3M5RA

Crystal structure of swine flu virus ns1 effector domain from h1n1 influenza a/california/07/2009
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
126
structure length
126
Chain Sequence
b'HMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQRFAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title Crystal Structure of Swine Flu Virus NS1 Effector Domain from H1N1 Influenza A/California/07/2009
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 38
structure length 126
sequence length 126
chains with identical sequence B, D, E, F, G
ec nomenclature
pdb deposition date 2010-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3m5rA00
3KWGA 3KWIA 3RVCA 3P39A 3M5RA 3P38A 3P31A 3O9RA 3O9QA 3D6RA 3L4QA 2GX9A 3EE9A 3O9TA 3F5TA 3OA9A 3O9SA 4OPHA 2KKZA 2RHKA 3O9UA 4OPAA 3EE8A
chains in the Genus database with same CATH superfamily
3R6MA 3SPYA 4LF5K 4CGHA 3VQEA 3CIPA 3DLGA 3V4IA 2NLXA 4F9OA 2FLOA 4E7IA 3WXJA 1K73O 1E3MA 3THYA 4KTZA 2QXLA 1SQKA 3ENOA 3O08A 1KD1O 3QNNA 2YI1A 4DV4K 3CCMN 3O9TA 3C7NB 5C15A 3THWA 4PKGA 1XC9A 3A5LC 5FLXO 1KAXA 3U3GA 4GV6A 4JI1K 4RW7A 1NGDA 3BUZB 3WNFA 3K9KA 3HTVA 1QTMA 3OYDA 1RBRA 5JMVA 1HYVA 4BR7A 3THVA 1VQMN 3SAHA 3CCRN 3TU5A 5LJVA 2BE2A 4IWVA 1RT6A 4JN4A 3C6TA 5CE3A 4FJXA 5M1PA 1VSKA 4BE2A 3ISNC 3MMVA 1VAZA 4CERA 3LP2A 2HHHK 4BVPA 1VSLA 1IKXA 3B6PA 4AILC 3TI0A 3SAFA 3G10A 3V9XA 4B3OA 3H1VX 3VA3A 5AQNA 3WNEA 2YX6A 5TKYA 4JKHA 2E2QA 3PX4A 3G0ZA 2W6LA 2HHVA 1B9DA 3VF4A 4LF4K 4E7JA 3K58A 2A41A 3LALA 3NVMA 1HUXA 3RMBA 3SQ4A 4KHQA 1TV6A 4BRLA 4FLXA 4CJ5A 1RDDA 5C2FA 5FPDA 3O3HA 4BC2A 4F8RA 2A40A 1TK0A 1J54A 2O8CB 3LDPA 5FRMA 3OYNA 3WXLA 1BCOA 3M6GA 3CJ1A 3SUPA 1C1CA 4CJ7A 4E1NA 3L2WA 4CFAA 4RW8A 1J53A 3HI0A 2FSNA 4JKBA 4NCBA 5AZJA 4WCEL 3LAMA 4Z94A 3EZ5A 2HHUA 4BRMA 4BRAA 5DM7L 2F9WA 4FWOA 4A2AA 3V9ZA 2OZSA 3AA4A 3CM6A 4CFDA 5GINA 1RTHA 3V6DA 1KVCA 3L2VA 2GUIA 4CIFA 4CZIA 2GTDA 4O5BA 1T7PA 4XH5A 2HMPA 4KHNA 1RTDA 1RT5A 3CFOA 3VEXA 4HWIA 2Q97A 3VEVA 3KJVA 4I7FA 5ADXH 4LF7K 4FWKA 1JJ2M 1NOZA 4AH9A 4FXDA 4CJKA 5GAGP 3ZEUA 4BDPA 3WQUA 4CJ4A 5EY4A 3EEQA 3MEGA 4CGFA 1XHXA 2VG6A 2QWNA 4M3YA 1RILA 4FLYA 1NKBA 2IAJA 4BRFA 1EWRA 4CJEA 1TAQA 2HMIA 1VSDA 3AA2A 4CBXA 3AVJA 4H8KA 3P38A 1FKPA 1NKCA 5AQKA 1J6ZA 1VRTA 2ZF5O 4DLEA 1WBBA 2O8FB 3ULEB 1BCMA 1BIUA 4B1VA 2QM1A 1ASVA 4YNQA 1KXPA 1NOYA 3MN6A 3VQCA 3AY9A 4XH4A 4J8FA 4OKJA 4WQ4C 1N34K 3PLAA 4H5NA 2A3ZA 4CJFA 3NGYA 1U49A 1GLFO 3P5JA 4RW4A 2UXBK 4E1MA 3HSCA 4DR5K 3AAQA 4A2BA 2HHWA 5A2QO 4A5AA 2E20A 2P9PB 4F4KA 4LSLA 2FSKA 2XHBA 5DK5A 2Z1IA 2NRZA 1YVNA 1TKXA 4M41A 4M3UA 2E2NA 3OS2A 2DY4A 2D0PA 3AA5X 1VQPN 4XIUA 3SJHA 3E9LA 5EX5A 3VGKA 4ILHA 1R59O 3AVGA 4NYFA 2UUBK 2RKIA 4O0IA 1N36K 3H46O 3IS9A 2O8DB 4HHTA 4E7KA 1S9EA 2VQFK 4IXCA 5CYMA 1M90O 1HMVA 3ZSZA 2O8BA 3TPQA 4BG9A 1GOBA 3M8PA 1EO1A 3CPWM 2FXUA 3HYFA 4PA1A 4AHCA 2D0OA 4MDAA 2HNYA 5FPNA 3AARA 3S41A 1VSMA 3GBTA 1YXQA 1X9MA 3GE1A 5E41A 2HBMA 4GKJK 1W9HA 4LY7A 5HOOA 3HP6A 4CJLA 1IBLK 1BA0A 3TAQA 3ZCMA 4DTPA 3VESA 5SZTA 3AO2A 4EHTA 4FOIA 2XO7A 1ZXOA 4PHTX 3BDPA 3SBGA 4B9TA 5HRSA 5HL7L 4BR2A 5M1FA 3L0QA 4IKFA 3SAGA 3VQ7A 2P9SA 3AVLA 5F0XA 1NWKA 4FLUA 1TGOA 3Q7CA 2UYTA 3ZX3A 4BRIA 1T6CA 4CGJA 4ILGB 4DQSA 4EFHA 1C0MA 2P9KA 3DOLA 3VQBA 2D0AA 1JKHA 2Q31A 4M7XA 1KQSM 5DMRA 4NXNK 3VEYA 1KFDA 4FZXC 1T03A 1HKCA 3TWHA 4YOUA 1BI4A 4FOEA 4LF9K 3NF8A 3ENHA 2QKKA 3VA0A 1V4SA 5FRNA 2F8SA 1NK0A 4WYBA 1KLMA 2AA4A 1ATNA 2IDOA 1CLQA 1VSIA 4DTRA 2F8TA 2VCPA 2WFBA 4I9QA 5HRPA 2Q0RA 5AR0A 4OLBA 1W2BM 5AQZA 4IO9L 2JGUA 3CI5A 4JHDA 3E66A 2XY8A 1MU2A 3N4PA 1MDUB 2P9LB 1X3NA 3DXMB 2Y1IA 1GLBG 2P5OA 4CJVA 2BGGA 4CJSA 2O4GA 4EP5A 4FZZA 3ZETA 4JKGB 4YOYA 2OANA 2QW9A 4CI6A 4CJTA 2FBTA 2E6LA 4X65K 4JKFA 5AQFA 3UB5A 5AQMA 1QVGM 3LDQA 4JKCA 3OYBA 3OTOK 1TKTA 3MXIA 4JK8A 5AQWA 1ITGA 4OKKA 1FKOA 2E88A 3QFPA 3KK2A 3SCXA 5HLFA 5FPMA 3DLBA 4WF9L 4E1JA 4H03B 5GAEP 4M7YA 4MFBA 5BRHA 1D4XA 1B92A 3KK3A 4KTWA 2UUAK 4Z4IA 1KVBA 1ZBSA 5HROA 4GV9A 3RMCA 3FZHA 3IUCA 2QWOA 1Z05A 3ID8A 3T69A 3Q7BA 1WUAA 1JLEA 1K8KB 1QQCA 1NMNA 1T6DA 2QWQA 5LL6Z 2LSNA 2PFUA 5M1NA 3EY1A 2EX3A 3SQ0A 2AJQA 4CFBA 1HRHA 4FWRA 3CCVN 1RBUA 1TYQB 3HRGA 4BRGA 4DF4A 3SQ2A 4O5FA 4KO0A 1RBSA 4BC3A 3LZJA 2KW4A 4DU4A 1JLCA 1S1WA 4H0XB 3S9HA 5AZIB 4NO7A 3O4NA 3CG7A 2CH6A 5JICA 5DM6L 3ALYA 1KRPA 2OPPA 3VQQA 5GADP 4CCHA 1ASWA 3L4IA 3BF3A 4CECA 3ZX0A 4O44A 3UKRA 3SYZA 1JLFA 2YNFA 3WQTA 4Q0BA 2VGMA 3CPEA 3FGUA 3AAPA 4DG1A 5SWMA 3UE5A 1RT3A 2IOCA 1XC3A 2QA4N 1VQ7N 4HCBA 3VENA 1RGIA 1BL3A 2YHWA 4E3SA 4X64K 3T1YK 1Q81O 3O9SA 2P9IA 5M1KA 4IG3A 4KREA 2E1YA 4DUYK 1U04A 4ELVA 4FPBA 1ILYA 5AFUA 3R3LA 4BRCA 3CETA 1YI2N 3HP9A 4GKKK 4CZKA 3DI6A 2H3GX 2G8FA 2OZMA 2QK9A 3I8BA 3PIOL 3IKMA 1HJOA 2HF3A 4DTMA 1RT4A 1KAYA 2ETJA 3VN5A 4DHYA 5BN8A 4IOCL 1QQOA 4HTUA 1JL1A 3DM2A 3EYZA 3MN5A 1NMDA 4IO8A 2OPQA 4JAXA 4BRKA 1RT2A 3OYFA 1CZ9A 1CXQA 1D9DA 1T05A 3CD6N 4ELTA 1SS6A 2VWJA 1HYSA 3A5OC 3T1HK 1TUYA 3A8YA 2OPSA 4Y1CA 2KFZA 3NHGA 2Z1GA 3BEXA 1CXUA 1WSEA 3THXA 3KTQA 4C8OA 1SL2A 2F9TA 4DFKA 4M3RA 4I6MA 1S1XA 1ASUA 1VQ5N 1W0HA 3CJBA 2P9NA 2IVPA 3F5TA 4B1UB 2DFHA 3AGRA 3GDQA 2D5RA 3VERA 4Z4GA 1YUWA 2BUPA 4CIGA 5LMUK 3AO4A 3C6AA 1MWMA 3FZKA 3HL8A 3SUQA 4U7BA 1XUPO 4CHYA 5FDLA 2F7TA 3RTVA 2RF2A 3KLEA 3D2EA 4DQ8A 5EOYA 1U47A 5AQHA 4PQUA 3C7NA 2ITGA 3CM5A 4B9UA 3OYIA 3J80O 3HJFA 3EE8A 3C65A 1J9AA 4K42A 4WQ5A 3EZWA 2RN2A 3OYJA 1EQYA 4CF0A 1I94K 4O8KA 2QWRA 3LDNA 1Z6RA 2YHAA 1FW6A 1JLQA 3SMSA 2WBNA 1VQLN 3O9QA 2A1SA 1LAWA 3VEZA 2D0BA 5T7BA 3SI6A 1XI1A 3OYLA 4CZMA 4NLBA 4H5VA 3ATVA 5FPEA 4CJQA 2A42A 3AVIA 1HPMA 1XMOK 1K9MO 4ID1A 1P8ZA 3O9UA 3QDKA 1NK5A 3T3FA 3CFRA 1O13A 3HM9A 5AQXA 4BQZA 5LMNK 4E89A 4DQPA 1JCFA 3VQ5A 4FM0A 3RMDA 4N56A 5LJWA 3AVAA 1VK0A 2Q0UA 4OX9K 3I0SA 2EWSA 2GUPA 3ZSVA 4DF8A 3ASMA 4CJWA 3J8AA 1A5VA 3AVCA 4N41A 4OGEA 4FJIA 3VF2A 3BZKA 1RT7A 2Y1JA 4IOAL 3BF1A 1GOAA 4JNEA 2YNGA 2KTQA 4ZTJA 4CZHA 2D0CA 1GLDG 1D5AA 3DRPA 4BACA 1S3XA 4DS5A 1HX1A 4DU3A 1XNQK 1MA9B 4WQ4A 4FL9A 3I56N 4DSFA 4DU1A 3TR8A 3QNOA 1X1PA 2O8CA 1WSIA 5BREA 3BP8A 2CGKA 4DTUA 4KHUA 1YIJN 4IFEA 1UWBA 4RCHA 3RMAA 1XNRK 3SBTA 3MCAB 1YJNN 1GLEG 1C1AA 3RVCA 4E7LA 5BN9A 4FM1A 1JLAA 3LWLA 4JLHA 1HQUA 1EWQA 3OYEA 3EE9A 2IGIA 3GG4A 2F96A 5HP1A 1OH5A 2B4JA 2QWPA 5JVHL 4JI3K 1EP4A 4LD0A 2PAVA 3K0SA 3HO1A 3CC7N 4DV7K 3M5RA 4DMNA 1U45A 4OPJA 3R8EA 4NCAA 1ATRA 4FK4A 3D45A 4AHSA 2YJEA 4EAHD 3CYMA 3THWB 4J2DA 1XHZA 1NU0A 1T3VA 3LAKA 5D3GA 1GLCG 4JD2A 4FJNA 4KHYA 3HBTA 5C42A 4H5WA 2GV9A 3AA3A 3VGLA 4GMJB 3LDLA 3NDKA 3F9MA 4FWNA 1HYZA 5I3UA 4KH4A 1KAZA 3P31A 1IO2A 4WQ5C 5KPTA 3LPUA 3O9RA 3ZT4A 1J5EK 4DFMA 3QEWA 2O8FA 1FXXA 3QIOA 4FSVA 3ULEA 4W5QA 1VSEA 4JI5K 1IG8A 1QHAA 2I7PA 1JXBA 2YNIA 1O1WA 2VYPA 1YT3A 3SNNA 1UAXA 3NCIA 3KVGA 4FWLA 2QKBA 2I5JA 4CJRA 4N76A 3ZSXA 4GNIA 2VWKA 5J1EA 2KFNA 1HR0K 2FBXA 4YFUA 4W5RA 4O0JA 1R0AA 2GWKA 3NVKA 1IJJA 3MXMA 1XMQK 3RR8A 4IG0A 4BR4A 2IVNA 2CGLA 1BO5O 4B9QA 2P5GA 4J2EA 3S3NA 4M63C 1IBKK 4K43A 2X6SA 4BROA 4CZLA 3LPTA 5AQUA 3E1YA 4OVLA 1ZBFA 2DTUA 5C0YA 1XWLA 2W42A 2YNHA 3V1RA 3D2FA 1A5XA 3DLRA 3SK3A 2G8KA 3HT3A 4JI4K 2BH1A 3I33A 1JCEA 4UQGA 2O8DA 4BDYA 4K41A 4BRNA 3QIPA 3IFRA 3P4IA 5GIPA 1WAJA 2HB5A 2E8AA 1BQNA 1YTAA 3FZMA 4A5BA 3PO5A 3PSIA 3AV9A 1RNHA 4Z4HA 4G9ZA 5AZJB 2BTFA 3MEEA 2O8EB 3NF9A 4B9VA 3PX0A 3PX6A 1HNVA 3K5LA 4MLEA 4CHPA 2QWLA 4MO5A 3VTHA 1WSHA 4KTQA 3CJCA 3L2UA 4DWIA 1QS4A 3DJCA 2HVHA 1OKJA 4DTNA 1NGEA 1JLGA 3QFUA 3C0BA 3DLEA 4FM2A 4JRQA 5MLCQ 1BUPA 1VSFA 4FVMA 3KLFA 4E0DA 3CCEN 3VF6A 4DR7K 2KZMA 3ZSWA 4CZGA 3LANA 3L2QA 1M1KO 3A0IX 2G8UA 3SQ1A 2CGJA 3D0PA 5BR8K 1Q86O 4I2QA 4KFBA 2HOEA 4Z0UA 5KRTA 2VG7A 3KLGA 4PY5A 4NB4A 1NJYA 4L8RB 4H0TB 3DRSA 3DMJA 4E7HA 3IDHA 3CCQN 3TAPA 2G8HA 3J7AP 4BR9A 1L3UA 4MDBA 2ZJPL 2HHTA 3SLCA 2F4VK 2NNWA 1Q18A 4CJPA 4JKEA 4FJLA 1SAZA 4HUFA 1OH8A 3ENBA 1LW0A 3R9PA 2A1RA 3O6WA 3RWUA 1JXEA 2ZQBA 3NE6A 3TAFA 3T7ZA 5JLHA 4J2AA 3MWTA 4DKWA 1QSSA 4CD1A 5ADXA 3LP0A 4CBWA 4BWJA 4BRPA 3NF6A 2Z1JA 1WB9A 2KQ2A 1NJWA 1T8EA 1C0UA 3IG1A 4B9MA 3E01A 3D6RA 3J7ZO 3MAQA 4B08A 1HNZK 1VQ8N 2VQEK 3AVKA 4CEOA 4JKGA 1CZBA 3CJAA 2P1JA 3LP3A 2RE2A 3OJSA 4BGBA 1TVRA 1EETA 3EO3A 4BR0A 4R79A 4BR5A 1I39A 3ZSQA 2V7ZA 1EX4A 3ID6A 4FJ5A 4ID5A 4FJ9A 1WSGA 3L6QA 1TL1A 3QICA 1WAFA 2HHSA 3CJ7A 5CR4A 3PSFA 4M3TA 4H0PA 4KH6A 4OPAA 4B1WB 1DTTA 1LOTB 4PKHA 2P51A 4CE9A 4DR1K 4LF8K 4YY3K 1EKEA 2ZGZA 4ICLA 4KRFA 2V7YA 2HNZA 4FLVA 1BGXT 5EVZA 3O1WA 3OHRA 3M8SA 2WC9A 1U6ZA 2QEXN 3ZSYA 3CF5L 2HVIA 3H08A 4AQYK 3JYTA 1YITN 4DQQA 1FJGK 5FROA 2ZM6K 2AP1A 1UA1A 4H4MA 1LAVA 4NLCA 4DFJA 4KPYA 4DR4K 1T44A 5AFUH 1VSHA 5KPZA 2FF3B 4WFBL 4LC9B 1C1BA 2I7NA 4FWQA 5AZIA 3VPZA 4BC4A 2XRIA 1G15A 1IKYA 3MCPA 3TSPA 2G8VA 4A59A 1UA0A 4BVOA 3TABA 4JK9A 1S6PA 3QINA 4QAGA 5HRRA 4WFNL 4DV1K 2O4IA 4FWPA 4K0KK 4RWTA 2P9UB 4AM6A 4IZ9A 3CJ9A 1S1UA 5CHIA 1BIZA 1NK4A 2YV0X 1RTJA 3E9OA 3O3FA 1BI4B 4WFAL 4CEEA 5AQGA 2Q36A 3IAYA 3SMPA 3JSMA 3OW2M 3QEIA 1K6YA 2HBLA 1Q9YA 4CGIA 4CF2A 1ESVA 4E19A 3WEEA 1OVQA 3KLHA 2X74A 1QQMA 4JHDB 4C8NA 3VMFB 4GVMA 4DTXA 2QXFA 4HCCA 3V1OA 3HZ6A 4C8MA 1NGBA 1Y97A 3DYAA 3NFAA 2KLAA 3ZETB 4G1QA 4C23A 3U9DA 2G8WA 5AQVA 4X62K 3EKUA 3NAEA 2GELA 5JLFA 3LWMA 3OYCA 3LL3A 3BZCA 1U2VB 3WXKA 4BRDA 5AQLA 2Q2RA 1ZBIA 4FJJA 1Q8IA 2E1ZA 2KZZA 3LP1A 5KGWA 2GX9A 1QZ5A 2EHGA 3H1QA 2V52B 4DUZK 4OPHA 3HPOA 3H3OB 5AQJA 3WXIA 3U3YA 1NK6A 2NRTA 4KKOA 3J81O 5CZ2A 3N4QA 4B3SK 3SUNA 1E4GT 4FWSA 3AVNA 2BDPA 3MN7A 2HF4A 4FJHA 3TARA 2YKNA 3HPGA 2ZJRL 1HJRA 1J5OA 1Y64A 3CCLN 1TKZA 4KI6A 1JLBA 4OGCA 1DGKN 3J7YP 3LDOA 1SKSA 2B5JA 2YKMA 4OKEA 1YTUA 3CCUN 3SV4A 3C6HA 1TK8A 5KRSA 3ZT0A 4GVEA 4JI2K 4FWMA 3QB0A 3DLKA 4JK7A 4LH4A 3RSEA 3QEVA 5J2MA 3P83D 4H0YB 3K5MA 1QE1A 4CF9A 3AO1A 1Q82O 3DXKA 4IDHA 4X66K 1RDBA 3S3MA 1GLJO 3UKRB 1KCFA 1WSFA 4QS8A 1UOCA 3NGZA 1OH6A 4JYAK 4PUOA 4NXMK 1G99A 5E26A 4GY2B 2HSTA 1KC8O 4DSEA 4C1NK 2P9IB 4F3OA 4CEAA 4CEDA 1EXQA 2YHXA 1L3TA 4BREA 3CHWA 4DTSA 4ZHRA 4IEIA 4ISGA 4EIAA 4MQ3A 1NLVA 4LSNA 1GLLO 4BE0A 2DFFA 2WTUA 3M8RA 1NGJA 5CZ1A 3KHYA 2W41A 3UIQA 2JLEA 3CC4N 1C0TA 1NBWA 3LM2A 2X6NA 5KI6A 4DS4A 3SV3A 3THXB 3QBXA 3UKUB 4PL8A 4O8UA 2CH5A 3AVMA 3O8MA 4CZEA 5BPLA 3VQDA 4I6MB 3TAMA 3KZBA 5BPMA 1JL2A 5KQ8A 4O55A 2HHQA 2P9NB 3DWLA 2NRWA 2PYLA 1SV5A 1C0GA 3IMXA 4XEIA 5I9EB 3MEDA 4LH5A 2UXCK 1S22A 3VETA 4J2BA 2WOMA 3CC2N 1NKEA 1BWFO 4DR3K 4DV0K 2E4LA 3TTCA 1GOCA 4DR6K 1NK9A 3O4QA 4BGAA 3KKRA 2VGNA 3KD5E 5HBMA 4OJRA 3P1GA 3DRRA 5M1QA 1NM1A 3D2EB 3IRXA 4IJAA 4RW9A 1DT9A 1H1VA 2KHOA 2PYJA 3FFKB 3QERA 4OLAA 1N33K 1SUQA 2A5XA 1X9JA 5CYQA 3SUOA 1YJWN 4DTJA 3GOIA 2G8IA 4Y0WA 3V1QA 3TAGA 3C95A 4IEEA 3OYKA 5K14A 2IVOA 4FYDA 3KK7A 4U67L 3V9UA 1IV0A 1WN7A 1RFQA 1HLUA 4O4GA 3OYGA 3DOKA 3T19A 4KHPK 1A5WA 5KQDA 4DV6K 1W97L 4KB0A 2ZGYA 5GIOA 4JEPA 2W6KA 4TSXA 1HKGA 5JS2A 4A61A 4Z4CA 3THYB 4FLZA 2RPIA 1NNEA 4HUEA 3MXJA 3GL1A 4MLHA 3OA9A 2ZJQL 4BRQA 1JCGA 4DV3K 4C8LA 4H5RA 5EU7A 5AQRA 1HNXK 2OYQA 3CQ8A 4N5SA 3OYHA 5M1OA 4KAZA 1IH7A 2IIRA 4QOZB 1ATSA 1NGHA 4BRHA 3NGIA 3MX2A 1SKWA 3I0RA 3MWPA 1VQ6N 2E2OA 3CQYA 3EKSA 3K59A 4DR2K 3HVTA 4K25A 1YHQN 3ZT3A 1XQSC 2KKZA 4IFYA 3U8XA 4DV5K 4JS5A 1WOQA 4QCLA 2O8EA 5BR9A 3L3UA 4FJMA 4CEQA 1S1VA 4JI8K 1Z26A 1NGAA 2DPNA 3B6OA 1YF5L 4QS7A 4IOXA 4MO4A 5JVGL 1L5UA 3D7EO 1D9FA 2XY7A 2DFEA 2P9PA 5AQOA 5C10A 3SZ2A 3K2PA 1QHTA 3OYAA 1OVYA 1IKWA 1OH7A 2IC3A 3H6EA 3P39A 4RG8A 4CJUA 3H3NO 3WNHA 3FLCO 2ASMA 1C6VA 4CF8A 3U9ZA 3TAEA 3RRHA 2V51B 1QQNA 4WE1A 5AQYA 4AHRA 1NGIA 3NBPA 4CHQA 3OY9A 4H0VB 3F2KA 1N32K 4JD2B 4AHUA 4YOWA 4ZTFA 1LWCA 4I2PA 2E6MA 4K8XA 1VQON 3KWGA 1WSJA 4B3RK 1BISA 3OBWA 4ELUA 4GV3A 2ZWHA 4BG8A 3AVBA 4AHVA 1RBVA 3OBYA 1TKDA 3KK1A 5J2NA 1LCUA 5AQIA 1TL3A 3QESA 1N6QA 4B8CA 4YDUA 3M8QA 1HKBA 3W0LA 1DKGD 3ITHA 1VHXA 5C25A 4B1YB 5ELZA 4PL7A 2HW3A 3MECA 2OTLN 3FFIA 4F3TA 3CXCM 3V9SA 1RT1A 4IFVA 4FJ8A 1S1TA 2FC0A 3ZEUB 1IBMK 3ZYYX 1NK7A 1NJIO 4GW6A 3NH1A 4Y1DA 1MWKA 2FF6A 3TTFA 3HOSA 4HVJA 5TKWA 3ZSRA 1BA1A 4KBOA 1RDWX 1NGCA 5BPNA 1NJXA 3NH2A 3SJJA 1BQMA 4B9NA 1SL0A 3D2FB 4CVNE 4YOTA 4W5NA 4LFCK 1RBTA 4V19S 4N47A 1NGFA 1IKVA 4AHTA 4CFCA 1HQEA 1L3VA 2BANA 3C6UA 3QETA 4CHOA 3DLLL 4JI7K 4DTOA 1BU6O 1F21A 4CBUA 3PO4A 4DQIA 4DFPA 4KV8A 3ZT2A 4K8ZA 2HBJA 3G71N 2OA8A 4CK2A 1NK8A 2PZSA 3WUHA 4DSLA 3M1FA 4CGGA 3CCSN 1WBDA 4JI6K 5BRFA 3KWIA 4YORA 4FO0A 4AF1A 4JRPA 4XH1A 4F2RA 4BDZA 4M3ZA 1NG9A 2NRRA 3MK6A 2OCEA 3AO3A 4CJ3A 2UU9K 4PKIA 3VQ8A 5B8HA 4CHZA 4DSKA 4FCYA 2XY6A 2P9LA 4B9LA 3DXMA 4LFAK 3JXUA 1YJ9N 3RRGA 1DEJA 4FLWA 3NMUA 4DSJA 4JS4A 2HBKA 3O1BA 3DLHA 4EZ6A 3ZSOA 4L3QA 4CGDA 3L8BA 3FZLA 2FBYA 5EXWA 5KGXA 4C1NI 1TAUA 3FR0A 1BG3A 3FE1A 3L2RA 5C24A 3G4SN 3HSTB 4CW7B 3L4QA 4FPAA 5IWAK 4BWMA 1GLAG 2O8BB 5CY4A 1YAGA 4M3XA 3CMEN 1I3AA 1VSJA 3SPZA 1Z25A 2P9UA 1BOTO 4KI4A 2GEMA 1X9WA 4BC5A 4RTFD 4LFBK 1RDUA 1ZC6A 1B9FA 3PY8A 1K8KA 4KH5A 4W5TA 1IG9A 4M45A 3AVHA 3ATUA 1L3SA 3AO5A 4NCGA 2Z1HA 3HXMA 3JAMO 2ZE2A 3A2FA 4FW2A 4YOVA 4Q5VA 3HOTA 4OPKA 4FJGA 4A62A 4CEBA 1N8RO 3QEPA 2VWBA 1K8AO 1DTQA 3M3ZA 1TYQA 3VOVA 3BY5A 3OS1A 1TK5A 3PV8A 1RTIA 2P9SB 1KSPA 1HPZA 1KLNA 5AQPA 3ZLJA 1CZAN 4YDUC 3V81A 4EP4A 4EZ9A 5J2QA 3VGMA 4NYNA 5E84A 3QBWA 5IT9O 3BGRA 3W3DA 4FLTA 2GBZA 1V4TA 3EN9A 4FZYA 3OVNA 4CEFA 1U4BA 4JI0K 4FW1A 4CIEA 2P9KB 4W5OA 3LZIA 2XY5A 4JV5K 2ATQA 1QSLA 3T1AA 2Q3SA 4HUGA 1RDAA 1BHLA 4CF1A 1U2VA 2Q1NA 2FBVA 1VQNN 4B3MK 3MDQA 3ZX2A 2YHYA 1RCHA 1KVAA 3ZT1A 4CZFA 1ZYQA 2UUCK 2HNDA 4AM7A 5LY3A 3K5OA 2RHKA 4FVUA 4JKDA 2JWLA 2NRVA 5JS1A 4HTLA 3WXMB 4CESA 3AVFA 4RW6A 2NRHA 2OPRA 4KHWA 2PBDA 1S6QA 2GWJA 3O4WA 1U48A 1Q7YO 3MX5A 1D8YA 1DLOA 2HHXA 1VQ9N 3TTDA 4B3TK 2D4WA 3HK2A 4IDKA 3PUFA 3A5NC 1HNIA 1WLJA 4H4OA 4DCHA 4FK2A 2QTDA 3CCJN 3I8DA 3LDSA 4CK3A 1S9GA 1E4FT 3G25A 3TANA 2WONA 5AQSA 3KLIA 5BRDA 5C2DA 1VRUA 4ISEA 4Z4FA 5H1SQ 1WNSA 3HM8A 1N5YA 1X3MA 4FJKA 2IS3A 3QEXA 4PWDA 1SL1A 4BQLA 4FJ7A 3CERA 2B6AA 2J4RA 5KTQA 4IJNA 4B8AB 2R7YA 3NH0A 4UY8O 3E9PA 2VG5A 4ISFA 2ITMA 4I9LA 4LF6K 3NF7A 3VQPA 4M3WA 4IBNA 1LW2A 4CHNA 4B1ZA 5J2PA 2QWMA 3VQ4A 1KTQA 2JWKA 3I55N 3K5NA 4DLGA 5F1XA 3R1XA 3TSUA 4B9SA 4JKAA 3PIPL 3QMLA 3O3GA 3FZFA 4R5PA 3CFPA 1Q9XA 3WEEB 3OJUA 2W40A 3EL2A 4CZJA 1QVFM 3VEWA 3JS6A 5GAHP 2QI2A 1TUUA 5HRNA 4KHSA 4M42A 3HVRA 3S3OA 4KB1A 3QLHA 3H45C 3VEOA 4YHHK 5AJ3K 3V9WA 1SKRA 3B8AX 4EHUA 1SZ2A 2E2PA 3LM9A 1LWEA 4CD3A 3KIOA 3ULDA 3RR7A 1VQKN 2NRXA 3KD1E 4H0OA 5I42A 3KKSA 1P90A 2UXDK 3QO9A 1QZ6A 3F73A 3MN9A 3UKUA 3VQ6A 4B1XB 4BE1A 3OYMA 4DV2K 4ILJA 4F2SA 1LV5A 3G6EN 1YVUA 3VQ9A 3O80A 1W7AA 3L3VA 2ASOA 4DB3A 1QSYA 1ZBUA 3WT0A 2ASPA 1ZBLA 5KPRA 5AQTA 1X9SA 2E5LK 2NZTA 3VQAA 1VQ4N 4C8KA 3A5MC 1REVA 3U4LA 5AQQA 3K57A 4YOXA 1HNWK 1BDGA 1NJZA 4A57A 1KFSA 2YHBA 3U6FA 4BY9C 4Z4EA 2WUSA 4CEZA 3K9JA 5F2RA 3F9KA 2YCHA 1C0FA 1S5JA 3OS0A 4CK1A 1NGGA 2PY5A 5C12A 4OO1J 4QS9A 2NUBA 3RSEB 1LWFA 3WNGA 4DSIA 3CMAN 2D1KA 3O5BA 1FK9A 1S72N 3CQXA 3AGKA 2ZD1A 3DXKB 3HPHA 1RDCA 2FSJA 1ZBHA 4FK0A 3VTIA 2A6AA 3TSQA 2X78A 3C94A 4DQRA 2YJFA 3DAWA 4H5TA 2OTJN
chains in the Genus database with same CATH topology
3R6MA 3FLCO 3ZX0A 4JKGA 3CJAA 3UKRA 3CIPA 2ASMA 2NLXA 3WQTA 4F9OA 2FLOA 2RE2A 3WXJA 1K73O 2VGMA 3CPEA 3FGUA 3AAPA 4BGBA 4BR0A 3EO3A 3U9ZA 4R79A 2QXLA 4BR5A 3UE5A 1SQKA 3ENOA 3O08A 2V7ZA 1KD1O 3ID6A 1XC3A 2V51B 1QQNA 2QA4N 2YI1A 3L6QA 1VQ7N 3VENA 1RGIA 3QICA 3CCMN 5AQYA 3O9TA 2YHWA 1NGIA 1Q81O 3C7NB 3O9SA 4H0VB 2P9IA 5M1KA 5C15A 3F2KA 2E1YA 4PKGA 3CJ7A 4JD2B 5CR4A 4YOWA 3A5LC 4H0PA 4FPBA 1KAXA 4GV6A 1ILYA 4KH6A 4OPAA 4B1WB 5AFUA 1LOTB 3R3LA 1NGDA 4PKHA 4BRCA 3BUZB 3CETA 1YI2N 1VQON 3KWGA 3K9KA 1K8AO 3HTVA 4CZKA 2H3GX 3OBWA 3I8BA 3PIOL 3IKMA 5JMVA 4GV3A 1HJOA 2HF3A 4BR7A 2ZGZA 1VQMN 3SAHA 2ZWHA 3TU5A 4BG8A 3CCRN 1KAYA 5LJVA 2V7YA 4DHYA 5BN8A 4IOCL 1QQOA 4IWVA 5EVZA 3OBYA 3MN5A 1NMDA 4IO8A 4JAXA 4JN4A 3O1WA 4BRKA 5CE3A 3OHRA 2WC9A 1U6ZA 5M1PA 2QEXN 3CF5L 1LCUA 5AQIA 3CD6N 1YITN 1SS6A 3MMVA 1VAZA 3A5OC 4YDUA 2AP1A 1TUYA 3A8YA 4BVPA 4NLCA 1HKBA 3W0LA 1T44A 3BEXA 1DKGD 3SAFA 5AFUH 5KPZA 2FF3B 4B1YB 4WFBL 3H1VX 4LC9B 5ELZA 2F9TA 4PL7A 5AQNA 2I7NA 4I6MA 2OTLN 2YX6A 4FWQA 5AZIA 3CXCM 3VPZA 5TKYA 4JKHA 4BC4A 1VQ5N 2E2QA 3MCPA 3ZEUB 3CJBA 2P9NA 3TSPA 3ZYYX 2IVPA 3F5TA 4A59A 4B1UB 4BVOA 1NJIO 3AGRA 4JK9A 3GDQA 1MWKA 2FF6A 3VF4A 3TTFA 4WFNL 3HOSA 5TKWA 1S72N 4FWPA 1BA1A 4KBOA 3VERA 4RWTA 1YUWA 2A41A 1RDWX 2BUPA 3NVMA 2P9UB 4AM6A 1NGCA 1HUXA 5BPNA 4IZ9A 3CJ9A 3C6AA 5CHIA 1MWMA 3FZKA 3D2FB 4BRLA 4YOTA 4U7BA 1XUPO 3E9OA 5C2FA 5FPDA 1NGFA 4BC2A 2F7TA 4WFAL 3D2EA 5AQGA 2Q36A 3DLLL 4DQ8A 2A40A 1BU6O 5EOYA 3SMPA 4CBUA 3LDPA 5AQHA 3C7NA 3OW2M 3WXLA 3M6GA 3CJ1A 2HBJA 2HBLA 3G71N 4CJ7A 3EE8A 3C65A 4K42A 1ESVA 4WQ5A 3M1FA 3WUHA 3EZWA 3HI0A 2FSNA 4JKBA 1EQYA 3WEEA 5AZJA 5BRFA 3CCSN 4WCEL 3KWIA 4YORA 4O8KA 4FO0A 4AF1A 4Z94A 4XH1A 2QWRA 4BRMA 4BRAA 5DM7L 2F9WA 1QQMA 2NRRA 4FWOA 4JHDB 3LDNA 3MK6A 1Z6RA 3VMFB 4A2AA 3SMSA 2WBNA 1VQLN 3O9QA 4PKIA 5GINA 3VEZA 3HZ6A 4CZMA 4NLBA 1NGBA 4H5VA 5B8HA 3ATVA 5FPEA 2A42A 1HPMA 2P9LA 2KLAA 2GTDA 3DXMA 4CZIA 1K9MO 3ZETB 3JXUA 1YJ9N 1P8ZA 4C23A 3U9DA 1DEJA 3O9UA 3QDKA 5AQVA 4XH5A 3NMUA 3EKUA 2HMPA 2GELA 2HBKA 3O1BA 1O13A 5JLFA 4L3QA 5AQXA 3LL3A 3VEXA 3FZLA 4HWIA 1U2VB 3P39A 3WXKA 2Q97A 5EXWA 4BRDA 4C1NI 3VEVA 5AQLA 4BQZA 5ADXH 3FR0A 2Q2RA 1BG3A 1JCFA 3FE1A 4FWKA 1JJ2M 3G4SN 5LJWA 2E1ZA 2Q0UA 3L4QA 2GX9A 4FPAA 5GAGP 1QZ5A 3ZEUA 2EWSA 3H1QA 2V52B 1GLAG 3WQUA 2GUPA 4OPHA 5EY4A 1YAGA 3H3OB 5AQJA 3WXIA 2NRTA 3CMEN 2QWNA 3J8AA 3N4QA 4BRFA 2P9UA 1BOTO 1E4GT 2GEMA 4FWSA 3VF2A 4IOAL 4CBXA 4BC5A 3BF1A 3MN7A 2HF4A 3P38A 4JNEA 4RTFD 1J6ZA 1RDUA 5AQKA 1ZC6A 4CZHA 2ZF5O 1GLDG 2ZJRL 1K8KA 3ULEB 1Y64A 4B1VA 3CCLN 1S3XA 4KH5A 2QM1A 1HX1A 3ATUA 1KXPA 1DGKN 1MA9B 3AY9A 3MN6A 3LDOA 4FL9A 4WQ4A 3I56N 4XH4A 5BREA 3BP8A 2CGKA 5F1XA 4J8FA 1YIJN 3CCUN 4IFEA 4YOVA 3C6HA 3HOTA 4WQ4C 4RCHA 4A62A 1N8RO 3PLAA 3SBTA 2VWBA 3MCAB 4GVEA 1YJNN 1GLEG 2A3ZA 3M3ZA 1TYQA 4FWMA 4H5NA 3QB0A 3VOVA 4JK7A 3RVCA 1GLFO 2P9SB 5BN9A 3RSEA 5AQPA 3HSCA 1CZAN 4YDUC 4H0YB 3AAQA 4A2BA 4A5AA 3VGMA 2E20A 2P9PB 5E84A 3QBWA 2FSKA 3W3DA 1Q82O 3DXKA 4IDHA 3EE9A 1V4TA 1YVNA 2NRZA 3EN9A 3GG4A 2E2NA 2D0PA 1VQPN 1GLJO 2P9KB 2QWPA 5JVHL 3SJHA 3UKRB 3E9LA 5EX5A 3VGKA 4ILHA 4QS8A 2PAVA 3CC7N 1R59O 3M5RA 1U2VA 2Q1NA 1G99A 1VQNN 3R8EA 1ATRA 3H46O 5E26A 3MDQA 3ZX2A 2YJEA 2YHYA 4GY2B 2HSTA 4EAHD 1KC8O 4C1NK 2P9IB 4CZFA 4AM7A 4IXCA 1T3VA 5LY3A 2YHXA 1M90O 4BREA 3CHWA 3TPQA 4BG9A 1GLCG 2RHKA 4JD2A 4FVUA 4IEIA 3HBTA 4ISGA 4EIAA 2FXUA 4H5WA 4JKDA 3CPWM 1EO1A 2JWLA 2NRVA 3VGLA 3LDLA 1NLVA 1GLLO 3F9MA 4FWNA 2D0OA 4MDAA 4HTLA 3WXMB 4KH4A 5FPNA 1KAZA 3AARA 2NRHA 1NGJA 3P31A 2PBDA 3S41A 4WQ5C 3GBTA 2GWJA 3O4WA 3O9RA 3KHYA 5KPTA 1YXQA 2W41A 4FSVA 3ULEA 1Q7YO 3GE1A 3MX5A 1VQ9N 2HBMA 3TTDA 3CC4N 1IG8A 2D4WA 5HOOA 1QHAA 2I7PA 3A5NC 1BA0A 1NBWA 3LM2A 3VESA 4DCHA 4EHTA 4FOIA 2QTDA 2VYPA 3CCJN 1ZXOA 4PHTX 3QBXA 3SBGA 3UKUB 4PL8A 4O8UA 5HL7L 2CH5A 1E4FT 3G25A 3O8MA 4BR2A 3L4IA 4CZEA 5BPLA 5M1FA 3L0QA 3KVGA 3SAGA 4I6MB 2P9SA 4FWLA 5AQSA 3KZBA 5BPMA 5F0XA 5KQ8A 1NWKA 2P9NB 4GNIA 3DWLA 5BRDA 5C2DA 2NRWA 3Q7CA 2UYTA 4ISEA 3ZX3A 4BRIA 1C0GA 3IMXA 4XEIA 5I9EB 5H1SQ 3HM8A 1T6CA 2GWKA 1X3MA 3NVKA 1IJJA 4ILGB 1S22A 3VETA 4EFHA 4BR4A 2IVNA 3CC2N 2CGLA 1BO5O 4B9QA 2P9KA 4BQLA 1BWFO 4M63C 4K43A 4BROA 3CERA 4CZLA 2J4RA 4IJNA 2Q31A 3TTCA 4UY8O 4M7XA 3E9PA 5AQUA 4BGAA 3E1YA 1KQSM 2VGNA 3VEYA 5C0YA 4ISFA 2ITMA 3D2FA 5M1QA 1NM1A 3D2EB 3SK3A 4IJAA 2BH1A 4B1ZA 1HKCA 4YOUA 4FOEA 1DT9A 2QWMA 3I33A 1H1VA 1JCEA 2KHOA 3ENHA 3FFKB 4K41A 4BRNA 1V4SA 3I55N 2JWKA 3IFRA 4WYBA 3P4IA 2A5XA 3R1XA 2AA4A 3TSUA 4JKAA 1ATNA 2E8AA 1X9JA 3FZMA 4A5BA 3QMLA 3PIPL 3FZFA 3WEEB 1YJWN 4G9ZA 5AZJB 2BTFA 2VCPA 2W40A 2WFBA 3GOIA 3EL2A 4Y0WA 4MLEA 4CZJA 2QWLA 4MO5A 3VEWA 1QVFM 3VTHA 2Q0RA 3JS6A 4IEEA 5AR0A 5GAHP 1W2BM 2IVOA 3CJCA 2QI2A 1TUUA 3DJCA 5AQZA 3KK7A 1OKJA 4U67L 4IO9L 1NGEA 3CI5A 3QFUA 3C0BA 1RFQA 4JHDA 3E66A 3H45C 3VEOA 1HLUA 3N4PA 5MLCQ 1MDUB 3B8AX 1BUPA 2P9LB 1SZ2A 2E2PA 1X3NA 3DXMB 3LM9A 4EHUA 5KQDA 4CD3A 1W97L 1GLBG 1VQKN 2NRXA 3CCEN 2ZGYA 3VF6A 3ZETA 5GIOA 4JKGB 4JEPA 4H0OA 4YOYA 2OANA 4CZGA 2QW9A 1P90A 1M1KO 4CI6A 3A0IX 1QZ6A 3MN9A 1HKGA 3UKUA 2CGJA 4A61A 4B1XB 4JKFA 5AQFA 1Q86O 3UB5A 5AQMA 1QVGM 3LDQA 4JKCA 2HOEA 4ILJA 4JK8A 4NB4A 5AQWA 3GL1A 4MLHA 3G6EN 3OA9A 4H0TB 3O80A 2ZJQL 2E88A 3QFPA 4BRQA 1JCGA 5FPMA 3IDHA 3CCQN 4WF9L 4H5RA 4E1JA 2ASOA 4DB3A 4H03B 4BR9A 5GAEP 4M7YA 5BRHA 3WT0A 2ASPA 5KPRA 1D4XA 4MDBA 5AQTA 2ZJPL 3SLCA 2NZTA 2NNWA 1VQ4N 5AQRA 1Q18A 3A5MC 1ZBSA 3U4LA 4GV9A 5M1OA 3FZHA 4JKEA 3IUCA 1SAZA 2IIRA 2QWOA 5AQQA 4YOXA 1Z05A 3ID8A 3T69A 1ATSA 1WUAA 3Q7BA 1K8KB 1NGHA 4BRHA 1BDGA 3MX2A 4A57A 3MWPA 1T6DA 2QWQA 3ENBA 4BY9C 1VQ6N 2WUSA 2E2OA 3CQYA 3EKSA 3R9PA 2PFUA 4K25A 1YHQN 3O6WA 3K9JA 5F2RA 5M1NA 1XQSC 2KKZA 2YCHA 1C0FA 1NGGA 3T7ZA 5JLHA 3MWTA 4FWRA 4DKWA 5C12A 4QS9A 3U8XA 3CCVN 4OO1J 4CD1A 1TYQB 5ADXA 3HRGA 1WOQA 4BRGA 4O5FA 4CBWA 5BR9A 3RSEB 4BRPA 4BC3A 3CMAN 2D1KA 4H0XB 1NGAA 2DPNA 3O5BA 1YF5L 4IOXA 4NO7A 3CQXA 4MO4A 2CH6A 3AGKA 4QS7A 5AZIB 3DXKB 5JICA 5DM6L 3D7EO 5JVGL 2FSJA 3D6RA 3J7ZO 2P9PA 3VTIA 5AQOA 2A6AA 5C10A 3TSQA 5GADP 1OVYA 2YJFA 3DAWA 4H5TA 2OTJN 3H6EA 3BF3A 5GIPA 1VQ8N 3H3NO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWG A;  3KWI A;  3RVC A;  3P39 A;  3M5R A;  3P38 A;  3P31 A;  3O9R A;  3O9Q A;  3D6R A;  3L4Q A;  2GX9 A;  3EE9 A;  3O9T A;  3F5T A;  3OA9 A;  3O9S A;  4OPH A;  2KKZ A;  2RHK A;  3O9U A;  4OPA A;  3EE8 A; 
#chains in the Genus database with same CATH topology
 3R6M A;  3SPY A;  4LF5 K;  4CGH A;  3VQE A;  3CIP A;  3DLG A;  3V4I A;  2NLX A;  4F9O A;  2FLO A;  4E7I A;  3WXJ A;  1K73 O;  1E3M A;  3THY A;  4KTZ A;  2QXL A;  1SQK A;  3ENO A;  3O08 A;  1KD1 O;  3QNN A;  2YI1 A;  4DV4 K;  3CCM N;  3O9T A;  3C7N B;  5C15 A;  3THW A;  4PKG A;  1XC9 A;  3A5L C;  5FLX O;  1KAX A;  3U3G A;  4GV6 A;  4JI1 K;  4RW7 A;  1NGD A;  3BUZ B;  3WNF A;  3K9K A;  3HTV A;  1QTM A;  3OYD A;  1RBR A;  5JMV A;  1HYV A;  4BR7 A;  3THV A;  1VQM N;  3SAH A;  3CCR N;  3TU5 A;  5LJV A;  2BE2 A;  4IWV A;  1RT6 A;  4JN4 A;  3C6T A;  5CE3 A;  4FJX A;  5M1P A;  1VSK A;  4BE2 A;  3ISN C;  3MMV A;  1VAZ A;  4CER A;  3LP2 A;  2HHH K;  4BVP A;  1VSL A;  1IKX A;  3B6P A;  4AIL C;  3TI0 A;  3SAF A;  3G10 A;  3V9X A;  4B3O A;  3H1V X;  3VA3 A;  5AQN A;  3WNE A;  2YX6 A;  5TKY A;  4JKH A;  2E2Q A;  3PX4 A;  3G0Z A;  2W6L A;  2HHV A;  1B9D A;  3VF4 A;  4LF4 K;  4E7J A;  3K58 A;  2A41 A;  3LAL A;  3NVM A;  1HUX A;  3RMB A;  3SQ4 A;  4KHQ A;  1TV6 A;  4BRL A;  4FLX A;  4CJ5 A;  1RDD A;  5C2F A;  5FPD A;  3O3H A;  4BC2 A;  4F8R A;  2A40 A;  1TK0 A;  1J54 A;  2O8C B;  3LDP A;  5FRM A;  3OYN A;  3WXL A;  1BCO A;  3M6G A;  3CJ1 A;  3SUP A;  1C1C A;  4CJ7 A;  4E1N A;  3L2W A;  4CFA A;  4RW8 A;  1J53 A;  3HI0 A;  2FSN A;  4JKB A;  4NCB A;  5AZJ A;  4WCE L;  3LAM A;  4Z94 A;  3EZ5 A;  2HHU A;  4BRM A;  4BRA A;  5DM7 L;  2F9W A;  4FWO A;  4A2A A;  3V9Z A;  2OZS A;  3AA4 A;  3CM6 A;  4CFD A;  5GIN A;  1RTH A;  3V6D A;  1KVC A;  3L2V A;  2GUI A;  4CIF A;  4CZI A;  2GTD A;  4O5B A;  1T7P A;  4XH5 A;  2HMP A;  4KHN A;  1RTD A;  1RT5 A;  3CFO A;  3VEX A;  4HWI A;  2Q97 A;  3VEV A;  3KJV A;  4I7F A;  5ADX H;  4LF7 K;  4FWK A;  1JJ2 M;  1NOZ A;  4AH9 A;  4FXD A;  4CJK A;  5GAG P;  3ZEU A;  4BDP A;  3WQU A;  4CJ4 A;  5EY4 A;  3EEQ A;  3MEG A;  4CGF A;  1XHX A;  2VG6 A;  2QWN A;  4M3Y A;  1RIL A;  4FLY A;  1NKB A;  2IAJ A;  4BRF A;  1EWR A;  4CJE A;  1TAQ A;  2HMI A;  1VSD A;  3AA2 A;  4CBX A;  3AVJ A;  4H8K A;  3P38 A;  1FKP A;  1NKC A;  5AQK A;  1J6Z A;  1VRT A;  2ZF5 O;  4DLE A;  1WBB A;  2O8F B;  3ULE B;  1BCM A;  1BIU A;  4B1V A;  2QM1 A;  1ASV A;  4YNQ A;  1KXP A;  1NOY A;  3MN6 A;  3VQC A;  3AY9 A;  4XH4 A;  4J8F A;  4OKJ A;  4WQ4 C;  1N34 K;  3PLA A;  4H5N A;  2A3Z A;  4CJF A;  3NGY A;  1U49 A;  1GLF O;  3P5J A;  4RW4 A;  2UXB K;  4E1M A;  3HSC A;  4DR5 K;  3AAQ A;  4A2B A;  2HHW A;  5A2Q O;  4A5A A;  2E20 A;  2P9P B;  4F4K A;  4LSL A;  2FSK A;  2XHB A;  5DK5 A;  2Z1I A;  2NRZ A;  1YVN A;  1TKX A;  4M41 A;  4M3U A;  2E2N A;  3OS2 A;  2DY4 A;  2D0P A;  3AA5 X;  1VQP N;  4XIU A;  3SJH A;  3E9L A;  5EX5 A;  3VGK A;  4ILH A;  1R59 O;  3AVG A;  4NYF A;  2UUB K;  2RKI A;  4O0I A;  1N36 K;  3H46 O;  3IS9 A;  2O8D B;  4HHT A;  4E7K A;  1S9E A;  2VQF K;  4IXC A;  5CYM A;  1M90 O;  1HMV A;  3ZSZ A;  2O8B A;  3TPQ A;  4BG9 A;  1GOB A;  3M8P A;  1EO1 A;  3CPW M;  2FXU A;  3HYF A;  4PA1 A;  4AHC A;  2D0O A;  4MDA A;  2HNY A;  5FPN A;  3AAR A;  3S41 A;  1VSM A;  3GBT A;  1YXQ A;  1X9M A;  3GE1 A;  5E41 A;  2HBM A;  4GKJ K;  1W9H A;  4LY7 A;  5HOO A;  3HP6 A;  4CJL A;  1IBL K;  1BA0 A;  3TAQ A;  3ZCM A;  4DTP A;  3VES A;  5SZT A;  3AO2 A;  4EHT A;  4FOI A;  2XO7 A;  1ZXO A;  4PHT X;  3BDP A;  3SBG A;  4B9T A;  5HRS A;  5HL7 L;  4BR2 A;  5M1F A;  3L0Q A;  4IKF A;  3SAG A;  3VQ7 A;  2P9S A;  3AVL A;  5F0X A;  1NWK A;  4FLU A;  1TGO A;  3Q7C A;  2UYT A;  3ZX3 A;  4BRI A;  1T6C A;  4CGJ A;  4ILG B;  4DQS A;  4EFH A;  1C0M A;  2P9K A;  3DOL A;  3VQB A;  2D0A A;  1JKH A;  2Q31 A;  4M7X A;  1KQS M;  5DMR A;  4NXN K;  3VEY A;  1KFD A;  4FZX C;  1T03 A;  1HKC A;  3TWH A;  4YOU A;  1BI4 A;  4FOE A;  4LF9 K;  3NF8 A;  3ENH A;  2QKK A;  3VA0 A;  1V4S A;  5FRN A;  2F8S A;  1NK0 A;  4WYB A;  1KLM A;  2AA4 A;  1ATN A;  2IDO A;  1CLQ A;  1VSI A;  4DTR A;  2F8T A;  2VCP A;  2WFB A;  4I9Q A;  5HRP A;  2Q0R A;  5AR0 A;  4OLB A;  1W2B M;  5AQZ A;  4IO9 L;  2JGU A;  3CI5 A;  4JHD A;  3E66 A;  2XY8 A;  1MU2 A;  3N4P A;  1MDU B;  2P9L B;  1X3N A;  3DXM B;  2Y1I A;  1GLB G;  2P5O A;  4CJV A;  2BGG A;  4CJS A;  2O4G A;  4EP5 A;  4FZZ A;  3ZET A;  4JKG B;  4YOY A;  2OAN A;  2QW9 A;  4CI6 A;  4CJT A;  2FBT A;  2E6L A;  4X65 K;  4JKF A;  5AQF A;  3UB5 A;  5AQM A;  1QVG M;  3LDQ A;  4JKC A;  3OYB A;  3OTO K;  1TKT A;  3MXI A;  4JK8 A;  5AQW A;  1ITG A;  4OKK A;  1FKO A;  2E88 A;  3QFP A;  3KK2 A;  3SCX A;  5HLF A;  5FPM A;  3DLB A;  4WF9 L;  4E1J A;  4H03 B;  5GAE P;  4M7Y A;  4MFB A;  5BRH A;  1D4X A;  1B92 A;  3KK3 A;  4KTW A;  2UUA K;  4Z4I A;  1KVB A;  1ZBS A;  5HRO A;  4GV9 A;  3RMC A;  3FZH A;  3IUC A;  2QWO A;  1Z05 A;  3ID8 A;  3T69 A;  3Q7B A;  1WUA A;  1JLE A;  1K8K B;  1QQC A;  1NMN A;  1T6D A;  2QWQ A;  5LL6 Z;  2LSN A;  2PFU A;  5M1N A;  3EY1 A;  2EX3 A;  3SQ0 A;  2AJQ A;  4CFB A;  1HRH A;  4FWR A;  3CCV N;  1RBU A;  1TYQ B;  3HRG A;  4BRG A;  4DF4 A;  3SQ2 A;  4O5F A;  4KO0 A;  1RBS A;  4BC3 A;  3LZJ A;  2KW4 A;  4DU4 A;  1JLC A;  1S1W A;  4H0X B;  3S9H A;  5AZI B;  4NO7 A;  3O4N A;  3CG7 A;  2CH6 A;  5JIC A;  5DM6 L;  3ALY A;  1KRP A;  2OPP A;  3VQQ A;  5GAD P;  4CCH A;  1ASW A;  3L4I A;  3BF3 A;  4CEC A;  3ZX0 A;  4O44 A;  3UKR A;  3SYZ A;  1JLF A;  2YNF A;  3WQT A;  4Q0B A;  2VGM A;  3CPE A;  3FGU A;  3AAP A;  4DG1 A;  5SWM A;  3UE5 A;  1RT3 A;  2IOC A;  1XC3 A;  2QA4 N;  1VQ7 N;  4HCB A;  3VEN A;  1RGI A;  1BL3 A;  2YHW A;  4E3S A;  4X64 K;  3T1Y K;  1Q81 O;  3O9S A;  2P9I A;  5M1K A;  4IG3 A;  4KRE A;  2E1Y A;  4DUY K;  1U04 A;  4ELV A;  4FPB A;  1ILY A;  5AFU A;  3R3L A;  4BRC A;  3CET A;  1YI2 N;  3HP9 A;  4GKK K;  4CZK A;  3DI6 A;  2H3G X;  2G8F A;  2OZM A;  2QK9 A;  3I8B A;  3PIO L;  3IKM A;  1HJO A;  2HF3 A;  4DTM A;  1RT4 A;  1KAY A;  2ETJ A;  3VN5 A;  4DHY A;  5BN8 A;  4IOC L;  1QQO A;  4HTU A;  1JL1 A;  3DM2 A;  3EYZ A;  3MN5 A;  1NMD A;  4IO8 A;  2OPQ A;  4JAX A;  4BRK A;  1RT2 A;  3OYF A;  1CZ9 A;  1CXQ A;  1D9D A;  1T05 A;  3CD6 N;  4ELT A;  1SS6 A;  2VWJ A;  1HYS A;  3A5O C;  3T1H K;  1TUY A;  3A8Y A;  2OPS A;  4Y1C A;  2KFZ A;  3NHG A;  2Z1G A;  3BEX A;  1CXU A;  1WSE A;  3THX A;  3KTQ A;  4C8O A;  1SL2 A;  2F9T A;  4DFK A;  4M3R A;  4I6M A;  1S1X A;  1ASU A;  1VQ5 N;  1W0H A;  3CJB A;  2P9N A;  2IVP A;  3F5T A;  4B1U B;  2DFH A;  3AGR A;  3GDQ A;  2D5R A;  3VER A;  4Z4G A;  1YUW A;  2BUP A;  4CIG A;  5LMU K;  3AO4 A;  3C6A A;  1MWM A;  3FZK A;  3HL8 A;  3SUQ A;  4U7B A;  1XUP O;  4CHY A;  5FDL A;  2F7T A;  3RTV A;  2RF2 A;  3KLE A;  3D2E A;  4DQ8 A;  5EOY A;  1U47 A;  5AQH A;  4PQU A;  3C7N A;  2ITG A;  3CM5 A;  4B9U A;  3OYI A;  3J80 O;  3HJF A;  3EE8 A;  3C65 A;  1J9A A;  4K42 A;  4WQ5 A;  3EZW A;  2RN2 A;  3OYJ A;  1EQY A;  4CF0 A;  1I94 K;  4O8K A;  2QWR A;  3LDN A;  1Z6R A;  2YHA A;  1FW6 A;  1JLQ A;  3SMS A;  2WBN A;  1VQL N;  3O9Q A;  2A1S A;  1LAW A;  3VEZ A;  2D0B A;  5T7B A;  3SI6 A;  1XI1 A;  3OYL A;  4CZM A;  4NLB A;  4H5V A;  3ATV A;  5FPE A;  4CJQ A;  2A42 A;  3AVI A;  1HPM A;  1XMO K;  1K9M O;  4ID1 A;  1P8Z A;  3O9U A;  3QDK A;  1NK5 A;  3T3F A;  3CFR A;  1O13 A;  3HM9 A;  5AQX A;  4BQZ A;  5LMN K;  4E89 A;  4DQP A;  1JCF A;  3VQ5 A;  4FM0 A;  3RMD A;  4N56 A;  5LJW A;  3AVA A;  1VK0 A;  2Q0U A;  4OX9 K;  3I0S A;  2EWS A;  2GUP A;  3ZSV A;  4DF8 A;  3ASM A;  4CJW A;  3J8A A;  1A5V A;  3AVC A;  4N41 A;  4OGE A;  4FJI A;  3VF2 A;  3BZK A;  1RT7 A;  2Y1J A;  4IOA L;  3BF1 A;  1GOA A;  4JNE A;  2YNG A;  2KTQ A;  4ZTJ A;  4CZH A;  2D0C A;  1GLD G;  1D5A A;  3DRP A;  4BAC A;  1S3X A;  4DS5 A;  1HX1 A;  4DU3 A;  1XNQ K;  1MA9 B;  4WQ4 A;  4FL9 A;  3I56 N;  4DSF A;  4DU1 A;  3TR8 A;  3QNO A;  1X1P A;  2O8C A;  1WSI A;  5BRE A;  3BP8 A;  2CGK A;  4DTU A;  4KHU A;  1YIJ N;  4IFE A;  1UWB A;  4RCH A;  3RMA A;  1XNR K;  3SBT A;  3MCA B;  1YJN N;  1GLE G;  1C1A A;  3RVC A;  4E7L A;  5BN9 A;  4FM1 A;  1JLA A;  3LWL A;  4JLH A;  1HQU A;  1EWQ A;  3OYE A;  3EE9 A;  2IGI A;  3GG4 A;  2F96 A;  5HP1 A;  1OH5 A;  2B4J A;  2QWP A;  5JVH L;  4JI3 K;  1EP4 A;  4LD0 A;  2PAV A;  3K0S A;  3HO1 A;  3CC7 N;  4DV7 K;  3M5R A;  4DMN A;  1U45 A;  4OPJ A;  3R8E A;  4NCA A;  1ATR A;  4FK4 A;  3D45 A;  4AHS A;  2YJE A;  4EAH D;  3CYM A;  3THW B;  4J2D A;  1XHZ A;  1NU0 A;  1T3V A;  3LAK A;  5D3G A;  1GLC G;  4JD2 A;  4FJN A;  4KHY A;  3HBT A;  5C42 A;  4H5W A;  2GV9 A;  3AA3 A;  3VGL A;  4GMJ B;  3LDL A;  3NDK A;  3F9M A;  4FWN A;  1HYZ A;  5I3U A;  4KH4 A;  1KAZ A;  3P31 A;  1IO2 A;  4WQ5 C;  5KPT A;  3LPU A;  3O9R A;  3ZT4 A;  1J5E K;  4DFM A;  3QEW A;  2O8F A;  1FXX A;  3QIO A;  4FSV A;  3ULE A;  4W5Q A;  1VSE A;  4JI5 K;  1IG8 A;  1QHA A;  2I7P A;  1JXB A;  2YNI A;  1O1W A;  2VYP A;  1YT3 A;  3SNN A;  1UAX A;  3NCI A;  3KVG A;  4FWL A;  2QKB A;  2I5J A;  4CJR A;  4N76 A;  3ZSX A;  4GNI A;  2VWK A;  5J1E A;  2KFN A;  1HR0 K;  2FBX A;  4YFU A;  4W5R A;  4O0J A;  1R0A A;  2GWK A;  3NVK A;  1IJJ A;  3MXM A;  1XMQ K;  3RR8 A;  4IG0 A;  4BR4 A;  2IVN A;  2CGL A;  1BO5 O;  4B9Q A;  2P5G A;  4J2E A;  3S3N A;  4M63 C;  1IBK K;  4K43 A;  2X6S A;  4BRO A;  4CZL A;  3LPT A;  5AQU A;  3E1Y A;  4OVL A;  1ZBF A;  2DTU A;  5C0Y A;  1XWL A;  2W42 A;  2YNH A;  3V1R A;  3D2F A;  1A5X A;  3DLR A;  3SK3 A;  2G8K A;  3HT3 A;  4JI4 K;  2BH1 A;  3I33 A;  1JCE A;  4UQG A;  2O8D A;  4BDY A;  4K41 A;  4BRN A;  3QIP A;  3IFR A;  3P4I A;  5GIP A;  1WAJ A;  2HB5 A;  2E8A A;  1BQN A;  1YTA A;  3FZM A;  4A5B A;  3PO5 A;  3PSI A;  3AV9 A;  1RNH A;  4Z4H A;  4G9Z A;  5AZJ B;  2BTF A;  3MEE A;  2O8E B;  3NF9 A;  4B9V A;  3PX0 A;  3PX6 A;  1HNV A;  3K5L A;  4MLE A;  4CHP A;  2QWL A;  4MO5 A;  3VTH A;  1WSH A;  4KTQ A;  3CJC A;  3L2U A;  4DWI A;  1QS4 A;  3DJC A;  2HVH A;  1OKJ A;  4DTN A;  1NGE A;  1JLG A;  3QFU A;  3C0B A;  3DLE A;  4FM2 A;  4JRQ A;  5MLC Q;  1BUP A;  1VSF A;  4FVM A;  3KLF A;  4E0D A;  3CCE N;  3VF6 A;  4DR7 K;  2KZM A;  3ZSW A;  4CZG A;  3LAN A;  3L2Q A;  1M1K O;  3A0I X;  2G8U A;  3SQ1 A;  2CGJ A;  3D0P A;  5BR8 K;  1Q86 O;  4I2Q A;  4KFB A;  2HOE A;  4Z0U A;  5KRT A;  2VG7 A;  3KLG A;  4PY5 A;  4NB4 A;  1NJY A;  4L8R B;  4H0T B;  3DRS A;  3DMJ A;  4E7H A;  3IDH A;  3CCQ N;  3TAP A;  2G8H A;  3J7A P;  4BR9 A;  1L3U A;  4MDB A;  2ZJP L;  2HHT A;  3SLC A;  2F4V K;  2NNW A;  1Q18 A;  4CJP A;  4JKE A;  4FJL A;  1SAZ A;  4HUF A;  1OH8 A;  3ENB A;  1LW0 A;  3R9P A;  2A1R A;  3O6W A;  3RWU A;  1JXE A;  2ZQB A;  3NE6 A;  3TAF A;  3T7Z A;  5JLH A;  4J2A A;  3MWT A;  4DKW A;  1QSS A;  4CD1 A;  5ADX A;  3LP0 A;  4CBW A;  4BWJ A;  4BRP A;  3NF6 A;  2Z1J A;  1WB9 A;  2KQ2 A;  1NJW A;  1T8E A;  1C0U A;  3IG1 A;  4B9M A;  3E01 A;  3D6R A;  3J7Z O;  3MAQ A;  4B08 A;  1HNZ K;  1VQ8 N;  2VQE K;  3AVK A;  4CEO A;  4JKG A;  1CZB A;  3CJA A;  2P1J A;  3LP3 A;  2RE2 A;  3OJS A;  4BGB A;  1TVR A;  1EET A;  3EO3 A;  4BR0 A;  4R79 A;  4BR5 A;  1I39 A;  3ZSQ A;  2V7Z A;  1EX4 A;  3ID6 A;  4FJ5 A;  4ID5 A;  4FJ9 A;  1WSG A;  3L6Q A;  1TL1 A;  3QIC A;  1WAF A;  2HHS A;  3CJ7 A;  5CR4 A;  3PSF A;  4M3T A;  4H0P A;  4KH6 A;  4OPA A;  4B1W B;  1DTT A;  1LOT B;  4PKH A;  2P51 A;  4CE9 A;  4DR1 K;  4LF8 K;  4YY3 K;  1EKE A;  2ZGZ A;  4ICL A;  4KRF A;  2V7Y A;  2HNZ A;  4FLV A;  1BGX T;  5EVZ A;  3O1W A;  3OHR A;  3M8S A;  2WC9 A;  1U6Z A;  2QEX N;  3ZSY A;  3CF5 L;  2HVI A;  3H08 A;  4AQY K;  3JYT A;  1YIT N;  4DQQ A;  1FJG K;  5FRO A;  2ZM6 K;  2AP1 A;  1UA1 A;  4H4M A;  1LAV A;  4NLC A;  4DFJ A;  4KPY A;  4DR4 K;  1T44 A;  5AFU H;  1VSH A;  5KPZ A;  2FF3 B;  4WFB L;  4LC9 B;  1C1B A;  2I7N A;  4FWQ A;  5AZI A;  3VPZ A;  4BC4 A;  2XRI A;  1G15 A;  1IKY A;  3MCP A;  3TSP A;  2G8V A;  4A59 A;  1UA0 A;  4BVO A;  3TAB A;  4JK9 A;  1S6P A;  3QIN A;  4QAG A;  5HRR A;  4WFN L;  4DV1 K;  2O4I A;  4FWP A;  4K0K K;  4RWT A;  2P9U B;  4AM6 A;  4IZ9 A;  3CJ9 A;  1S1U A;  5CHI A;  1BIZ A;  1NK4 A;  2YV0 X;  1RTJ A;  3E9O A;  3O3F A;  1BI4 B;  4WFA L;  4CEE A;  5AQG A;  2Q36 A;  3IAY A;  3SMP A;  3JSM A;  3OW2 M;  3QEI A;  1K6Y A;  2HBL A;  1Q9Y A;  4CGI A;  4CF2 A;  1ESV A;  4E19 A;  3WEE A;  1OVQ A;  3KLH A;  2X74 A;  1QQM A;  4JHD B;  4C8N A;  3VMF B;  4GVM A;  4DTX A;  2QXF A;  4HCC A;  3V1O A;  3HZ6 A;  4C8M A;  1NGB A;  1Y97 A;  3DYA A;  3NFA A;  2KLA A;  3ZET B;  4G1Q A;  4C23 A;  3U9D A;  2G8W A;  5AQV A;  4X62 K;  3EKU A;  3NAE A;  2GEL A;  5JLF A;  3LWM A;  3OYC A;  3LL3 A;  3BZC A;  1U2V B;  3WXK A;  4BRD A;  5AQL A;  2Q2R A;  1ZBI A;  4FJJ A;  1Q8I A;  2E1Z A;  2KZZ A;  3LP1 A;  5KGW A;  2GX9 A;  1QZ5 A;  2EHG A;  3H1Q A;  2V52 B;  4DUZ K;  4OPH A;  3HPO A;  3H3O B;  5AQJ A;  3WXI A;  3U3Y A;  1NK6 A;  2NRT A;  4KKO A;  3J81 O;  5CZ2 A;  3N4Q A;  4B3S K;  3SUN A;  1E4G T;  4FWS A;  3AVN A;  2BDP A;  3MN7 A;  2HF4 A;  4FJH A;  3TAR A;  2YKN A;  3HPG A;  2ZJR L;  1HJR A;  1J5O A;  1Y64 A;  3CCL N;  1TKZ A;  4KI6 A;  1JLB A;  4OGC A;  1DGK N;  3J7Y P;  3LDO A;  1SKS A;  2B5J A;  2YKM A;  4OKE A;  1YTU A;  3CCU N;  3SV4 A;  3C6H A;  1TK8 A;  5KRS A;  3ZT0 A;  4GVE A;  4JI2 K;  4FWM A;  3QB0 A;  3DLK A;  4JK7 A;  4LH4 A;  3RSE A;  3QEV A;  5J2M A;  3P83 D;  4H0Y B;  3K5M A;  1QE1 A;  4CF9 A;  3AO1 A;  1Q82 O;  3DXK A;  4IDH A;  4X66 K;  1RDB A;  3S3M A;  1GLJ O;  3UKR B;  1KCF A;  1WSF A;  4QS8 A;  1UOC A;  3NGZ A;  1OH6 A;  4JYA K;  4PUO A;  4NXM K;  1G99 A;  5E26 A;  4GY2 B;  2HST A;  1KC8 O;  4DSE A;  4C1N K;  2P9I B;  4F3O A;  4CEA A;  4CED A;  1EXQ A;  2YHX A;  1L3T A;  4BRE A;  3CHW A;  4DTS A;  4ZHR A;  4IEI A;  4ISG A;  4EIA A;  4MQ3 A;  1NLV A;  4LSN A;  1GLL O;  4BE0 A;  2DFF A;  2WTU A;  3M8R A;  1NGJ A;  5CZ1 A;  3KHY A;  2W41 A;  3UIQ A;  2JLE A;  3CC4 N;  1C0T A;  1NBW A;  3LM2 A;  2X6N A;  5KI6 A;  4DS4 A;  3SV3 A;  3THX B;  3QBX A;  3UKU B;  4PL8 A;  4O8U A;  2CH5 A;  3AVM A;  3O8M A;  4CZE A;  5BPL A;  3VQD A;  4I6M B;  3TAM A;  3KZB A;  5BPM A;  1JL2 A;  5KQ8 A;  4O55 A;  2HHQ A;  2P9N B;  3DWL A;  2NRW A;  2PYL A;  1SV5 A;  1C0G A;  3IMX A;  4XEI A;  5I9E B;  3MED A;  4LH5 A;  2UXC K;  1S22 A;  3VET A;  4J2B A;  2WOM A;  3CC2 N;  1NKE A;  1BWF O;  4DR3 K;  4DV0 K;  2E4L A;  3TTC A;  1GOC A;  4DR6 K;  1NK9 A;  3O4Q A;  4BGA A;  3KKR A;  2VGN A;  3KD5 E;  5HBM A;  4OJR A;  3P1G A;  3DRR A;  5M1Q A;  1NM1 A;  3D2E B;  3IRX A;  4IJA A;  4RW9 A;  1DT9 A;  1H1V A;  2KHO A;  2PYJ A;  3FFK B;  3QER A;  4OLA A;  1N33 K;  1SUQ A;  2A5X A;  1X9J A;  5CYQ A;  3SUO A;  1YJW N;  4DTJ A;  3GOI A;  2G8I A;  4Y0W A;  3V1Q A;  3TAG A;  3C95 A;  4IEE A;  3OYK A;  5K14 A;  2IVO A;  4FYD A;  3KK7 A;  4U67 L;  3V9U A;  1IV0 A;  1WN7 A;  1RFQ A;  1HLU A;  4O4G A;  3OYG A;  3DOK A;  3T19 A;  4KHP K;  1A5W A;  5KQD A;  4DV6 K;  1W97 L;  4KB0 A;  2ZGY A;  5GIO A;  4JEP A;  2W6K A;  4TSX A;  1HKG A;  5JS2 A;  4A61 A;  4Z4C A;  3THY B;  4FLZ A;  2RPI A;  1NNE A;  4HUE A;  3MXJ A;  3GL1 A;  4MLH A;  3OA9 A;  2ZJQ L;  4BRQ A;  1JCG A;  4DV3 K;  4C8L A;  4H5R A;  5EU7 A;  5AQR A;  1HNX K;  2OYQ A;  3CQ8 A;  4N5S A;  3OYH A;  5M1O A;  4KAZ A;  1IH7 A;  2IIR A;  4QOZ B;  1ATS A;  1NGH A;  4BRH A;  3NGI A;  3MX2 A;  1SKW A;  3I0R A;  3MWP A;  1VQ6 N;  2E2O A;  3CQY A;  3EKS A;  3K59 A;  4DR2 K;  3HVT A;  4K25 A;  1YHQ N;  3ZT3 A;  1XQS C;  2KKZ A;  4IFY A;  3U8X A;  4DV5 K;  4JS5 A;  1WOQ A;  4QCL A;  2O8E A;  5BR9 A;  3L3U A;  4FJM A;  4CEQ A;  1S1V A;  4JI8 K;  1Z26 A;  1NGA A;  2DPN A;  3B6O A;  1YF5 L;  4QS7 A;  4IOX A;  4MO4 A;  5JVG L;  1L5U A;  3D7E O;  1D9F A;  2XY7 A;  2DFE A;  2P9P A;  5AQO A;  5C10 A;  3SZ2 A;  3K2P A;  1QHT A;  3OYA A;  1OVY A;  1IKW A;  1OH7 A;  2IC3 A;  3H6E A;  3P39 A;  4RG8 A;  4CJU A;  3H3N O;  3WNH A;  3FLC O;  2ASM A;  1C6V A;  4CF8 A;  3U9Z A;  3TAE A;  3RRH A;  2V51 B;  1QQN A;  4WE1 A;  5AQY A;  4AHR A;  1NGI A;  3NBP A;  4CHQ A;  3OY9 A;  4H0V B;  3F2K A;  1N32 K;  4JD2 B;  4AHU A;  4YOW A;  4ZTF A;  1LWC A;  4I2P A;  2E6M A;  4K8X A;  1VQO N;  3KWG A;  1WSJ A;  4B3R K;  1BIS A;  3OBW A;  4ELU A;  4GV3 A;  2ZWH A;  4BG8 A;  3AVB A;  4AHV A;  1RBV A;  3OBY A;  1TKD A;  3KK1 A;  5J2N A;  1LCU A;  5AQI A;  1TL3 A;  3QES A;  1N6Q A;  4B8C A;  4YDU A;  3M8Q A;  1HKB A;  3W0L A;  1DKG D;  3ITH A;  1VHX A;  5C25 A;  4B1Y B;  5ELZ A;  4PL7 A;  2HW3 A;  3MEC A;  2OTL N;  3FFI A;  4F3T A;  3CXC M;  3V9S A;  1RT1 A;  4IFV A;  4FJ8 A;  1S1T A;  2FC0 A;  3ZEU B;  1IBM K;  3ZYY X;  1NK7 A;  1NJI O;  4GW6 A;  3NH1 A;  4Y1D A;  1MWK A;  2FF6 A;  3TTF A;  3HOS A;  4HVJ A;  5TKW A;  3ZSR A;  1BA1 A;  4KBO A;  1RDW X;  1NGC A;  5BPN A;  1NJX A;  3NH2 A;  3SJJ A;  1BQM A;  4B9N A;  1SL0 A;  3D2F B;  4CVN E;  4YOT A;  4W5N A;  4LFC K;  1RBT A;  4V19 S;  4N47 A;  1NGF A;  1IKV A;  4AHT A;  4CFC A;  1HQE A;  1L3V A;  2BAN A;  3C6U A;  3QET A;  4CHO A;  3DLL L;  4JI7 K;  4DTO A;  1BU6 O;  1F21 A;  4CBU A;  3PO4 A;  4DQI A;  4DFP A;  4KV8 A;  3ZT2 A;  4K8Z A;  2HBJ A;  3G71 N;  2OA8 A;  4CK2 A;  1NK8 A;  2PZS A;  3WUH A;  4DSL A;  3M1F A;  4CGG A;  3CCS N;  1WBD A;  4JI6 K;  5BRF A;  3KWI A;  4YOR A;  4FO0 A;  4AF1 A;  4JRP A;  4XH1 A;  4F2R A;  4BDZ A;  4M3Z A;  1NG9 A;  2NRR A;  3MK6 A;  2OCE A;  3AO3 A;  4CJ3 A;  2UU9 K;  4PKI A;  3VQ8 A;  5B8H A;  4CHZ A;  4DSK A;  4FCY A;  2XY6 A;  2P9L A;  4B9L A;  3DXM A;  4LFA K;  3JXU A;  1YJ9 N;  3RRG A;  1DEJ A;  4FLW A;  3NMU A;  4DSJ A;  4JS4 A;  2HBK A;  3O1B A;  3DLH A;  4EZ6 A;  3ZSO A;  4L3Q A;  4CGD A;  3L8B A;  3FZL A;  2FBY A;  5EXW A;  5KGX A;  4C1N I;  1TAU A;  3FR0 A;  1BG3 A;  3FE1 A;  3L2R A;  5C24 A;  3G4S N;  3HST B;  4CW7 B;  3L4Q A;  4FPA A;  5IWA K;  4BWM A;  1GLA G;  2O8B B;  5CY4 A;  1YAG A;  4M3X A;  3CME N;  1I3A A;  1VSJ A;  3SPZ A;  1Z25 A;  2P9U A;  1BOT O;  4KI4 A;  2GEM A;  1X9W A;  4BC5 A;  4RTF D;  4LFB K;  1RDU A;  1ZC6 A;  1B9F A;  3PY8 A;  1K8K A;  4KH5 A;  4W5T A;  1IG9 A;  4M45 A;  3AVH A;  3ATU A;  1L3S A;  3AO5 A;  4NCG A;  2Z1H A;  3HXM A;  3JAM O;  2ZE2 A;  3A2F A;  4FW2 A;  4YOV A;  4Q5V A;  3HOT A;  4OPK A;  4FJG A;  4A62 A;  4CEB A;  1N8R O;  3QEP A;  2VWB A;  1K8A O;  1DTQ A;  3M3Z A;  1TYQ A;  3VOV A;  3BY5 A;  3OS1 A;  1TK5 A;  3PV8 A;  1RTI A;  2P9S B;  1KSP A;  1HPZ A;  1KLN A;  5AQP A;  3ZLJ A;  1CZA N;  4YDU C;  3V81 A;  4EP4 A;  4EZ9 A;  5J2Q A;  3VGM A;  4NYN A;  5E84 A;  3QBW A;  5IT9 O;  3BGR A;  3W3D A;  4FLT A;  2GBZ A;  1V4T A;  3EN9 A;  4FZY A;  3OVN A;  4CEF A;  1U4B A;  4JI0 K;  4FW1 A;  4CIE A;  2P9K B;  4W5O A;  3LZI A;  2XY5 A;  4JV5 K;  2ATQ A;  1QSL A;  3T1A A;  2Q3S A;  4HUG A;  1RDA A;  1BHL A;  4CF1 A;  1U2V A;  2Q1N A;  2FBV A;  1VQN N;  4B3M K;  3MDQ A;  3ZX2 A;  2YHY A;  1RCH A;  1KVA A;  3ZT1 A;  4CZF A;  1ZYQ A;  2UUC K;  2HND A;  4AM7 A;  5LY3 A;  3K5O A;  2RHK A;  4FVU A;  4JKD A;  2JWL A;  2NRV A;  5JS1 A;  4HTL A;  3WXM B;  4CES A;  3AVF A;  4RW6 A;  2NRH A;  2OPR A;  4KHW A;  2PBD A;  1S6Q A;  2GWJ A;  3O4W A;  1U48 A;  1Q7Y O;  3MX5 A;  1D8Y A;  1DLO A;  2HHX A;  1VQ9 N;  3TTD A;  4B3T K;  2D4W A;  3HK2 A;  4IDK A;  3PUF A;  3A5N C;  1HNI A;  1WLJ A;  4H4O A;  4DCH A;  4FK2 A;  2QTD A;  3CCJ N;  3I8D A;  3LDS A;  4CK3 A;  1S9G A;  1E4F T;  3G25 A;  3TAN A;  2WON A;  5AQS A;  3KLI A;  5BRD A;  5C2D A;  1VRU A;  4ISE A;  4Z4F A;  5H1S Q;  1WNS A;  3HM8 A;  1N5Y A;  1X3M A;  4FJK A;  2IS3 A;  3QEX A;  4PWD A;  1SL1 A;  4BQL A;  4FJ7 A;  3CER A;  2B6A A;  2J4R A;  5KTQ A;  4IJN A;  4B8A B;  2R7Y A;  3NH0 A;  4UY8 O;  3E9P A;  2VG5 A;  4ISF A;  2ITM A;  4I9L A;  4LF6 K;  3NF7 A;  3VQP A;  4M3W A;  4IBN A;  1LW2 A;  4CHN A;  4B1Z A;  5J2P A;  2QWM A;  3VQ4 A;  1KTQ A;  2JWK A;  3I55 N;  3K5N A;  4DLG A;  5F1X A;  3R1X A;  3TSU A;  4B9S A;  4JKA A;  3PIP L;  3QML A;  3O3G A;  3FZF A;  4R5P A;  3CFP A;  1Q9X A;  3WEE B;  3OJU A;  2W40 A;  3EL2 A;  4CZJ A;  1QVF M;  3VEW A;  3JS6 A;  5GAH P;  2QI2 A;  1TUU A;  5HRN A;  4KHS A;  4M42 A;  3HVR A;  3S3O A;  4KB1 A;  3QLH A;  3H45 C;  3VEO A;  4YHH K;  5AJ3 K;  3V9W A;  1SKR A;  3B8A X;  4EHU A;  1SZ2 A;  2E2P A;  3LM9 A;  1LWE A;  4CD3 A;  3KIO A;  3ULD A;  3RR7 A;  1VQK N;  2NRX A;  3KD1 E;  4H0O A;  5I42 A;  3KKS A;  1P90 A;  2UXD K;  3QO9 A;  1QZ6 A;  3F73 A;  3MN9 A;  3UKU A;  3VQ6 A;  4B1X B;  4BE1 A;  3OYM A;  4DV2 K;  4ILJ A;  4F2S A;  1LV5 A;  3G6E N;  1YVU A;  3VQ9 A;  3O80 A;  1W7A A;  3L3V A;  2ASO A;  4DB3 A;  1QSY A;  1ZBU A;  3WT0 A;  2ASP A;  1ZBL A;  5KPR A;  5AQT A;  1X9S A;  2E5L K;  2NZT A;  3VQA A;  1VQ4 N;  4C8K A;  3A5M C;  1REV A;  3U4L A;  5AQQ A;  3K57 A;  4YOX A;  1HNW K;  1BDG A;  1NJZ A;  4A57 A;  1KFS A;  2YHB A;  3U6F A;  4BY9 C;  4Z4E A;  2WUS A;  4CEZ A;  3K9J A;  5F2R A;  3F9K A;  2YCH A;  1C0F A;  1S5J A;  3OS0 A;  4CK1 A;  1NGG A;  2PY5 A;  5C12 A;  4OO1 J;  4QS9 A;  2NUB A;  3RSE B;  1LWF A;  3WNG A;  4DSI A;  3CMA N;  2D1K A;  3O5B A;  1FK9 A;  1S72 N;  3CQX A;  3AGK A;  2ZD1 A;  3DXK B;  3HPH A;  1RDC A;  2FSJ A;  1ZBH A;  4FK0 A;  3VTI A;  2A6A A;  3TSQ A;  2X78 A;  3C94 A;  4DQR A;  2YJF A;  3DAW A;  4H5T A;  2OTJ N; 
#chains in the Genus database with same CATH homology
 3R6M A;  3FLC O;  3ZX0 A;  4JKG A;  3CJA A;  3UKR A;  3CIP A;  2ASM A;  2NLX A;  3WQT A;  4F9O A;  2FLO A;  2RE2 A;  3WXJ A;  1K73 O;  2VGM A;  3CPE A;  3FGU A;  3AAP A;  4BGB A;  4BR0 A;  3EO3 A;  3U9Z A;  4R79 A;  2QXL A;  4BR5 A;  3UE5 A;  1SQK A;  3ENO A;  3O08 A;  2V7Z A;  1KD1 O;  3ID6 A;  1XC3 A;  2V51 B;  1QQN A;  2QA4 N;  2YI1 A;  3L6Q A;  1VQ7 N;  3VEN A;  1RGI A;  3QIC A;  3CCM N;  5AQY A;  3O9T A;  2YHW A;  1NGI A;  1Q81 O;  3C7N B;  3O9S A;  4H0V B;  2P9I A;  5M1K A;  5C15 A;  3F2K A;  2E1Y A;  4PKG A;  3CJ7 A;  4JD2 B;  5CR4 A;  4YOW A;  3A5L C;  4H0P A;  4FPB A;  1KAX A;  4GV6 A;  1ILY A;  4KH6 A;  4OPA A;  4B1W B;  5AFU A;  1LOT B;  3R3L A;  1NGD A;  4PKH A;  4BRC A;  3BUZ B;  3CET A;  1YI2 N;  1VQO N;  3KWG A;  3K9K A;  1K8A O;  3HTV A;  4CZK A;  2H3G X;  3OBW A;  3I8B A;  3PIO L;  3IKM A;  5JMV A;  4GV3 A;  1HJO A;  2HF3 A;  4BR7 A;  2ZGZ A;  1VQM N;  3SAH A;  2ZWH A;  3TU5 A;  4BG8 A;  3CCR N;  1KAY A;  5LJV A;  2V7Y A;  4DHY A;  5BN8 A;  4IOC L;  1QQO A;  4IWV A;  5EVZ A;  3OBY A;  3MN5 A;  1NMD A;  4IO8 A;  4JAX A;  4JN4 A;  3O1W A;  4BRK A;  5CE3 A;  3OHR A;  2WC9 A;  1U6Z A;  5M1P A;  2QEX N;  3CF5 L;  1LCU A;  5AQI A;  3CD6 N;  1YIT N;  1SS6 A;  3MMV A;  1VAZ A;  3A5O C;  4YDU A;  2AP1 A;  1TUY A;  3A8Y A;  4BVP A;  4NLC A;  1HKB A;  3W0L A;  1T44 A;  3BEX A;  1DKG D;  3SAF A;  5AFU H;  5KPZ A;  2FF3 B;  4B1Y B;  4WFB L;  3H1V X;  4LC9 B;  5ELZ A;  2F9T A;  4PL7 A;  5AQN A;  2I7N A;  4I6M A;  2OTL N;  2YX6 A;  4FWQ A;  5AZI A;  3CXC M;  3VPZ A;  5TKY A;  4JKH A;  4BC4 A;  1VQ5 N;  2E2Q A;  3MCP A;  3ZEU B;  3CJB A;  2P9N A;  3TSP A;  3ZYY X;  2IVP A;  3F5T A;  4A59 A;  4B1U B;  4BVO A;  1NJI O;  3AGR A;  4JK9 A;  3GDQ A;  1MWK A;  2FF6 A;  3VF4 A;  3TTF A;  4WFN L;  3HOS A;  5TKW A;  1S72 N;  4FWP A;  1BA1 A;  4KBO A;  3VER A;  4RWT A;  1YUW A;  2A41 A;  1RDW X;  2BUP A;  3NVM A;  2P9U B;  4AM6 A;  1NGC A;  1HUX A;  5BPN A;  4IZ9 A;  3CJ9 A;  3C6A A;  5CHI A;  1MWM A;  3FZK A;  3D2F B;  4BRL A;  4YOT A;  4U7B A;  1XUP O;  3E9O A;  5C2F A;  5FPD A;  1NGF A;  4BC2 A;  2F7T A;  4WFA L;  3D2E A;  5AQG A;  2Q36 A;  3DLL L;  4DQ8 A;  2A40 A;  1BU6 O;  5EOY A;  3SMP A;  4CBU A;  3LDP A;  5AQH A;  3C7N A;  3OW2 M;  3WXL A;  3M6G A;  3CJ1 A;  2HBJ A;  2HBL A;  3G71 N;  4CJ7 A;  3EE8 A;  3C65 A;  4K42 A;  1ESV A;  4WQ5 A;  3M1F A;  3WUH A;  3EZW A;  3HI0 A;  2FSN A;  4JKB A;  1EQY A;  3WEE A;  5AZJ A;  5BRF A;  3CCS N;  4WCE L;  3KWI A;  4YOR A;  4O8K A;  4FO0 A;  4AF1 A;  4Z94 A;  4XH1 A;  2QWR A;  4BRM A;  4BRA A;  5DM7 L;  2F9W A;  1QQM A;  2NRR A;  4FWO A;  4JHD B;  3LDN A;  3MK6 A;  1Z6R A;  3VMF B;  4A2A A;  3SMS A;  2WBN A;  1VQL N;  3O9Q A;  4PKI A;  5GIN A;  3VEZ A;  3HZ6 A;  4CZM A;  4NLB A;  1NGB A;  4H5V A;  5B8H A;  3ATV A;  5FPE A;  2A42 A;  1HPM A;  2P9L A;  2KLA A;  2GTD A;  3DXM A;  4CZI A;  1K9M O;  3ZET B;  3JXU A;  1YJ9 N;  1P8Z A;  4C23 A;  3U9D A;  1DEJ A;  3O9U A;  3QDK A;  5AQV A;  4XH5 A;  3NMU A;  3EKU A;  2HMP A;  2GEL A;  2HBK A;  3O1B A;  1O13 A;  5JLF A;  4L3Q A;  5AQX A;  3LL3 A;  3VEX A;  3FZL A;  4HWI A;  1U2V B;  3P39 A;  3WXK A;  2Q97 A;  5EXW A;  4BRD A;  4C1N I;  3VEV A;  5AQL A;  4BQZ A;  5ADX H;  3FR0 A;  2Q2R A;  1BG3 A;  1JCF A;  3FE1 A;  4FWK A;  1JJ2 M;  3G4S N;  5LJW A;  2E1Z A;  2Q0U A;  3L4Q A;  2GX9 A;  4FPA A;  5GAG P;  1QZ5 A;  3ZEU A;  2EWS A;  3H1Q A;  2V52 B;  1GLA G;  3WQU A;  2GUP A;  4OPH A;  5EY4 A;  1YAG A;  3H3O B;  5AQJ A;  3WXI A;  2NRT A;  3CME N;  2QWN A;  3J8A A;  3N4Q A;  4BRF A;  2P9U A;  1BOT O;  1E4G T;  2GEM A;  4FWS A;  3VF2 A;  4IOA L;  4CBX A;  4BC5 A;  3BF1 A;  3MN7 A;  2HF4 A;  3P38 A;  4JNE A;  4RTF D;  1J6Z A;  1RDU A;  5AQK A;  1ZC6 A;  4CZH A;  2ZF5 O;  1GLD G;  2ZJR L;  1K8K A;  3ULE B;  1Y64 A;  4B1V A;  3CCL N;  1S3X A;  4KH5 A;  2QM1 A;  1HX1 A;  3ATU A;  1KXP A;  1DGK N;  1MA9 B;  3AY9 A;  3MN6 A;  3LDO A;  4FL9 A;  4WQ4 A;  3I56 N;  4XH4 A;  5BRE A;  3BP8 A;  2CGK A;  5F1X A;  4J8F A;  1YIJ N;  3CCU N;  4IFE A;  4YOV A;  3C6H A;  3HOT A;  4WQ4 C;  4RCH A;  4A62 A;  1N8R O;  3PLA A;  3SBT A;  2VWB A;  3MCA B;  4GVE A;  1YJN N;  1GLE G;  2A3Z A;  3M3Z A;  1TYQ A;  4FWM A;  4H5N A;  3QB0 A;  3VOV A;  4JK7 A;  3RVC A;  1GLF O;  2P9S B;  5BN9 A;  3RSE A;  5AQP A;  3HSC A;  1CZA N;  4YDU C;  4H0Y B;  3AAQ A;  4A2B A;  4A5A A;  3VGM A;  2E20 A;  2P9P B;  5E84 A;  3QBW A;  2FSK A;  3W3D A;  1Q82 O;  3DXK A;  4IDH A;  3EE9 A;  1V4T A;  1YVN A;  2NRZ A;  3EN9 A;  3GG4 A;  2E2N A;  2D0P A;  1VQP N;  1GLJ O;  2P9K B;  2QWP A;  5JVH L;  3SJH A;  3UKR B;  3E9L A;  5EX5 A;  3VGK A;  4ILH A;  4QS8 A;  2PAV A;  3CC7 N;  1R59 O;  3M5R A;  1U2V A;  2Q1N A;  1G99 A;  1VQN N;  3R8E A;  1ATR A;  3H46 O;  5E26 A;  3MDQ A;  3ZX2 A;  2YJE A;  2YHY A;  4GY2 B;  2HST A;  4EAH D;  1KC8 O;  4C1N K;  2P9I B;  4CZF A;  4AM7 A;  4IXC A;  1T3V A;  5LY3 A;  2YHX A;  1M90 O;  4BRE A;  3CHW A;  3TPQ A;  4BG9 A;  1GLC G;  2RHK A;  4JD2 A;  4FVU A;  4IEI A;  3HBT A;  4ISG A;  4EIA A;  2FXU A;  4H5W A;  4JKD A;  3CPW M;  1EO1 A;  2JWL A;  2NRV A;  3VGL A;  3LDL A;  1NLV A;  1GLL O;  3F9M A;  4FWN A;  2D0O A;  4MDA A;  4HTL A;  3WXM B;  4KH4 A;  5FPN A;  1KAZ A;  3AAR A;  2NRH A;  1NGJ A;  3P31 A;  2PBD A;  3S41 A;  4WQ5 C;  3GBT A;  2GWJ A;  3O4W A;  3O9R A;  3KHY A;  5KPT A;  1YXQ A;  2W41 A;  4FSV A;  3ULE A;  1Q7Y O;  3GE1 A;  3MX5 A;  1VQ9 N;  2HBM A;  3TTD A;  3CC4 N;  1IG8 A;  2D4W A;  5HOO A;  1QHA A;  2I7P A;  3A5N C;  1BA0 A;  1NBW A;  3LM2 A;  3VES A;  4DCH A;  4EHT A;  4FOI A;  2QTD A;  2VYP A;  3CCJ N;  1ZXO A;  4PHT X;  3QBX A;  3SBG A;  3UKU B;  4PL8 A;  4O8U A;  5HL7 L;  2CH5 A;  1E4F T;  3G25 A;  3O8M A;  4BR2 A;  3L4I A;  4CZE A;  5BPL A;  5M1F A;  3L0Q A;  3KVG A;  3SAG A;  4I6M B;  2P9S A;  4FWL A;  5AQS A;  3KZB A;  5BPM A;  5F0X A;  5KQ8 A;  1NWK A;  2P9N B;  4GNI A;  3DWL A;  5BRD A;  5C2D A;  2NRW A;  3Q7C A;  2UYT A;  4ISE A;  3ZX3 A;  4BRI A;  1C0G A;  3IMX A;  4XEI A;  5I9E B;  5H1S Q;  3HM8 A;  1T6C A;  2GWK A;  1X3M A;  3NVK A;  1IJJ A;  4ILG B;  1S22 A;  3VET A;  4EFH A;  4BR4 A;  2IVN A;  3CC2 N;  2CGL A;  1BO5 O;  4B9Q A;  2P9K A;  4BQL A;  1BWF O;  4M63 C;  4K43 A;  4BRO A;  3CER A;  4CZL A;  2J4R A;  4IJN A;  2Q31 A;  3TTC A;  4UY8 O;  4M7X A;  3E9P A;  5AQU A;  4BGA A;  3E1Y A;  1KQS M;  2VGN A;  3VEY A;  5C0Y A;  4ISF A;  2ITM A;  3D2F A;  5M1Q A;  1NM1 A;  3D2E B;  3SK3 A;  4IJA A;  2BH1 A;  4B1Z A;  1HKC A;  4YOU A;  4FOE A;  1DT9 A;  2QWM A;  3I33 A;  1H1V A;  1JCE A;  2KHO A;  3ENH A;  3FFK B;  4K41 A;  4BRN A;  1V4S A;  3I55 N;  2JWK A;  3IFR A;  4WYB A;  3P4I A;  2A5X A;  3R1X A;  2AA4 A;  3TSU A;  4JKA A;  1ATN A;  2E8A A;  1X9J A;  3FZM A;  4A5B A;  3QML A;  3PIP L;  3FZF A;  3WEE B;  1YJW N;  4G9Z A;  5AZJ B;  2BTF A;  2VCP A;  2W40 A;  2WFB A;  3GOI A;  3EL2 A;  4Y0W A;  4MLE A;  4CZJ A;  2QWL A;  4MO5 A;  3VEW A;  1QVF M;  3VTH A;  2Q0R A;  3JS6 A;  4IEE A;  5AR0 A;  5GAH P;  1W2B M;  2IVO A;  3CJC A;  2QI2 A;  1TUU A;  3DJC A;  5AQZ A;  3KK7 A;  1OKJ A;  4U67 L;  4IO9 L;  1NGE A;  3CI5 A;  3QFU A;  3C0B A;  1RFQ A;  4JHD A;  3E66 A;  3H45 C;  3VEO A;  1HLU A;  3N4P A;  5MLC Q;  1MDU B;  3B8A X;  1BUP A;  2P9L B;  1SZ2 A;  2E2P A;  1X3N A;  3DXM B;  3LM9 A;  4EHU A;  5KQD A;  4CD3 A;  1W97 L;  1GLB G;  1VQK N;  2NRX A;  3CCE N;  2ZGY A;  3VF6 A;  3ZET A;  5GIO A;  4JKG B;  4JEP A;  4H0O A;  4YOY A;  2OAN A;  4CZG A;  2QW9 A;  1P90 A;  1M1K O;  4CI6 A;  3A0I X;  1QZ6 A;  3MN9 A;  1HKG A;  3UKU A;  2CGJ A;  4A61 A;  4B1X B;  4JKF A;  5AQF A;  1Q86 O;  3UB5 A;  5AQM A;  1QVG M;  3LDQ A;  4JKC A;  2HOE A;  4ILJ A;  4JK8 A;  4NB4 A;  5AQW A;  3GL1 A;  4MLH A;  3G6E N;  3OA9 A;  4H0T B;  3O80 A;  2ZJQ L;  2E88 A;  3QFP A;  4BRQ A;  1JCG A;  5FPM A;  3IDH A;  3CCQ N;  4WF9 L;  4H5R A;  4E1J A;  2ASO A;  4DB3 A;  4H03 B;  4BR9 A;  5GAE P;  4M7Y A;  5BRH A;  3WT0 A;  2ASP A;  5KPR A;  1D4X A;  4MDB A;  5AQT A;  2ZJP L;  3SLC A;  2NZT A;  2NNW A;  1VQ4 N;  5AQR A;  1Q18 A;  3A5M C;  1ZBS A;  3U4L A;  4GV9 A;  5M1O A;  3FZH A;  4JKE A;  3IUC A;  1SAZ A;  2IIR A;  2QWO A;  5AQQ A;  4YOX A;  1Z05 A;  3ID8 A;  3T69 A;  1ATS A;  1WUA A;  3Q7B A;  1K8K B;  1NGH A;  4BRH A;  1BDG A;  3MX2 A;  4A57 A;  3MWP A;  1T6D A;  2QWQ A;  3ENB A;  4BY9 C;  1VQ6 N;  2WUS A;  2E2O A;  3CQY A;  3EKS A;  3R9P A;  2PFU A;  4K25 A;  1YHQ N;  3O6W A;  3K9J A;  5F2R A;  5M1N A;  1XQS C;  2KKZ A;  2YCH A;  1C0F A;  1NGG A;  3T7Z A;  5JLH A;  3MWT A;  4FWR A;  4DKW A;  5C12 A;  4QS9 A;  3U8X A;  3CCV N;  4OO1 J;  4CD1 A;  1TYQ B;  5ADX A;  3HRG A;  1WOQ A;  4BRG A;  4O5F A;  4CBW A;  5BR9 A;  3RSE B;  4BRP A;  4BC3 A;  3CMA N;  2D1K A;  4H0X B;  1NGA A;  2DPN A;  3O5B A;  1YF5 L;  4IOX A;  4NO7 A;  3CQX A;  4MO4 A;  2CH6 A;  3AGK A;  4QS7 A;  5AZI B;  3DXK B;  5JIC A;  5DM6 L;  3D7E O;  5JVG L;  2FSJ A;  3D6R A;  3J7Z O;  2P9P A;  3VTI A;  5AQO A;  2A6A A;  5C10 A;  3TSQ A;  5GAD P;  1OVY A;  2YJF A;  3DAW A;  4H5T A;  2OTJ N;  3H6E A;  3BF3 A;  5GIP A;  1VQ8 N;  3H3N O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...