3M65A

Crystal structure of bacillus subtilis lon n-terminal domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
204
Chain Sequence
ELKRSIPLLPLRGLLVYPTMVLHLDVGRDKSVQALEQAMMHDHMIFLATQQDISIDEPGEDEIFTVGTYTKIKQMLKLPNGTIRVLVEGLKRAHIVKYNEHEDYTSVDIQLIHEDKDTEDEALMRTLLDHFDQYIKISKKISAETYAAVTDIEEPGRMADIVASHLPLKLKDKQDILETADVKDRLNKVIDFINNEKEVLEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent protease La 1
publication title Crystal Structures of Bacillus subtilis Lon Protease.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 61
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3m65A02
2.30.130.40 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 LON domain-like 3m65A01
3M65A 4CI1B 2ANEA 4CI3B 3LJCA 1ZBOA 4CI2B 4TZ4C
chains in the Genus database with same CATH superfamily
4ISSA 2AXDS 2XQ7A 2XY8B 2XM2A 4KX6A 2LLYA 5J0ZA 3IA3A 4EV6A 4DV6T 1YXRA 1Y01A 5AQIB 1ZOYA 2GK9A 5AQSB 3ZMVB 4KMCA 3SFEA 5JR9A 3UFEA 2QYWA 3OVUA 1SE7A 2JQHA 4LMLA 2VVSA 1FMVA 4BJMA 5C2TA 2V6YB 5HCJA 3PUQA 4EYYR 4EXTA 3A8YC 3SWHA 5CJ5A 1WK2A 2CMRA 5JTGA 2E2AA 4NIQA 2DCFA 5AFUL 4KBMB 5AQFB 3PUAA 4LF7T 4MFRA 3LWVA 1U4QA 2I0MA 2N1GA 3AEEA 3ONXA 3O4XE 4QKNA 2C5JA 2IDOB 3Q5EA 2E9XA 4UVBB 2Q9QC 4YSXA 3ZJ1A 3I0QA 2P9BA 3VKHA 4KI0F 2RFKA 3J9X1 4IL4A 3MJXA 3FZMB 3ZMUB 4GKJT 4JI8T 2KINB 2WWUA 2UUCT 4AKHA 4CXYA 1E2AA 4PFOA 4L0RA 1KK7A 4NXMT 3DJBA 4YHHT 2A3DA 4BAYB 4WBNE 4B3TT 3NRXA 2UUAT 1WXWA 4GYRA 4PAGA 5IWAT 2OA5A 2VURA 4CI3B 2K48A 3ZKRA 2UUBT 5L3BB 1L0VA 4JV5T 4BA9A 3PURA 3AE2A 4HWFA 1HNXT 1S94A 2UXXB 2CWWA 2G0UA 1MMDA 4K0UA 3C98B 1N33T 3D79A 4HGAA 3NZQA 2UXBT 3K1SA 5HXEA 2L3LA 5L3FB 5KX5E 5IYZE 5AQGB 2W66A 2JJ9A 5HXRA 5L47A 5AQVB 4J2CA 5CB4E 1VCSA 5FXWA 2BG9C 4IIJE 3RI5A 5J2TE 4OX9T 2HPLA 2WZHA 1UX4A 2W67A 2XQAA 3C4ZA 3EABA 5LJMA 2B1EA 1HCIA 4HEAA 2X0HA 4DNDA 4U74A 3EI0A 4CI2B 3AEDA 5LG4A 3RYCE 4AQFA 4GKKT 3LWOA 3MQKA 3AXJA 3FB2A 2E5VA 1D0XA 3BQKA 3KVAA 4UV9B 4ZI2C 4GIWA 4A56A 2JQQA 3I0OA 2C0SA 3AAAB 5EK4A 3HR0A 1MMGA 3MKDA 4EIWA 3R84B 5LNKA 2CXLA 4DUZT 3HKBE 4Z91A 2LSIA 2KSRA 4E7SA 4DBRA 4LF8T 4MHCA 4OHFA 3O1IA 3RH3A 4DBQA 4YTMA 3TLTA 2CWOA 3LFMA 4TV8E 4JBWF 5FYMA 4ZXLA 3PUSA 4QX8B 3JADA 1T8BA 2E8IA 2JPFA 5H6RB 4P1NA 5JREA 1IJ5A 3FZKB 5HXSA 2UXNB 4TV9E 1W0AA 1YW0A 4M1PA 3E08A 4H9SE 4U31A 1XNQT 4FI5A 2I59A 2CLYB 2ZM2A 3AVRA 4CXXA 4PK5A 2MYSA 5LB7B 2NR4A 3P4SA 3O1HA 2V6XA 5JQGE 3QB5K 2DI4A 2WM9A 3VKGA 4YT0A 3OYXA 5AQJB 4IDPA 2ZLYA 4ZZCA 4DR2T 3ZMZB 2A9UA 2UXDT 2PG8A 4IDNA 3HA4A 2LSGA 4O4HE 5FY7A 5ADXL 2C5IT 5FL0A 2NW8A 2XQYA 5KDMC 3T8OA 4LFBT 5L3GB 3AVSA 3FBZA 1D1CA 5GONE 3MXZA 2FUPA 2BVMA 1IZNB 3AB3B 1N36T 3LWQA 2LKHA 1U5PA 1UOYA 2XASB 4CN1A 2FRXA 4MBQA 1ZEEA 3F31A 3LK3B 2HN1A 3KDSE 2WMOA 2VVNA 4X1KE 1S35A 1BR0A 5HYAA 2X66A 4DR5T 5LHGB 5LYJE 3AA6B 1R8IA 1WR0A 4IDOA 5AQRB 2K3WA 3JAFA 1XZYA 1XMOT 2CE7A 1HNZT 4O2BE 4IE7A 3MACA 2V5DA 4O2AE 1YQ4A 5HXHA 5L4HA 1US7B 2J5TA 2V7JA 2YINA 2W00A 1UCUA 3IF8B 4L5GA 2ODVA 2PJQA 5HEHA 1JNRA 3K3OA 3LDFA 5ETWA 2A72A 4ZZBA 2KXPB 5FY0A 3N9NA 1T5YA 2YOEA 3FZFB 3Q5DA 3O1JA 1I94T 2LE8A 3B5MA 2UU9T 1LKXA 4X64T 2KZ7B 4YTNA 1VOMA 4GOUA 4TWHA 1T98A 1X79A 1IT7A 1OEDC 2VWAA 3RYHE 1X9BA 2K5BB 2BG9A 4ZI7E 3PDYA 5FXZA 3RYFE 1YKEB 2MOZA 4DR3T 4Z8XA 4EEBA 2D9DA 1IBLT 2KNDA 1SA0E 1FJGT 5JDHA 2XAFB 3PTRB 2HHHT 3SOLA 4AISA 5AQPB 3HI2A 1ZL3A 5F3JA 4JYAT 3GN5A 2XAGB 3C4XA 2FJDA 4IE5A 1DU2A 2AE9A 3VR8A 2CBJA 4AKRB 2PFVA 4PK4A 5ABHA 2V5CA 5AQQB 4YSYA 3N9MA 4CQIA 1QLBA 1Y64B 3EHZA 3N9QA 3JCFA 2HH7A 3HAXA 1HG2A 3RRCA 3E22E 4TNWA 5HEUA 4Z90A 4DR7T 3LWRA 4UVAB 3RF1A 3AE6A 5JR9B 5AQNB 4OFZA 5JDQA 3NRYA 5FL1A 2NP9A 5LMUT 2LT3A 4H9RC 4H63H 2LHNA 3MA9A 2NW7A 1XDPA 5HEJA 2BKOA 2KWIB 5CA1E 4PJLA 4CN6A 4JI1T 2KLQA 1T72A 4ZS3A 2VL0A 5KXJA 2E9XB 4LF9T 3JC6D 1YQ3A 2WQYA 3CX7B 3AA0B 3M6VA 4AKIA 2FBWA 4ZOLE 3IEEA 1M62A 4G63A 3B57A 4DIDB 1SQWA 4JEUB 2IUBA 2KWHA 4QWNB 4WZXA 2VKJA 2H89A 5JVDE 4QXCB 3OBVE 3Q2MA 2KMFA 3MZKB 2BKNA 2CLYC 2CPTA 4AI6A 3CMLA 2VKDA 4JI4T 1B7TA 3OJAA 3NVOA 2CXDA 1Z0PA 3LSVA 4U7YA 5AQLB 3ZN1B 3BQIA 3NWIA 4I50E 2VB6A 3ANWA 4UEMA 4UELA 2EHOB 3M65A 3P8CD 2XQ9A 4O4LE 2X51A 4Q1TA 2VKOA 3PUWF 3PU3A 4X1YE 4EEDA 2CEAA 1ZBOA 3GA8A 3QOFA 4O8SA 4CN4A 4L9IA 3ZT6A 3FZHB 5CGMA 4EZHA 4HKAA 4UR9A 1QSDA 1M7KA 1OEDB 4DO0A 1G73A 2DWGA 4YLHA 4HFBA 3D0TA 2V6YA 4YSZA 4AIUA 2WB5A 4LMJA 4U7IA 3AEAA 3VR9A 3KVBA 2BG9E 4C91A 2V26A 2DHRA 2VASA 4DV0T 1HX8A 1NENA 1S04A 5F5WA 5C8YE 1WCRA 3AXJB 4IDZA 4QH1A 5L3DB 3C50A 3NZPA 4N78D 1VCTA 1ZE1A 2Q9QD 3IUWA 2Z6EA 2IC9A 3FHNA 2ODUA 4B3ST 2VQFT 1IT8A 4A5XA 3RIUC 2RP4A 3L3PA 1ZKEA 2DWKA 3PUYF 2XJ7A 5CFBA 1NWMX 4TX5A 2M6BA 1HX1B 3RRWA 2F4VT 1TE7A 3ZT5A 3A5XA 3PUVF 3RYIE 3HL6A 3ZLIA 5TAOA 2ACXA 5FKYA 5EK3A 2LM9A 2IHR1 3ZYKA 4LF6T 1XWMA 3ZMSB 4H9QC 4QX7B 5LA6E 1IBKT 4XBFB 4PNIA 2W0GA 3P7IA 5DABA 3N2OA 4CI1B 2N9DA 5LGTB 3JAEA 3RC3A 3UU4A 3UQ7A 4NPPA 3OTOT 5JDNA 4HFIA 3LBXB 3UU5A 4HFCA 2HN2A 4U72A 3K3NA 1LVFA 3RIFA 3LG7A 1GQEA 3TLWA 2JQKA 3M4XA 2N2NA 3KV5A 1XNEA 3RLFF 5LCYA 3ONJA 5JRCB 4A98A 2YK0A 4ILUA 2LSYA 3R6NA 5AQOB 3RX6A 4PFPA 4JI3T 4DV4T 4B6XA 2AS0A 2CHOA 1EZ3A 3WAKA 1G8XA 5EZYE 1HF8A 2XQ8A 1FEWA 4I43B 4ZI2D 5LMNT 4EGWA 4KP3C 5BR8T 3K8PC 2QGSA 4F8HA 4BJNA 4PJNA 4HFHA 2V8SV 1OWAA 2FJBA 1MIYA 2X0LB 2ZM8A 2M67A 3HKCE 4GK5E 4DR4T 3PUGA 2DL1A 4JI6T 1KFYA 4DV1T 2VL8A 5JR9C 4QH5A 3N2KE 3HKDE 3OPCA 2V7IA 2W61A 3H3AA 4AKGA 3I1AA 2L8KA 4PK6A 5LOVE 3UU6A 3CQGB 3O9XA 2XAJB 4JI0T 2WAUA 1I6ZA 2Z0TA 2PTFA 2XSBA 4CXWA 4CZZB 2YN6A 2J4GA 1MNDA 3C4WA 4A97A 2E9XC 4ZHQE 2VKHA 4UF0B 4DV2T 2B78A 2Q9QA 3T1YT 4GK0E 3ONLC 5J1GA 1IBMT 3K3QC 4OK0A 1HG5A 4X66T 2MTQA 4YJ3E 4X1IE 2W4XA 3CWZB 4IDQA 5L2LA 4X62T 4HTEA 5LXTE 3MK7C 4GYSA 1CHUA 3E0ZA 4DV3T 2XAHB 3P4PA 5LHHB 3RPUA 4X5TA 4WNKA 3AEFA 2EY4A 4YTPA 3UQ4A 2LSKA 4B3RT 1E1HB 1ZP0A 4WW0A 2X68A 3CVRA 3CKDA 3TKLB 1KEYA 2H7OA 3TLVA 3PJAJ 1IQ8A 1KF6A 4HN9A 2EHOC 2BDEA 2ES0A 2NTYA 2XZEA 4QXBB 2C5KT 2KT9A 5LP6E 3LDQB 4TZ4C 1QUUA 4HWHA 3UUXB 4P0AA 3J7Yq 2XTLA 1WYCA 3PE0A 4HFEA 3UUBA 4P09A 2JMKA 3T1HT 2WP9A 5CA0E 5ABFB 5L3CB 4H9OC 3ZSTA 4PJJA 1HFAA 3P50A 2WZIA 1BR2A 2RPAA 5DJQC 1J1JA 4KHPT 2MPKA 2L9QA 1FMWA 4ZEYA 3PU8A 3AEGA 2VK9A 1YD8G 4IHJE 4AQFC 2CX1A 5J2UE 2D0TA 4ILBA 2P38A 4DV7T 1HNWT 5FVKA 4TNVA 2IAKA 2WU5A 2Y8DA 5ABEA 5JDFA 3BQLA 2EHOD 2Y48B 3V5SA 3N9OA 3DP7A 3DTOA 5FXXA 3U3IA 2X0YA 2W62A 4DVDA 2BVLA 4DR1T 4IREA 3LJCA 2BZBA 2D0UA 4EAHA 3N9LA 1W09A 2LM2A 3CPZA 3L39A 1KNRA 2CX0A 5DQVA 2BBHA 4JI5T 3UULA 4ANJA 3OYZA 2WBLA 3RGLA 2WWVA 3ZPOA 2BS4A 2V1DB 2B76A 4U2YA 3SS1A 2PBIA 3ZCJA 3AE3A 3AECA 3ESLA 1K8WA 2XQ3A 3ZEFB 1NEKA 5EK2A 4ILAA 3HKEE 2WDVA 5FVLA 4LMKA 4NXNT 4TWFA 5FMNA 3ANWB 3EDVA 5ABGA 3KV6A 4E7ZA 2OV9A 4IE4A 1IAPA 4LFCT 2CM0A 1NAFA 1ZS7A 5L4EA 3PUZF 4HWIB 2K9AA 4MLKA 4JI7T 4UV8B 4U2ZA 2MBGA 3M6UA 2JIWA 3W15B 4YHJA 2J47A 4JI2T 4TWDA 4COFA 4B3MT 2LJLA 5LJNA 3V5UA 2AB4A 5FP3A 3AE5A 3CIRA 4EB6E 3U28A 3EDUA 2Y6XA 1W9RA 3UU3A 4X20E 2RA1A 3QNUA 3FZLB 2J5VA 5H6QB 1WLXA 2XPKA 1UX5A 2E5OA 5LG3A 2WSSV 2ZMAA 4G2AA 5LGUB 2H3RA 2XM1A 2DP9A 3GMIA 5HWYA 3TLUA 2WDQA 3SFDA 4AQYT 1MMNA 3G06A 5IHYA 2D2SA 1ZV4X 4K0KT 2CXFA 2J62A 4OYKA 4UIGA 3UAIA 2YDQA 1UURA 4HWDA 3AA1B 1KNZA 1VRBA 2J1DG 3VRBA 5FY1A 5HXCA 4NUUA 3UFGA 4X65T 4I55E 2BBJA 2IW5B 3X1DA 4DMGA 3KV4A 4LF5T 2WCAA 3VSEA 4QH4A 1W0BA 2EHOA 1HTJF 1SGVA 1D1AA 2ZM6T 3ZT7A 1Q7HA 1ZE2A 2NWBA 3Q5XA 4JLEA 5LHIB 3N5LA 2CA5A 3H37A 4UVCB 3P4WA 3AE4A 3LK2B 3B13A 1O3XA 4UXNB 2ACZA 2WS3A 1FIOA 2Q07A 1OEDA 3C0KA 2CCQA 4OYJA 2QRXA 2NOXA 3ZC0A 4ILCA 2W2UA 3LK42 2YU1A 3CQCB 1MIVA 3CK6A 3N9PA 1JNZA 3KFWX 4MALA 3EAMA 1LRZA 3L09A 5JDGA 3QC9A 2HPJA 1UK5A 3WAJA 4ISTA 3ABVA 4IE0A 3RKOA 5A1LA 2XUEA 2CRBA 2X67A 4P0BA 3AAEB 3ZN0B 2X9YA 4EOZB 2WY2A 4QXHB 3LWPA 3QB5A 2NTXA 4ERRA 5AQMB 1N34T 2LOSA 3VRAA 4IT4A 3ZCIA 3U78A 1UUSA 2X9WA 1WXXA 2APOA 5AQTB 4TN7B 4HE8A 3RKGA 4Q25A 4PW8A 4FJOA 4KHZF 3N2GE 4C90A 2JRKA 2NW9A 2M6IA 3RC8A 1XDOA 5E0OA 4WYVA 1J5WA 4U33A 3RIAA 5JDLA 5M4YA 3RHWA 3P4RA 1OXZA 3NBXX 4ZS2A 1Z8UA 4DMWA 4HFDA 2XQ6A 2V7LA 1J5ET 1D0ZA 3LBXA 3CX8B 2X9HA 1HR0T 4EYUA 3AAIA 1MNEA 3EVYA 3Q9DA 3KINB 1CUNA 4AQGA 2DLRA 2CBIA 2IC6A 1XMQT 3ZYLA 5FXVA 3M6XA 3OKQA 3RQWA 4YFSA 3S4UA 4JUYA 2H88A 2Q9QB 3PUXF 5JRCA 4V1Av 1N32T 4JEHB 2WU2A 3ZMTB 5BMVE 4DUYT 3IHRA 2LEHA 4HFVA 2FJAA 2SPCA 3ETVA 3UUNA 5JH7E 5IUXA 3AA7B 2R6GF 3CX6B 2ANEA 4H63V 3I9WA 5DQWA 4LFAT 3HJWA 3FXEB 5HEOA 4H9NC 2BS3A 2YDSA 3PJAA 5AQHB 4DMVA 4AXPA 2AUSA 4NUVA 1H7CA 3AE9A 3UU8A 2BS2A 4F6RC 2WMNA 3UTKA 4IGUA 2XQ4A 3AE7A 5AQUB 4WBOA 3A7MA 3I9YA 2LRLA 1MMAA 1BR4A 1WR6A 2IIUA 4ADZA 3ZSSA 4IL9A 5FNVE 1R3EA 3AE8A 1T7SA 3UUMA 3VHLA 2E5LT 2KKUA 2LSJA 2BG9B 4XZCA 3HJYA 2FJEA 1OEDE 2K24A 4KUMB 4TUYE 3TLSA 3IBPA 1UGOA 3P4QA 4LF4T 1R3FA 2YU2A 3AE1A 1WYBA 4UF0A 1XNRT 3M3ZB 2IMLA 4YJ2E 4HWCA 5C3JA 5LBMA 2E9XD 1SUMB 3GN5B 3ZYMA 3FBLA 1V9DA 2LHRA 3RIUA 2UXCT 4DV5T 3CQXC 2CHNA 4PJMA 2H7VC 1WRDA 3UT5E 3RQUA 3NKZA 4ZI3C 2A2FX 3FXDB 5HAXA 2ZM0A 2VQET 3WI3A 5LBQB 2QVAA 1WFDA 2OLTA 1J2BA 2I6HA 2JQ9A 3ZV0C 1SHZC 3KBTA 3F2EA 5JDMA 3C51A 3BK9A 4I0UA 2YDRA 4EZ4A 2D5UA 1KNPA 3EUHA 3L8RA 5F8PA 2V7KA 4ASKA 4I4TE 2X9XA 2V7MA 4O4IE 4U3CA 3PV0F 1MIWA 4IE6A 1ZHCA 2WDRA 1LVKA 3GWHA 3QK6A 5L3EB 3SRZA 3KV9A 3JC6C 3F57A 2JMHA 4XAXB 2YEVC 3ZC1A 3AEBA 2BKPA 3C64A 2XHEB 2LOPA 2MAWA 5ABFA 5KMGP 4DR6T 5LGNB 4YY3T 4O4JE 4YXDA 5HWXA 2LRKA 4AKLA 3H3MA 1BR1A 2DNXA 2W63A 1D0YA 5HEGA 2XAQB 3QUJA 4H9PC 4QHOA 1AJ3A 1HS7A 1E7PA 3ETUA 4ZI3D 1D1BA 2LKGA 3VU7H 2HVYA 2YKSA 1YKHB 3M6WA 3ZJ2A 5HCMA 2QA7A 3KBUA 2CWYA 2XQ5A 5AQKB 1IJ6A 2XSAA 3Q5WA
chains in the Genus database with same CATH topology
3K8PC 3K3OA 4ISSA 1HTJF 2QGSA 4BJNA 5ETWA 4PJNA 1D1AA 2A72A 2KXPB 5FY0A 3N9NA 1OWAA 2NWBA 1MIYA 3O1JA 2LE8A 1LKXA 2X0LB 2ZM8A 3Q5XA 2M67A 3HKCE 4JLEA 2KZ7B 5LHIB 3N5LA 2CA5A 3H37A 4GK5E 4UVCB 3PUGA 1VOMA 4GOUA 2GK9A 3LK2B 1T98A 1O3XA 3B13A 1X79A 3ZMVB 2VL8A 4UXNB 4KMCA 1FIOA 2VWAA 5JR9C 5JR9A 3RYHE 2K5BB 2CCQA 3UFEA 3N2KE 4ZI7E 3PDYA 3HKDE 2V7IA 5FXZA 3RYFE 4OYJA 2NOXA 3ZC0A 2W61A 3H3AA 1YKEB 4AKGA 2MOZA 3LK42 1FMVA 2YU1A 3CQCB 4BJMA 1MIVA 3I1AA 2L8KA 3N9PA 4PK6A 3PUQA 5LOVE 4Z8XA 4EYYR 4EXTA 3KFWX 3CQGB 4MALA 2KNDA 3SWHA 2XAJB 3O9XA 2CMRA 1LRZA 3L09A 5JDGA 3QC9A 2HPJA 3WAJA 1SA0E 2WAUA 5JDHA 2XAFB 3PTRB 2DCFA 4ISTA 3SOLA 4KBMB 5AFUL 4IE0A 3PUAA 3HI2A 3RKOA 4MFRA 4CXWA 1U4QA 4CZZB 5A1LA 2XUEA 5F3JA 2N1GA 2X67A 3ONXA 3O4XE 1MNDA 3C4WA 4P0BA 4QKNA 2C5JA 3AAEB 3ZN0B 2E9XC 2E9XA 2X9YA 3GN5A 4ZHQE 2VKHA 2XAGB 4UF0B 3C4XA 4UVBB 4IE5A 2Q9QC 4EOZB 3ZJ1A 2Q9QA 4QXHB 4GK0E 3I0QA 5J1GA 2P9BA 3K3QC 4OK0A 3VKHA 1HG5A 2MTQA 3J9X1 2NTXA 3MJXA 4YJ3E 3ZMUB 4ERRA 4X1IE 4AKRB 2PFVA 2LOSA 4PK4A 3CWZB 2KINB 2WWUA 3ZCIA 5L2LA 4HTEA 3N9MA 5LXTE 3MK7C 4CXYA 4AKHA 3U78A 4CQIA 4GYSA 2X9WA 4L0RA 4PFOA 1KK7A 1Y64B 3N9QA 3E0ZA 4TN7B 2HH7A 2XAHB 3DJBA 4HE8A 1HG2A 3RRCA 2A3DA 4BAYB 3E22E 4PW8A 4FJOA 4WBNE 3N2GE 3NRXA 3RPUA 5LHHB 4C90A 4GYRA 4PAGA 4UVAB 2JRKA 2NW9A 4WNKA 2OA5A 3RC8A 4CI3B 2LSKA 5JR9B 5E0OA 2K48A 1E1HB 5JDLA 5M4YA 4WW0A 5L3BB 2X68A 3CVRA 3CKDA 3TKLB 2H7OA 4OFZA 5JDQA 4BA9A 3PURA 3NRYA 2NP9A 2LT3A 1S94A 2UXXB 1OXZA 3NBXX 4H9RC 4HN9A 4H63H 2EHOC 2BDEA 2ES0A 2G0UA 2LHNA 4ZS2A 3MA9A 2NTYA 2NW7A 4DMWA 1MMDA 2V7LA 4K0UA 4QXBB 1D0ZA 2C5KT 2KT9A 2KWIB 3LBXA 5CA1E 3CX8B 3C98B 5LP6E 2X9HA 4PJLA 4HGAA 3NZQA 4EYUA 3AAIA 1MNEA 2KLQA 3EVYA 3Q9DA 3KINB 1CUNA 4AQGA 4TZ4C 2DLRA 5HXEA 4ZS3A 2L3LA 5L3FB 2IC6A 5KX5E 5IYZE 3ZYLA 1QUUA 2JJ9A 5FXVA 3OKQA 3UUXB 2E9XB 5HXRA 4YFSA 4P0AA 3S4UA 4JUYA 3J7Yq 2Q9QB 2XTLA 3JC6D 1WYCA 3PE0A 4J2CA 5CB4E 3CX7B 4P09A 5FXWA 5JRCA 2JMKA 3AA0B 4IIJE 4V1Av 4JEHB 5J2TE 4AKIA 5CA0E 4ZOLE 5L3CB 3IEEA 4H9OC 3ZMTB 2HPLA 5BMVE 4PJJA 1HFAA 1UX4A 4G63A 3B57A 3C4ZA 1BR2A 4JEUB 2B1EA 2KWHA 3IHRA 5LJMA 1HCIA 5DJQC 4QWNB 2L9QA 4HEAA 1FMWA 2LEHA 4DNDA 4HFVA 4U74A 3PU8A 2VKJA 4CI2B 2VK9A 1YD8G 4IHJE 5LG4A 2SPCA 3ETVA 4QXCB 5JVDE 3UUNA 3RYCE 3OBVE 3Q2MA 2KMFA 3MZKB 4AQFC 4AQFA 5J2UE 5JH7E 2CLYC 2D0TA 4AI6A 3AA7B 3CX6B 3CMLA 2VKDA 2ANEA 4H63V 3FB2A 1B7TA 3I9WA 1D0XA 3BQKA 3KVAA 5DQWA 4UV9B 2IAKA 4ZI2C 3OJAA 4GIWA 4A56A 2JQQA 3I0OA 3FXEB 2CXDA 1Z0PA 2Y8DA 2C0SA 4H9NC 3ZN1B 3BQIA 5JDFA 3BQLA 4I50E 2VB6A 3ANWA 2EHOD 2Y48B 3AAAB 3N9OA 4UEMA 4UELA 3V5SA 2EHOB 3M65A 3DP7A 5EK4A 3HR0A 3P8CD 4O4LE 1MMGA 2X51A 3DTOA 3MKDA 4DMVA 4EIWA 5FXXA 4AXPA 3R84B 3U3IA 5LNKA 2VKOA 4NUVA 2CXLA 1H7CA 3PU3A 2W62A 3HKBE 4DVDA 4X1YE 2BVLA 4F6RC 2WMNA 2LSIA 4E7SA 3UTKA 2CEAA 4DBRA 4IGUA 4MHCA 3LJCA 1ZBOA 4OHFA 3GA8A 4WBOA 2BZBA 3O1IA 3RH3A 4O8SA 3I9YA 4DBQA 2D0UA 4EAHA 1MMAA 4L9IA 1BR4A 2CWOA 3LFMA 3N9LA 4TV8E 4EZHA 5FYMA 1WR6A 4HKAA 3CPZA 4ADZA 1QSDA 5FNVE 5DQVA 3UUMA 3VHLA 3PUSA 4DO0A 1G73A 4QX8B 2DWGA 4YLHA 2LSJA 3D0TA 4XZCA 3UULA 4ANJA 2E8IA 2JPFA 3OYZA 5H6RB 2WBLA 2K24A 4KUMB 5JREA 4TUYE 3KVBA 3ZPOA 1IJ5A 4C91A 2V26A 5HXSA 2V1DB 2UXNB 4TV9E 2DHRA 3SS1A 3IBPA 2PBIA 1YW0A 2VASA 4M1PA 3ZCJA 3E08A 3ESLA 1HX8A 4H9SE 4FI5A 2I59A 2CLYB 2YU2A 2ZM2A 3AVRA 1WYBA 4UF0A 4CXXA 3ZEFB 5C8YE 4PK5A 2MYSA 4IDZA 4YJ2E 5EK2A 5L3DB 3C50A 3O1HA 5LBMA 3NZPA 2E9XD 4N78D 5JQGE 3HKEE 3GN5B 2Q9QD 3ZYMA 2DI4A 2Z6EA 2WM9A 5FMNA 2IC9A 3ANWB 3EDVA 3VKGA 3FHNA 2ODUA 3OYXA 3KV6A 3FBLA 4E7ZA 1V9DA 2LHRA 2RP4A 2ZLYA 3L3PA 1ZKEA 4IE4A 1IAPA 2DWKA 2CM0A 1NWMX 3CQXC 4TX5A 1NAFA 3ZMZB 4PJMA 2H7VC 3RRWA 1WRDA 3UT5E 2PG8A 3HA4A 2K9AA 2LSGA 4MLKA 4ZI3C 3A5XA 4O4HE 2A2FX 3RYIE 3HL6A 3FXDB 3ZLIA 5FY7A 4UV8B 5HAXA 2ZM0A 5TAOA 5ADXL 2MBGA 5LBQB 3WI3A 2ACXA 2C5IT 2NW8A 1SHZC 3KBTA 3F2EA 3W15B 5JDMA 2XQYA 4YHJA 5EK3A 3T8OA 5KDMC 2LM9A 5L3GB 3ZYKA 3AVSA 3C51A 3FBZA 3BK9A 1D1CA 2LJLA 4EZ4A 3ZMSB 2D5UA 5LJNA 5GONE 3EUHA 3V5UA 3MXZA 5F8PA 2V7KA 4H9QC 5FP3A 4QX7B 4EB6E 3EDUA 5LA6E 2BVMA 2Y6XA 1IZNB 4ASKA 4XBFB 4I4TE 3AB3B 4PNIA 2X9XA 2W0GA 4X20E 2RA1A 3P7IA 5DABA 3N2OA 2V7MA 4O4IE 1U5PA 4CI1B 2N9DA 5LGTB 3RC3A 2XASB 5H6QB 1WLXA 1MIWA 4IE6A 5JDNA 1UX5A 1ZHCA 3LBXB 2WSSV 2ZMAA 4MBQA 4G2AA 1ZEEA 5LGUB 3F31A 1LVKA 3LK3B 3GWHA 3QK6A 2H3RA 3KDSE 4U72A 2WMOA 5L3EB 3SRZA 3KV9A 3GMIA 3JC6C 5HWYA 4X1KE 1S35A 3F57A 3K3NA 2JMHA 1LVFA 1BR0A 3LG7A 5HYAA 4XAXB 2X66A 1MMNA 2YEVC 5IHYA 3ZC1A 2D2SA 5LHGB 2N2NA 1ZV4X 3KV5A 2CXFA 3C64A 2XHEB 2LOPA 4OYKA 5KMGP 3AA6B 5LYJE 5LGNB 4O4JE 4UIGA 5LCYA 5HWXA 5JRCB 4AKLA 2YK0A 1BR1A 2DNXA 2LSYA 2W63A 4ILUA 1D0YA 3R6NA 3RX6A 2CE7A 3AA1B 2XAQB 3QUJA 4O2BE 4IE7A 3MACA 4PFPA 4H9PC 4B6XA 1KNZA 4O2AE 1VRBA 2J1DG 1EZ3A 4QHOA 3WAKA 5FY1A 1G8XA 5HXHA 1AJ3A 1US7B 3ETUA 1HS7A 5HXCA 4NUUA 4ZI3D 1D1BA 5EZYE 3VU7H 1HF8A 1YKHB 2V7JA 2YINA 2W00A 4I55E 1FEWA 1UCUA 3IF8B 4L5GA 3ZJ2A 2IW5B 4I43B 2QA7A 3KV4A 2ODVA 3KBUA 2CWYA 4ZI2D 1IJ6A 2PJQA 2EHOA 3Q5WA 4KP3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M65 A;  4CI1 B;  2ANE A;  4CI3 B;  3LJC A;  1ZBO A;  4CI2 B;  4TZ4 C; 
#chains in the Genus database with same CATH topology
 4ISS A;  2AXD S;  2XQ7 A;  2XY8 B;  2XM2 A;  4KX6 A;  2LLY A;  5J0Z A;  3IA3 A;  4EV6 A;  4DV6 T;  1YXR A;  1Y01 A;  5AQI B;  1ZOY A;  2GK9 A;  5AQS B;  3ZMV B;  4KMC A;  3SFE A;  5JR9 A;  3UFE A;  2QYW A;  3OVU A;  1SE7 A;  2JQH A;  4LML A;  2VVS A;  1FMV A;  4BJM A;  5C2T A;  2V6Y B;  5HCJ A;  3PUQ A;  4EYY R;  4EXT A;  3A8Y C;  3SWH A;  5CJ5 A;  1WK2 A;  2CMR A;  5JTG A;  2E2A A;  4NIQ A;  2DCF A;  5AFU L;  4KBM B;  5AQF B;  3PUA A;  4LF7 T;  4MFR A;  3LWV A;  1U4Q A;  2I0M A;  2N1G A;  3AEE A;  3ONX A;  3O4X E;  4QKN A;  2C5J A;  2IDO B;  3Q5E A;  2E9X A;  4UVB B;  2Q9Q C;  4YSX A;  3ZJ1 A;  3I0Q A;  2P9B A;  3VKH A;  4KI0 F;  2RFK A;  3J9X 1;  4IL4 A;  3MJX A;  3FZM B;  3ZMU B;  4GKJ T;  4JI8 T;  2KIN B;  2WWU A;  2UUC T;  4AKH A;  4CXY A;  1E2A A;  4PFO A;  4L0R A;  1KK7 A;  4NXM T;  3DJB A;  4YHH T;  2A3D A;  4BAY B;  4WBN E;  4B3T T;  3NRX A;  2UUA T;  1WXW A;  4GYR A;  4PAG A;  5IWA T;  2OA5 A;  2VUR A;  4CI3 B;  2K48 A;  3ZKR A;  2UUB T;  5L3B B;  1L0V A;  4JV5 T;  4BA9 A;  3PUR A;  3AE2 A;  4HWF A;  1HNX T;  1S94 A;  2UXX B;  2CWW A;  2G0U A;  1MMD A;  4K0U A;  3C98 B;  1N33 T;  3D79 A;  4HGA A;  3NZQ A;  2UXB T;  3K1S A;  5HXE A;  2L3L A;  5L3F B;  5KX5 E;  5IYZ E;  5AQG B;  2W66 A;  2JJ9 A;  5HXR A;  5L47 A;  5AQV B;  4J2C A;  5CB4 E;  1VCS A;  5FXW A;  2BG9 C;  4IIJ E;  3RI5 A;  5J2T E;  4OX9 T;  2HPL A;  2WZH A;  1UX4 A;  2W67 A;  2XQA A;  3C4Z A;  3EAB A;  5LJM A;  2B1E A;  1HCI A;  4HEA A;  2X0H A;  4DND A;  4U74 A;  3EI0 A;  4CI2 B;  3AED A;  5LG4 A;  3RYC E;  4AQF A;  4GKK T;  3LWO A;  3MQK A;  3AXJ A;  3FB2 A;  2E5V A;  1D0X A;  3BQK A;  3KVA A;  4UV9 B;  4ZI2 C;  4GIW A;  4A56 A;  2JQQ A;  3I0O A;  2C0S A;  3AAA B;  5EK4 A;  3HR0 A;  1MMG A;  3MKD A;  4EIW A;  3R84 B;  5LNK A;  2CXL A;  4DUZ T;  3HKB E;  4Z91 A;  2LSI A;  2KSR A;  4E7S A;  4DBR A;  4LF8 T;  4MHC A;  4OHF A;  3O1I A;  3RH3 A;  4DBQ A;  4YTM A;  3TLT A;  2CWO A;  3LFM A;  4TV8 E;  4JBW F;  5FYM A;  4ZXL A;  3PUS A;  4QX8 B;  3JAD A;  1T8B A;  2E8I A;  2JPF A;  5H6R B;  4P1N A;  5JRE A;  1IJ5 A;  3FZK B;  5HXS A;  2UXN B;  4TV9 E;  1W0A A;  1YW0 A;  4M1P A;  3E08 A;  4H9S E;  4U31 A;  1XNQ T;  4FI5 A;  2I59 A;  2CLY B;  2ZM2 A;  3AVR A;  4CXX A;  4PK5 A;  2MYS A;  5LB7 B;  2NR4 A;  3P4S A;  3O1H A;  2V6X A;  5JQG E;  3QB5 K;  2DI4 A;  2WM9 A;  3VKG A;  4YT0 A;  3OYX A;  5AQJ B;  4IDP A;  2ZLY A;  4ZZC A;  4DR2 T;  3ZMZ B;  2A9U A;  2UXD T;  2PG8 A;  4IDN A;  3HA4 A;  2LSG A;  4O4H E;  5FY7 A;  5ADX L;  2C5I T;  5FL0 A;  2NW8 A;  2XQY A;  5KDM C;  3T8O A;  4LFB T;  5L3G B;  3AVS A;  3FBZ A;  1D1C A;  5GON E;  3MXZ A;  2FUP A;  2BVM A;  1IZN B;  3AB3 B;  1N36 T;  3LWQ A;  2LKH A;  1U5P A;  1UOY A;  2XAS B;  4CN1 A;  2FRX A;  4MBQ A;  1ZEE A;  3F31 A;  3LK3 B;  2HN1 A;  3KDS E;  2WMO A;  2VVN A;  4X1K E;  1S35 A;  1BR0 A;  5HYA A;  2X66 A;  4DR5 T;  5LHG B;  5LYJ E;  3AA6 B;  1R8I A;  1WR0 A;  4IDO A;  5AQR B;  2K3W A;  3JAF A;  1XZY A;  1XMO T;  2CE7 A;  1HNZ T;  4O2B E;  4IE7 A;  3MAC A;  2V5D A;  4O2A E;  1YQ4 A;  5HXH A;  5L4H A;  1US7 B;  2J5T A;  2V7J A;  2YIN A;  2W00 A;  1UCU A;  3IF8 B;  4L5G A;  2ODV A;  2PJQ A;  5HEH A;  1JNR A;  3K3O A;  3LDF A;  5ETW A;  2A72 A;  4ZZB A;  2KXP B;  5FY0 A;  3N9N A;  1T5Y A;  2YOE A;  3FZF B;  3Q5D A;  3O1J A;  1I94 T;  2LE8 A;  3B5M A;  2UU9 T;  1LKX A;  4X64 T;  2KZ7 B;  4YTN A;  1VOM A;  4GOU A;  4TWH A;  1T98 A;  1X79 A;  1IT7 A;  1OED C;  2VWA A;  3RYH E;  1X9B A;  2K5B B;  2BG9 A;  4ZI7 E;  3PDY A;  5FXZ A;  3RYF E;  1YKE B;  2MOZ A;  4DR3 T;  4Z8X A;  4EEB A;  2D9D A;  1IBL T;  2KND A;  1SA0 E;  1FJG T;  5JDH A;  2XAF B;  3PTR B;  2HHH T;  3SOL A;  4AIS A;  5AQP B;  3HI2 A;  1ZL3 A;  5F3J A;  4JYA T;  3GN5 A;  2XAG B;  3C4X A;  2FJD A;  4IE5 A;  1DU2 A;  2AE9 A;  3VR8 A;  2CBJ A;  4AKR B;  2PFV A;  4PK4 A;  5ABH A;  2V5C A;  5AQQ B;  4YSY A;  3N9M A;  4CQI A;  1QLB A;  1Y64 B;  3EHZ A;  3N9Q A;  3JCF A;  2HH7 A;  3HAX A;  1HG2 A;  3RRC A;  3E22 E;  4TNW A;  5HEU A;  4Z90 A;  4DR7 T;  3LWR A;  4UVA B;  3RF1 A;  3AE6 A;  5JR9 B;  5AQN B;  4OFZ A;  5JDQ A;  3NRY A;  5FL1 A;  2NP9 A;  5LMU T;  2LT3 A;  4H9R C;  4H63 H;  2LHN A;  3MA9 A;  2NW7 A;  1XDP A;  5HEJ A;  2BKO A;  2KWI B;  5CA1 E;  4PJL A;  4CN6 A;  4JI1 T;  2KLQ A;  1T72 A;  4ZS3 A;  2VL0 A;  5KXJ A;  2E9X B;  4LF9 T;  3JC6 D;  1YQ3 A;  2WQY A;  3CX7 B;  3AA0 B;  3M6V A;  4AKI A;  2FBW A;  4ZOL E;  3IEE A;  1M62 A;  4G63 A;  3B57 A;  4DID B;  1SQW A;  4JEU B;  2IUB A;  2KWH A;  4QWN B;  4WZX A;  2VKJ A;  2H89 A;  5JVD E;  4QXC B;  3OBV E;  3Q2M A;  2KMF A;  3MZK B;  2BKN A;  2CLY C;  2CPT A;  4AI6 A;  3CML A;  2VKD A;  4JI4 T;  1B7T A;  3OJA A;  3NVO A;  2CXD A;  1Z0P A;  3LSV A;  4U7Y A;  5AQL B;  3ZN1 B;  3BQI A;  3NWI A;  4I50 E;  2VB6 A;  3ANW A;  4UEM A;  4UEL A;  2EHO B;  3M65 A;  3P8C D;  2XQ9 A;  4O4L E;  2X51 A;  4Q1T A;  2VKO A;  3PUW F;  3PU3 A;  4X1Y E;  4EED A;  2CEA A;  1ZBO A;  3GA8 A;  3QOF A;  4O8S A;  4CN4 A;  4L9I A;  3ZT6 A;  3FZH B;  5CGM A;  4EZH A;  4HKA A;  4UR9 A;  1QSD A;  1M7K A;  1OED B;  4DO0 A;  1G73 A;  2DWG A;  4YLH A;  4HFB A;  3D0T A;  2V6Y A;  4YSZ A;  4AIU A;  2WB5 A;  4LMJ A;  4U7I A;  3AEA A;  3VR9 A;  3KVB A;  2BG9 E;  4C91 A;  2V26 A;  2DHR A;  2VAS A;  4DV0 T;  1HX8 A;  1NEN A;  1S04 A;  5F5W A;  5C8Y E;  1WCR A;  3AXJ B;  4IDZ A;  4QH1 A;  5L3D B;  3C50 A;  3NZP A;  4N78 D;  1VCT A;  1ZE1 A;  2Q9Q D;  3IUW A;  2Z6E A;  2IC9 A;  3FHN A;  2ODU A;  4B3S T;  2VQF T;  1IT8 A;  4A5X A;  3RIU C;  2RP4 A;  3L3P A;  1ZKE A;  2DWK A;  3PUY F;  2XJ7 A;  5CFB A;  1NWM X;  4TX5 A;  2M6B A;  1HX1 B;  3RRW A;  2F4V T;  1TE7 A;  3ZT5 A;  3A5X A;  3PUV F;  3RYI E;  3HL6 A;  3ZLI A;  5TAO A;  2ACX A;  5FKY A;  5EK3 A;  2LM9 A;  2IHR 1;  3ZYK A;  4LF6 T;  1XWM A;  3ZMS B;  4H9Q C;  4QX7 B;  5LA6 E;  1IBK T;  4XBF B;  4PNI A;  2W0G A;  3P7I A;  5DAB A;  3N2O A;  4CI1 B;  2N9D A;  5LGT B;  3JAE A;  3RC3 A;  3UU4 A;  3UQ7 A;  4NPP A;  3OTO T;  5JDN A;  4HFI A;  3LBX B;  3UU5 A;  4HFC A;  2HN2 A;  4U72 A;  3K3N A;  1LVF A;  3RIF A;  3LG7 A;  1GQE A;  3TLW A;  2JQK A;  3M4X A;  2N2N A;  3KV5 A;  1XNE A;  3RLF F;  5LCY A;  3ONJ A;  5JRC B;  4A98 A;  2YK0 A;  4ILU A;  2LSY A;  3R6N A;  5AQO B;  3RX6 A;  4PFP A;  4JI3 T;  4DV4 T;  4B6X A;  2AS0 A;  2CHO A;  1EZ3 A;  3WAK A;  1G8X A;  5EZY E;  1HF8 A;  2XQ8 A;  1FEW A;  4I43 B;  4ZI2 D;  5LMN T;  4EGW A;  4KP3 C;  5BR8 T;  3K8P C;  2QGS A;  4F8H A;  4BJN A;  4PJN A;  4HFH A;  2V8S V;  1OWA A;  2FJB A;  1MIY A;  2X0L B;  2ZM8 A;  2M67 A;  3HKC E;  4GK5 E;  4DR4 T;  3PUG A;  2DL1 A;  4JI6 T;  1KFY A;  4DV1 T;  2VL8 A;  5JR9 C;  4QH5 A;  3N2K E;  3HKD E;  3OPC A;  2V7I A;  2W61 A;  3H3A A;  4AKG A;  3I1A A;  2L8K A;  4PK6 A;  5LOV E;  3UU6 A;  3CQG B;  3O9X A;  2XAJ B;  4JI0 T;  2WAU A;  1I6Z A;  2Z0T A;  2PTF A;  2XSB A;  4CXW A;  4CZZ B;  2YN6 A;  2J4G A;  1MND A;  3C4W A;  4A97 A;  2E9X C;  4ZHQ E;  2VKH A;  4UF0 B;  4DV2 T;  2B78 A;  2Q9Q A;  3T1Y T;  4GK0 E;  3ONL C;  5J1G A;  1IBM T;  3K3Q C;  4OK0 A;  1HG5 A;  4X66 T;  2MTQ A;  4YJ3 E;  4X1I E;  2W4X A;  3CWZ B;  4IDQ A;  5L2L A;  4X62 T;  4HTE A;  5LXT E;  3MK7 C;  4GYS A;  1CHU A;  3E0Z A;  4DV3 T;  2XAH B;  3P4P A;  5LHH B;  3RPU A;  4X5T A;  4WNK A;  3AEF A;  2EY4 A;  4YTP A;  3UQ4 A;  2LSK A;  4B3R T;  1E1H B;  1ZP0 A;  4WW0 A;  2X68 A;  3CVR A;  3CKD A;  3TKL B;  1KEY A;  2H7O A;  3TLV A;  3PJA J;  1IQ8 A;  1KF6 A;  4HN9 A;  2EHO C;  2BDE A;  2ES0 A;  2NTY A;  2XZE A;  4QXB B;  2C5K T;  2KT9 A;  5LP6 E;  3LDQ B;  4TZ4 C;  1QUU A;  4HWH A;  3UUX B;  4P0A A;  3J7Y q;  2XTL A;  1WYC A;  3PE0 A;  4HFE A;  3UUB A;  4P09 A;  2JMK A;  3T1H T;  2WP9 A;  5CA0 E;  5ABF B;  5L3C B;  4H9O C;  3ZST A;  4PJJ A;  1HFA A;  3P50 A;  2WZI A;  1BR2 A;  2RPA A;  5DJQ C;  1J1J A;  4KHP T;  2MPK A;  2L9Q A;  1FMW A;  4ZEY A;  3PU8 A;  3AEG A;  2VK9 A;  1YD8 G;  4IHJ E;  4AQF C;  2CX1 A;  5J2U E;  2D0T A;  4ILB A;  2P38 A;  4DV7 T;  1HNW T;  5FVK A;  4TNV A;  2IAK A;  2WU5 A;  2Y8D A;  5ABE A;  5JDF A;  3BQL A;  2EHO D;  2Y48 B;  3V5S A;  3N9O A;  3DP7 A;  3DTO A;  5FXX A;  3U3I A;  2X0Y A;  2W62 A;  4DVD A;  2BVL A;  4DR1 T;  4IRE A;  3LJC A;  2BZB A;  2D0U A;  4EAH A;  3N9L A;  1W09 A;  2LM2 A;  3CPZ A;  3L39 A;  1KNR A;  2CX0 A;  5DQV A;  2BBH A;  4JI5 T;  3UUL A;  4ANJ A;  3OYZ A;  2WBL A;  3RGL A;  2WWV A;  3ZPO A;  2BS4 A;  2V1D B;  2B76 A;  4U2Y A;  3SS1 A;  2PBI A;  3ZCJ A;  3AE3 A;  3AEC A;  3ESL A;  1K8W A;  2XQ3 A;  3ZEF B;  1NEK A;  5EK2 A;  4ILA A;  3HKE E;  2WDV A;  5FVL A;  4LMK A;  4NXN T;  4TWF A;  5FMN A;  3ANW B;  3EDV A;  5ABG A;  3KV6 A;  4E7Z A;  2OV9 A;  4IE4 A;  1IAP A;  4LFC T;  2CM0 A;  1NAF A;  1ZS7 A;  5L4E A;  3PUZ F;  4HWI B;  2K9A A;  4MLK A;  4JI7 T;  4UV8 B;  4U2Z A;  2MBG A;  3M6U A;  2JIW A;  3W15 B;  4YHJ A;  2J47 A;  4JI2 T;  4TWD A;  4COF A;  4B3M T;  2LJL A;  5LJN A;  3V5U A;  2AB4 A;  5FP3 A;  3AE5 A;  3CIR A;  4EB6 E;  3U28 A;  3EDU A;  2Y6X A;  1W9R A;  3UU3 A;  4X20 E;  2RA1 A;  3QNU A;  3FZL B;  2J5V A;  5H6Q B;  1WLX A;  2XPK A;  1UX5 A;  2E5O A;  5LG3 A;  2WSS V;  2ZMA A;  4G2A A;  5LGU B;  2H3R A;  2XM1 A;  2DP9 A;  3GMI A;  5HWY A;  3TLU A;  2WDQ A;  3SFD A;  4AQY T;  1MMN A;  3G06 A;  5IHY A;  2D2S A;  1ZV4 X;  4K0K T;  2CXF A;  2J62 A;  4OYK A;  4UIG A;  3UAI A;  2YDQ A;  1UUR A;  4HWD A;  3AA1 B;  1KNZ A;  1VRB A;  2J1D G;  3VRB A;  5FY1 A;  5HXC A;  4NUU A;  3UFG A;  4X65 T;  4I55 E;  2BBJ A;  2IW5 B;  3X1D A;  4DMG A;  3KV4 A;  4LF5 T;  2WCA A;  3VSE A;  4QH4 A;  1W0B A;  2EHO A;  1HTJ F;  1SGV A;  1D1A A;  2ZM6 T;  3ZT7 A;  1Q7H A;  1ZE2 A;  2NWB A;  3Q5X A;  4JLE A;  5LHI B;  3N5L A;  2CA5 A;  3H37 A;  4UVC B;  3P4W A;  3AE4 A;  3LK2 B;  3B13 A;  1O3X A;  4UXN B;  2ACZ A;  2WS3 A;  1FIO A;  2Q07 A;  1OED A;  3C0K A;  2CCQ A;  4OYJ A;  2QRX A;  2NOX A;  3ZC0 A;  4ILC A;  2W2U A;  3LK4 2;  2YU1 A;  3CQC B;  1MIV A;  3CK6 A;  3N9P A;  1JNZ A;  3KFW X;  4MAL A;  3EAM A;  1LRZ A;  3L09 A;  5JDG A;  3QC9 A;  2HPJ A;  1UK5 A;  3WAJ A;  4IST A;  3ABV A;  4IE0 A;  3RKO A;  5A1L A;  2XUE A;  2CRB A;  2X67 A;  4P0B A;  3AAE B;  3ZN0 B;  2X9Y A;  4EOZ B;  2WY2 A;  4QXH B;  3LWP A;  3QB5 A;  2NTX A;  4ERR A;  5AQM B;  1N34 T;  2LOS A;  3VRA A;  4IT4 A;  3ZCI A;  3U78 A;  1UUS A;  2X9W A;  1WXX A;  2APO A;  5AQT B;  4TN7 B;  4HE8 A;  3RKG A;  4Q25 A;  4PW8 A;  4FJO A;  4KHZ F;  3N2G E;  4C90 A;  2JRK A;  2NW9 A;  2M6I A;  3RC8 A;  1XDO A;  5E0O A;  4WYV A;  1J5W A;  4U33 A;  3RIA A;  5JDL A;  5M4Y A;  3RHW A;  3P4R A;  1OXZ A;  3NBX X;  4ZS2 A;  1Z8U A;  4DMW A;  4HFD A;  2XQ6 A;  2V7L A;  1J5E T;  1D0Z A;  3LBX A;  3CX8 B;  2X9H A;  1HR0 T;  4EYU A;  3AAI A;  1MNE A;  3EVY A;  3Q9D A;  3KIN B;  1CUN A;  4AQG A;  2DLR A;  2CBI A;  2IC6 A;  1XMQ T;  3ZYL A;  5FXV A;  3M6X A;  3OKQ A;  3RQW A;  4YFS A;  3S4U A;  4JUY A;  2H88 A;  2Q9Q B;  3PUX F;  5JRC A;  4V1A v;  1N32 T;  4JEH B;  2WU2 A;  3ZMT B;  5BMV E;  4DUY T;  3IHR A;  2LEH A;  4HFV A;  2FJA A;  2SPC A;  3ETV A;  3UUN A;  5JH7 E;  5IUX A;  3AA7 B;  2R6G F;  3CX6 B;  2ANE A;  4H63 V;  3I9W A;  5DQW A;  4LFA T;  3HJW A;  3FXE B;  5HEO A;  4H9N C;  2BS3 A;  2YDS A;  3PJA A;  5AQH B;  4DMV A;  4AXP A;  2AUS A;  4NUV A;  1H7C A;  3AE9 A;  3UU8 A;  2BS2 A;  4F6R C;  2WMN A;  3UTK A;  4IGU A;  2XQ4 A;  3AE7 A;  5AQU B;  4WBO A;  3A7M A;  3I9Y A;  2LRL A;  1MMA A;  1BR4 A;  1WR6 A;  2IIU A;  4ADZ A;  3ZSS A;  4IL9 A;  5FNV E;  1R3E A;  3AE8 A;  1T7S A;  3UUM A;  3VHL A;  2E5L T;  2KKU A;  2LSJ A;  2BG9 B;  4XZC A;  3HJY A;  2FJE A;  1OED E;  2K24 A;  4KUM B;  4TUY E;  3TLS A;  3IBP A;  1UGO A;  3P4Q A;  4LF4 T;  1R3F A;  2YU2 A;  3AE1 A;  1WYB A;  4UF0 A;  1XNR T;  3M3Z B;  2IML A;  4YJ2 E;  4HWC A;  5C3J A;  5LBM A;  2E9X D;  1SUM B;  3GN5 B;  3ZYM A;  3FBL A;  1V9D A;  2LHR A;  3RIU A;  2UXC T;  4DV5 T;  3CQX C;  2CHN A;  4PJM A;  2H7V C;  1WRD A;  3UT5 E;  3RQU A;  3NKZ A;  4ZI3 C;  2A2F X;  3FXD B;  5HAX A;  2ZM0 A;  2VQE T;  3WI3 A;  5LBQ B;  2QVA A;  1WFD A;  2OLT A;  1J2B A;  2I6H A;  2JQ9 A;  3ZV0 C;  1SHZ C;  3KBT A;  3F2E A;  5JDM A;  3C51 A;  3BK9 A;  4I0U A;  2YDR A;  4EZ4 A;  2D5U A;  1KNP A;  3EUH A;  3L8R A;  5F8P A;  2V7K A;  4ASK A;  4I4T E;  2X9X A;  2V7M A;  4O4I E;  4U3C A;  3PV0 F;  1MIW A;  4IE6 A;  1ZHC A;  2WDR A;  1LVK A;  3GWH A;  3QK6 A;  5L3E B;  3SRZ A;  3KV9 A;  3JC6 C;  3F57 A;  2JMH A;  4XAX B;  2YEV C;  3ZC1 A;  3AEB A;  2BKP A;  3C64 A;  2XHE B;  2LOP A;  2MAW A;  5ABF A;  5KMG P;  4DR6 T;  5LGN B;  4YY3 T;  4O4J E;  4YXD A;  5HWX A;  2LRK A;  4AKL A;  3H3M A;  1BR1 A;  2DNX A;  2W63 A;  1D0Y A;  5HEG A;  2XAQ B;  3QUJ A;  4H9P C;  4QHO A;  1AJ3 A;  1HS7 A;  1E7P A;  3ETU A;  4ZI3 D;  1D1B A;  2LKG A;  3VU7 H;  2HVY A;  2YKS A;  1YKH B;  3M6W A;  3ZJ2 A;  5HCM A;  2QA7 A;  3KBU A;  2CWY A;  2XQ5 A;  5AQK B;  1IJ6 A;  2XSA A;  3Q5W A; 
#chains in the Genus database with same CATH homology
 3K8P C;  3K3O A;  4ISS A;  1HTJ F;  2QGS A;  4BJN A;  5ETW A;  4PJN A;  1D1A A;  2A72 A;  2KXP B;  5FY0 A;  3N9N A;  1OWA A;  2NWB A;  1MIY A;  3O1J A;  2LE8 A;  1LKX A;  2X0L B;  2ZM8 A;  3Q5X A;  2M67 A;  3HKC E;  4JLE A;  2KZ7 B;  5LHI B;  3N5L A;  2CA5 A;  3H37 A;  4GK5 E;  4UVC B;  3PUG A;  1VOM A;  4GOU A;  2GK9 A;  3LK2 B;  1T98 A;  1O3X A;  3B13 A;  1X79 A;  3ZMV B;  2VL8 A;  4UXN B;  4KMC A;  1FIO A;  2VWA A;  5JR9 C;  5JR9 A;  3RYH E;  2K5B B;  2CCQ A;  3UFE A;  3N2K E;  4ZI7 E;  3PDY A;  3HKD E;  2V7I A;  5FXZ A;  3RYF E;  4OYJ A;  2NOX A;  3ZC0 A;  2W61 A;  3H3A A;  1YKE B;  4AKG A;  2MOZ A;  3LK4 2;  1FMV A;  2YU1 A;  3CQC B;  4BJM A;  1MIV A;  3I1A A;  2L8K A;  3N9P A;  4PK6 A;  3PUQ A;  5LOV E;  4Z8X A;  4EYY R;  4EXT A;  3KFW X;  3CQG B;  4MAL A;  2KND A;  3SWH A;  2XAJ B;  3O9X A;  2CMR A;  1LRZ A;  3L09 A;  5JDG A;  3QC9 A;  2HPJ A;  3WAJ A;  1SA0 E;  2WAU A;  5JDH A;  2XAF B;  3PTR B;  2DCF A;  4IST A;  3SOL A;  4KBM B;  5AFU L;  4IE0 A;  3PUA A;  3HI2 A;  3RKO A;  4MFR A;  4CXW A;  1U4Q A;  4CZZ B;  5A1L A;  2XUE A;  5F3J A;  2N1G A;  2X67 A;  3ONX A;  3O4X E;  1MND A;  3C4W A;  4P0B A;  4QKN A;  2C5J A;  3AAE B;  3ZN0 B;  2E9X C;  2E9X A;  2X9Y A;  3GN5 A;  4ZHQ E;  2VKH A;  2XAG B;  4UF0 B;  3C4X A;  4UVB B;  4IE5 A;  2Q9Q C;  4EOZ B;  3ZJ1 A;  2Q9Q A;  4QXH B;  4GK0 E;  3I0Q A;  5J1G A;  2P9B A;  3K3Q C;  4OK0 A;  3VKH A;  1HG5 A;  2MTQ A;  3J9X 1;  2NTX A;  3MJX A;  4YJ3 E;  3ZMU B;  4ERR A;  4X1I E;  4AKR B;  2PFV A;  2LOS A;  4PK4 A;  3CWZ B;  2KIN B;  2WWU A;  3ZCI A;  5L2L A;  4HTE A;  3N9M A;  5LXT E;  3MK7 C;  4CXY A;  4AKH A;  3U78 A;  4CQI A;  4GYS A;  2X9W A;  4L0R A;  4PFO A;  1KK7 A;  1Y64 B;  3N9Q A;  3E0Z A;  4TN7 B;  2HH7 A;  2XAH B;  3DJB A;  4HE8 A;  1HG2 A;  3RRC A;  2A3D A;  4BAY B;  3E22 E;  4PW8 A;  4FJO A;  4WBN E;  3N2G E;  3NRX A;  3RPU A;  5LHH B;  4C90 A;  4GYR A;  4PAG A;  4UVA B;  2JRK A;  2NW9 A;  4WNK A;  2OA5 A;  3RC8 A;  4CI3 B;  2LSK A;  5JR9 B;  5E0O A;  2K48 A;  1E1H B;  5JDL A;  5M4Y A;  4WW0 A;  5L3B B;  2X68 A;  3CVR A;  3CKD A;  3TKL B;  2H7O A;  4OFZ A;  5JDQ A;  4BA9 A;  3PUR A;  3NRY A;  2NP9 A;  2LT3 A;  1S94 A;  2UXX B;  1OXZ A;  3NBX X;  4H9R C;  4HN9 A;  4H63 H;  2EHO C;  2BDE A;  2ES0 A;  2G0U A;  2LHN A;  4ZS2 A;  3MA9 A;  2NTY A;  2NW7 A;  4DMW A;  1MMD A;  2V7L A;  4K0U A;  4QXB B;  1D0Z A;  2C5K T;  2KT9 A;  2KWI B;  3LBX A;  5CA1 E;  3CX8 B;  3C98 B;  5LP6 E;  2X9H A;  4PJL A;  4HGA A;  3NZQ A;  4EYU A;  3AAI A;  1MNE A;  2KLQ A;  3EVY A;  3Q9D A;  3KIN B;  1CUN A;  4AQG A;  4TZ4 C;  2DLR A;  5HXE A;  4ZS3 A;  2L3L A;  5L3F B;  2IC6 A;  5KX5 E;  5IYZ E;  3ZYL A;  1QUU A;  2JJ9 A;  5FXV A;  3OKQ A;  3UUX B;  2E9X B;  5HXR A;  4YFS A;  4P0A A;  3S4U A;  4JUY A;  3J7Y q;  2Q9Q B;  2XTL A;  3JC6 D;  1WYC A;  3PE0 A;  4J2C A;  5CB4 E;  3CX7 B;  4P09 A;  5FXW A;  5JRC A;  2JMK A;  3AA0 B;  4IIJ E;  4V1A v;  4JEH B;  5J2T E;  4AKI A;  5CA0 E;  4ZOL E;  5L3C B;  3IEE A;  4H9O C;  3ZMT B;  2HPL A;  5BMV E;  4PJJ A;  1HFA A;  1UX4 A;  4G63 A;  3B57 A;  3C4Z A;  1BR2 A;  4JEU B;  2B1E A;  2KWH A;  3IHR A;  5LJM A;  1HCI A;  5DJQ C;  4QWN B;  2L9Q A;  4HEA A;  1FMW A;  2LEH A;  4DND A;  4HFV A;  4U74 A;  3PU8 A;  2VKJ A;  4CI2 B;  2VK9 A;  1YD8 G;  4IHJ E;  5LG4 A;  2SPC A;  3ETV A;  4QXC B;  5JVD E;  3UUN A;  3RYC E;  3OBV E;  3Q2M A;  2KMF A;  3MZK B;  4AQF C;  4AQF A;  5J2U E;  5JH7 E;  2CLY C;  2D0T A;  4AI6 A;  3AA7 B;  3CX6 B;  3CML A;  2VKD A;  2ANE A;  4H63 V;  3FB2 A;  1B7T A;  3I9W A;  1D0X A;  3BQK A;  3KVA A;  5DQW A;  4UV9 B;  2IAK A;  4ZI2 C;  3OJA A;  4GIW A;  4A56 A;  2JQQ A;  3I0O A;  3FXE B;  2CXD A;  1Z0P A;  2Y8D A;  2C0S A;  4H9N C;  3ZN1 B;  3BQI A;  5JDF A;  3BQL A;  4I50 E;  2VB6 A;  3ANW A;  2EHO D;  2Y48 B;  3AAA B;  3N9O A;  4UEM A;  4UEL A;  3V5S A;  2EHO B;  3M65 A;  3DP7 A;  5EK4 A;  3HR0 A;  3P8C D;  4O4L E;  1MMG A;  2X51 A;  3DTO A;  3MKD A;  4DMV A;  4EIW A;  5FXX A;  4AXP A;  3R84 B;  3U3I A;  5LNK A;  2VKO A;  4NUV A;  2CXL A;  1H7C A;  3PU3 A;  2W62 A;  3HKB E;  4DVD A;  4X1Y E;  2BVL A;  4F6R C;  2WMN A;  2LSI A;  4E7S A;  3UTK A;  2CEA A;  4DBR A;  4IGU A;  4MHC A;  3LJC A;  1ZBO A;  4OHF A;  3GA8 A;  4WBO A;  2BZB A;  3O1I A;  3RH3 A;  4O8S A;  3I9Y A;  4DBQ A;  2D0U A;  4EAH A;  1MMA A;  4L9I A;  1BR4 A;  2CWO A;  3LFM A;  3N9L A;  4TV8 E;  4EZH A;  5FYM A;  1WR6 A;  4HKA A;  3CPZ A;  4ADZ A;  1QSD A;  5FNV E;  5DQV A;  3UUM A;  3VHL A;  3PUS A;  4DO0 A;  1G73 A;  4QX8 B;  2DWG A;  4YLH A;  2LSJ A;  3D0T A;  4XZC A;  3UUL A;  4ANJ A;  2E8I A;  2JPF A;  3OYZ A;  5H6R B;  2WBL A;  2K24 A;  4KUM B;  5JRE A;  4TUY E;  3KVB A;  3ZPO A;  1IJ5 A;  4C91 A;  2V26 A;  5HXS A;  2V1D B;  2UXN B;  4TV9 E;  2DHR A;  3SS1 A;  3IBP A;  2PBI A;  1YW0 A;  2VAS A;  4M1P A;  3ZCJ A;  3E08 A;  3ESL A;  1HX8 A;  4H9S E;  4FI5 A;  2I59 A;  2CLY B;  2YU2 A;  2ZM2 A;  3AVR A;  1WYB A;  4UF0 A;  4CXX A;  3ZEF B;  5C8Y E;  4PK5 A;  2MYS A;  4IDZ A;  4YJ2 E;  5EK2 A;  5L3D B;  3C50 A;  3O1H A;  5LBM A;  3NZP A;  2E9X D;  4N78 D;  5JQG E;  3HKE E;  3GN5 B;  2Q9Q D;  3ZYM A;  2DI4 A;  2Z6E A;  2WM9 A;  5FMN A;  2IC9 A;  3ANW B;  3EDV A;  3VKG A;  3FHN A;  2ODU A;  3OYX A;  3KV6 A;  3FBL A;  4E7Z A;  1V9D A;  2LHR A;  2RP4 A;  2ZLY A;  3L3P A;  1ZKE A;  4IE4 A;  1IAP A;  2DWK A;  2CM0 A;  1NWM X;  3CQX C;  4TX5 A;  1NAF A;  3ZMZ B;  4PJM A;  2H7V C;  3RRW A;  1WRD A;  3UT5 E;  2PG8 A;  3HA4 A;  2K9A A;  2LSG A;  4MLK A;  4ZI3 C;  3A5X A;  4O4H E;  2A2F X;  3RYI E;  3HL6 A;  3FXD B;  3ZLI A;  5FY7 A;  4UV8 B;  5HAX A;  2ZM0 A;  5TAO A;  5ADX L;  2MBG A;  5LBQ B;  3WI3 A;  2ACX A;  2C5I T;  2NW8 A;  1SHZ C;  3KBT A;  3F2E A;  3W15 B;  5JDM A;  2XQY A;  4YHJ A;  5EK3 A;  3T8O A;  5KDM C;  2LM9 A;  5L3G B;  3ZYK A;  3AVS A;  3C51 A;  3FBZ A;  3BK9 A;  1D1C A;  2LJL A;  4EZ4 A;  3ZMS B;  2D5U A;  5LJN A;  5GON E;  3EUH A;  3V5U A;  3MXZ A;  5F8P A;  2V7K A;  4H9Q C;  5FP3 A;  4QX7 B;  4EB6 E;  3EDU A;  5LA6 E;  2BVM A;  2Y6X A;  1IZN B;  4ASK A;  4XBF B;  4I4T E;  3AB3 B;  4PNI A;  2X9X A;  2W0G A;  4X20 E;  2RA1 A;  3P7I A;  5DAB A;  3N2O A;  2V7M A;  4O4I E;  1U5P A;  4CI1 B;  2N9D A;  5LGT B;  3RC3 A;  2XAS B;  5H6Q B;  1WLX A;  1MIW A;  4IE6 A;  5JDN A;  1UX5 A;  1ZHC A;  3LBX B;  2WSS V;  2ZMA A;  4MBQ A;  4G2A A;  1ZEE A;  5LGU B;  3F31 A;  1LVK A;  3LK3 B;  3GWH A;  3QK6 A;  2H3R A;  3KDS E;  4U72 A;  2WMO A;  5L3E B;  3SRZ A;  3KV9 A;  3GMI A;  3JC6 C;  5HWY A;  4X1K E;  1S35 A;  3F57 A;  3K3N A;  2JMH A;  1LVF A;  1BR0 A;  3LG7 A;  5HYA A;  4XAX B;  2X66 A;  1MMN A;  2YEV C;  5IHY A;  3ZC1 A;  2D2S A;  5LHG B;  2N2N A;  1ZV4 X;  3KV5 A;  2CXF A;  3C64 A;  2XHE B;  2LOP A;  4OYK A;  5KMG P;  3AA6 B;  5LYJ E;  5LGN B;  4O4J E;  4UIG A;  5LCY A;  5HWX A;  5JRC B;  4AKL A;  2YK0 A;  1BR1 A;  2DNX A;  2LSY A;  2W63 A;  4ILU A;  1D0Y A;  3R6N A;  3RX6 A;  2CE7 A;  3AA1 B;  2XAQ B;  3QUJ A;  4O2B E;  4IE7 A;  3MAC A;  4PFP A;  4H9P C;  4B6X A;  1KNZ A;  4O2A E;  1VRB A;  2J1D G;  1EZ3 A;  4QHO A;  3WAK A;  5FY1 A;  1G8X A;  5HXH A;  1AJ3 A;  1US7 B;  3ETU A;  1HS7 A;  5HXC A;  4NUU A;  4ZI3 D;  1D1B A;  5EZY E;  3VU7 H;  1HF8 A;  1YKH B;  2V7J A;  2YIN A;  2W00 A;  4I55 E;  1FEW A;  1UCU A;  3IF8 B;  4L5G A;  3ZJ2 A;  2IW5 B;  4I43 B;  2QA7 A;  3KV4 A;  2ODV A;  3KBU A;  2CWY A;  4ZI2 D;  1IJ6 A;  2PJQ A;  2EHO A;  3Q5W A;  4KP3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...