3M65A

Crystal structure of bacillus subtilis lon n-terminal domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
204
Chain Sequence
ELKRSIPLLPLRGLLVYPTMVLHLDVGRDKSVQALEQAMMHDHMIFLATQQDISIDEPGEDEIFTVGTYTKIKQMLKLPNGTIRVLVEGLKRAHIVKYNEHEDYTSVDIQLIHEDKDTEDEALMRTLLDHFDQYIKISKKISAETYAAVTDIEEPGRMADIVASHLPLKLKDKQDILETADVKDRLNKVIDFINNEKEVLEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent protease La 1
publication title Crystal Structures of Bacillus subtilis Lon Protease.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 61
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3m65A02
2.30.130.40 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 LON domain-like 3m65A01
3M65A 2ANEA 4CI3B 4TZ4C 4CI1B 3LJCA 4CI2B 1ZBOA
chains in the Genus database with same CATH superfamily
5JDFA 1JNZA 1D0XA 3LBXB 4HGAA 5FY7A 5H6RB 1MIYA 1ZEEA 5HEHA 3EI0A 2QVAA 2ZM0A 5HXSA 4L9IA 3HI2A 2IC9A 1D0ZA 2L3LA 2WDRA 4GK0E 4A98A 4JV5T 5GONE 3D0TA 1FIOA 2IMLA 4AQGA 2X0LB 4MLKA 5IHYA 4U72A 4QHOA 2V6YB 1V9DA 4B3ST 3ONLC 4NXMT 1IT7A 3Q2MA 2CBJA 5HCMA 5AQLB 4AQYT 2MOZA 3N9PA 1I6ZA 3MACA 2VURA 2X9HA 3ZMUB 4DR4T 2QA7A 3UU6A 3LWQA 2WU2A 3BQLA 2L8KA 3U78A 4TWHA 3QK6A 2K5BB 3GWHA 1G8XA 4ZHQE 3NZQA 1UOYA 4IDOA 1YKEB 4MBQA 3EUHA 4MHCA 2MYSA 2BBHA 4ZI2C 4PNIA 1D0YA 2J5VA 5LXTE 2FJDA 2XQ3A 3MA9A 1HG2A 2BS2A 3PURA 3RX6A 3P50A 3I1AA 4LMKA 4U31A 4PJNA 5DQVA 1N32T 3V5UA 3K3NA 3S4UA 4O8SA 3J7Yq 3V5SA 2WSSV 3Q5WA 2LT3A 3QNUA 4M1PA 3C4ZA 3RYHE 3IA3A 4EGWA 3LJCA 3N9OA 2XSBA 4PAGA 5ABFA 3OVUA 4AKLA 5FMNA 4DBQA 2IIUA 4CN1A 5AQHB 2VKDA 3P4PA 4JI0T 2AB4A 2FJBA 5BR8T 1E2AA 2WY2A 1D1BA 3NZPA 2QRXA 2Q9QC 3CX8B 3H3MA 1UCUA 4G63A 1MMDA 3RGLA 3AAAB 4QH1A 4JEUB 1R3FA 3AE9A 1D1AA 2HN2A 2XM2A 3BQIA 1QSDA 1UURA 1KNRA 4J2CA 1S94A 2Z0TA 2UXNB 2YOEA 4H9PC 3AA1B 4NIQA 3ESLA 4LMJA 4ZZCA 2W63A 3F2EA 2UXXB 5IWAT 1M62A 2AUSA 2XQAA 3UULA 3O1JA 5AQRB 2CWWA 2I6HA 4PK5A 3ZT6A 4DV1T 3LK2B 2QGSA 4AISA 1J5ET 4DV6T 3ZYMA 4LMLA 1WK2A 2AE9A 3L09A 5HYAA 2CX0A 4IDZA 4IE6A 3UU5A 1H7CA 2WWVA 2JQ9A 5LJNA 3FXDB 3J9X1 2AS0A 1QLBA 1MMNA 4KHZF 3ONJA 2RPAA 3C4WA 4X1YE 4E7SA 3ZPOA 4ZS3A 3E08A 2SPCA 1KNPA 2CX1A 3K1SA 2XAHB 3I0OA 5LHIB 5H6QB 3TKLB 4ZXLA 2V5CA 5HXHA 2VASA 3LK3B 2H3RA 3H37A 3L39A 5LBQB 1KNZA 5C3JA 1Y64B 2W0GA 4EZHA 1NAFA 2D2SA 1CHUA 2XJ7A 5CJ5A 3JCFA 1I94T 3VHLA 2DHRA 3M6VA 5JH7E 3MZKB 5L3FB 1OXZA 5ABFB 1J5WA 2A2FX 2PG8A 2FJAA 3UUBA 2ZLYA 2E5LT 3IF8B 3RIAA 4OX9T 1DU2A 3LDFA 5ABHA 4U2YA 3UU3A 4QXCB 5AQQB 4IDNA 4C91A 1FMVA 2PFVA 2KLQA 2V7MA 1IBLT 2VKOA 4UF0A 1LVFA 1XNRT 4TV9E 5J1GA 1HFAA 4QX8B 5FXZA 5AQSB 2YK0A 5J2UE 4XBFB 2HH7A 3UQ4A 4WW0A 3AEAA 2C5KT 3F57A 2L9QA 4QKNA 1JNRA 5L3EB 1ZE1A 4YJ3E 2XQ5A 5HWXA 2LRKA 1XNQT 3WAKA 5AQVB 5F3JA 1LRZA 3PUZF 4GOUA 2KWHA 3KV9A 2XSAA 4DV5T 4Z8XA 1VOMA 3F31A 2FRXA 1OEDE 4LFCT 4H9RC 4U33A 4YSXA 3AE3A 3RIUA 1HF8A 5ABEA 4TWDA 4OYJA 2W00A 3AA6B 4A97A 2X0YA 4TV8E 1NEKA 2XQ9A 2WZIA 3X1DA 3NKZA 5JR9A 1ZBOA 4LF9T 5A1LA 2CXDA 3GA8A 4YTNA 1ZS7A 1WXXA 4UR9A 3DJBA 3AEDA 3CMLA 1WYBA 4CXXA 2NTYA 1VCTA 2I59A 4YHJA 1ZKEA 4P09A 4YLHA 1FMWA 3JC6C 2D0TA 2BZBA 2XAGB 4FI5A 5LA6E 2NTXA 2XQYA 3WAJA 3CX7B 1N34T 3CQCB 4UELA 4NUUA 1EZ3A 1VCSA 3ZJ2A 4TX5A 4WYVA 2LHRA 2HHHT 3KV5A 3ANWA 4GK5E 4JYAT 3RPUA 3O1HA 4EV6A 4O2BE 1HS7A 2V26A 2VKJA 4LF8T 2BG9A 3AXJA 5FYMA 4G2AA 4DMGA 3ZCIA 5L47A 4ISSA 5EK4A 4O2AE 2LSKA 2ZM2A 1U4QA 1IT8A 4DBRA 4EXTA 4EYYR 2XQ6A 3SOLA 2CEAA 4DO0A 5FP3A 1OWAA 2D5UA 2WMNA 1BR4A 1BR0A 1YQ3A 3PU8A 3A8YC 4ERRA 5KDMC 2XPKA 1S35A 4WBOA 1Z0PA 2E5VA 3ZMTB 1WYCA 5IUXA 2KWIB 4UV8B 2CXLA 2LE8A 1N36T 3GN5A 4ZOLE 1KF6A 2CA5A 3FZKB 3N9LA 3SFDA 2P9BA 2NW9A 1HNZT 4JI7T 2X51A 3M6UA 3NBXX 5TAOA 3PV0F 4YFSA 2YU2A 5JDMA 3PE0A 3U3IA 3HKDE 4X65T 1YXRA 4IT4A 2XM1A 4IE5A 3Q9DA 4KHPT 3SFEA 4U74A 2UXCT 3HJWA 5JVDE 3LWPA 2E5OA 5LOVE 3CX6B 4I43B 4HFHA 5JR9B 4B3MT 4L5GA 3WI3A 1XDPA 2CHNA 4AXPA 2DLRA 4O4JE 1MMGA 4OHFA 2N2NA 3UUNA 2E2AA 3TLUA 2UU9T 1HNWT 2OV9A 5AQTB 3ZEFB 2FUPA 1UX5A 3KFWX 3RKGA 5JTGA 4DR2T 3O9XA 3C0KA 5LJMA 3AEFA 2MPKA 4PK6A 3T1HT 3RIUC 3PUQA 3CIRA 1MNEA 2N9DA 4B3RT 3AE4A 5FXXA 5JR9C 2DWGA 2V7JA 2CBIA 4LFBT 1UGOA 4JI8T 3C51A 5FY0A 3TLSA 2KINB 3PDYA 1W0BA 4PJJA 5AQJB 4DV3T 3AXJB 2LSIA 2VK9A 4B6XA 5DABA 3VR8A 2VQFT 3T1YT 2AXDS 2XUEA 4KMCA 4P1NA 4ZI2D 2CPTA 3B57A 4TWFA 1VRBA 2VL8A 4WNKA 2CRBA 2CHOA 4B3TT 1D1CA 1T8BA 2Q9QB 3EVYA 4BA9A 5LMNT 3AVSA 3RHWA 3BQKA 1XWMA 4UVCB 3GN5B 3MK7C 3FBZA 1E1HB 2LEHA 4WBNE 5F8PA 2LJLA 3B5MA 3AE6A 2G0UA 2BG9C 5L4HA 2WBLA 3AB3B 2KT9A 4IL9A 1Z8UA 2EHOA 2UXDT 4LFAT 3Q5XA 3MXZA 2BBJA 3P8CD 3A5XA 4ASKA 3GMIA 3PUAA 2YINA 4CXYA 2ZMAA 4JI3T 2YKSA 2XAQB 3IBPA 2D0UA 1YQ4A 2V1DB 3OKQA 2Q07A 1IBKT 4V1Av 3RI5A 2WMOA 2Q9QD 5L3GB 4DR6T 3M6WA 4IGUA 1SHZC 5LMUT 4BJMA 4X64T 2NR4A 2WP9A 2XAFB 2M6BA 4BJNA 2ODVA 3FBLA 2LOPA 1CUNA 1J1JA 2V5DA 3EABA 4E7ZA 4DVDA 3O4XE 3PTRB 4EAHA 4C90A 1T5YA 3U28A 1WFDA 5AQOB 3M65A 4OK0A 4Z90A 3ZN1B 4GKKT 4IREA 4EZ4A 5EK3A 4YT0A 2DCFA 1MIVA 2JIWA 3UUXB 4GYRA 2WDVA 2DI4A 4GIWA 4X62T 3ZMSB 2LM2A 5EK2A 5AFUL 3NRYA 3VKHA 4KX6A 4YSYA 4HWCA 4PFOA 5CB4E 3P4RA 3HA4A 3ETUA 3KBUA 1MIWA 3PUXF 4CI3B 2K3WA 3LG7A 2E9XA 5AQUB 2WM9A 2PJQA 4NPPA 3D79A 4YHHT 5JRCA 4BAYB 5KMGP 5FKYA 5ADXL 2KXPB 1ZE2A 4ISTA 4IE0A 3ZC0A 1SQWA 4X20E 2WZHA 3AA0B 1BR1A 2OA5A 1T98A 4H63V 4HKAA 4ZZBA 5M4YA 4IIJE 1Y01A 5ABGA 2J5TA 3I0QA 4DIDB 4U2ZA 4H9OC 3I9WA 5AQNB 3KV4A 2ACZA 3B13A 1O3XA 1GQEA 3OJAA 2YDQA 2M67A 4ZI3C 2EY4A 5L2LA 4FJOA 4XAXB 4Z91A 2JQQA 5LBMA 1KEYA 4DV4T 5HEOA 3RYIE 2CE7A 5J2TE 2HPLA 3BK9A 4KI0F 2J62A 2J1DG 2EHOC 1HTJF 2LM9A 2YDSA 2LKHA 3MJXA 3PUGA 2KMFA 5HEJA 1W09A 2Y48B 3JAEA 3IEEA 2B76A 3QB5A 5JDQA 4IDPA 4ZI7E 2HN1A 4MFRA 3Q5DA 3ETVA 2KSRA 1ZOYA 3UTKA 2C0SA 2UUBT 3ZYKA 2IW5B 2NWBA 2P38A 3C50A 3NWIA 4UV9B 1ZL3A 4TN7B 5LB7B 4H9SE 3IUWA 4F8HA 2VKHA 4TNWA 4H9NC 5LGUB 3PJAA 2J47A 3UU4A 3RQUA 3HL6A 1N33T 3PUWF 5CGMA 5HEGA 3EDVA 4HWHA 3L3PA 2X9WA 4A5XA 4HE8A 5JREA 2R6GF 4CN6A 2E9XB 5JDHA 1IQ8A 4KUMB 4ILUA 1K8WA 5FXWA 4PJLA 5JRCB 5LNKA 4PFPA 3AE8A 4ILAA 3RF1A 4JI1T 4AIUA 5JQGE 2K48A 4TZ4C 2JMHA 4OFZA 2ZM8A 3JC6D 2WQYA 2CXFA 2W62A 4DMVA 1SGVA 2W67A 4JBWF 4DNDA 2BVLA 4UF0B 1TE7A 4UVBB 4HFVA 3OYXA 2CCQA 3AEEA 3CVRA 2WS3A 2XQ4A 4COFA 1Q7HA 1XMOT 2CMRA 5BMVE 2E9XC 3ZMVB 2E8IA 3LWVA 2A3DA 3QOFA 1IZNB 3AE7A 3N9NA 4QXHB 3Q5EA 3A7MA 3KBTA 4TNVA 3PUSA 2M6IA 5HXCA 2H88A 4DR3T 4DMWA 1WLXA 4JEHB 4U3CA 3M3ZB 3RIFA 4JUYA 2E9XD 4AI6A 4HWFA 4JI6T 3ZN0B 3ZT5A 2ACXA 1S04A 1YD8G 2H89A 4QX7B 4H63H 3PU3A 2BS3A 4CZZB 3ZC1A 5LHHB 4K0KT 2RFKA 3NRXA 4AKHA 4EYUA 3SRZA 2B78A 2W61A 3VU7H 3CPZA 3KVAA 4A56A 1XZYA 2I0MA 3E0ZA 3R6NA 5ETWA 2D9DA 2NP9A 4QXBB 1R3EA 3QC9A 3UU8A 2QYWA 5FY1A 3RQWA 4QH5A 3FZHB 3EHZA 2YU1A 1W0AA 5C8YE 3C4XA 3KV6A 1W9RA 4CXWA 1NWMX 2CLYB 2ODUA 3RLFF 1MMAA 1NENA 2IC6A 4JI2T 1YKHB 4LF6T 1KK7A 3AAIA 1R8IA 4K0UA 1T72A 4HEAA 4HN9A 4DR1T 3AA7B 4ZEYA 3N2KE 4HWIB 4HFEA 3OBVE 4AKIA 1HNXT 4CQIA 2VB6A 2MTQA 2JQHA 4CI1B 2Z6EA 3UFEA 4X66T 1ZHCA 2CLYC 3QUJA 2LSYA 4KBMB 3ANWB 5DQWA 1FJGT 2OLTA 3FZFB 5E0OA 5CA1E 1IJ5A 3LWRA 1LKXA 5FVLA 2BG9B 4IHJE 1IJ6A 3RYFE 1SA0E 3FZLB 2UXBT 3NVOA 4EEBA 4IE7A 3CWZB 3L8RA 2W2UA 3OYZA 3PUVF 2IUBA 5EZYE 4O4HE 3M6XA 2VWAA 3LWOA 1U5PA 4I0UA 4P0AA 2LSJA 4N78D 4X1KE 1X9BA 4PW8A 3UQ7A 4X5TA 5KX5E 2BKOA 3FZMB 3RRWA 3SWHA 4ANJA 3CK6A 1IBMT 3IHRA 2H7OA 4F6RC 2VL0A 3RC3A 4U7IA 3RYCE 2W66A 4ADZA 2GK9A 2BG9E 3C98B 2DL1A 4NXNT 2X66A 2CWOA 3VKGA 1UUSA 2VVNA 2WB5A 3CKDA 1ZP0A 5CFBA 2K24A 3SS1A 1OEDA 3AEGA 1WCRA 4AQFA 3AAEB 1HX1B 1SUMB 3K8PC 5JDNA 3UAIA 1FEWA 1US7B 3VRBA 2APOA 5LG4A 5L3BB 4UVAB 3FHNA 2K9AA 5LYJE 2F4VT 4CN4A 4U7YA 4EOZB 5HXRA 4PK4A 4UEMA 3TLVA 2FJEA 2LHNA 4HWDA 3I9YA 2LSGA 2RP4A 3CQGB 1XNEA 3G06A 1QUUA 2XZEA 2YDRA 3PJAJ 3ZMZB 1MNDA 4YJ2E 5AQIB 2BS4A 4YSZA 2NW8A 2LKGA 3K3OA 4X1IE 5JDGA 2V6XA 2LRLA 2WU5A 5F5WA 5AQKB 5AQPB 5AQFB 4ILBA 5FNVE 3EDUA 1IAPA 1HR0T 3LK42 2X9XA 4EB6E 2BKPA 2UUAT 3FXEB 3TLTA 2HPJA 5FVKA 4I50E 1XDOA 3LFMA 2V7LA 1B7TA 2V7KA 3MQKA 2J4GA 4HFBA 2JMKA 5HWYA 4DV2T 4IDQA 2NOXA 3C64A 3ZCJA 5C2TA 3AE2A 4MALA 3KINB 4O4IE 1J2BA 2A72A 1WR0A 4JLEA 1HCIA 3E22E 4IL4A 2LLYA 3EAMA 5L4EA 3CQXC 3PUYF 2EHOB 5FL1A 4IE4A 2XTLA 2WWUA 3ZLIA 3AE5A 3N2OA 4NUVA 5FXVA 3HKBE 4ILCA 3VRAA 3RC8A 2XQ7A 2VVSA 4KP3C 2ANEA 1M7KA 4WZXA 4DV7T 3ZJ1A 3ZKRA 1XMQT 4CI2B 2V8SV 2WCAA 1OEDB 2FBWA 2XHEB 3ZT7A 3ZV0C 5AQGB 3K3QC 5L3CB 4DR5T 4UIGA 2XASB 5LCYA 3T8OA 2DNXA 5DJQC 2XQ8A 2Y8DA 3P7IA 4JI4T 2IDOB 4TUYE 4HFCA 3UUMA 4ZI3D 3HAXA 2XY8B 1UK5A 4HFIA 2PBIA 3KVBA 3ZSSA 3LDQB 1X79A 5FL0A 2ES0A 2MAWA 2EHOD 4YY3T 1AJ3A 2BKNA 3O1IA 5J0ZA 2C5JA 2WDQA 4I4TE 3OPCA 4L0RA 3H3AA 5LGNB 1OEDC 3JADA 2BVMA 4AQFC 3LSVA 3HKEE 5HEUA 5L3DB 2H7VC 2DP9A 3DP7A 1WR6A 2BDEA 3P4WA 4Q25A 2KKUA 2ZM6T 4Q1TA 4ZS2A 3HR0A 3W15B 4AKRB 3M4XA 3OTOT 2X9YA 5JDLA 3RKOA 3LBXA 2MBGA 3ONXA 4YTPA 2X67A 1SE7A 1LVKA 4GYSA 3AE1A 3P4SA 2KNDA 2UUCT 4O4LE 4DUZT 3UFGA 4YTMA 1ZV4X 3DTOA 2YN6A 5LP6E 2X0HA 3FB2A 4DUYT 5KXJA 5HCJA 1E7PA 3R84B 4PJMA 2A9UA 4LF7T 3N9QA 4HTEA 4P0BA 2CWYA 2V6YA 3TLWA 1L0VA 4GKJT 2XAJB 3RRCA 5HAXA 5AQMB 1G73A 3UT5E 2RA1A 2YEVC 3HKCE 1YW0A 2KZ7B 3P4QA 3N9MA 3N2GE 4HFDA 5LHGB 4QWNB 3QB5K 2WAUA 3ZSTA 2C5IT 2NW7A 2X68A 2VQET 2Y6XA 3MKDA 2PTFA 2N1GA 4LF5T 1BR2A 4DR7T 4UXNB 2JQKA 3HJYA 1HX8A 1WRDA 1T7SA 2JRKA 4DV0T 4I55E 1HG5A 2W4XA 4JI5T 4QH4A 2HVYA 1KFYA 4EEDA 2IAKA 3AVRA 3AECA 4YXDA 2CM0A 4XZCA 2IHR1 2JPFA 3VSEA 3ZYLA 2Q9QA 5IYZE 1UX4A 4OYKA 5CA0E 5LG3A 1WXWA 4LF4T 3N5LA 2LOSA 3VR9A 2B1EA 4H9QC 4AKGA 5HXEA 5LGTB 2JJ9A 3JAFA 3AEBA 4EIWA 3KDSE 3ABVA 2V7IA 3RH3A 2DWKA
chains in the Genus database with same CATH topology
3IHRA 2H7OA 3LG7A 2E9XA 5JDFA 1D0XA 3LBXB 4HGAA 5JR9A 4F6RC 2WM9A 2PJQA 3RC3A 5FY7A 1ZBOA 5H6RB 5A1LA 3RYCE 1MIYA 1ZEEA 2CXDA 3GA8A 4ADZA 2GK9A 4BAYB 5KMGP 5JRCA 3C98B 5ADXL 2KXPB 3DJBA 2X66A 2ZM0A 2CWOA 5HXSA 3VKGA 4L9IA 3HI2A 3CMLA 2IC9A 4ISTA 1D0ZA 1WYBA 2L3LA 4IE0A 3ZC0A 4CXXA 4X20E 2NTYA 2I59A 4GK0E 4YHJA 3CKDA 1ZKEA 3AA0B 1BR1A 2OA5A 4P09A 1T98A 5GONE 4YLHA 3D0TA 1FIOA 4H63V 4HKAA 1FMWA 5M4YA 3JC6C 2D0TA 4IIJE 2BZBA 2K24A 2XAGB 3SS1A 2X0LB 4AQGA 4FI5A 4MLKA 5LA6E 4AQFA 5IHYA 2NTXA 4U72A 3AAEB 4QHOA 1V9DA 3I0QA 2XQYA 4H9OC 3WAJA 3I9WA 3KV4A 3CX7B 3K8PC 3B13A 5JDNA 3Q2MA 1O3XA 1FEWA 3OJAA 1US7B 3CQCB 4UELA 2M67A 4NUUA 1EZ3A 3ZJ2A 4TX5A 4ZI3C 2LHRA 2MOZA 5L3BB 3N9PA 5LG4A 5L2LA 3MACA 4UVAB 3FHNA 2X9HA 2K9AA 3KV5A 4FJOA 3ANWA 4XAXB 3ZMUB 5LYJE 4GK5E 2QA7A 3O1HA 3RPUA 2JQQA 5LBMA 1HS7A 4O2BE 2V26A 3RYIE 2CE7A 4EOZB 5J2TE 2VKJA 3BQLA 2HPLA 2L8KA 4PK4A 5HXRA 3QK6A 4UEMA 3U78A 2K5BB 3BK9A 3GWHA 1G8XA 2J1DG 2EHOC 2LHNA 5FYMA 1HTJF 2LM9A 3NZQA 4G2AA 4ZHQE 3ZCIA 3MJXA 3PUGA 2KMFA 3I9YA 2LSGA 2RP4A 4ISSA 5EK4A 4O2AE 1YKEB 2LSKA 2ZM2A 3CQGB 4MBQA 2Y48B 3EUHA 1U4QA 4MHCA 2MYSA 4DBRA 4EXTA 4EYYR 1QUUA 3SOLA 4ZI2C 2CEAA 4DO0A 3IEEA 4PNIA 3ZMZB 1MNDA 5FP3A 4YJ2E 5JDQA 1OWAA 2D5UA 1D0YA 2WMNA 1BR4A 1BR0A 2NW8A 3K3OA 4X1IE 4ZI7E 3PU8A 5LXTE 4ERRA 5KDMC 4MFRA 3MA9A 1HG2A 1S35A 3ETVA 5JDGA 4WBOA 1Z0PA 3PURA 3RX6A 3ZMTB 3I1AA 1WYCA 3UTKA 5FNVE 2KWIB 4UV8B 2CXLA 3EDUA 4PJNA 1IAPA 2LE8A 3LK42 2C0SA 3GN5A 2X9XA 5DQVA 3ZYKA 4ZOLE 4EB6E 2CA5A 2IW5B 3V5UA 3K3NA 3N9LA 2NWBA 3S4UA 4O8SA 3FXEB 3C50A 3J7Yq 2HPJA 2P9BA 4UV9B 2NW9A 3V5SA 2WSSV 4I50E 4TN7B 2X51A 3Q5WA 4H9SE 2LT3A 3LFMA 2VKHA 2V7LA 4M1PA 3C4ZA 3RYHE 4H9NC 1B7TA 2V7KA 5LGUB 5HWYA 2JMKA 3NBXX 5TAOA 4YFSA 2YU2A 5JDMA 2NOXA 3LJCA 3C64A 3N9OA 3ZCJA 4PAGA 3PE0A 3U3IA 3HKDE 3HL6A 4MALA 3KINB 4O4IE 2A72A 4JLEA 3EDVA 4AKLA 4IE5A 1HCIA 3E22E 3Q9DA 5FMNA 4U74A 4DBQA 3L3PA 2X9WA 4HE8A 5JVDE 5JREA 3CQXC 5LOVE 3CX6B 2VKDA 2EHOB 2E9XB 4I43B 4IE4A 2XTLA 2WWUA 5JR9B 5JDHA 3ZLIA 4KUMB 4L5GA 4ILUA 3WI3A 3N2OA 4NUVA 1D1BA 3NZPA 3HKBE 5FXVA 5FXWA 4AXPA 2DLRA 4PJLA 4O4JE 5JRCB 2Q9QC 3CX8B 1MMGA 4OHFA 2N2NA 5LNKA 1UCUA 4G63A 4PFPA 3UUNA 1MMDA 3AAAB 3RC8A 5JQGE 2K48A 4KP3C 4JEUB 2ANEA 3ZEFB 3ZJ1A 4TZ4C 1UX5A 3KFWX 2JMHA 1D1AA 3BQIA 4OFZA 3O9XA 1QSDA 2ZM8A 4CI2B 3JC6D 5LJMA 4J2CA 1S94A 2CXFA 2UXNB 4H9PC 2W62A 2XHEB 4DMVA 3AA1B 4PK6A 3ESLA 4DNDA 2BVLA 3PUQA 4UF0B 3K3QC 4UVBB 4HFVA 3OYXA 4UIGA 5L3CB 2CCQA 2XASB 5LCYA 3T8OA 3CVRA 2W63A 2DNXA 3F2EA 5DJQC 2UXXB 1MNEA 2Y8DA 3P7IA 2CMRA 4TUYE 5BMVE 2E9XC 2N9DA 3UUMA 3ZMVB 2E8IA 3UULA 5FXXA 3O1JA 2A3DA 5JR9C 2DWGA 2V7JA 4PK5A 4ZI3D 1IZNB 3LK2B 3N9NA 4QXHB 2QGSA 2PBIA 3KBTA 3ZYMA 3C51A 3PUSA 5FY0A 3KVBA 5HXCA 2KINB 3PDYA 4PJJA 3L09A 4DMWA 5HYAA 1WLXA 4IDZA 4JEHB 4IE6A 1H7CA 1X79A 5LJNA 3FXDB 2ES0A 4JUYA 2EHOD 3J9X1 2E9XD 2LSIA 2VK9A 4B6XA 4AI6A 5DABA 1AJ3A 3O1IA 1MMNA 2XUEA 4KMCA 3ZN0B 2C5JA 2ACXA 4I4TE 4ZI2D 4L0RA 1YD8G 3H3AA 3B57A 5LGNB 4QX7B 1VRBA 2BVMA 3C4WA 4AQFC 4H63H 4X1YE 3HKEE 3PU3A 2VL8A 5L3DB 4WNKA 4E7SA 2H7VC 1D1CA 4ZS3A 3E08A 3ZPOA 2SPCA 3DP7A 3ZC1A 4CZZB 1WR6A 2BDEA 2Q9QB 5LHHB 3EVYA 4BA9A 2XAHB 3I0OA 5LHIB 3AVSA 3NRXA 3BQKA 5H6QB 4UVCB 4ZS2A 3HR0A 3W15B 4AKRB 4AKHA 4EYUA 2X9YA 3SRZA 3GN5B 5JDLA 3TKLB 2W61A 3RKOA 3VU7H 3LBXA 3MK7C 2MBGA 5HXHA 3CPZA 3FBZA 2VASA 3LK3B 3ONXA 1E1HB 2H3RA 2LEHA 2X67A 3H37A 3KVAA 4A56A 4WBNE 1LVKA 5F8PA 5LBQB 2LJLA 4GYSA 3E0ZA 2KNDA 3R6NA 1KNZA 2G0UA 5ETWA 4O4LE 1Y64B 2NP9A 2W0GA 4QXBB 1NAFA 4EZHA 2WBLA 2D2SA 3QC9A 3AB3B 1ZV4X 3DTOA 5FY1A 5LP6E 2KT9A 3FB2A 2DHRA 2YU1A 2EHOA 3VHLA 5JH7E 3MZKB 5C8YE 3Q5XA 5L3FB 3MXZA 3P8CD 3C4XA 3KV6A 1OXZA 4CXWA 3A5XA 4ASKA 1NWMX 3GMIA 3R84B 3PUAA 2CLYB 2ODUA 4PJMA 1MMAA 2YINA 4CXYA 2ZMAA 3N9QA 2A2FX 2PG8A 4HTEA 4P0BA 2CWYA 2XAQB 2IC6A 3IBPA 1YKHB 2ZLYA 2D0UA 1KK7A 3AAIA 2XAJB 3IF8B 2V1DB 3OKQA 3RRCA 5HAXA 4K0UA 4V1Av 4QXCB 1G73A 3UT5E 1FMVA 2RA1A 2YEVC 3HKCE 4HEAA 4HN9A 4C91A 1YW0A 2PFVA 2WMOA 2KLQA 2KZ7B 2V7MA 2Q9QD 3AA7B 5L3GB 2VKOA 3N2KE 4IGUA 3N9MA 3N2GE 1SHZC 4BJMA 4UF0A 1LVFA 4TV9E 3OBVE 5LHGB 2XAFB 5J1GA 4AKIA 4QWNB 4BJNA 1HFAA 4QX8B 5FXZA 2ODVA 4CQIA 3FBLA 2YK0A 2VB6A 2MTQA 2WAUA 5J2UE 2LOPA 1CUNA 4XBFB 2C5IT 2NW7A 2X68A 2HH7A 4E7ZA 4DVDA 3O4XE 3PTRB 4WW0A 4CI1B 2Y6XA 2Z6EA 3UFEA 3MKDA 1ZHCA 2N1GA 2CLYC 3QUJA 1BR2A 2LSYA 4KBMB 3ANWB 5DQWA 4UXNB 2C5KT 4EAHA 4C90A 1HX8A 3F57A 2L9QA 1WRDA 5E0OA 5CA1E 1IJ5A 1LKXA 2JRKA 4QKNA 3M65A 4I55E 4IHJE 5L3EB 1HG5A 1IJ6A 4OK0A 3RYFE 3ZN1B 4YJ3E 2IAKA 1SA0E 4EZ4A 5HWXA 5EK3A 3AVRA 2DCFA 2CM0A 1MIVA 4XZCA 3UUXB 4IE7A 4GYRA 3CWZB 2JPFA 3WAKA 3ZYLA 2DI4A 4GIWA 2Q9QA 5F3JA 5IYZE 1UX4A 3OYZA 4OYKA 5CA0E 3ZMSB 1LRZA 4GOUA 5EK2A 2KWHA 3KV9A 5EZYE 4O4HE 3N5LA 4Z8XA 1VOMA 3F31A 5AFUL 2LOSA 3NRYA 3VKHA 2VWAA 2B1EA 1U5PA 4H9QC 4AKGA 4H9RC 4PFOA 4P0AA 2LSJA 5CB4E 4N78D 4X1KE 3HA4A 4PW8A 5HXEA 3ETUA 5LGTB 2JJ9A 3KBUA 5KX5E 1MIWA 4EIWA 1HF8A 3KDSE 3RRWA 3SWHA 4CI3B 4OYJA 2W00A 2V7IA 4ANJA 3RH3A 3AA6B 2DWKA 4TV8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M65 A;  2ANE A;  4CI3 B;  4TZ4 C;  4CI1 B;  3LJC A;  4CI2 B;  1ZBO A; 
#chains in the Genus database with same CATH topology
 5JDF A;  1JNZ A;  1D0X A;  3LBX B;  4HGA A;  5FY7 A;  5H6R B;  1MIY A;  1ZEE A;  5HEH A;  3EI0 A;  2QVA A;  2ZM0 A;  5HXS A;  4L9I A;  3HI2 A;  2IC9 A;  1D0Z A;  2L3L A;  2WDR A;  4GK0 E;  4A98 A;  4JV5 T;  5GON E;  3D0T A;  1FIO A;  2IML A;  4AQG A;  2X0L B;  4MLK A;  5IHY A;  4U72 A;  4QHO A;  2V6Y B;  1V9D A;  4B3S T;  3ONL C;  4NXM T;  1IT7 A;  3Q2M A;  2CBJ A;  5HCM A;  5AQL B;  4AQY T;  2MOZ A;  3N9P A;  1I6Z A;  3MAC A;  2VUR A;  2X9H A;  3ZMU B;  4DR4 T;  2QA7 A;  3UU6 A;  3LWQ A;  2WU2 A;  3BQL A;  2L8K A;  3U78 A;  4TWH A;  3QK6 A;  2K5B B;  3GWH A;  1G8X A;  4ZHQ E;  3NZQ A;  1UOY A;  4IDO A;  1YKE B;  4MBQ A;  3EUH A;  4MHC A;  2MYS A;  2BBH A;  4ZI2 C;  4PNI A;  1D0Y A;  2J5V A;  5LXT E;  2FJD A;  2XQ3 A;  3MA9 A;  1HG2 A;  2BS2 A;  3PUR A;  3RX6 A;  3P50 A;  3I1A A;  4LMK A;  4U31 A;  4PJN A;  5DQV A;  1N32 T;  3V5U A;  3K3N A;  3S4U A;  4O8S A;  3J7Y q;  3V5S A;  2WSS V;  3Q5W A;  2LT3 A;  3QNU A;  4M1P A;  3C4Z A;  3RYH E;  3IA3 A;  4EGW A;  3LJC A;  3N9O A;  2XSB A;  4PAG A;  5ABF A;  3OVU A;  4AKL A;  5FMN A;  4DBQ A;  2IIU A;  4CN1 A;  5AQH B;  2VKD A;  3P4P A;  4JI0 T;  2AB4 A;  2FJB A;  5BR8 T;  1E2A A;  2WY2 A;  1D1B A;  3NZP A;  2QRX A;  2Q9Q C;  3CX8 B;  3H3M A;  1UCU A;  4G63 A;  1MMD A;  3RGL A;  3AAA B;  4QH1 A;  4JEU B;  1R3F A;  3AE9 A;  1D1A A;  2HN2 A;  2XM2 A;  3BQI A;  1QSD A;  1UUR A;  1KNR A;  4J2C A;  1S94 A;  2Z0T A;  2UXN B;  2YOE A;  4H9P C;  3AA1 B;  4NIQ A;  3ESL A;  4LMJ A;  4ZZC A;  2W63 A;  3F2E A;  2UXX B;  5IWA T;  1M62 A;  2AUS A;  2XQA A;  3UUL A;  3O1J A;  5AQR B;  2CWW A;  2I6H A;  4PK5 A;  3ZT6 A;  4DV1 T;  3LK2 B;  2QGS A;  4AIS A;  1J5E T;  4DV6 T;  3ZYM A;  4LML A;  1WK2 A;  2AE9 A;  3L09 A;  5HYA A;  2CX0 A;  4IDZ A;  4IE6 A;  3UU5 A;  1H7C A;  2WWV A;  2JQ9 A;  5LJN A;  3FXD B;  3J9X 1;  2AS0 A;  1QLB A;  1MMN A;  4KHZ F;  3ONJ A;  2RPA A;  3C4W A;  4X1Y E;  4E7S A;  3ZPO A;  4ZS3 A;  3E08 A;  2SPC A;  1KNP A;  2CX1 A;  3K1S A;  2XAH B;  3I0O A;  5LHI B;  5H6Q B;  3TKL B;  4ZXL A;  2V5C A;  5HXH A;  2VAS A;  3LK3 B;  2H3R A;  3H37 A;  3L39 A;  5LBQ B;  1KNZ A;  5C3J A;  1Y64 B;  2W0G A;  4EZH A;  1NAF A;  2D2S A;  1CHU A;  2XJ7 A;  5CJ5 A;  3JCF A;  1I94 T;  3VHL A;  2DHR A;  3M6V A;  5JH7 E;  3MZK B;  5L3F B;  1OXZ A;  5ABF B;  1J5W A;  2A2F X;  2PG8 A;  2FJA A;  3UUB A;  2ZLY A;  2E5L T;  3IF8 B;  3RIA A;  4OX9 T;  1DU2 A;  3LDF A;  5ABH A;  4U2Y A;  3UU3 A;  4QXC B;  5AQQ B;  4IDN A;  4C91 A;  1FMV A;  2PFV A;  2KLQ A;  2V7M A;  1IBL T;  2VKO A;  4UF0 A;  1LVF A;  1XNR T;  4TV9 E;  5J1G A;  1HFA A;  4QX8 B;  5FXZ A;  5AQS B;  2YK0 A;  5J2U E;  4XBF B;  2HH7 A;  3UQ4 A;  4WW0 A;  3AEA A;  2C5K T;  3F57 A;  2L9Q A;  4QKN A;  1JNR A;  5L3E B;  1ZE1 A;  4YJ3 E;  2XQ5 A;  5HWX A;  2LRK A;  1XNQ T;  3WAK A;  5AQV B;  5F3J A;  1LRZ A;  3PUZ F;  4GOU A;  2KWH A;  3KV9 A;  2XSA A;  4DV5 T;  4Z8X A;  1VOM A;  3F31 A;  2FRX A;  1OED E;  4LFC T;  4H9R C;  4U33 A;  4YSX A;  3AE3 A;  3RIU A;  1HF8 A;  5ABE A;  4TWD A;  4OYJ A;  2W00 A;  3AA6 B;  4A97 A;  2X0Y A;  4TV8 E;  1NEK A;  2XQ9 A;  2WZI A;  3X1D A;  3NKZ A;  5JR9 A;  1ZBO A;  4LF9 T;  5A1L A;  2CXD A;  3GA8 A;  4YTN A;  1ZS7 A;  1WXX A;  4UR9 A;  3DJB A;  3AED A;  3CML A;  1WYB A;  4CXX A;  2NTY A;  1VCT A;  2I59 A;  4YHJ A;  1ZKE A;  4P09 A;  4YLH A;  1FMW A;  3JC6 C;  2D0T A;  2BZB A;  2XAG B;  4FI5 A;  5LA6 E;  2NTX A;  2XQY A;  3WAJ A;  3CX7 B;  1N34 T;  3CQC B;  4UEL A;  4NUU A;  1EZ3 A;  1VCS A;  3ZJ2 A;  4TX5 A;  4WYV A;  2LHR A;  2HHH T;  3KV5 A;  3ANW A;  4GK5 E;  4JYA T;  3RPU A;  3O1H A;  4EV6 A;  4O2B E;  1HS7 A;  2V26 A;  2VKJ A;  4LF8 T;  2BG9 A;  3AXJ A;  5FYM A;  4G2A A;  4DMG A;  3ZCI A;  5L47 A;  4ISS A;  5EK4 A;  4O2A E;  2LSK A;  2ZM2 A;  1U4Q A;  1IT8 A;  4DBR A;  4EXT A;  4EYY R;  2XQ6 A;  3SOL A;  2CEA A;  4DO0 A;  5FP3 A;  1OWA A;  2D5U A;  2WMN A;  1BR4 A;  1BR0 A;  1YQ3 A;  3PU8 A;  3A8Y C;  4ERR A;  5KDM C;  2XPK A;  1S35 A;  4WBO A;  1Z0P A;  2E5V A;  3ZMT B;  1WYC A;  5IUX A;  2KWI B;  4UV8 B;  2CXL A;  2LE8 A;  1N36 T;  3GN5 A;  4ZOL E;  1KF6 A;  2CA5 A;  3FZK B;  3N9L A;  3SFD A;  2P9B A;  2NW9 A;  1HNZ T;  4JI7 T;  2X51 A;  3M6U A;  3NBX X;  5TAO A;  3PV0 F;  4YFS A;  2YU2 A;  5JDM A;  3PE0 A;  3U3I A;  3HKD E;  4X65 T;  1YXR A;  4IT4 A;  2XM1 A;  4IE5 A;  3Q9D A;  4KHP T;  3SFE A;  4U74 A;  2UXC T;  3HJW A;  5JVD E;  3LWP A;  2E5O A;  5LOV E;  3CX6 B;  4I43 B;  4HFH A;  5JR9 B;  4B3M T;  4L5G A;  3WI3 A;  1XDP A;  2CHN A;  4AXP A;  2DLR A;  4O4J E;  1MMG A;  4OHF A;  2N2N A;  3UUN A;  2E2A A;  3TLU A;  2UU9 T;  1HNW T;  2OV9 A;  5AQT B;  3ZEF B;  2FUP A;  1UX5 A;  3KFW X;  3RKG A;  5JTG A;  4DR2 T;  3O9X A;  3C0K A;  5LJM A;  3AEF A;  2MPK A;  4PK6 A;  3T1H T;  3RIU C;  3PUQ A;  3CIR A;  1MNE A;  2N9D A;  4B3R T;  3AE4 A;  5FXX A;  5JR9 C;  2DWG A;  2V7J A;  2CBI A;  4LFB T;  1UGO A;  4JI8 T;  3C51 A;  5FY0 A;  3TLS A;  2KIN B;  3PDY A;  1W0B A;  4PJJ A;  5AQJ B;  4DV3 T;  3AXJ B;  2LSI A;  2VK9 A;  4B6X A;  5DAB A;  3VR8 A;  2VQF T;  3T1Y T;  2AXD S;  2XUE A;  4KMC A;  4P1N A;  4ZI2 D;  2CPT A;  3B57 A;  4TWF A;  1VRB A;  2VL8 A;  4WNK A;  2CRB A;  2CHO A;  4B3T T;  1D1C A;  1T8B A;  2Q9Q B;  3EVY A;  4BA9 A;  5LMN T;  3AVS A;  3RHW A;  3BQK A;  1XWM A;  4UVC B;  3GN5 B;  3MK7 C;  3FBZ A;  1E1H B;  2LEH A;  4WBN E;  5F8P A;  2LJL A;  3B5M A;  3AE6 A;  2G0U A;  2BG9 C;  5L4H A;  2WBL A;  3AB3 B;  2KT9 A;  4IL9 A;  1Z8U A;  2EHO A;  2UXD T;  4LFA T;  3Q5X A;  3MXZ A;  2BBJ A;  3P8C D;  3A5X A;  4ASK A;  3GMI A;  3PUA A;  2YIN A;  4CXY A;  2ZMA A;  4JI3 T;  2YKS A;  2XAQ B;  3IBP A;  2D0U A;  1YQ4 A;  2V1D B;  3OKQ A;  2Q07 A;  1IBK T;  4V1A v;  3RI5 A;  2WMO A;  2Q9Q D;  5L3G B;  4DR6 T;  3M6W A;  4IGU A;  1SHZ C;  5LMU T;  4BJM A;  4X64 T;  2NR4 A;  2WP9 A;  2XAF B;  2M6B A;  4BJN A;  2ODV A;  3FBL A;  2LOP A;  1CUN A;  1J1J A;  2V5D A;  3EAB A;  4E7Z A;  4DVD A;  3O4X E;  3PTR B;  4EAH A;  4C90 A;  1T5Y A;  3U28 A;  1WFD A;  5AQO B;  3M65 A;  4OK0 A;  4Z90 A;  3ZN1 B;  4GKK T;  4IRE A;  4EZ4 A;  5EK3 A;  4YT0 A;  2DCF A;  1MIV A;  2JIW A;  3UUX B;  4GYR A;  2WDV A;  2DI4 A;  4GIW A;  4X62 T;  3ZMS B;  2LM2 A;  5EK2 A;  5AFU L;  3NRY A;  3VKH A;  4KX6 A;  4YSY A;  4HWC A;  4PFO A;  5CB4 E;  3P4R A;  3HA4 A;  3ETU A;  3KBU A;  1MIW A;  3PUX F;  4CI3 B;  2K3W A;  3LG7 A;  2E9X A;  5AQU B;  2WM9 A;  2PJQ A;  4NPP A;  3D79 A;  4YHH T;  5JRC A;  4BAY B;  5KMG P;  5FKY A;  5ADX L;  2KXP B;  1ZE2 A;  4IST A;  4IE0 A;  3ZC0 A;  1SQW A;  4X20 E;  2WZH A;  3AA0 B;  1BR1 A;  2OA5 A;  1T98 A;  4H63 V;  4HKA A;  4ZZB A;  5M4Y A;  4IIJ E;  1Y01 A;  5ABG A;  2J5T A;  3I0Q A;  4DID B;  4U2Z A;  4H9O C;  3I9W A;  5AQN B;  3KV4 A;  2ACZ A;  3B13 A;  1O3X A;  1GQE A;  3OJA A;  2YDQ A;  2M67 A;  4ZI3 C;  2EY4 A;  5L2L A;  4FJO A;  4XAX B;  4Z91 A;  2JQQ A;  5LBM A;  1KEY A;  4DV4 T;  5HEO A;  3RYI E;  2CE7 A;  5J2T E;  2HPL A;  3BK9 A;  4KI0 F;  2J62 A;  2J1D G;  2EHO C;  1HTJ F;  2LM9 A;  2YDS A;  2LKH A;  3MJX A;  3PUG A;  2KMF A;  5HEJ A;  1W09 A;  2Y48 B;  3JAE A;  3IEE A;  2B76 A;  3QB5 A;  5JDQ A;  4IDP A;  4ZI7 E;  2HN1 A;  4MFR A;  3Q5D A;  3ETV A;  2KSR A;  1ZOY A;  3UTK A;  2C0S A;  2UUB T;  3ZYK A;  2IW5 B;  2NWB A;  2P38 A;  3C50 A;  3NWI A;  4UV9 B;  1ZL3 A;  4TN7 B;  5LB7 B;  4H9S E;  3IUW A;  4F8H A;  2VKH A;  4TNW A;  4H9N C;  5LGU B;  3PJA A;  2J47 A;  3UU4 A;  3RQU A;  3HL6 A;  1N33 T;  3PUW F;  5CGM A;  5HEG A;  3EDV A;  4HWH A;  3L3P A;  2X9W A;  4A5X A;  4HE8 A;  5JRE A;  2R6G F;  4CN6 A;  2E9X B;  5JDH A;  1IQ8 A;  4KUM B;  4ILU A;  1K8W A;  5FXW A;  4PJL A;  5JRC B;  5LNK A;  4PFP A;  3AE8 A;  4ILA A;  3RF1 A;  4JI1 T;  4AIU A;  5JQG E;  2K48 A;  4TZ4 C;  2JMH A;  4OFZ A;  2ZM8 A;  3JC6 D;  2WQY A;  2CXF A;  2W62 A;  4DMV A;  1SGV A;  2W67 A;  4JBW F;  4DND A;  2BVL A;  4UF0 B;  1TE7 A;  4UVB B;  4HFV A;  3OYX A;  2CCQ A;  3AEE A;  3CVR A;  2WS3 A;  2XQ4 A;  4COF A;  1Q7H A;  1XMO T;  2CMR A;  5BMV E;  2E9X C;  3ZMV B;  2E8I A;  3LWV A;  2A3D A;  3QOF A;  1IZN B;  3AE7 A;  3N9N A;  4QXH B;  3Q5E A;  3A7M A;  3KBT A;  4TNV A;  3PUS A;  2M6I A;  5HXC A;  2H88 A;  4DR3 T;  4DMW A;  1WLX A;  4JEH B;  4U3C A;  3M3Z B;  3RIF A;  4JUY A;  2E9X D;  4AI6 A;  4HWF A;  4JI6 T;  3ZN0 B;  3ZT5 A;  2ACX A;  1S04 A;  1YD8 G;  2H89 A;  4QX7 B;  4H63 H;  3PU3 A;  2BS3 A;  4CZZ B;  3ZC1 A;  5LHH B;  4K0K T;  2RFK A;  3NRX A;  4AKH A;  4EYU A;  3SRZ A;  2B78 A;  2W61 A;  3VU7 H;  3CPZ A;  3KVA A;  4A56 A;  1XZY A;  2I0M A;  3E0Z A;  3R6N A;  5ETW A;  2D9D A;  2NP9 A;  4QXB B;  1R3E A;  3QC9 A;  3UU8 A;  2QYW A;  5FY1 A;  3RQW A;  4QH5 A;  3FZH B;  3EHZ A;  2YU1 A;  1W0A A;  5C8Y E;  3C4X A;  3KV6 A;  1W9R A;  4CXW A;  1NWM X;  2CLY B;  2ODU A;  3RLF F;  1MMA A;  1NEN A;  2IC6 A;  4JI2 T;  1YKH B;  4LF6 T;  1KK7 A;  3AAI A;  1R8I A;  4K0U A;  1T72 A;  4HEA A;  4HN9 A;  4DR1 T;  3AA7 B;  4ZEY A;  3N2K E;  4HWI B;  4HFE A;  3OBV E;  4AKI A;  1HNX T;  4CQI A;  2VB6 A;  2MTQ A;  2JQH A;  4CI1 B;  2Z6E A;  3UFE A;  4X66 T;  1ZHC A;  2CLY C;  3QUJ A;  2LSY A;  4KBM B;  3ANW B;  5DQW A;  1FJG T;  2OLT A;  3FZF B;  5E0O A;  5CA1 E;  1IJ5 A;  3LWR A;  1LKX A;  5FVL A;  2BG9 B;  4IHJ E;  1IJ6 A;  3RYF E;  1SA0 E;  3FZL B;  2UXB T;  3NVO A;  4EEB A;  4IE7 A;  3CWZ B;  3L8R A;  2W2U A;  3OYZ A;  3PUV F;  2IUB A;  5EZY E;  4O4H E;  3M6X A;  2VWA A;  3LWO A;  1U5P A;  4I0U A;  4P0A A;  2LSJ A;  4N78 D;  4X1K E;  1X9B A;  4PW8 A;  3UQ7 A;  4X5T A;  5KX5 E;  2BKO A;  3FZM B;  3RRW A;  3SWH A;  4ANJ A;  3CK6 A;  1IBM T;  3IHR A;  2H7O A;  4F6R C;  2VL0 A;  3RC3 A;  4U7I A;  3RYC E;  2W66 A;  4ADZ A;  2GK9 A;  2BG9 E;  3C98 B;  2DL1 A;  4NXN T;  2X66 A;  2CWO A;  3VKG A;  1UUS A;  2VVN A;  2WB5 A;  3CKD A;  1ZP0 A;  5CFB A;  2K24 A;  3SS1 A;  1OED A;  3AEG A;  1WCR A;  4AQF A;  3AAE B;  1HX1 B;  1SUM B;  3K8P C;  5JDN A;  3UAI A;  1FEW A;  1US7 B;  3VRB A;  2APO A;  5LG4 A;  5L3B B;  4UVA B;  3FHN A;  2K9A A;  5LYJ E;  2F4V T;  4CN4 A;  4U7Y A;  4EOZ B;  5HXR A;  4PK4 A;  4UEM A;  3TLV A;  2FJE A;  2LHN A;  4HWD A;  3I9Y A;  2LSG A;  2RP4 A;  3CQG B;  1XNE A;  3G06 A;  1QUU A;  2XZE A;  2YDR A;  3PJA J;  3ZMZ B;  1MND A;  4YJ2 E;  5AQI B;  2BS4 A;  4YSZ A;  2NW8 A;  2LKG A;  3K3O A;  4X1I E;  5JDG A;  2V6X A;  2LRL A;  2WU5 A;  5F5W A;  5AQK B;  5AQP B;  5AQF B;  4ILB A;  5FNV E;  3EDU A;  1IAP A;  1HR0 T;  3LK4 2;  2X9X A;  4EB6 E;  2BKP A;  2UUA T;  3FXE B;  3TLT A;  2HPJ A;  5FVK A;  4I50 E;  1XDO A;  3LFM A;  2V7L A;  1B7T A;  2V7K A;  3MQK A;  2J4G A;  4HFB A;  2JMK A;  5HWY A;  4DV2 T;  4IDQ A;  2NOX A;  3C64 A;  3ZCJ A;  5C2T A;  3AE2 A;  4MAL A;  3KIN B;  4O4I E;  1J2B A;  2A72 A;  1WR0 A;  4JLE A;  1HCI A;  3E22 E;  4IL4 A;  2LLY A;  3EAM A;  5L4E A;  3CQX C;  3PUY F;  2EHO B;  5FL1 A;  4IE4 A;  2XTL A;  2WWU A;  3ZLI A;  3AE5 A;  3N2O A;  4NUV A;  5FXV A;  3HKB E;  4ILC A;  3VRA A;  3RC8 A;  2XQ7 A;  2VVS A;  4KP3 C;  2ANE A;  1M7K A;  4WZX A;  4DV7 T;  3ZJ1 A;  3ZKR A;  1XMQ T;  4CI2 B;  2V8S V;  2WCA A;  1OED B;  2FBW A;  2XHE B;  3ZT7 A;  3ZV0 C;  5AQG B;  3K3Q C;  5L3C B;  4DR5 T;  4UIG A;  2XAS B;  5LCY A;  3T8O A;  2DNX A;  5DJQ C;  2XQ8 A;  2Y8D A;  3P7I A;  4JI4 T;  2IDO B;  4TUY E;  4HFC A;  3UUM A;  4ZI3 D;  3HAX A;  2XY8 B;  1UK5 A;  4HFI A;  2PBI A;  3KVB A;  3ZSS A;  3LDQ B;  1X79 A;  5FL0 A;  2ES0 A;  2MAW A;  2EHO D;  4YY3 T;  1AJ3 A;  2BKN A;  3O1I A;  5J0Z A;  2C5J A;  2WDQ A;  4I4T E;  3OPC A;  4L0R A;  3H3A A;  5LGN B;  1OED C;  3JAD A;  2BVM A;  4AQF C;  3LSV A;  3HKE E;  5HEU A;  5L3D B;  2H7V C;  2DP9 A;  3DP7 A;  1WR6 A;  2BDE A;  3P4W A;  4Q25 A;  2KKU A;  2ZM6 T;  4Q1T A;  4ZS2 A;  3HR0 A;  3W15 B;  4AKR B;  3M4X A;  3OTO T;  2X9Y A;  5JDL A;  3RKO A;  3LBX A;  2MBG A;  3ONX A;  4YTP A;  2X67 A;  1SE7 A;  1LVK A;  4GYS A;  3AE1 A;  3P4S A;  2KND A;  2UUC T;  4O4L E;  4DUZ T;  3UFG A;  4YTM A;  1ZV4 X;  3DTO A;  2YN6 A;  5LP6 E;  2X0H A;  3FB2 A;  4DUY T;  5KXJ A;  5HCJ A;  1E7P A;  3R84 B;  4PJM A;  2A9U A;  4LF7 T;  3N9Q A;  4HTE A;  4P0B A;  2CWY A;  2V6Y A;  3TLW A;  1L0V A;  4GKJ T;  2XAJ B;  3RRC A;  5HAX A;  5AQM B;  1G73 A;  3UT5 E;  2RA1 A;  2YEV C;  3HKC E;  1YW0 A;  2KZ7 B;  3P4Q A;  3N9M A;  3N2G E;  4HFD A;  5LHG B;  4QWN B;  3QB5 K;  2WAU A;  3ZST A;  2C5I T;  2NW7 A;  2X68 A;  2VQE T;  2Y6X A;  3MKD A;  2PTF A;  2N1G A;  4LF5 T;  1BR2 A;  4DR7 T;  4UXN B;  2JQK A;  3HJY A;  1HX8 A;  1WRD A;  1T7S A;  2JRK A;  4DV0 T;  4I55 E;  1HG5 A;  2W4X A;  4JI5 T;  4QH4 A;  2HVY A;  1KFY A;  4EED A;  2IAK A;  3AVR A;  3AEC A;  4YXD A;  2CM0 A;  4XZC A;  2IHR 1;  2JPF A;  3VSE A;  3ZYL A;  2Q9Q A;  5IYZ E;  1UX4 A;  4OYK A;  5CA0 E;  5LG3 A;  1WXW A;  4LF4 T;  3N5L A;  2LOS A;  3VR9 A;  2B1E A;  4H9Q C;  4AKG A;  5HXE A;  5LGT B;  2JJ9 A;  3JAF A;  3AEB A;  4EIW A;  3KDS E;  3ABV A;  2V7I A;  3RH3 A;  2DWK A; 
#chains in the Genus database with same CATH homology
 3IHR A;  2H7O A;  3LG7 A;  2E9X A;  5JDF A;  1D0X A;  3LBX B;  4HGA A;  5JR9 A;  4F6R C;  2WM9 A;  2PJQ A;  3RC3 A;  5FY7 A;  1ZBO A;  5H6R B;  5A1L A;  3RYC E;  1MIY A;  1ZEE A;  2CXD A;  3GA8 A;  4ADZ A;  2GK9 A;  4BAY B;  5KMG P;  5JRC A;  3C98 B;  5ADX L;  2KXP B;  3DJB A;  2X66 A;  2ZM0 A;  2CWO A;  5HXS A;  3VKG A;  4L9I A;  3HI2 A;  3CML A;  2IC9 A;  4IST A;  1D0Z A;  1WYB A;  2L3L A;  4IE0 A;  3ZC0 A;  4CXX A;  4X20 E;  2NTY A;  2I59 A;  4GK0 E;  4YHJ A;  3CKD A;  1ZKE A;  3AA0 B;  1BR1 A;  2OA5 A;  4P09 A;  1T98 A;  5GON E;  4YLH A;  3D0T A;  1FIO A;  4H63 V;  4HKA A;  1FMW A;  5M4Y A;  3JC6 C;  2D0T A;  4IIJ E;  2BZB A;  2K24 A;  2XAG B;  3SS1 A;  2X0L B;  4AQG A;  4FI5 A;  4MLK A;  5LA6 E;  4AQF A;  5IHY A;  2NTX A;  4U72 A;  3AAE B;  4QHO A;  1V9D A;  3I0Q A;  2XQY A;  4H9O C;  3WAJ A;  3I9W A;  3KV4 A;  3CX7 B;  3K8P C;  3B13 A;  5JDN A;  3Q2M A;  1O3X A;  1FEW A;  3OJA A;  1US7 B;  3CQC B;  4UEL A;  2M67 A;  4NUU A;  1EZ3 A;  3ZJ2 A;  4TX5 A;  4ZI3 C;  2LHR A;  2MOZ A;  5L3B B;  3N9P A;  5LG4 A;  5L2L A;  3MAC A;  4UVA B;  3FHN A;  2X9H A;  2K9A A;  3KV5 A;  4FJO A;  3ANW A;  4XAX B;  3ZMU B;  5LYJ E;  4GK5 E;  2QA7 A;  3O1H A;  3RPU A;  2JQQ A;  5LBM A;  1HS7 A;  4O2B E;  2V26 A;  3RYI E;  2CE7 A;  4EOZ B;  5J2T E;  2VKJ A;  3BQL A;  2HPL A;  2L8K A;  4PK4 A;  5HXR A;  3QK6 A;  4UEM A;  3U78 A;  2K5B B;  3BK9 A;  3GWH A;  1G8X A;  2J1D G;  2EHO C;  2LHN A;  5FYM A;  1HTJ F;  2LM9 A;  3NZQ A;  4G2A A;  4ZHQ E;  3ZCI A;  3MJX A;  3PUG A;  2KMF A;  3I9Y A;  2LSG A;  2RP4 A;  4ISS A;  5EK4 A;  4O2A E;  1YKE B;  2LSK A;  2ZM2 A;  3CQG B;  4MBQ A;  2Y48 B;  3EUH A;  1U4Q A;  4MHC A;  2MYS A;  4DBR A;  4EXT A;  4EYY R;  1QUU A;  3SOL A;  4ZI2 C;  2CEA A;  4DO0 A;  3IEE A;  4PNI A;  3ZMZ B;  1MND A;  5FP3 A;  4YJ2 E;  5JDQ A;  1OWA A;  2D5U A;  1D0Y A;  2WMN A;  1BR4 A;  1BR0 A;  2NW8 A;  3K3O A;  4X1I E;  4ZI7 E;  3PU8 A;  5LXT E;  4ERR A;  5KDM C;  4MFR A;  3MA9 A;  1HG2 A;  1S35 A;  3ETV A;  5JDG A;  4WBO A;  1Z0P A;  3PUR A;  3RX6 A;  3ZMT B;  3I1A A;  1WYC A;  3UTK A;  5FNV E;  2KWI B;  4UV8 B;  2CXL A;  3EDU A;  4PJN A;  1IAP A;  2LE8 A;  3LK4 2;  2C0S A;  3GN5 A;  2X9X A;  5DQV A;  3ZYK A;  4ZOL E;  4EB6 E;  2CA5 A;  2IW5 B;  3V5U A;  3K3N A;  3N9L A;  2NWB A;  3S4U A;  4O8S A;  3FXE B;  3C50 A;  3J7Y q;  2HPJ A;  2P9B A;  4UV9 B;  2NW9 A;  3V5S A;  2WSS V;  4I50 E;  4TN7 B;  2X51 A;  3Q5W A;  4H9S E;  2LT3 A;  3LFM A;  2VKH A;  2V7L A;  4M1P A;  3C4Z A;  3RYH E;  4H9N C;  1B7T A;  2V7K A;  5LGU B;  5HWY A;  2JMK A;  3NBX X;  5TAO A;  4YFS A;  2YU2 A;  5JDM A;  2NOX A;  3LJC A;  3C64 A;  3N9O A;  3ZCJ A;  4PAG A;  3PE0 A;  3U3I A;  3HKD E;  3HL6 A;  4MAL A;  3KIN B;  4O4I E;  2A72 A;  4JLE A;  3EDV A;  4AKL A;  4IE5 A;  1HCI A;  3E22 E;  3Q9D A;  5FMN A;  4U74 A;  4DBQ A;  3L3P A;  2X9W A;  4HE8 A;  5JVD E;  5JRE A;  3CQX C;  5LOV E;  3CX6 B;  2VKD A;  2EHO B;  2E9X B;  4I43 B;  4IE4 A;  2XTL A;  2WWU A;  5JR9 B;  5JDH A;  3ZLI A;  4KUM B;  4L5G A;  4ILU A;  3WI3 A;  3N2O A;  4NUV A;  1D1B A;  3NZP A;  3HKB E;  5FXV A;  5FXW A;  4AXP A;  2DLR A;  4PJL A;  4O4J E;  5JRC B;  2Q9Q C;  3CX8 B;  1MMG A;  4OHF A;  2N2N A;  5LNK A;  1UCU A;  4G63 A;  4PFP A;  3UUN A;  1MMD A;  3AAA B;  3RC8 A;  5JQG E;  2K48 A;  4KP3 C;  4JEU B;  2ANE A;  3ZEF B;  3ZJ1 A;  4TZ4 C;  1UX5 A;  3KFW X;  2JMH A;  1D1A A;  3BQI A;  4OFZ A;  3O9X A;  1QSD A;  2ZM8 A;  4CI2 B;  3JC6 D;  5LJM A;  4J2C A;  1S94 A;  2CXF A;  2UXN B;  4H9P C;  2W62 A;  2XHE B;  4DMV A;  3AA1 B;  4PK6 A;  3ESL A;  4DND A;  2BVL A;  3PUQ A;  4UF0 B;  3K3Q C;  4UVB B;  4HFV A;  3OYX A;  4UIG A;  5L3C B;  2CCQ A;  2XAS B;  5LCY A;  3T8O A;  3CVR A;  2W63 A;  2DNX A;  3F2E A;  5DJQ C;  2UXX B;  1MNE A;  2Y8D A;  3P7I A;  2CMR A;  4TUY E;  5BMV E;  2E9X C;  2N9D A;  3UUM A;  3ZMV B;  2E8I A;  3UUL A;  5FXX A;  3O1J A;  2A3D A;  5JR9 C;  2DWG A;  2V7J A;  4PK5 A;  4ZI3 D;  1IZN B;  3LK2 B;  3N9N A;  4QXH B;  2QGS A;  2PBI A;  3KBT A;  3ZYM A;  3C51 A;  3PUS A;  5FY0 A;  3KVB A;  5HXC A;  2KIN B;  3PDY A;  4PJJ A;  3L09 A;  4DMW A;  5HYA A;  1WLX A;  4IDZ A;  4JEH B;  4IE6 A;  1H7C A;  1X79 A;  5LJN A;  3FXD B;  2ES0 A;  4JUY A;  2EHO D;  3J9X 1;  2E9X D;  2LSI A;  2VK9 A;  4B6X A;  4AI6 A;  5DAB A;  1AJ3 A;  3O1I A;  1MMN A;  2XUE A;  4KMC A;  3ZN0 B;  2C5J A;  2ACX A;  4I4T E;  4ZI2 D;  4L0R A;  1YD8 G;  3H3A A;  3B57 A;  5LGN B;  4QX7 B;  1VRB A;  2BVM A;  3C4W A;  4AQF C;  4H63 H;  4X1Y E;  3HKE E;  3PU3 A;  2VL8 A;  5L3D B;  4WNK A;  4E7S A;  2H7V C;  1D1C A;  4ZS3 A;  3E08 A;  3ZPO A;  2SPC A;  3DP7 A;  3ZC1 A;  4CZZ B;  1WR6 A;  2BDE A;  2Q9Q B;  5LHH B;  3EVY A;  4BA9 A;  2XAH B;  3I0O A;  5LHI B;  3AVS A;  3NRX A;  3BQK A;  5H6Q B;  4UVC B;  4ZS2 A;  3HR0 A;  3W15 B;  4AKR B;  4AKH A;  4EYU A;  2X9Y A;  3SRZ A;  3GN5 B;  5JDL A;  3TKL B;  2W61 A;  3RKO A;  3VU7 H;  3LBX A;  3MK7 C;  2MBG A;  5HXH A;  3CPZ A;  3FBZ A;  2VAS A;  3LK3 B;  3ONX A;  1E1H B;  2H3R A;  2LEH A;  2X67 A;  3H37 A;  3KVA A;  4A56 A;  4WBN E;  1LVK A;  5F8P A;  5LBQ B;  2LJL A;  4GYS A;  3E0Z A;  2KND A;  3R6N A;  1KNZ A;  2G0U A;  5ETW A;  4O4L E;  1Y64 B;  2NP9 A;  2W0G A;  4QXB B;  1NAF A;  4EZH A;  2WBL A;  2D2S A;  3QC9 A;  3AB3 B;  1ZV4 X;  3DTO A;  5FY1 A;  5LP6 E;  2KT9 A;  3FB2 A;  2DHR A;  2YU1 A;  2EHO A;  3VHL A;  5JH7 E;  3MZK B;  5C8Y E;  3Q5X A;  5L3F B;  3MXZ A;  3P8C D;  3C4X A;  3KV6 A;  1OXZ A;  4CXW A;  3A5X A;  4ASK A;  1NWM X;  3GMI A;  3R84 B;  3PUA A;  2CLY B;  2ODU A;  4PJM A;  1MMA A;  2YIN A;  4CXY A;  2ZMA A;  3N9Q A;  2A2F X;  2PG8 A;  4HTE A;  4P0B A;  2CWY A;  2XAQ B;  2IC6 A;  3IBP A;  1YKH B;  2ZLY A;  2D0U A;  1KK7 A;  3AAI A;  2XAJ B;  3IF8 B;  2V1D B;  3OKQ A;  3RRC A;  5HAX A;  4K0U A;  4V1A v;  4QXC B;  1G73 A;  3UT5 E;  1FMV A;  2RA1 A;  2YEV C;  3HKC E;  4HEA A;  4HN9 A;  4C91 A;  1YW0 A;  2PFV A;  2WMO A;  2KLQ A;  2KZ7 B;  2V7M A;  2Q9Q D;  3AA7 B;  5L3G B;  2VKO A;  3N2K E;  4IGU A;  3N9M A;  3N2G E;  1SHZ C;  4BJM A;  4UF0 A;  1LVF A;  4TV9 E;  3OBV E;  5LHG B;  2XAF B;  5J1G A;  4AKI A;  4QWN B;  4BJN A;  1HFA A;  4QX8 B;  5FXZ A;  2ODV A;  4CQI A;  3FBL A;  2YK0 A;  2VB6 A;  2MTQ A;  2WAU A;  5J2U E;  2LOP A;  1CUN A;  4XBF B;  2C5I T;  2NW7 A;  2X68 A;  2HH7 A;  4E7Z A;  4DVD A;  3O4X E;  3PTR B;  4WW0 A;  4CI1 B;  2Y6X A;  2Z6E A;  3UFE A;  3MKD A;  1ZHC A;  2N1G A;  2CLY C;  3QUJ A;  1BR2 A;  2LSY A;  4KBM B;  3ANW B;  5DQW A;  4UXN B;  2C5K T;  4EAH A;  4C90 A;  1HX8 A;  3F57 A;  2L9Q A;  1WRD A;  5E0O A;  5CA1 E;  1IJ5 A;  1LKX A;  2JRK A;  4QKN A;  3M65 A;  4I55 E;  4IHJ E;  5L3E B;  1HG5 A;  1IJ6 A;  4OK0 A;  3RYF E;  3ZN1 B;  4YJ3 E;  2IAK A;  1SA0 E;  4EZ4 A;  5HWX A;  5EK3 A;  3AVR A;  2DCF A;  2CM0 A;  1MIV A;  4XZC A;  3UUX B;  4IE7 A;  4GYR A;  3CWZ B;  2JPF A;  3WAK A;  3ZYL A;  2DI4 A;  4GIW A;  2Q9Q A;  5F3J A;  5IYZ E;  1UX4 A;  3OYZ A;  4OYK A;  5CA0 E;  3ZMS B;  1LRZ A;  4GOU A;  5EK2 A;  2KWH A;  3KV9 A;  5EZY E;  4O4H E;  3N5L A;  4Z8X A;  1VOM A;  3F31 A;  5AFU L;  2LOS A;  3NRY A;  3VKH A;  2VWA A;  2B1E A;  1U5P A;  4H9Q C;  4AKG A;  4H9R C;  4PFO A;  4P0A A;  2LSJ A;  5CB4 E;  4N78 D;  4X1K E;  3HA4 A;  4PW8 A;  5HXE A;  3ETU A;  5LGT B;  2JJ9 A;  3KBU A;  5KX5 E;  1MIW A;  4EIW A;  1HF8 A;  3KDS E;  3RRW A;  3SWH A;  4CI3 B;  4OYJ A;  2W00 A;  2V7I A;  4ANJ A;  3RH3 A;  3AA6 B;  2DWK A;  4TV8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...