQI A;  1RGI A;  2P9I A;  5AQZ A;  3FGU A;  3VEZ A;  1VQ8 N;  2YI1 A;  5KQD A;  4FPA A;  4EIA A;  2W40 A;  3D7E O;  4GV9 A;  1GLA G;  5AQU A;  3FZF A;  3AAR A;  3TTC A;  1QZ5 A;  3O9U A;  4WFB L;  4GV3 A;  3EE9 A;  3FZK A;  5AZI B;  4U7B A;  2GWK A;  3SK3 A;  3CC7 N;  1DEJ A;  2GUP A;  1X3M A;  3MK6 A;  3SBT A;  3CF5 L;  3GE1 A;  3M6G A;  1VQ6 N;  2YJF A;  3ZX3 A;  1VQL N;  2GX9 A;  4BR9 A;  3ATU A;  4YOU A;  3VF4 A;  3WT0 A;  4GVE A;  3MWP A;  1NGI A;  2WFB A;  4H5N A;  3RSE B;  1QVF M;  2CH6 A;  3P31 A;  4FOI A;  3TU5 A;  3KWI A;  4FWQ A;  2NZT A;  5AFU A;  5BRD A;  2BUP A;  1NJI O;  3SAG A;  5KPT A;  3MN6 A;  4ISG A;  4RCH A;  4WQ5 C;  3VEX A;  3VTI A;  5AQH A;  4H0V B;  2ZWH A;  2PBD A;  5GAD P;  3I8B A;  4BRN A;  1T3V A;  2QWP A;  5ADX H;  4B9Q A;  1NGB A;  2FF3 B;  3CI5 A;  5EY4 A;  2VCP A;  3AGR A;  3Q7B A;  3TSP A;  5EXW A;  3ENH A;  3GDQ A;  4JD2 A;  5AQV A;  3I56 N;  2WUS A;  4JKF A;  5KPR A;  3HOT A;  3KHY A;  1NWK A;  1JCE A;  3MMV A;  4J8F A;  1RFQ A;  4NLC A;  1TUU A;  3U9D A;  5AQN A;  1YJN N;  2HBM A;  1M90 O;  5FPN A;  3UB5 A;  3L6Q A;  1C0F A;  1D4X A;  3EL2 A;  3WEE A;  4RWT A;  1GLF O;  3BF3 A;  4YOV A;  1VQ4 N;  4JKB A;  1U2V B;  3EO3 A;  4FWS A;  3CQY A;  3D2F B;  4AM6 A;  2P9P B;  4FO0 A;  4IXC A;  3FZH A;  2KHO A;  3LM2 A;  4H5V A;  4O5F A;  4BC4 A;  3GBT A;  5AFU H;  3BUZ B;  2WC9 A;  1K8A O;  5LJW A;  2NNW A;  1QZ6 A;  3WUH A;  1BOT O;  2NRW A;  4K25 A;  5JMV A;  3ZX2 A;  1ZC6 A;  2QW9 A;  3G4S N;  1NGE A;  3O4W A;  4PL8 A;  3WXJ A;  3TTD A;  5LY3 A;  2CGJ A;  4BGB A;  3L0Q A;  3TSU A;  3PIP L;  5AQT A;  3EKS A;  4BR5 A;  1TUY A;  3F2K A;  3PLA A;  1OKJ A;  3DXM A;  1MWM A;  4IZ9 A;  1DGK N;  1SZ2 A;  4PKH A;  1YAG A;  5ELZ A;  3VER A;  2QWL A;  3A8Y A;  2CGK A;  3NVK A;  1OVY A;  4WFN L;  1S22 A;  4CZE A;  3G71 N;  1NGH A;  1QVG M;  2YHX A;  4MDB A;  3R6M A;  2QWO A;  1BG3 A;  3ULE A;  3CCR N;  1Q81 O;  2Q36 A;  4JK8 A;  5BRH A;  2YJE A;  2YX6 A;  3D2E B;  3WXL A;  4WQ4 A;  1SS6 A;  4WQ4 C;  4BRH A;  4FWN A;  2QA4 N;  3C65 A;  4A61 A;  1VQN N;  3LM9 A;  4K41 A;  1NGG A;  3AAP A;  4CZJ A;  1T6D A;  4BC5 A;  4M63 C;  3VF6 A;  3O9T A;  1C0G A;  4B1W B;  2A41 A;  1MDU B;  1R59 O;  4XEI A;  3D6R A;  3HOS A;  2E1Y A;  4JKD A;  5EX5 A;  3WXK A;  3T69 A;  3GG4 A;  3CPE A;  3U9Z A;  4IJN A;  3VMF B;  4B1V A;  1HLU A;  3ATV A;  4H5T A;  2J4R A;  1GLJ O;  4CI6 A;  4A62 A;  1K9M O;  3CJ9 A;  3J8A A;  1HJO A;  4JNE A;  5F1X A;  3QB0 A;  3U8X A;  4BGA A;  2E88 A;  5FPE A;  3F5T A;  2AA4 A;  5E26 A;  3DLL L;  3H45 C;  4BC3 A;  2E2O A;  4BQL A;  3FLC O;  3IUC A;  3UKR A;  3K9K A;  3TTF A;  5M1O A;  2NRT A;  2HF4 A;  4JHD B;  1KAX A;  3O6W A;  2KKZ A;  2A42 A;  5GAH P;  4CZL A;  1YVN A;  3J7Z O;  3A0I X;  2GEL A;  1V4T A;  4BR4 A;  2FSN A;  2NRH A;  5AQM A;  2NRZ A;  3R8E A;  4EHU A;  1JCF A;  2A40 A;  3SBG A;  5C0Y A;  2HF3 A;  3CCU N;  1TYQ B;  4H0O A;  3FZM A;  1T6C A;  4GV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...