3M65A

Crystal structure of bacillus subtilis lon n-terminal domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
204
Chain Sequence
ELKRSIPLLPLRGLLVYPTMVLHLDVGRDKSVQALEQAMMHDHMIFLATQQDISIDEPGEDEIFTVGTYTKIKQMLKLPNGTIRVLVEGLKRAHIVKYNEHEDYTSVDIQLIHEDKDTEDEALMRTLLDHFDQYIKISKKISAETYAAVTDIEEPGRMADIVASHLPLKLKDKQDILETADVKDRLNKVIDFINNEKEVLEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Bacillus subtilis Lon Protease.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords ATP-dependent protease La 1
total genus 61
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3m65A02
2.30.130.40 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 LON domain-like 3m65A01
4CI1B 3LJCA 1ZBOA 2ANEA 3M65A 4CI3B 4CI2B 4TZ4C
chains in the Genus database with same CATH superfamily
3SS1A 3EDVA 3ZMZB 5LOVE 4ISSA 3NRYA 2WY2A 3UULA 1HF8A 4FJOA 2IIUA 4LFBT 1BR0A 3AA0B 4UV9B 4QH5A 2AB4A 3HJWA 4XZCA 3P50A 4A97A 4ZI3C 3KV9A 3UU6A 4B3ST 2CXDA 2VKJA 2K3WA 1KFYA 3PUWF 2MOZA 4DR7T 5AQPB 2ZMAA 2X0YA 4QH1A 4UIGA 5J0ZA 4EZHA 1HFAA 5EK2A 4DV7T 2N9DA 3N2OA 3PV0F 4JI3T 2XM1A 4YY3T 4IDPA 2LSYA 4WBOA 5HEGA 4JLEA 3CPZA 2CX0A 2X9WA 3FXDB 4O4LE 3LK3B 4EIWA 2IUBA 4GYRA 4LF6T 3I9WA 4A98A 1JNZA 4X1YE 3ZJ2A 3PUZF 4WNKA 4ZI2D 3RYFE 1R3EA 3IF8B 3NRXA 5L3EB 3V5UA 2MTQA 3H3MA 2E5LT 4UR9A 4U74A 3RLFF 4H9SE 3FZKB 3RKOA 5L3GB 4H9QC 3VRBA 3OVUA 3FB2A 2RA1A 3C51A 5KXJA 4J2CA 3CX6B 1BR2A 2C5IT 1KF6A 2XASB 4PAGA 4WZXA 4CI3B 3LWOA 3KV5A 4LF7T 2LSJA 2NR4A 3ZMUB 5LCYA 2QGSA 2CEAA 3AEFA 2KXPB 3AE7A 3UU5A 4EEDA 2N2NA 3RQWA 5JDMA 3P4PA 3PUXF 3E22E 5F8PA 1ZEEA 2D5UA 2YDQA 1YKHB 3AEGA 3ZYMA 3FBLA 1HG5A 3ZCIA 2YU1A 5JDGA 3M65A 2V7LA 3K8PC 3ABVA 4BAYB 3P4SA 3LWRA 4EZ4A 2H89A 2D2SA 4C91A 5LMNT 3WAJA 5H6QB 2KLQA 3AE8A 2CPTA 1D1BA 2NW9A 2XQ4A 3AE9A 2ZM6T 1E2AA 2LSGA 1WR6A 2YEVC 2XQ7A 2YOEA 2P9BA 5EZYE 2JPFA 3E08A 3RYIE 1WYCA 2DI4A 3MACA 2E9XD 2KKUA 3NBXX 1ZHCA 3IUWA 4AI6A 2X67A 3FZLB 2LSKA 3AE2A 3DTOA 2WZHA 3ZT7A 1WLXA 3B57A 2XZEA 3HL6A 4AKLA 4PW8A 1SE7A 1HX1B 2DCFA 5AQSB 3NVOA 1V9DA 4GKKT 3B5MA 2LKGA 3GA8A 2J62A 5JREA 2I0MA 3B13A 2BKNA 5F3JA 3CK6A 5CA1E 3DJBA 4PK6A 3SWHA 4O4JE 3MKDA 2W62A 5ETWA 2JMKA 4DV2T 3WAKA 2IC6A 1KNPA 4NUUA 3A5XA 1ZP0A 2PFVA 3AA1B 3TLWA 2WCAA 4I4TE 2AE9A 2L9QA 3JAFA 1MNDA 3QC9A 1H7CA 2ODUA 5FY1A 2WS3A 4Z91A 5JR9C 4PFOA 3NZQA 5F5WA 3J9X1 2EHOB 4HWDA 3ESLA 4IDOA 2XQ6A 2W67A 2MYSA 2PG8A 4I0UA 3F31A 2C0SA 1FJGT 4AKHA 5HCMA 3PUAA 1DU2A 4QHOA 2V1DB 2VL0A 2QA7A 5L2LA 4QKNA 1T72A 5HXHA 5DQWA 3TLTA 1MMAA 4UVBB 5L3CB 2UUBT 4GYSA 4UV8B 3SRZA 3SFDA 4N78D 1YW0A 2D0TA 3ZMTB 1E1HB 2WZIA 3R84B 5L3BB 5AFUL 2WQYA 3KV4A 4KHZF 4DV5T 2LT3A 4IE5A 1JNRA 4X62T 3P4RA 2XHEB 5L4EA 4LMKA 3LWVA 4EB6E 4TV9E 3RIUA 3AEBA 3KBUA 3UUXB 4KHPT 2CRBA 4L0RA 4O4IE 4YTMA 4JI1T 1OWAA 3ZT5A 4GIWA 2ES0A 2VQET 4CZZB 2LM9A 3IA3A 1MMNA 1QLBA 5CFBA 1K8WA 3ANWA 4PK5A 5FXZA 5AQKB 4LF5T 2XQ8A 3EVYA 2JQKA 3AAAB 4UF0B 2NW8A 1D0ZA 4YJ2E 4HGAA 3MJXA 3TKLB 5TAOA 4PJNA 2JJ9A 3MK7C 1D0XA 4HTEA 3JAEA 3J7Yq 4QXCB 4U33A 3ANWB 4H63V 4E7SA 4TUYE 2NTYA 1HNZT 3PU3A 3ONLC 1TE7A 4HFCA 1J1JA 4DV3T 2E9XA 2Q07A 2YN6A 4H9PC 4KI0F 2XQ3A 2XPKA 5C8YE 2MPKA 1YXRA 3UTKA 3FXEB 2UXCT 2X0LB 3EHZA 2KZ7B 3N9LA 3KV6A 2WBLA 4QWNB 4HKAA 3C4XA 1NEKA 3FZHB 4ILCA 2Y6XA 4ILUA 3UFGA 4A5XA 3T1HT 2Q9QD 3AXJB 4LMJA 3RHWA 3Q2MA 4EV6A 5DJQC 2XM2A 2FRXA 1LVKA 2ZM8A 1SHZC 2HPLA 5HXRA 2KINB 3N9MA 2MBGA 3EUHA 3OPCA 3Q5DA 1J5WA 1SGVA 3AE3A 3ZN1B 4DBRA 3PJAA 2IHR1 5HCJA 3N9OA 3JADA 2JQHA 3UU8A 4NPPA 3V5SA 3ZKRA 4ZI2C 4EGWA 2IC9A 3OJAA 4ADZA 2WP9A 4DV4T 2WU2A 3GMIA 2DNXA 3AEAA 5BR8T 3G06A 2A2FX 2VVNA 4GK0E 1KNZA 4U72A 1XNQT 3FBZA 2NTXA 4B3TT 3M6WA 3KFWX 1HCIA 5LBMA 4U2ZA 4LF8T 4AKIA 1M7KA 3LG7A 4Z90A 5E0OA 2V7KA 3CQGB 2DP9A 3O1HA 3PURA 2CLYB 3VKHA 5AQMB 1ZL3A 4U3CA 3PUYF 3UFEA 3LDQB 3I0OA 5J2UE 2R6GF 3S4UA 4X5TA 4X1KE 4EOZB 3BQIA 2VWAA 2N1GA 3HKDE 2WU5A 3AA7B 4ZHQE 2XAGB 4HFBA 2BS2A 4ILAA 1IAPA 1I94T 2VQFT 5AQTB 3K3NA 3RIUC 3P7IA 4TV8E 5CJ5A 4O2BE 2BDEA 2RPAA 4HWIB 5FYMA 3ZSSA 5FVKA 4JV5T 2KWIB 2WB5A 3M3ZB 4EAHA 2V6XA 2V7MA 2JRKA 3L8RA 3QOFA 4UVAB 4NXMT 3IBPA 2W63A 1UURA 4ISTA 4K0UA 5ABFB 3TLVA 2X9HA 4IT4A 2X9XA 2FJBA 4K0KT 5KDMC 3FZMB 1WYBA 4NUVA 1IBMT 3ZSTA 1EZ3A 1B7TA 4CQIA 3NWIA 5LA6E 4MBQA 2E5OA 1Q7HA 2LJLA 1KEYA 5LHIB 4DR4T 3DP7A 2WM9A 5ABFA 2IDOB 4HFEA 4I50E 5FL1A 1ZBOA 2C5JA 4LF4T 1QUUA 1SA0E 4ZS3A 2WWVA 2HH7A 5L4HA 1W0AA 5HWYA 2NOXA 5CA0E 3AEDA 5AQRB 3U28A 5JTGA 1I6ZA 2WDQA 4AQGA 4MHCA 5HXSA 4IGUA 2KT9A 2LM2A 4YT0A 2XSBA 2B78A 1U4QA 4CN4A 5KX5E 2XAFB 2VURA 3MZKB 4DV0T 5BMVE 1E7PA 2CHOA 2X66A 3NZPA 4XAXB 2V26A 3LFMA 1KNRA 3ZJ1A 3AAIA 4QX7B 3AECA 5HEHA 3OTOT 4V1Av 2FJDA 2HVYA 4UEMA 2M6IA 3T8OA 5IHYA 3L09A 1T98A 1VCSA 2YINA 3ZPOA 3OBVE 3QB5K 1YKEB 5FXXA 2LE8A 2M67A 2HPJA 2CA5A 4CXXA 2H7OA 2BG9B 3UUMA 5LB7B 2LKHA 5AQGB 1MIYA 2DLRA 2A72A 2KWHA 3ZLIA 5J1GA 3Q5WA 4DMVA 1Z0PA 4WYVA 2HN2A 1U5PA 4TNVA 2UXXB 3AE4A 2I59A 2CX1A 4ERRA 1MIVA 3K3OA 2BG9A 2QYWA 4YHJA 2XQ9A 4DIDB 5JRCA 2BVMA 5HEOA 5LP6E 3AA6B 2Q9QC 3LBXB 3IEEA 2WAUA 4JEUB 3ZYKA 3W15B 4YTPA 3HKCE 5L3FB 1IT7A 2L8KA 2CMRA 3Q5EA 4QX8B 4GOUA 2E8IA 2BBHA 4JBWF 1XNRT 5LHHB 5JRCB 4IHJE 4O4HE 4TN7B 1MNEA 5HEJA 3LBXA 4QH4A 1WXXA 3RRWA 4H9RC 2YK0A 5AQHB 2XY8B 4EEBA 3RC8A 4JI0T 1OEDA 3LK42 2V8SV 5AQNB 2WDRA 5JH7E 1WK2A 3PE0A 3BQLA 4LFAT 1XMOT 2FJEA 3MXZA 3HI2A 4ZS2A 2V6YA 2W2UA 1NWMX 4I43B 4B6XA 4X1IE 4HFVA 1OEDB 4ZEYA 2E5VA 3KVAA 1IQ8A 2GK9A 3LDFA 4XBFB 2A3DA 4AIUA 2VK9A 2HN1A 3LK2B 3LSVA 3KBTA 4PK4A 2UXNB 3CX8B 4F6RC 4IE4A 5FY7A 3NKZA 5JR9B 2BS3A 1N33T 2K48A 2F4VT 4DVDA 3EI0A 5AQQB 3C64A 3Q5XA 3CMLA 1UOYA 2NWBA 2X51A 4X66T 4HFDA 3N9NA 1IBKT 5HEUA 3ZC0A 1ZS7A 2G0UA 5JR9A 3C0KA 3UAIA 2UXDT 2APOA 2AXDS 2ODVA 3GN5A 2XAHB 4HFIA 3UQ7A 3KINB 3EABA 5DABA 3U3IA 1S35A 2MAWA 4IDZA 1ZE1A 5AQLB 3T1YT 1YQ4A 2H3RA 2RP4A 4DNDA 1GQEA 3RF1A 1VCTA 3QK6A 1SQWA 1MIWA 4H63H 4CN1A 4O8SA 2Z0TA 2VASA 5AQOB 3GN5B 1HTJF 1T5YA 2X68A 3O9XA 2QRXA 3M4XA 2LOSA 2YDRA 5FY0A 4CXWA 2YKSA 2ANEA 2OA5A 5JQGE 3M6XA 3RX6A 4X65T 1HX8A 3HKEE 1G8XA 2HHHT 2BBJA 4AQFC 2JQQA 3PUVF 2CCQA 1M62A 2BS4A 3AVRA 2BZBA 3PUQA 4PNIA 4H9NC 3PTRB 1UX4A 5LG4A 4G63A 3ZV0C 4B3MT 1O3XA 2WSSV 3UQ4A 3ONXA 3N9QA 5HXCA 2VVSA 3F57A 5FNVE 2K5BB 3QNUA 4IIJE 5IWAT 1OEDC 3TLUA 4Q1TA 2CWOA 1T7SA 1ZE2A 1YD8G 4WBNE 5L47A 4CI1B 4PJJA 1UUSA 4DMWA 4OYKA 1D0YA 3C98B 3UUBA 2JIWA 2CBIA 4TWFA 2E2AA 2LHNA 3SOLA 4LMLA 2J4GA 2LRLA 3UUNA 5AQJB 2I6HA 2KMFA 2JMHA 1NENA 3PJAJ 2KNDA 2AUSA 4JI8T 1D1CA 2CXFA 2J5TA 4DUYT 4UVCB 2DWKA 2WMNA 1HS7A 3K3QC 4OX9T 1VRBA 4HEAA 1Y64B 4KMCA 4PJLA 2XSAA 3CIRA 1XZYA 3CWZB 1XMQT 1J2BA 2ZLYA 4IDNA 5C2TA 2NP9A 1ZOYA 2Z6EA 1LVFA 4M1PA 2CLYC 4ZOLE 3BQKA 3K1SA 1ZV4X 5FP3A 2M6BA 2KSRA 3A8YC 3JCFA 1BR1A 4OHFA 5JDNA 4YXDA 2W0GA 3PDYA 1IBLT 3AXJA 2K24A 4JI4T 1YQ3A 4JYAT 4KP3C 1HG2A 4JI7T 4DR1T 2IAKA 2B76A 2L3LA 2H88A 2XAJB 5IYZE 2J1DG 2Q9QB 4QXHB 3CVRA 2CWWA 2PTFA 2V5DA 3ETVA 5AQFB 2LOPA 2SPCA 4FI5A 3HJYA 1W9RA 3Q9DA 4CN6A 1L0VA 5AQIB 4KBMB 2Q9QA 2VB6A 3ZEFB 1MMGA 2LHRA 2H7VC 4COFA 3H37A 4L5GA 4U31A 3ZMSB 3ZT6A 4DV1T 1J5ET 2UU9T 2UXBT 1WCRA 4PJMA 1XDPA 1LRZA 1T8BA 3FZFB 5M4YA 1CHUA 3EDUA 4AXPA 3I1AA 4TWDA 3P8CD 4YHHT 2C5KT 4DV6T 2YDSA 4IREA 3VSEA 5EK4A 4G2AA 1QSDA 4ILBA 1MMDA 5GONE 3BK9A 3WI3A 4U7YA 1S04A 2FBWA 1XNEA 1IT8A 1N32T 1WRDA 1AJ3A 4NXNT 3IHRA 5DQVA 4BJMA 2BG9E 5L3DB 5FXVA 3MA9A 1LKXA 1CUNA 4DR2T 4DR6T 1UGOA 2J5VA 3C4ZA 2ZM0A 2P38A 3I9YA 3KDSE 2WMOA 3RIAA 2EHOA 4BJNA 5JDLA 2X0HA 5KMGP 5AQVB 2FJAA 3KVBA 1UCUA 3ETUA 3RYHE 1ZKEA 4JUYA 1N34T 4A56A 3ZN0B 2CM0A 2W4XA 2CE7A 4DO0A 3MQKA 4IE7A 4AQFA 4YSZA 4HWCA 3RYCE 2WWUA 5LBQB 3AE5A 3GWHA 3N9PA 3OKQA 2ACZA 4IL4A 2VKHA 5LMUT 1UK5A 1X9BA 4YLHA 4NIQA 4LF9T 4MFRA 3PUSA 2UUCT 1NAFA 2QVAA 5C3JA 5LNKA 2WDVA 3AAEB 4E7ZA 2A9UA 2BKOA 4UXNB 3ZCJA 2ZM2A 2W00A 3TLSA 1Y01A 3SFEA 3PU8A 2XUEA 3VHLA 3RRCA 2EHOD 4OYJA 3CX7B 3CQXC 3LWPA 4CI2B 1HNXT 1KK7A 2YU2A 3L3PA 5J2TE 1HR0T 3CKDA 5LHGB 5A1LA 3O1JA 4X20E 5JDQA 2CXLA 3HA4A 3N2GE 4UF0A 4IDQA 3AVSA 3LWQA 4HE8A 5IUXA 4JI5T 4ZZBA 2VKDA 4GK5E 5FMNA 3OYZA 4AKRB 4DMGA 5ABHA 5LXTE 1W09A 3ONJA 1IJ5A 1FEWA 4U7IA 4JEHB 2V7IA 2FUPA 3P4WA 3UT5E 4OK0A 2RFKA 2CBJA 2IMLA 2E9XB 4JI6T 2BVLA 4IE6A 2ACXA 2D0UA 4ZXLA 4TX5A 4IE0A 3I0QA 4IL9A 2XAQB 4U2YA 2E9XC 2EHOC 3L39A 1XWMA 4QXBB 4DR5T 4EYYR 5ABGA 1US7B 5FL0A 3N5LA 1WR0A 1WXWA 4P09A 3F2EA 5CB4E 3E0ZA 2VKOA 3LJCA 2PBIA 3VR8A 3AEEA 4P1NA 4AQYT 4EXTA 4ZI7E 1D1AA 4PFPA 5LGTB 3A7MA 2DL1A 3UU4A 2BG9C 5JVDE 4YSYA 3VKGA 5LJNA 2IW5B 1UX5A 5HXEA 2X9YA 3R6NA 4LFCT 3D0TA 1XDOA 5EK3A 3HR0A 4L9IA 4AKGA 4MLKA 3P4QA 3JC6C 2JQ9A 3H3AA 4ANJA 2XTLA 3ZMVB 5HWXA 4P0BA 3VU7H 4C90A 2LSIA 2D9DA 3RI5A 1OXZA 4Z8XA 2VL8A 1OEDE 2V5CA 2BKPA 2XQ5A 2Y48B 3RQUA 4TNWA 2W66A 4DBQA 4OFZA 3C4WA 4H9OC 3QB5A 2V6YB 4GKJT 1VOMA 2EY4A 4EYUA 4KUMB 4B3RT 3D79A 3X1DA 5LGNB 3AE6A 3M6UA 3VRAA 4DR3T 4WW0A 5FXWA 2UUAT 4X64T 2PJQA 4Q25A 3UU3A 5HAXA 5HYAA 3VR9A 5LJMA 1S94A 1R8IA 4UELA 3CQCB 2J47A 1R3FA 4DUZT 2LLYA 5ADXL 2W61A 3RPUA 4YTNA 4HFHA 2NW7A 3RC3A 2XQYA 4JI2T 1HNWT 4F8HA 2DHRA 3RIFA 1BR4A 3RKGA 3EAMA 4TWHA 3RGLA 2XQAA 4P0AA 5JDHA 5ABEA 3C50A 5LG3A 3M6VA 4ASKA 3ZYLA 1WFDA 3U78A 2AS0A 3N2KE 5FKYA 4I55E 3AB3B 4HWHA 4ZZCA 5LGUB 3PUGA 2CWYA 4HN9A 3O4XE 2B1EA 2DWGA 3ZC1A 1G73A 2OV9A 5LYJE 1SUMB 3OYXA 3FHNA 1FMWA 4YJ3E 1W0BA 2V7JA 3HAXA 2K9AA 2Y8DA 1FIOA 3HKBE 1X79A 4TZ4C 4YSXA 1N36T 4KX6A 2XJ7A 4ZI3D 1Z8UA 3O1IA 5H6RB 5FVLA 4HWFA 3RH3A 1IJ6A 3AE1A 5JDFA 5AQUB 1FMVA 3JC6D 2CHNA 4CXYA 2OLTA 1IZNB 4YFSA 4BA9A 4AISA 2LRKA 4MALA 5CGMA 2LEHA 3QUJA 4O2AE
chains in the Genus database with same CATH topology
2WBLA 3SS1A 3EDVA 4QWNB 1NWMX 3ZMZB 5LOVE 4HKAA 4I43B 3C4XA 4ISSA 3NRYA 4B6XA 4X1IE 4HFVA 1HF8A 3UULA 3C4ZA 2ZM0A 2Y6XA 4FJOA 4ILUA 3I9YA 3KDSE 2Q9QD 2WMOA 3AA0B 3KVAA 4UV9B 1BR0A 2EHOA 4BJNA 2GK9A 5JDLA 5KMGP 4XBFB 3Q2MA 2A3DA 3KVBA 2VK9A 4XZCA 3LK2B 1UCUA 3ETUA 3RYHE 1ZKEA 5DJQC 4JUYA 4PK4A 3KBTA 4ZI3C 2ZM8A 1LVKA 2UXNB 3KV9A 2CM0A 3CX8B 2CXDA 3ZN0B 4A56A 2VKJA 4F6RC 2CE7A 4IE4A 1SHZC 2HPLA 5FY7A 4DO0A 5JR9B 2MOZA 2K48A 4IE7A 5HXRA 2KINB 3N9MA 4AQFA 2ZMAA 2MBGA 4UIGA 3EUHA 4EZHA 1HFAA 3ZN1B 3RYCE 4DVDA 5EK2A 4DBRA 2WWUA 2N9DA 3N2OA 3C64A 5LBQB 3Q5XA 3N9OA 3CMLA 2NWBA 2X51A 3V5SA 2LSYA 3GWHA 4WBOA 3N9PA 4ZI2C 4JLEA 2IC9A 3CPZA 3OKQA 3N9NA 3OJAA 4ADZA 2X9WA 3FXDB 4O4LE 3ZC0A 2VKHA 4YLHA 2G0UA 3LK3B 5JR9A 4EIWA 4GYRA 3GMIA 3I9WA 4MFRA 3GN5A 2ODVA 2DNXA 2XAHB 3KINB 3PUSA 3U3IA 5DABA 1S35A 2A2FX 4GK0E 4IDZA 1NAFA 1KNZA 4U72A 5LNKA 3FBZA 2NTXA 4X1YE 2H3RA 3AAEB 3ZJ2A 4E7ZA 3KFWX 4WNKA 2RP4A 4ZI2D 3RYFE 4DNDA 1HCIA 4UXNB 3IF8B 3ZCJA 3NRXA 2ZM2A 2W00A 5LBMA 5L3EB 3V5UA 2MTQA 3QK6A 3PU8A 2XUEA 1MIWA 4H63H 4U74A 3VHLA 4H9SE 4AKIA 3RRCA 2EHOD 4OYJA 3CX7B 4O8SA 3LG7A 3CQXC 2VASA 3RKOA 3GN5B 4CI2B 1HTJF 2V7KA 5E0OA 1KK7A 2YU2A 5L3GB 2X68A 3L3PA 4H9QC 3O9XA 5J2TE 3CQGB 3CKDA 3FB2A 2RA1A 3C51A 3O1HA 3PURA 2LOSA 5LHGB 2CLYB 5A1LA 3VKHA 5FY0A 4CXWA 4J2CA 3O1JA 2ANEA 3CX6B 1BR2A 2C5IT 2XASB 4PAGA 2OA5A 4X20E 4CI3B 5JQGE 5JDQA 3KV5A 2CXLA 2LSJA 3HA4A 3N2GE 4UF0A 3RX6A 3UFEA 3AVSA 3ZMUB 1HX8A 3HKEE 1G8XA 4HE8A 5LCYA 2VKDA 3I0OA 4GK5E 5FMNA 4AQFC 3OYZA 4AKRB 2QGSA 5J2UE 2CEAA 2JQQA 3S4UA 5LXTE 2CCQA 2KXPB 1IJ5A 4X1KE 2N2NA 1FEWA 5JDMA 4EOZB 4JEHB 2V7IA 3AVRA 3BQIA 2VWAA 2BZBA 3PUQA 4PNIA 3E22E 2N1GA 4H9NC 3HKDE 3UT5E 3PTRB 3AA7B 4OK0A 4ZHQE 1UX4A 5LG4A 5F8PA 1ZEEA 2D5UA 2XAGB 2E9XB 4G63A 2BVLA 1YKHB 4IE6A 1IAPA 1O3XA 2ACXA 2D0UA 3K3NA 2WSSV 4TX5A 3ZYMA 3FBLA 3P7IA 1HG5A 3ZCIA 2YU1A 4TV8E 4IE0A 3ONXA 5JDGA 3N9QA 3M65A 4O2BE 3I0QA 2V7LA 3K8PC 5HXCA 2BDEA 4BAYB 2XAQB 3F57A 4EZ4A 5FNVE 2K5BB 2D2SA 4IIJE 2E9XC 2EHOC 5FYMA 2KWIB 4QXBB 4C91A 4EYYR 2CWOA 1YD8G 4WBNE 3WAJA 5H6QB 4EAHA 2KLQA 1US7B 1D1BA 4CI1B 4PJJA 2V7MA 4OYKA 2NW9A 4DMWA 3N5LA 1D0YA 3C98B 2JRKA 4UVAB 4P09A 3F2EA 3IBPA 5CB4E 2W63A 3E0ZA 2LSGA 4ISTA 4K0UA 2VKOA 1WR6A 2YEVC 2X9HA 3LJCA 2PBIA 2P9BA 2LHNA 2X9XA 3SOLA 5EZYE 4EXTA 2JPFA 4ZI7E 5KDMC 3E08A 1D1AA 4PFPA 3RYIE 1WYCA 5LGTB 2DI4A 3MACA 2E9XD 1WYBA 3UUNA 4NUVA 5JVDE 3NBXX 1ZHCA 1EZ3A 1B7TA 2KMFA 3VKGA 4AI6A 4CQIA 2JMHA 2X67A 5LA6E 5LJNA 2LSKA 3DTOA 2IW5B 4MBQA 2KNDA 1UX5A 1WLXA 3B57A 1D1CA 2CXFA 2X9YA 3HL6A 3R6NA 4AKLA 5HXEA 3D0TA 4UVCB 4PW8A 2DWKA 2LJLA 2DCFA 5LHIB 3DP7A 2WMNA 2WM9A 1HS7A 1V9DA 5EK3A 3K3QC 4I50E 3HR0A 4L9IA 4AKGA 4MLKA 3JC6C 1ZBOA 2C5JA 1VRBA 3GA8A 3H3AA 4HEAA 1QUUA 5JREA 1SA0E 4ZS3A 4ANJA 1Y64B 3B13A 4KMCA 4PJLA 2XTLA 2HH7A 3ZMVB 5F3JA 5HWYA 5CA1E 5HWXA 4P0BA 4ZS2A 3VU7H 4C90A 3CWZB 2NOXA 2LSIA 3DJBA 5CA0E 4PK6A 3SWHA 4O4JE 2ZLYA 3MKDA 1OXZA 2W62A 4Z8XA 5ETWA 2JMKA 4AQGA 2VL8A 2NP9A 4MHCA 5HXSA 2Z6EA 3WAKA 2IC6A 4NUUA 3A5XA 1LVFA 4IGUA 2KT9A 2Y48B 4M1PA 2PFVA 1U4QA 3AA1B 2CLYC 4DBQA 4ZOLE 5KX5E 4I4TE 4OFZA 3BQKA 2XAFB 3C4WA 4H9OC 2L9QA 1ZV4X 5FP3A 1VOMA 1MNDA 3QC9A 3MZKB 4EYUA 5BMVE 1BR1A 4OHFA 2X66A 5JDNA 4KUMB 2W0GA 3NZPA 1H7CA 4XAXB 2ODUA 2V26A 3PDYA 5FY1A 5LGNB 3LFMA 3ZJ1A 3AAIA 5JR9C 4QX7B 4PFOA 4WW0A 3NZQA 5FXWA 3J9X1 2EHOB 2K24A 3ESLA 4V1Av 2PJQA 4UEMA 2MYSA 5HAXA 5HYAA 2PG8A 3F31A 4KP3C 3T8OA 1HG2A 5IHYA 3L09A 2C0SA 1T98A 4AKHA 3PUAA 5LJMA 2IAKA 1S94A 4QHOA 2V1DB 4UELA 2L3LA 2YINA 2QA7A 3CQCB 5L2LA 3ZPOA 4QKNA 2XAJB 5IYZE 5HXHA 5ADXL 2J1DG 5DQWA 2Q9QB 2W61A 3OBVE 4QXHB 3RPUA 1MMAA 4UVBB 5L3CB 1YKEB 5FXXA 4GYSA 3CVRA 2LE8A 2NW7A 2M67A 2HPJA 2CA5A 4UV8B 3SRZA 3RC3A 4CXXA 2H7OA 2XQYA 3UUMA 3ETVA 4N78D 1YW0A 2D0TA 3ZMTB 2LOPA 1E1HB 1MIYA 2DLRA 2DHRA 2SPCA 3R84B 2A72A 4FI5A 1BR4A 5L3BB 2KWHA 3ZLIA 3Q9DA 5AFUL 5J1GA 3KV4A 3Q5WA 2LT3A 4DMVA 4IE5A 1Z0PA 4P0AA 2XHEB 5JDHA 4KBMB 3C50A 2Q9QA 4ASKA 1U5PA 3ZYLA 2UXXB 4EB6E 2I59A 2VB6A 4TV9E 3ZEFB 3KBUA 4ERRA 3UUXB 1MIVA 3K3OA 1MMGA 4L0RA 4O4IE 3U78A 4YHJA 3N2KE 1OWAA 5JRCA 2BVMA 4I55E 2LHRA 2H7VC 3H37A 4GIWA 3AA6B 3AB3B 2Q9QC 4L5GA 4O2AE 5LP6E 2ES0A 3LBXB 3IEEA 4CZZB 2WAUA 3ZMSB 5LGUB 4JEUB 3ZYKA 3W15B 3HKCE 2LM9A 3PUGA 2CWYA 4PJMA 5L3FB 2L8KA 1MMNA 1LRZA 4HN9A 2CMRA 3EDUA 4AXPA 5M4YA 3I1AA 3O4XE 3ANWA 4QX8B 2B1EA 3P8CD 4GOUA 2DWGA 4PK5A 2E8IA 3ZC1A 1G73A 5FXZA 5LYJE 3OYXA 5LHHB 2C5KT 3EVYA 3FHNA 1FMWA 4YJ3E 5EK4A 4G2AA 1QSDA 5JRCB 4IHJE 3AAAB 2V7JA 4O4HE 1MMDA 4UF0B 2NW8A 1D0ZA 5GONE 3BK9A 2K9AA 4TN7B 4HGAA 1MNEA 3MJXA 3LBXA 3WI3A 4YJ2E 2Y8DA 1FIOA 3HKBE 5TAOA 1X79A 3TKLB 4PJNA 2JJ9A 3MK7C 4TZ4C 1D0XA 4ZI3D 3O1IA 4HTEA 3RRWA 4H9RC 5H6RB 2YK0A 3RH3A 3J7Yq 4QXCB 3ANWB 4H63V 1IJ6A 4TUYE 1WRDA 5JDFA 4E7SA 1AJ3A 2NTYA 3PU3A 1FMVA 3JC6D 3RC8A 3LK42 3IHRA 4CXYA 2E9XA 5DQVA 1IZNB 4H9PC 4BJMA 5JH7E 5C8YE 4YFSA 5L3DB 4BA9A 5FXVA 3MA9A 3UTKA 3FXEB 4MALA 3PE0A 2X0LB 2LEHA 3BQLA 2KZ7B 3N9LA 3KV6A 1LKXA 3MXZA 3HI2A 3QUJA 1CUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI1 B;  3LJC A;  1ZBO A;  2ANE A;  3M65 A;  4CI3 B;  4CI2 B;  4TZ4 C; 
#chains in the Genus database with same CATH topology
 3SS1 A;  3EDV A;  3ZMZ B;  5LOV E;  4ISS A;  3NRY A;  2WY2 A;  3UUL A;  1HF8 A;  4FJO A;  2IIU A;  4LFB T;  1BR0 A;  3AA0 B;  4UV9 B;  4QH5 A;  2AB4 A;  3HJW A;  4XZC A;  3P50 A;  4A97 A;  4ZI3 C;  3KV9 A;  3UU6 A;  4B3S T;  2CXD A;  2VKJ A;  2K3W A;  1KFY A;  3PUW F;  2MOZ A;  4DR7 T;  5AQP B;  2ZMA A;  2X0Y A;  4QH1 A;  4UIG A;  5J0Z A;  4EZH A;  1HFA A;  5EK2 A;  4DV7 T;  2N9D A;  3N2O A;  3PV0 F;  4JI3 T;  2XM1 A;  4YY3 T;  4IDP A;  2LSY A;  4WBO A;  5HEG A;  4JLE A;  3CPZ A;  2CX0 A;  2X9W A;  3FXD B;  4O4L E;  3LK3 B;  4EIW A;  2IUB A;  4GYR A;  4LF6 T;  3I9W A;  4A98 A;  1JNZ A;  4X1Y E;  3ZJ2 A;  3PUZ F;  4WNK A;  4ZI2 D;  3RYF E;  1R3E A;  3IF8 B;  3NRX A;  5L3E B;  3V5U A;  2MTQ A;  3H3M A;  2E5L T;  4UR9 A;  4U74 A;  3RLF F;  4H9S E;  3FZK B;  3RKO A;  5L3G B;  4H9Q C;  3VRB A;  3OVU A;  3FB2 A;  2RA1 A;  3C51 A;  5KXJ A;  4J2C A;  3CX6 B;  1BR2 A;  2C5I T;  1KF6 A;  2XAS B;  4PAG A;  4WZX A;  4CI3 B;  3LWO A;  3KV5 A;  4LF7 T;  2LSJ A;  2NR4 A;  3ZMU B;  5LCY A;  2QGS A;  2CEA A;  3AEF A;  2KXP B;  3AE7 A;  3UU5 A;  4EED A;  2N2N A;  3RQW A;  5JDM A;  3P4P A;  3PUX F;  3E22 E;  5F8P A;  1ZEE A;  2D5U A;  2YDQ A;  1YKH B;  3AEG A;  3ZYM A;  3FBL A;  1HG5 A;  3ZCI A;  2YU1 A;  5JDG A;  3M65 A;  2V7L A;  3K8P C;  3ABV A;  4BAY B;  3P4S A;  3LWR A;  4EZ4 A;  2H89 A;  2D2S A;  4C91 A;  5LMN T;  3WAJ A;  5H6Q B;  2KLQ A;  3AE8 A;  2CPT A;  1D1B A;  2NW9 A;  2XQ4 A;  3AE9 A;  2ZM6 T;  1E2A A;  2LSG A;  1WR6 A;  2YEV C;  2XQ7 A;  2YOE A;  2P9B A;  5EZY E;  2JPF A;  3E08 A;  3RYI E;  1WYC A;  2DI4 A;  3MAC A;  2E9X D;  2KKU A;  3NBX X;  1ZHC A;  3IUW A;  4AI6 A;  2X67 A;  3FZL B;  2LSK A;  3AE2 A;  3DTO A;  2WZH A;  3ZT7 A;  1WLX A;  3B57 A;  2XZE A;  3HL6 A;  4AKL A;  4PW8 A;  1SE7 A;  1HX1 B;  2DCF A;  5AQS B;  3NVO A;  1V9D A;  4GKK T;  3B5M A;  2LKG A;  3GA8 A;  2J62 A;  5JRE A;  2I0M A;  3B13 A;  2BKN A;  5F3J A;  3CK6 A;  5CA1 E;  3DJB A;  4PK6 A;  3SWH A;  4O4J E;  3MKD A;  2W62 A;  5ETW A;  2JMK A;  4DV2 T;  3WAK A;  2IC6 A;  1KNP A;  4NUU A;  3A5X A;  1ZP0 A;  2PFV A;  3AA1 B;  3TLW A;  2WCA A;  4I4T E;  2AE9 A;  2L9Q A;  3JAF A;  1MND A;  3QC9 A;  1H7C A;  2ODU A;  5FY1 A;  2WS3 A;  4Z91 A;  5JR9 C;  4PFO A;  3NZQ A;  5F5W A;  3J9X 1;  2EHO B;  4HWD A;  3ESL A;  4IDO A;  2XQ6 A;  2W67 A;  2MYS A;  2PG8 A;  4I0U A;  3F31 A;  2C0S A;  1FJG T;  4AKH A;  5HCM A;  3PUA A;  1DU2 A;  4QHO A;  2V1D B;  2VL0 A;  2QA7 A;  5L2L A;  4QKN A;  1T72 A;  5HXH A;  5DQW A;  3TLT A;  1MMA A;  4UVB B;  5L3C B;  2UUB T;  4GYS A;  4UV8 B;  3SRZ A;  3SFD A;  4N78 D;  1YW0 A;  2D0T A;  3ZMT B;  1E1H B;  2WZI A;  3R84 B;  5L3B B;  5AFU L;  2WQY A;  3KV4 A;  4KHZ F;  4DV5 T;  2LT3 A;  4IE5 A;  1JNR A;  4X62 T;  3P4R A;  2XHE B;  5L4E A;  4LMK A;  3LWV A;  4EB6 E;  4TV9 E;  3RIU A;  3AEB A;  3KBU A;  3UUX B;  4KHP T;  2CRB A;  4L0R A;  4O4I E;  4YTM A;  4JI1 T;  1OWA A;  3ZT5 A;  4GIW A;  2ES0 A;  2VQE T;  4CZZ B;  2LM9 A;  3IA3 A;  1MMN A;  1QLB A;  5CFB A;  1K8W A;  3ANW A;  4PK5 A;  5FXZ A;  5AQK B;  4LF5 T;  2XQ8 A;  3EVY A;  2JQK A;  3AAA B;  4UF0 B;  2NW8 A;  1D0Z A;  4YJ2 E;  4HGA A;  3MJX A;  3TKL B;  5TAO A;  4PJN A;  2JJ9 A;  3MK7 C;  1D0X A;  4HTE A;  3JAE A;  3J7Y q;  4QXC B;  4U33 A;  3ANW B;  4H63 V;  4E7S A;  4TUY E;  2NTY A;  1HNZ T;  3PU3 A;  3ONL C;  1TE7 A;  4HFC A;  1J1J A;  4DV3 T;  2E9X A;  2Q07 A;  2YN6 A;  4H9P C;  4KI0 F;  2XQ3 A;  2XPK A;  5C8Y E;  2MPK A;  1YXR A;  3UTK A;  3FXE B;  2UXC T;  2X0L B;  3EHZ A;  2KZ7 B;  3N9L A;  3KV6 A;  2WBL A;  4QWN B;  4HKA A;  3C4X A;  1NEK A;  3FZH B;  4ILC A;  2Y6X A;  4ILU A;  3UFG A;  4A5X A;  3T1H T;  2Q9Q D;  3AXJ B;  4LMJ A;  3RHW A;  3Q2M A;  4EV6 A;  5DJQ C;  2XM2 A;  2FRX A;  1LVK A;  2ZM8 A;  1SHZ C;  2HPL A;  5HXR A;  2KIN B;  3N9M A;  2MBG A;  3EUH A;  3OPC A;  3Q5D A;  1J5W A;  1SGV A;  3AE3 A;  3ZN1 B;  4DBR A;  3PJA A;  2IHR 1;  5HCJ A;  3N9O A;  3JAD A;  2JQH A;  3UU8 A;  4NPP A;  3V5S A;  3ZKR A;  4ZI2 C;  4EGW A;  2IC9 A;  3OJA A;  4ADZ A;  2WP9 A;  4DV4 T;  2WU2 A;  3GMI A;  2DNX A;  3AEA A;  5BR8 T;  3G06 A;  2A2F X;  2VVN A;  4GK0 E;  1KNZ A;  4U72 A;  1XNQ T;  3FBZ A;  2NTX A;  4B3T T;  3M6W A;  3KFW X;  1HCI A;  5LBM A;  4U2Z A;  4LF8 T;  4AKI A;  1M7K A;  3LG7 A;  4Z90 A;  5E0O A;  2V7K A;  3CQG B;  2DP9 A;  3O1H A;  3PUR A;  2CLY B;  3VKH A;  5AQM B;  1ZL3 A;  4U3C A;  3PUY F;  3UFE A;  3LDQ B;  3I0O A;  5J2U E;  2R6G F;  3S4U A;  4X5T A;  4X1K E;  4EOZ B;  3BQI A;  2VWA A;  2N1G A;  3HKD E;  2WU5 A;  3AA7 B;  4ZHQ E;  2XAG B;  4HFB A;  2BS2 A;  4ILA A;  1IAP A;  1I94 T;  2VQF T;  5AQT B;  3K3N A;  3RIU C;  3P7I A;  4TV8 E;  5CJ5 A;  4O2B E;  2BDE A;  2RPA A;  4HWI B;  5FYM A;  3ZSS A;  5FVK A;  4JV5 T;  2KWI B;  2WB5 A;  3M3Z B;  4EAH A;  2V6X A;  2V7M A;  2JRK A;  3L8R A;  3QOF A;  4UVA B;  4NXM T;  3IBP A;  2W63 A;  1UUR A;  4IST A;  4K0U A;  5ABF B;  3TLV A;  2X9H A;  4IT4 A;  2X9X A;  2FJB A;  4K0K T;  5KDM C;  3FZM B;  1WYB A;  4NUV A;  1IBM T;  3ZST A;  1EZ3 A;  1B7T A;  4CQI A;  3NWI A;  5LA6 E;  4MBQ A;  2E5O A;  1Q7H A;  2LJL A;  1KEY A;  5LHI B;  4DR4 T;  3DP7 A;  2WM9 A;  5ABF A;  2IDO B;  4HFE A;  4I50 E;  5FL1 A;  1ZBO A;  2C5J A;  4LF4 T;  1QUU A;  1SA0 E;  4ZS3 A;  2WWV A;  2HH7 A;  5L4H A;  1W0A A;  5HWY A;  2NOX A;  5CA0 E;  3AED A;  5AQR B;  3U28 A;  5JTG A;  1I6Z A;  2WDQ A;  4AQG A;  4MHC A;  5HXS A;  4IGU A;  2KT9 A;  2LM2 A;  4YT0 A;  2XSB A;  2B78 A;  1U4Q A;  4CN4 A;  5KX5 E;  2XAF B;  2VUR A;  3MZK B;  4DV0 T;  5BMV E;  1E7P A;  2CHO A;  2X66 A;  3NZP A;  4XAX B;  2V26 A;  3LFM A;  1KNR A;  3ZJ1 A;  3AAI A;  4QX7 B;  3AEC A;  5HEH A;  3OTO T;  4V1A v;  2FJD A;  2HVY A;  4UEM A;  2M6I A;  3T8O A;  5IHY A;  3L09 A;  1T98 A;  1VCS A;  2YIN A;  3ZPO A;  3OBV E;  3QB5 K;  1YKE B;  5FXX A;  2LE8 A;  2M67 A;  2HPJ A;  2CA5 A;  4CXX A;  2H7O A;  2BG9 B;  3UUM A;  5LB7 B;  2LKH A;  5AQG B;  1MIY A;  2DLR A;  2A72 A;  2KWH A;  3ZLI A;  5J1G A;  3Q5W A;  4DMV A;  1Z0P A;  4WYV A;  2HN2 A;  1U5P A;  4TNV A;  2UXX B;  3AE4 A;  2I59 A;  2CX1 A;  4ERR A;  1MIV A;  3K3O A;  2BG9 A;  2QYW A;  4YHJ A;  2XQ9 A;  4DID B;  5JRC A;  2BVM A;  5HEO A;  5LP6 E;  3AA6 B;  2Q9Q C;  3LBX B;  3IEE A;  2WAU A;  4JEU B;  3ZYK A;  3W15 B;  4YTP A;  3HKC E;  5L3F B;  1IT7 A;  2L8K A;  2CMR A;  3Q5E A;  4QX8 B;  4GOU A;  2E8I A;  2BBH A;  4JBW F;  1XNR T;  5LHH B;  5JRC B;  4IHJ E;  4O4H E;  4TN7 B;  1MNE A;  5HEJ A;  3LBX A;  4QH4 A;  1WXX A;  3RRW A;  4H9R C;  2YK0 A;  5AQH B;  2XY8 B;  4EEB A;  3RC8 A;  4JI0 T;  1OED A;  3LK4 2;  2V8S V;  5AQN B;  2WDR A;  5JH7 E;  1WK2 A;  3PE0 A;  3BQL A;  4LFA T;  1XMO T;  2FJE A;  3MXZ A;  3HI2 A;  4ZS2 A;  2V6Y A;  2W2U A;  1NWM X;  4I43 B;  4B6X A;  4X1I E;  4HFV A;  1OED B;  4ZEY A;  2E5V A;  3KVA A;  1IQ8 A;  2GK9 A;  3LDF A;  4XBF B;  2A3D A;  4AIU A;  2VK9 A;  2HN1 A;  3LK2 B;  3LSV A;  3KBT A;  4PK4 A;  2UXN B;  3CX8 B;  4F6R C;  4IE4 A;  5FY7 A;  3NKZ A;  5JR9 B;  2BS3 A;  1N33 T;  2K48 A;  2F4V T;  4DVD A;  3EI0 A;  5AQQ B;  3C64 A;  3Q5X A;  3CML A;  1UOY A;  2NWB A;  2X51 A;  4X66 T;  4HFD A;  3N9N A;  1IBK T;  5HEU A;  3ZC0 A;  1ZS7 A;  2G0U A;  5JR9 A;  3C0K A;  3UAI A;  2UXD T;  2APO A;  2AXD S;  2ODV A;  3GN5 A;  2XAH B;  4HFI A;  3UQ7 A;  3KIN B;  3EAB A;  5DAB A;  3U3I A;  1S35 A;  2MAW A;  4IDZ A;  1ZE1 A;  5AQL B;  3T1Y T;  1YQ4 A;  2H3R A;  2RP4 A;  4DND A;  1GQE A;  3RF1 A;  1VCT A;  3QK6 A;  1SQW A;  1MIW A;  4H63 H;  4CN1 A;  4O8S A;  2Z0T A;  2VAS A;  5AQO B;  3GN5 B;  1HTJ F;  1T5Y A;  2X68 A;  3O9X A;  2QRX A;  3M4X A;  2LOS A;  2YDR A;  5FY0 A;  4CXW A;  2YKS A;  2ANE A;  2OA5 A;  5JQG E;  3M6X A;  3RX6 A;  4X65 T;  1HX8 A;  3HKE E;  1G8X A;  2HHH T;  2BBJ A;  4AQF C;  2JQQ A;  3PUV F;  2CCQ A;  1M62 A;  2BS4 A;  3AVR A;  2BZB A;  3PUQ A;  4PNI A;  4H9N C;  3PTR B;  1UX4 A;  5LG4 A;  4G63 A;  3ZV0 C;  4B3M T;  1O3X A;  2WSS V;  3UQ4 A;  3ONX A;  3N9Q A;  5HXC A;  2VVS A;  3F57 A;  5FNV E;  2K5B B;  3QNU A;  4IIJ E;  5IWA T;  1OED C;  3TLU A;  4Q1T A;  2CWO A;  1T7S A;  1ZE2 A;  1YD8 G;  4WBN E;  5L47 A;  4CI1 B;  4PJJ A;  1UUS A;  4DMW A;  4OYK A;  1D0Y A;  3C98 B;  3UUB A;  2JIW A;  2CBI A;  4TWF A;  2E2A A;  2LHN A;  3SOL A;  4LML A;  2J4G A;  2LRL A;  3UUN A;  5AQJ B;  2I6H A;  2KMF A;  2JMH A;  1NEN A;  3PJA J;  2KND A;  2AUS A;  4JI8 T;  1D1C A;  2CXF A;  2J5T A;  4DUY T;  4UVC B;  2DWK A;  2WMN A;  1HS7 A;  3K3Q C;  4OX9 T;  1VRB A;  4HEA A;  1Y64 B;  4KMC A;  4PJL A;  2XSA A;  3CIR A;  1XZY A;  3CWZ B;  1XMQ T;  1J2B A;  2ZLY A;  4IDN A;  5C2T A;  2NP9 A;  1ZOY A;  2Z6E A;  1LVF A;  4M1P A;  2CLY C;  4ZOL E;  3BQK A;  3K1S A;  1ZV4 X;  5FP3 A;  2M6B A;  2KSR A;  3A8Y C;  3JCF A;  1BR1 A;  4OHF A;  5JDN A;  4YXD A;  2W0G A;  3PDY A;  1IBL T;  3AXJ A;  2K24 A;  4JI4 T;  1YQ3 A;  4JYA T;  4KP3 C;  1HG2 A;  4JI7 T;  4DR1 T;  2IAK A;  2B76 A;  2L3L A;  2H88 A;  2XAJ B;  5IYZ E;  2J1D G;  2Q9Q B;  4QXH B;  3CVR A;  2CWW A;  2PTF A;  2V5D A;  3ETV A;  5AQF B;  2LOP A;  2SPC A;  4FI5 A;  3HJY A;  1W9R A;  3Q9D A;  4CN6 A;  1L0V A;  5AQI B;  4KBM B;  2Q9Q A;  2VB6 A;  3ZEF B;  1MMG A;  2LHR A;  2H7V C;  4COF A;  3H37 A;  4L5G A;  4U31 A;  3ZMS B;  3ZT6 A;  4DV1 T;  1J5E T;  2UU9 T;  2UXB T;  1WCR A;  4PJM A;  1XDP A;  1LRZ A;  1T8B A;  3FZF B;  5M4Y A;  1CHU A;  3EDU A;  4AXP A;  3I1A A;  4TWD A;  3P8C D;  4YHH T;  2C5K T;  4DV6 T;  2YDS A;  4IRE A;  3VSE A;  5EK4 A;  4G2A A;  1QSD A;  4ILB A;  1MMD A;  5GON E;  3BK9 A;  3WI3 A;  4U7Y A;  1S04 A;  2FBW A;  1XNE A;  1IT8 A;  1N32 T;  1WRD A;  1AJ3 A;  4NXN T;  3IHR A;  5DQV A;  4BJM A;  2BG9 E;  5L3D B;  5FXV A;  3MA9 A;  1LKX A;  1CUN A;  4DR2 T;  4DR6 T;  1UGO A;  2J5V A;  3C4Z A;  2ZM0 A;  2P38 A;  3I9Y A;  3KDS E;  2WMO A;  3RIA A;  2EHO A;  4BJN A;  5JDL A;  2X0H A;  5KMG P;  5AQV B;  2FJA A;  3KVB A;  1UCU A;  3ETU A;  3RYH E;  1ZKE A;  4JUY A;  1N34 T;  4A56 A;  3ZN0 B;  2CM0 A;  2W4X A;  2CE7 A;  4DO0 A;  3MQK A;  4IE7 A;  4AQF A;  4YSZ A;  4HWC A;  3RYC E;  2WWU A;  5LBQ B;  3AE5 A;  3GWH A;  3N9P A;  3OKQ A;  2ACZ A;  4IL4 A;  2VKH A;  5LMU T;  1UK5 A;  1X9B A;  4YLH A;  4NIQ A;  4LF9 T;  4MFR A;  3PUS A;  2UUC T;  1NAF A;  2QVA A;  5C3J A;  5LNK A;  2WDV A;  3AAE B;  4E7Z A;  2A9U A;  2BKO A;  4UXN B;  3ZCJ A;  2ZM2 A;  2W00 A;  3TLS A;  1Y01 A;  3SFE A;  3PU8 A;  2XUE A;  3VHL A;  3RRC A;  2EHO D;  4OYJ A;  3CX7 B;  3CQX C;  3LWP A;  4CI2 B;  1HNX T;  1KK7 A;  2YU2 A;  3L3P A;  5J2T E;  1HR0 T;  3CKD A;  5LHG B;  5A1L A;  3O1J A;  4X20 E;  5JDQ A;  2CXL A;  3HA4 A;  3N2G E;  4UF0 A;  4IDQ A;  3AVS A;  3LWQ A;  4HE8 A;  5IUX A;  4JI5 T;  4ZZB A;  2VKD A;  4GK5 E;  5FMN A;  3OYZ A;  4AKR B;  4DMG A;  5ABH A;  5LXT E;  1W09 A;  3ONJ A;  1IJ5 A;  1FEW A;  4U7I A;  4JEH B;  2V7I A;  2FUP A;  3P4W A;  3UT5 E;  4OK0 A;  2RFK A;  2CBJ A;  2IML A;  2E9X B;  4JI6 T;  2BVL A;  4IE6 A;  2ACX A;  2D0U A;  4ZXL A;  4TX5 A;  4IE0 A;  3I0Q A;  4IL9 A;  2XAQ B;  4U2Y A;  2E9X C;  2EHO C;  3L39 A;  1XWM A;  4QXB B;  4DR5 T;  4EYY R;  5ABG A;  1US7 B;  5FL0 A;  3N5L A;  1WR0 A;  1WXW A;  4P09 A;  3F2E A;  5CB4 E;  3E0Z A;  2VKO A;  3LJC A;  2PBI A;  3VR8 A;  3AEE A;  4P1N A;  4AQY T;  4EXT A;  4ZI7 E;  1D1A A;  4PFP A;  5LGT B;  3A7M A;  2DL1 A;  3UU4 A;  2BG9 C;  5JVD E;  4YSY A;  3VKG A;  5LJN A;  2IW5 B;  1UX5 A;  5HXE A;  2X9Y A;  3R6N A;  4LFC T;  3D0T A;  1XDO A;  5EK3 A;  3HR0 A;  4L9I A;  4AKG A;  4MLK A;  3P4Q A;  3JC6 C;  2JQ9 A;  3H3A A;  4ANJ A;  2XTL A;  3ZMV B;  5HWX A;  4P0B A;  3VU7 H;  4C90 A;  2LSI A;  2D9D A;  3RI5 A;  1OXZ A;  4Z8X A;  2VL8 A;  1OED E;  2V5C A;  2BKP A;  2XQ5 A;  2Y48 B;  3RQU A;  4TNW A;  2W66 A;  4DBQ A;  4OFZ A;  3C4W A;  4H9O C;  3QB5 A;  2V6Y B;  4GKJ T;  1VOM A;  2EY4 A;  4EYU A;  4KUM B;  4B3R T;  3D79 A;  3X1D A;  5LGN B;  3AE6 A;  3M6U A;  3VRA A;  4DR3 T;  4WW0 A;  5FXW A;  2UUA T;  4X64 T;  2PJQ A;  4Q25 A;  3UU3 A;  5HAX A;  5HYA A;  3VR9 A;  5LJM A;  1S94 A;  1R8I A;  4UEL A;  3CQC B;  2J47 A;  1R3F A;  4DUZ T;  2LLY A;  5ADX L;  2W61 A;  3RPU A;  4YTN A;  4HFH A;  2NW7 A;  3RC3 A;  2XQY A;  4JI2 T;  1HNW T;  4F8H A;  2DHR A;  3RIF A;  1BR4 A;  3RKG A;  3EAM A;  4TWH A;  3RGL A;  2XQA A;  4P0A A;  5JDH A;  5ABE A;  3C50 A;  5LG3 A;  3M6V A;  4ASK A;  3ZYL A;  1WFD A;  3U78 A;  2AS0 A;  3N2K E;  5FKY A;  4I55 E;  3AB3 B;  4HWH A;  4ZZC A;  5LGU B;  3PUG A;  2CWY A;  4HN9 A;  3O4X E;  2B1E A;  2DWG A;  3ZC1 A;  1G73 A;  2OV9 A;  5LYJ E;  1SUM B;  3OYX A;  3FHN A;  1FMW A;  4YJ3 E;  1W0B A;  2V7J A;  3HAX A;  2K9A A;  2Y8D A;  1FIO A;  3HKB E;  1X79 A;  4TZ4 C;  4YSX A;  1N36 T;  4KX6 A;  2XJ7 A;  4ZI3 D;  1Z8U A;  3O1I A;  5H6R B;  5FVL A;  4HWF A;  3RH3 A;  1IJ6 A;  3AE1 A;  5JDF A;  5AQU B;  1FMV A;  3JC6 D;  2CHN A;  4CXY A;  2OLT A;  1IZN B;  4YFS A;  4BA9 A;  4AIS A;  2LRK A;  4MAL A;  5CGM A;  2LEH A;  3QUJ A;  4O2A E; 
#chains in the Genus database with same CATH homology
 2WBL A;  3SS1 A;  3EDV A;  4QWN B;  1NWM X;  3ZMZ B;  5LOV E;  4HKA A;  4I43 B;  3C4X A;  4ISS A;  3NRY A;  4B6X A;  4X1I E;  4HFV A;  1HF8 A;  3UUL A;  3C4Z A;  2ZM0 A;  2Y6X A;  4FJO A;  4ILU A;  3I9Y A;  3KDS E;  2Q9Q D;  2WMO A;  3AA0 B;  3KVA A;  4UV9 B;  1BR0 A;  2EHO A;  4BJN A;  2GK9 A;  5JDL A;  5KMG P;  4XBF B;  3Q2M A;  2A3D A;  3KVB A;  2VK9 A;  4XZC A;  3LK2 B;  1UCU A;  3ETU A;  3RYH E;  1ZKE A;  5DJQ C;  4JUY A;  4PK4 A;  3KBT A;  4ZI3 C;  2ZM8 A;  1LVK A;  2UXN B;  3KV9 A;  2CM0 A;  3CX8 B;  2CXD A;  3ZN0 B;  4A56 A;  2VKJ A;  4F6R C;  2CE7 A;  4IE4 A;  1SHZ C;  2HPL A;  5FY7 A;  4DO0 A;  5JR9 B;  2MOZ A;  2K48 A;  4IE7 A;  5HXR A;  2KIN B;  3N9M A;  4AQF A;  2ZMA A;  2MBG A;  4UIG A;  3EUH A;  4EZH A;  1HFA A;  3ZN1 B;  3RYC E;  4DVD A;  5EK2 A;  4DBR A;  2WWU A;  2N9D A;  3N2O A;  3C64 A;  5LBQ B;  3Q5X A;  3N9O A;  3CML A;  2NWB A;  2X51 A;  3V5S A;  2LSY A;  3GWH A;  4WBO A;  3N9P A;  4ZI2 C;  4JLE A;  2IC9 A;  3CPZ A;  3OKQ A;  3N9N A;  3OJA A;  4ADZ A;  2X9W A;  3FXD B;  4O4L E;  3ZC0 A;  2VKH A;  4YLH A;  2G0U A;  3LK3 B;  5JR9 A;  4EIW A;  4GYR A;  3GMI A;  3I9W A;  4MFR A;  3GN5 A;  2ODV A;  2DNX A;  2XAH B;  3KIN B;  3PUS A;  3U3I A;  5DAB A;  1S35 A;  2A2F X;  4GK0 E;  4IDZ A;  1NAF A;  1KNZ A;  4U72 A;  5LNK A;  3FBZ A;  2NTX A;  4X1Y E;  2H3R A;  3AAE B;  3ZJ2 A;  4E7Z A;  3KFW X;  4WNK A;  2RP4 A;  4ZI2 D;  3RYF E;  4DND A;  1HCI A;  4UXN B;  3IF8 B;  3ZCJ A;  3NRX A;  2ZM2 A;  2W00 A;  5LBM A;  5L3E B;  3V5U A;  2MTQ A;  3QK6 A;  3PU8 A;  2XUE A;  1MIW A;  4H63 H;  4U74 A;  3VHL A;  4H9S E;  4AKI A;  3RRC A;  2EHO D;  4OYJ A;  3CX7 B;  4O8S A;  3LG7 A;  3CQX C;  2VAS A;  3RKO A;  3GN5 B;  4CI2 B;  1HTJ F;  2V7K A;  5E0O A;  1KK7 A;  2YU2 A;  5L3G B;  2X68 A;  3L3P A;  4H9Q C;  3O9X A;  5J2T E;  3CQG B;  3CKD A;  3FB2 A;  2RA1 A;  3C51 A;  3O1H A;  3PUR A;  2LOS A;  5LHG B;  2CLY B;  5A1L A;  3VKH A;  5FY0 A;  4CXW A;  4J2C A;  3O1J A;  2ANE A;  3CX6 B;  1BR2 A;  2C5I T;  2XAS B;  4PAG A;  2OA5 A;  4X20 E;  4CI3 B;  5JQG E;  5JDQ A;  3KV5 A;  2CXL A;  2LSJ A;  3HA4 A;  3N2G E;  4UF0 A;  3RX6 A;  3UFE A;  3AVS A;  3ZMU B;  1HX8 A;  3HKE E;  1G8X A;  4HE8 A;  5LCY A;  2VKD A;  3I0O A;  4GK5 E;  5FMN A;  4AQF C;  3OYZ A;  4AKR B;  2QGS A;  5J2U E;  2CEA A;  2JQQ A;  3S4U A;  5LXT E;  2CCQ A;  2KXP B;  1IJ5 A;  4X1K E;  2N2N A;  1FEW A;  5JDM A;  4EOZ B;  4JEH B;  2V7I A;  3AVR A;  3BQI A;  2VWA A;  2BZB A;  3PUQ A;  4PNI A;  3E22 E;  2N1G A;  4H9N C;  3HKD E;  3UT5 E;  3PTR B;  3AA7 B;  4OK0 A;  4ZHQ E;  1UX4 A;  5LG4 A;  5F8P A;  1ZEE A;  2D5U A;  2XAG B;  2E9X B;  4G63 A;  2BVL A;  1YKH B;  4IE6 A;  1IAP A;  1O3X A;  2ACX A;  2D0U A;  3K3N A;  2WSS V;  4TX5 A;  3ZYM A;  3FBL A;  3P7I A;  1HG5 A;  3ZCI A;  2YU1 A;  4TV8 E;  4IE0 A;  3ONX A;  5JDG A;  3N9Q A;  3M65 A;  4O2B E;  3I0Q A;  2V7L A;  3K8P C;  5HXC A;  2BDE A;  4BAY B;  2XAQ B;  3F57 A;  4EZ4 A;  5FNV E;  2K5B B;  2D2S A;  4IIJ E;  2E9X C;  2EHO C;  5FYM A;  2KWI B;  4QXB B;  4C91 A;  4EYY R;  2CWO A;  1YD8 G;  4WBN E;  3WAJ A;  5H6Q B;  4EAH A;  2KLQ A;  1US7 B;  1D1B A;  4CI1 B;  4PJJ A;  2V7M A;  4OYK A;  2NW9 A;  4DMW A;  3N5L A;  1D0Y A;  3C98 B;  2JRK A;  4UVA B;  4P09 A;  3F2E A;  3IBP A;  5CB4 E;  2W63 A;  3E0Z A;  2LSG A;  4IST A;  4K0U A;  2VKO A;  1WR6 A;  2YEV C;  2X9H A;  3LJC A;  2PBI A;  2P9B A;  2LHN A;  2X9X A;  3SOL A;  5EZY E;  4EXT A;  2JPF A;  4ZI7 E;  5KDM C;  3E08 A;  1D1A A;  4PFP A;  3RYI E;  1WYC A;  5LGT B;  2DI4 A;  3MAC A;  2E9X D;  1WYB A;  3UUN A;  4NUV A;  5JVD E;  3NBX X;  1ZHC A;  1EZ3 A;  1B7T A;  2KMF A;  3VKG A;  4AI6 A;  4CQI A;  2JMH A;  2X67 A;  5LA6 E;  5LJN A;  2LSK A;  3DTO A;  2IW5 B;  4MBQ A;  2KND A;  1UX5 A;  1WLX A;  3B57 A;  1D1C A;  2CXF A;  2X9Y A;  3HL6 A;  3R6N A;  4AKL A;  5HXE A;  3D0T A;  4UVC B;  4PW8 A;  2DWK A;  2LJL A;  2DCF A;  5LHI B;  3DP7 A;  2WMN A;  2WM9 A;  1HS7 A;  1V9D A;  5EK3 A;  3K3Q C;  4I50 E;  3HR0 A;  4L9I A;  4AKG A;  4MLK A;  3JC6 C;  1ZBO A;  2C5J A;  1VRB A;  3GA8 A;  3H3A A;  4HEA A;  1QUU A;  5JRE A;  1SA0 E;  4ZS3 A;  4ANJ A;  1Y64 B;  3B13 A;  4KMC A;  4PJL A;  2XTL A;  2HH7 A;  3ZMV B;  5F3J A;  5HWY A;  5CA1 E;  5HWX A;  4P0B A;  4ZS2 A;  3VU7 H;  4C90 A;  3CWZ B;  2NOX A;  2LSI A;  3DJB A;  5CA0 E;  4PK6 A;  3SWH A;  4O4J E;  2ZLY A;  3MKD A;  1OXZ A;  2W62 A;  4Z8X A;  5ETW A;  2JMK A;  4AQG A;  2VL8 A;  2NP9 A;  4MHC A;  5HXS A;  2Z6E A;  3WAK A;  2IC6 A;  4NUU A;  3A5X A;  1LVF A;  4IGU A;  2KT9 A;  2Y48 B;  4M1P A;  2PFV A;  1U4Q A;  3AA1 B;  2CLY C;  4DBQ A;  4ZOL E;  5KX5 E;  4I4T E;  4OFZ A;  3BQK A;  2XAF B;  3C4W A;  4H9O C;  2L9Q A;  1ZV4 X;  5FP3 A;  1VOM A;  1MND A;  3QC9 A;  3MZK B;  4EYU A;  5BMV E;  1BR1 A;  4OHF A;  2X66 A;  5JDN A;  4KUM B;  2W0G A;  3NZP A;  1H7C A;  4XAX B;  2ODU A;  2V26 A;  3PDY A;  5FY1 A;  5LGN B;  3LFM A;  3ZJ1 A;  3AAI A;  5JR9 C;  4QX7 B;  4PFO A;  4WW0 A;  3NZQ A;  5FXW A;  3J9X 1;  2EHO B;  2K24 A;  3ESL A;  4V1A v;  2PJQ A;  4UEM A;  2MYS A;  5HAX A;  5HYA A;  2PG8 A;  3F31 A;  4KP3 C;  3T8O A;  1HG2 A;  5IHY A;  3L09 A;  2C0S A;  1T98 A;  4AKH A;  3PUA A;  5LJM A;  2IAK A;  1S94 A;  4QHO A;  2V1D B;  4UEL A;  2L3L A;  2YIN A;  2QA7 A;  3CQC B;  5L2L A;  3ZPO A;  4QKN A;  2XAJ B;  5IYZ E;  5HXH A;  5ADX L;  2J1D G;  5DQW A;  2Q9Q B;  2W61 A;  3OBV E;  4QXH B;  3RPU A;  1MMA A;  4UVB B;  5L3C B;  1YKE B;  5FXX A;  4GYS A;  3CVR A;  2LE8 A;  2NW7 A;  2M67 A;  2HPJ A;  2CA5 A;  4UV8 B;  3SRZ A;  3RC3 A;  4CXX A;  2H7O A;  2XQY A;  3UUM A;  3ETV A;  4N78 D;  1YW0 A;  2D0T A;  3ZMT B;  2LOP A;  1E1H B;  1MIY A;  2DLR A;  2DHR A;  2SPC A;  3R84 B;  2A72 A;  4FI5 A;  1BR4 A;  5L3B B;  2KWH A;  3ZLI A;  3Q9D A;  5AFU L;  5J1G A;  3KV4 A;  3Q5W A;  2LT3 A;  4DMV A;  4IE5 A;  1Z0P A;  4P0A A;  2XHE B;  5JDH A;  4KBM B;  3C50 A;  2Q9Q A;  4ASK A;  1U5P A;  3ZYL A;  2UXX B;  4EB6 E;  2I59 A;  2VB6 A;  4TV9 E;  3ZEF B;  3KBU A;  4ERR A;  3UUX B;  1MIV A;  3K3O A;  1MMG A;  4L0R A;  4O4I E;  3U78 A;  4YHJ A;  3N2K E;  1OWA A;  5JRC A;  2BVM A;  4I55 E;  2LHR A;  2H7V C;  3H37 A;  4GIW A;  3AA6 B;  3AB3 B;  2Q9Q C;  4L5G A;  4O2A E;  5LP6 E;  2ES0 A;  3LBX B;  3IEE A;  4CZZ B;  2WAU A;  3ZMS B;  5LGU B;  4JEU B;  3ZYK A;  3W15 B;  3HKC E;  2LM9 A;  3PUG A;  2CWY A;  4PJM A;  5L3F B;  2L8K A;  1MMN A;  1LRZ A;  4HN9 A;  2CMR A;  3EDU A;  4AXP A;  5M4Y A;  3I1A A;  3O4X E;  3ANW A;  4QX8 B;  2B1E A;  3P8C D;  4GOU A;  2DWG A;  4PK5 A;  2E8I A;  3ZC1 A;  1G73 A;  5FXZ A;  5LYJ E;  3OYX A;  5LHH B;  2C5K T;  3EVY A;  3FHN A;  1FMW A;  4YJ3 E;  5EK4 A;  4G2A A;  1QSD A;  5JRC B;  4IHJ E;  3AAA B;  2V7J A;  4O4H E;  1MMD A;  4UF0 B;  2NW8 A;  1D0Z A;  5GON E;  3BK9 A;  2K9A A;  4TN7 B;  4HGA A;  1MNE A;  3MJX A;  3LBX A;  3WI3 A;  4YJ2 E;  2Y8D A;  1FIO A;  3HKB E;  5TAO A;  1X79 A;  3TKL B;  4PJN A;  2JJ9 A;  3MK7 C;  4TZ4 C;  1D0X A;  4ZI3 D;  3O1I A;  4HTE A;  3RRW A;  4H9R C;  5H6R B;  2YK0 A;  3RH3 A;  3J7Y q;  4QXC B;  3ANW B;  4H63 V;  1IJ6 A;  4TUY E;  1WRD A;  5JDF A;  4E7S A;  1AJ3 A;  2NTY A;  3PU3 A;  1FMV A;  3JC6 D;  3RC8 A;  3LK4 2;  3IHR A;  4CXY A;  2E9X A;  5DQV A;  1IZN B;  4H9P C;  4BJM A;  5JH7 E;  5C8Y E;  4YFS A;  5L3D B;  4BA9 A;  5FXV A;  3MA9 A;  3UTK A;  3FXE B;  4MAL A;  3PE0 A;  2X0L B;  2LEH A;  3BQL A;  2KZ7 B;  3N9L A;  3KV6 A;  1LKX A;  3MXZ A;  3HI2 A;  3QUJ A;  1CUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...