3M65A

Crystal structure of bacillus subtilis lon n-terminal domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
204
Chain Sequence
b'ELKRSIPLLPLRGLLVYPTMVLHLDVGRDKSVQALEQAMMHDHMIFLATQQDISIDEPGEDEIFTVGTYTKIKQMLKLPNGTIRVLVEGLKRAHIVKYNEHEDYTSVDIQLIHEDKDTEDEALMRTLLDHFDQYIKISKKISAETYAAVTDIEEPGRMADIVASHLPLKLKDKQDILETADVKDRLNKVIDFINNEKEVLEIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent protease La 1
publication title Crystal Structures of Bacillus subtilis Lon Protease.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 61
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3m65A02
2.30.130.40 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 LON domain-like 3m65A01
4CI3B 4CI2B 3LJCA 3M65A 4CI1B 1ZBOA 4TZ4C 2ANEA
chains in the Genus database with same CATH superfamily
3ETVA 3G06A 1BR2A 3AVRA 3K3QC 4ASKA 3E0ZA 5FY1A 3LBXB 3ETUA 3NZPA 4UF0A 2E2AA 3O1JA 2CEAA 2V7LA 2YDQA 4ILUA 2EHOD 4U2YA 1W0AA 2LJLA 5AQKB 3ZKRA 3O4XE 4IIJE 3UUMA 3SRZA 2KT9A 4U74A 1G8XA 4CI1B 1UX4A 4NXMT 2XASB 2BZBA 3KVAA 3VU7H 2NTYA 2HHHT 3LWRA 2Q9QD 4AKIA 5AQIB 1KNRA 3T1YT 5HXRA 3S4UA 2Z0TA 3Q2MA 2E9XB 2AUSA 3Q5EA 4HE8A 3HJYA 3ZPOA 4PFOA 1E7PA 2GK9A 4LF5T 2KINB 2FJAA 2D9DA 3P4PA 1S35A 1WYCA 2L8KA 4EYUA 4U7IA 5HEGA 3BQLA 2WM9A 1XDPA 5C3JA 1H7CA 3WAJA 3P4SA 4EIWA 3RRCA 1KF6A 4GOUA 2LLYA 3T1HT 1WXXA 4YHJA 1O3XA 3Q5DA 2BKOA 3AB3B 1JNRA 5LGUB 3C4ZA 5ABEA 5HYAA 3QC9A 2YK0A 4DMWA 3UTKA 4BJNA 4JI0T 2WDRA 1VCSA 3O1IA 5LBQB 1QSDA 2WP9A 2PG8A 3LDQB 3MJXA 3E22E 3PDYA 2ACXA 3CVRA 2XQ4A 3X1DA 3PJAA 4ZEYA 1R3FA 4HFVA 2AXDS 2CPTA 2C0SA 2ZM6T 3TLSA 3OTOT 2LSKA 2VL8A 2LE8A 4Q1TA 1Y01A 1HX8A 2FJDA 3LWPA 3ZMSB 2VQET 3AA7B 5M4YA 3LWQA 2E5VA 2XQ9A 3C0KA 3AEFA 2DL1A 3LK3B 3RIUA 4O2AE 2J1DG 3PUYF 2UXNB 5LG3A 4ZI2D 3VR9A 2BS4A 2H89A 4EV6A 4LFBT 2WSSV 4I43B 2HPLA 1QUUA 2Q9QB 3ZMTB 3OKQA 4OX9T 2XQYA 4ZI3D 4XBFB 2LOPA 3RKGA 3FZKB 5JH7E 3A5XA 3ANWB 3UULA 2WDQA 3AE9A 4PJNA 3JAEA 5KXJA 5AQLB 2JPFA 5JTGA 1HF8A 1HX1B 2I6HA 4ILCA 3ZMUB 3EDVA 4PNIA 3MQKA 3OBVE 2FUPA 2I0MA 4BAYB 4YT0A 2HVYA 1G73A 3RLFF 2KSRA 4YTPA 2W0GA 2CHNA 4NXNT 4YTNA 2DCFA 5LMUT 3ZJ1A 2DLRA 5L47A 5L4EA 2XQ5A 4I50E 3CMLA 2A9UA 2UXDT 2LKHA 5HWXA 4IE5A 5CJ5A 2AE9A 1DU2A 4P0BA 4PAGA 3R6NA 1UCUA 1MMDA 2E8IA 2RFKA 4CQIA 1ZE1A 5JDQA 2CXLA 4H9OC 4ZZBA 4HWFA 2X51A 3HKEE 3N9OA 3OPCA 5HXSA 2BG9C 2ODUA 2UU9T 2X66A 3KBTA 2V7JA 3P4RA 3ONLC 4X5TA 2UXCT 2UXBT 2K3WA 3LSVA 4UVAB 4LMKA 1X79A 2ACZA 4Q25A 5FYMA 1XMOT 1HG2A 4DR2T 3M6VA 2I59A 1I6ZA 2RP4A 5EZYE 5HEOA 2XM2A 1JNZA 2W4XA 2XUEA 3ZCJA 4KX6A 2IC6A 2BVLA 2X0YA 5FXWA 5LG4A 5E0OA 2JQ9A 4DR7T 2L3LA 4AQYT 2Z6EA 4ZI7E 3LK42 4OHFA 2P38A 3H3AA 3UUBA 4H63H 3VRAA 3FZLB 2M67A 4LMJA 3RYFE 3VKHA 2BKPA 2WWVA 2VWAA 2NW7A 5AQGB 2ODVA 3K1SA 1N32T 4KUMB 2BG9A 1N36T 4IE0A 1ZS7A 4DBRA 4UIGA 1OEDC 5HAXA 1ZP0A 3HAXA 2Y6XA 1K8WA 4DV1T 1IBLT 3PU3A 4MFRA 3LG7A 4YLHA 3PURA 1S94A 4K0KT 4ILAA 2KNDA 4BA9A 5HEUA 5ABFA 5J1GA 2KZ7B 3N2GE 4HWCA 5EK3A 3SOLA 3P4QA 4HWDA 5AFUL 1W0BA 3UAIA 4DBQA 3DP7A 2A2FX 3MXZA 4A56A 4YFSA 2QYWA 1XMQT 1QLBA 3JADA 4QH4A 3CX7B 2J5TA 5FXZA 4TV9E 1SQWA 4YHHT 3B57A 4L0RA 2CA5A 3AE4A 3RIAA 3AE5A 1BR4A 2X68A 1HNWT 4EZ4A 4XZCA 4ZZCA 2E9XC 1NWMX 3RYIE 2BKNA 4TNVA 3V5SA 3PUZF 2E5LT 1BR1A 4CXWA 2AS0A 3UU4A 5KX5E 4FI5A 1Z8UA 2UUAT 4IDQA 3LDFA 3CQGB 3CQXC 3LBXA 1AJ3A 1KFYA 1HFAA 2VKOA 2ZLYA 3DJBA 2K24A 4EEBA 4JYAT 4UELA 4EEDA 3N9PA 2UXXB 5LHHB 5LGTB 3FB2A 3KFWX 4CN6A 2VKJA 1VCTA 3AEEA 2XQ8A 2A72A 3RIFA 5FL0A 3LFMA 2KWHA 1D1CA 3Q5WA 2YU1A 4U33A 3ZLIA 5HXHA 4X1KE 2DP9A 4UR9A 1FMWA 5LA6E 4H9RC 1WLXA 4JI1T 5LB7B 4TWDA 3TLUA 4XAXB 3ZC0A 2OA5A 4GK5E 4IGUA 5JDGA 4JI8T 3IEEA 4P0AA 2WWUA 5H6RB 3CKDA 3RH3A 3ESLA 5EK4A 2CBIA 4UEMA 3AAEB 2DI4A 2XZEA 1MMAA 4X66T 3U78A 4DV4T 4EAHA 2PFVA 4JI3T 5HXCA 4G2AA 1HCIA 1YQ3A 4EOZB 1X9BA 3KV4A 3PUSA 4EZHA 2RA1A 2IMLA 3D0TA 4MLKA 3PUAA 4QX8B 1UK5A 3ZMVB 5J0ZA 1FJGT 4U31A 5JDMA 4GKJT 2L9QA 4JI7T 2JMKA 4ERRA 1XNQT 1XWMA 1IZNB 2X9YA 3PE0A 3QK6A 1YQ4A 4N78D 5FXXA 3W15B 4Z90A 5LOVE 3LWVA 3BK9A 1YKHB 2YDSA 3RYCE 2NP9A 5FVKA 3KDSE 5LXTE 4JI4T 1ZHCA 5HCJA 4E7ZA 4GK0E 2V6XA 4YSYA 1KNZA 1LVKA 3M3ZB 4UVCB 4NUVA 1MIYA 4UV9B 2XPKA 5FNVE 4ILBA 3VSEA 3Q5XA 2IUBA 4I55E 3FBLA 2XSBA 3GMIA 4G63A 1NENA 2WCAA 4PW8A 1IJ6A 3TLVA 2LRKA 2LRLA 4MBQA 2OLTA 3RQWA 3C4WA 4LFCT 3RIUC 2LSYA 3F31A 5DABA 1EZ3A 4TUYE 3PUXF 3AAIA 4TZ4C 3NZQA 2K48A 3TLWA 2PBIA 2Y48B 3RC8A 2VB6A 2Q9QA 5JR9A 3HL6A 4LF8T 1VRBA 5AQNB 2JQKA 2PJQA 2BS3A 4AKGA 3ANWA 5AQFB 2CM0A 5AQHB 3JCFA 1UUSA 4DO0A 4O4JE 3RPUA 5FY7A 5L3DB 4PJMA 3L8RA 2RPAA 4YTMA 1US7B 3IHRA 2Y8DA 2CX0A 5FMNA 2BBHA 3KVBA 1XZYA 4LF6T 1R3EA 4HFIA 2OV9A 2HN1A 1CHUA 1U5PA 1ZOYA 3AA0B 1ZL3A 5JRCB 2EHOB 3UFEA 4U72A 1SUMB 2IC9A 1IT8A 5JQGE 3KV9A 2N1GA 4CZZB 4E7SA 1UOYA 1WR6A 2LEHA 2D0TA 4WBOA 2NW9A 1I94T 3KV6A 3KBUA 1M62A 4CXXA 4H63V 4TN7B 2LM9A 2MAWA 3AE1A 5JR9B 4L5GA 4AXPA 3U3IA 3ZSTA 1NEKA 3AVSA 2APOA 5LJNA 2IIUA 2E5OA 5CFBA 4AISA 4GYRA 2SPCA 2X9XA 5L3FB 5AQPB 5IYZE 4DMVA 1Y64B 3GN5B 4CI2B 5FP3A 3O9XA 2AB4A 5J2UE 1WR0A 4O2BE 3N5LA 2HH7A 4C91A 3ONXA 2LSIA 4UV8B 4YJ2E 4DV5T 2B76A 3VR8A 4DR4T 3EDUA 2LT3A 4WBNE 2V7KA 4KBMB 1MNDA 5CA1E 3FZHB 4CI3B 2JRKA 3SWHA 4OYKA 2W62A 3AA6B 3C64A 2CWYA 4KMCA 4ISTA 1OXZA 4MALA 5J2TE 4EB6E 2MOZA 2D5UA 5L3BB 5ABHA 5L3GB 3WAKA 2LM2A 3FZFB 4AIUA 2VKHA 1D1BA 3I1AA 3V5UA 4AQFA 1SE7A 1M7KA 3ZYMA 4DNDA 5H6QB 2XTLA 4U2ZA 2D2SA 2IW5B 3VHLA 5F8PA 4IHJE 3HR0A 1HNXT 4H9SE 2H7OA 4HWIB 4NPPA 3AEAA 4DR5T 2J47A 2M6IA 4DV3T 3OYXA 4IDNA 2KKUA 4DUYT 2DWKA 2FRXA 2JQHA 1Q7HA 2LSJA 1WFDA 5L2LA 2DNXA 4HKAA 5DQWA 4HN9A 1IBKT 3I0OA 2V8SV 3N9LA 4PJLA 3P7IA 1YW0A 2KLQA 3AECA 4ADZA 4O8SA 2QA7A 1IAPA 3AXJB 2CXDA 5AQMB 5FL1A 3FXDB 5LMNT 5LP6E 3LK2B 3P50A 3CIRA 1OEDE 3MK7C 5CGMA 5DJQC 2N2NA 2V7MA 3ZN1B 2JIWA 3JC6C 1LKXA 1T98A 1V9DA 4HEAA 2WDVA 3C50A 2ZM8A 2R6GF 2MTQA 3IUWA 1MMGA 4JEUB 3ZV0C 3RF1A 4I4TE 5KMGP 2V5DA 2LSGA 1IQ8A 3UUNA 3ZEFB 4HFBA 3CWZB 3QUJA 1FEWA 2ZM2A 2QVAA 3IF8B 2V6YA 4TV8E 3M4XA 1YD8G 4MHCA 1MNEA 4EYYR 4HGAA 2CLYB 2B78A 1SGVA 3I9YA 1HNZT 2LHRA 2XM1A 4H9NC 1J1JA 1SA0E 3EI0A 3PUWF 3ZSSA 2LHNA 2DHRA 1XNRT 2X67A 5HCMA 3ZC1A 4KHPT 2CHOA 4CXYA 5LNKA 5LGNB 4QX7B 3T8OA 3VRBA 3J9X1 5KDMC 2CWOA 4U7YA 4P1NA 3F57A 4O4LE 3NKZA 3RHWA 3WI3A 3P4WA 4I0UA 2PTFA 2W2UA 3JAFA 2NOXA 4HFDA 3NVOA 4HFCA 3QNUA 2E9XD 4PFPA 2V6YB 4DR6T 3UU6A 4HFHA 4YSXA 2IHR1 3MZKB 4F6RC 4PJJA 3A7MA 3QB5K 3ZJ2A 2FJBA 2WU2A 3QB5A 4QXCB 2YDRA 3ZT7A 2G0UA 1T7SA 4CN4A 3CK6A 3PU8A 3HA4A 1W9RA 5BR8T 2IAKA 3OVUA 2VURA 2YEVC 3ZN0B 3IBPA 2NTXA 1MIWA 3ZT6A 2A3DA 4KHZF 2XJ7A 1KNPA 2KMFA 2D0UA 5L3CB 5JVDE 4IE7A 1ZEEA 4QH1A 1MIVA 5LHGB 4M1PA 2VQFT 2EHOC 1ZV4X 4A98A 4HFEA 2K5BB 5C2TA 1J2BA 3AE3A 3D79A 3EAMA 4JBWF 4WNKA 2JJ9A 3K3NA 1WXWA 3QOFA 2WS3A 3BQIA 3UU8A 4DV0T 3RGLA 2XAFB 2V1DB 2M6BA 2WB5A 4HWHA 2Q9QC 4GIWA 5JR9C 4QH5A 5FKYA 4BJMA 2DWGA 1WK2A 1GQEA 5LYJE 3CPZA 3ONJA 1KK7A 3UT5E 3LJCA 2X0LB 4NUUA 3FBZA 3KV5A 5AQTB 4DVDA 2NWBA 1UURA 2BDEA 2F4VT 5AQUB 3C51A 2FBWA 3L09A 5LJMA 2LOSA 3E08A 1CUNA 5HEJA 3NRYA 2XHEB 4O4IE 3LWOA 2NR4A 4IT4A 4YY3T 4IE4A 3PTRB 5JRCA 1D0XA 2V5CA 2EHOA 2VKDA 4QXHB 3N9MA 4JLEA 3L3PA 1ZBOA 3UQ4A 4YXDA 5JDNA 2KWIB 4X1IE 3Q9DA 4X64T 1Z0PA 4UF0B 2QGSA 1FIOA 3A8YC 4X62T 4IREA 4AKHA 3SFEA 5C8YE 3N2KE 3F2EA 3OYZA 4WYVA 1R8IA 5TAOA 2WQYA 2W00A 4L9IA 5FXVA 2XY8B 3GN5A 4ZS2A 2P9BA 4OK0A 4A97A 2J4GA 3FHNA 4X65T 1HTJF 2VVNA 1ZE2A 4ISSA 5AQOB 5AQQB 3ZYLA 4ZHQE 4V1Av 3UFGA 3DTOA 4JI5T 4QHOA 1LVFA 3RKOA 3AE8A 4DV7T 4H9QC 3HKCE 3RQUA 3U28A 4ZI2C 2UUBT 2LKGA 2ZM0A 3C4XA 2W66A 3M6UA 4KP3C 4A5XA 2BS2A 2YOEA 3PUGA 5BMVE 3H37A 5F5WA 3AAAB 4LMLA 4ZI3C 2VASA 2WY2A 2H88A 1WRDA 4AQFC 1NAFA 3K8PC 3EVYA 3TLTA 4IL4A 4B3TT 1T5YA 1YXRA 2X0HA 3GA8A 4JUYA 4X1YE 1B7TA 3M6XA 2Q07A 4GYSA 2CXFA 2CWWA 1UGOA 3FZMB 3CX8B 4WZXA 1UX5A 5IHYA 5LBMA 4DUZT 4DV6T 5HWYA 3RC3A 3EHZA 3HJWA 4J2CA 3M6WA 1U4QA 3L39A 3RX6A 2C5KT 5F3JA 1T8BA 4NIQA 2KXPB 3H3MA 1N33T 4U3CA 4JEHB 2V26A 2NW8A 4ANJA 4QXBB 5LHIB 2CLYC 1MMNA 2XQ6A 4ZS3A 4FJOA 3AXJA 4O4HE 2XSAA 3CQCB 5HEHA 1L0VA 3NWIA 2BG9E 3CX6B 4AKRB 3VKGA 2B1EA 2YINA 1XNEA 2X9WA 4DV2T 2XQAA 4EXTA 5AQVB 2IDOB 2CRBA 4X20E 2ANEA 2C5JA 3TKLB 3N2OA 2CBJA 2XQ3A 1E1HB 5AQRB 2HN2A 4LFAT 2JMHA 4PK6A 3OJAA 3EUHA 4AQGA 5ADXL 5A1LA 3B13A 2CX1A 2XQ7A 3MKDA 4EGWA 4KI0F 2WU5A 3B5MA 4JV5T 3IA3A 2WMNA 3NBXX 3AE6A 4TX5A 4QKNA 2MBGA 4K0UA 4YSZA 3RI5A 4DR3T 3RRWA 1YKEB 3AA1B 3SS1A 4UVBB 5JDFA 3UQ7A 2H3RA 3KINB 2QRXA 4H9PC 2MYSA 3ZCIA 2J5VA 4GKKT 4IDZA 2K9AA 4ZOLE 4IDPA 5IUXA 2YKSA 4B3MT 2FJEA 3PV0F 4DIDB 4PK5A 1IBMT 3ZT5A 3PJAJ 2UUCT 3AE2A 4B6XA 2XAJB 3MACA 1KEYA 3PUVF 1T72A 3P8CD 3MA9A 4Z91A 1TE7A 5CA0E 2W63A 2JQQA 2C5IT 1D0YA 2MPKA 5AQSB 2VK9A 2X9HA 3HI2A 4P09A 3HKDE 3JC6D 4B3ST 4TWHA 4OFZA 3BQKA 2YN6A 5HXEA 1W09A 2CMRA 3AEGA 4LF7T 2VVSA 1HG5A 4DMGA 2W67A 2W61A 5CB4E 1N34T 5JDLA 4HTEA 5AQJB 4C90A 4ZXLA 4QWNB 4LF9T 1E2AA 4TWFA 4LF4T 3UU3A 3NRXA 4CN1A 1SHZC 4Z8XA 5GONE 1J5WA 4AKLA 5L3EB 3N9NA 2EY4A 3AEDA 3RYHE 3GWHA 2VL0A 5JDHA 2CE7A 3UUXB 3ABVA 1D1AA 1S04A 1VOMA 4IDOA 2N9DA 3HKBE 4B3RT 4IE6A 1J5ET 2BG9B 1FMVA 1WCRA 2BVMA 4AI6A 1OEDA 5FY0A 2CCQA 2WBLA 4YJ3E 1D0ZA 2WZHA 2WMOA 3I9WA 3AEBA 4F8HA 3R84B 1HS7A 2WZIA 3K3OA 4PK4A 5IWAT 5ABFB 1IT7A 1IJ5A 2J62A 1OWAA 5ABGA 2XAQB 1HR0T 3UU5A 5LCYA 4TNWA 3SFDA 2H7VC 3ZYKA 2XAGB 4JI6T 3EABA 2BBJA 2YU2A 5DQVA 5JREA 4IL9A 1BR0A 1XDOA 1ZKEA 2V7IA 2WAUA 4JI2T 4OYJA 3PUQA 5L4HA 3ZMZB 3C98B 2ZMAA 4DR1T 2E9XA 2XAHB 1LRZA 4UXNB 1WYBA 3AE7A 4WW0A 5EK2A 3I0QA 2HPJA 3J7Yq 3FXEB 3N9QA 5FVLA 3O1HA 3M65A 4COFA 5ETWA 1OEDB 2ES0A
chains in the Genus database with same CATH topology
3ETVA 1BR2A 3AVRA 3K3QC 2A2FX 3E0ZA 3MXZA 4V1Av 4A56A 4ASKA 5FY1A 3LBXB 3DTOA 4H9SE 4YFSA 3ETUA 2H7OA 4QHOA 1LVFA 3NZPA 4UF0A 3CX7B 3RKOA 5FXZA 4H9QC 4TV9E 3O1JA 2CEAA 3HKCE 2V7LA 4ZI2C 3OYXA 3B57A 4ILUA 2ZM0A 3C4XA 4L0RA 2CA5A 2EHOD 2DWKA 4KP3C 2LJLA 3O4XE 1BR4A 3PUGA 5BMVE 3H37A 2X68A 4IIJE 2LSJA 3AAAB 5L2LA 2DNXA 3UUMA 3SRZA 4HKAA 4EZ4A 4XZCA 2E9XC 4ZI3C 2VASA 1NWMX 3RYIE 5DQWA 2KT9A 4U74A 1G8XA 4HN9A 1UX4A 1WRDA 4CI1B 4AQFC 3V5SA 1NAFA 2XASB 3K8PC 3I0OA 3N9LA 2BZBA 3KVAA 1BR1A 4CXWA 3EVYA 3VU7H 2NTYA 4PJLA 3P7IA 1YW0A 2KLQA 5KX5E 2Q9QD 4AKIA 4FI5A 4ADZA 3GA8A 3CQGB 4JUYA 3CQXC 4X1YE 1B7TA 3LBXA 4O8SA 1AJ3A 2QA7A 5HXRA 1IAPA 4GYSA 2CXFA 3S4UA 3Q2MA 1HFAA 2CXDA 2VKOA 2ZLYA 3DJBA 2E9XB 2K24A 3CX8B 1UX5A 3FXDB 4UELA 5LP6E 4HE8A 3LK2B 3N9PA 5IHYA 2UXXB 3ZPOA 5LHHB 5LBMA 5LGTB 3FB2A 4PFOA 2GK9A 3KFWX 3MK7C 2KINB 5HWYA 5DJQC 2VKJA 3RC3A 2N2NA 4J2CA 2V7MA 1U4QA 3RX6A 1S35A 3ZN1B 2A72A 3JC6C 1LKXA 1T98A 1WYCA 2C5KT 3LFMA 5F3JA 2KWHA 2L8KA 4EYUA 1V9DA 3BQLA 4HEAA 2WM9A 3C50A 2ZM8A 2KXPB 1H7CA 1D1CA 3Q5WA 2YU1A 4JEHB 3WAJA 2V26A 2MTQA 3ZLIA 5HXHA 2NW8A 1MMGA 4ANJA 4QXBB 4JEUB 4X1KE 4EIWA 3RRCA 5LHIB 2CLYC 1FMWA 1MMNA 4GOUA 4H9RC 5LA6E 4I4TE 1WLXA 4ZS3A 4XAXB 3ZC0A 5KMGP 2LSGA 2OA5A 4GK5E 4YHJA 1O3XA 4IGUA 5JDGA 4FJOA 4O4HE 3IEEA 4P0AA 2WWUA 5H6RB 3AB3B 3CQCB 3DP7A 3UUNA 3ZEFB 5LGUB 3C4ZA 3CKDA 3CWZB 3RH3A 5HYAA 3CX6B 3QUJA 3ESLA 4AKRB 3VKGA 3QC9A 2B1EA 1FEWA 2ZM2A 2YINA 3IF8B 5EK4A 2YK0A 4DMWA 4TV8E 3UTKA 2X9WA 4BJNA 4UEMA 1YD8G 3AAEB 3O1IA 4EXTA 4MHCA 2DI4A 1MNEA 4EYYR 4HGAA 1MMAA 4X20E 5LBQB 2CLYB 1QSDA 2ANEA 3U78A 2C5JA 4EAHA 2PFVA 2PG8A 5HXCA 4G2AA 1HCIA 3I9YA 3TKLB 3N2OA 2LHRA 4H9NC 4EOZB 1SA0E 1E1HB 3KV4A 3MJXA 3PUSA 3E22E 3PDYA 4EZHA 2ACXA 2RA1A 3CVRA 2LHNA 3D0TA 4MLKA 2DHRA 2JMHA 4PK6A 3OJAA 3PUAA 4HFVA 4QX8B 3ZMVB 3EUHA 2X67A 2C0SA 4AQGA 5ADXL 2LSKA 2VL8A 5A1LA 5JDMA 2L9QA 3B13A 2JMKA 4ERRA 3MKDA 3ZC1A 2LE8A 1HX8A 4CXYA 1IZNB 2X9YA 5LNKA 3PE0A 5LGNB 4QX7B 3QK6A 3ZMSB 2WMNA 3NBXX 3T8OA 3AA7B 4TX5A 5M4YA 4QKNA 2MBGA 4K0UA 3J9X1 4N78D 5FXXA 3RRWA 1YKEB 5KDMC 3W15B 3AA1B 5LOVE 3SS1A 4UVBB 3LK3B 5JDFA 4O2AE 2H3RA 2CWOA 2J1DG 3BK9A 3KINB 2UXNB 1YKHB 4ZI2D 3F57A 3RYCE 4H9PC 2MYSA 4O4LE 3ZCIA 2NP9A 3KDSE 4IDZA 3WI3A 2K9AA 5LXTE 1ZHCA 2WSSV 4I43B 4ZOLE 4E7ZA 2HPLA 4GK0E 1QUUA 2NOXA 1KNZA 2Q9QB 3ZMTB 3OKQA 1LVKA 4UVCB 2XQYA 2E9XD 4ZI3D 4PFPA 4XBFB 2LOPA 4NUVA 1MIYA 4PK5A 4UV9B 5FNVE 5JH7E 3A5XA 3ANWB 3UULA 3Q5XA 4PJNA 3MZKB 4F6RC 4I55E 3FBLA 2JPFA 3GMIA 4B6XA 4PJJA 1HF8A 4G63A 4PW8A 2XAJB 3ZJ2A 1IJ6A 3MACA 4MBQA 4QXCB 3C4WA 2LSYA 3P8CD 3MA9A 3F31A 5DABA 1EZ3A 3ZMUB 3EDVA 4PNIA 2G0UA 3OBVE 4TUYE 5CA0E 4BAYB 1G73A 2W63A 3PU8A 2JQQA 2C5IT 3HA4A 3AAIA 4TZ4C 1D0YA 2VK9A 2X9HA 2W0GA 3NZQA 2K48A 2PBIA 2IAKA 2Y48B 3RC8A 2VB6A 2Q9QA 2YEVC 5JR9A 3HI2A 3HL6A 4P09A 3ZN0B 3IBPA 2NTXA 2DCFA 3HKDE 3JC6D 3ZJ1A 1MIWA 2DLRA 2A3DA 4OFZA 3BQKA 2KMFA 1VRBA 2PJQA 4I50E 2D0UA 4AKGA 3ANWA 3CMLA 5L3CB 5HXEA 5JVDE 2CMRA 5HWXA 4IE7A 2CM0A 4IE5A 1HG5A 1ZEEA 1MIVA 4P0BA 5LHGB 4M1PA 4DO0A 2EHOC 4O4JE 3RPUA 5FY7A 5L3DB 1ZV4X 4PJMA 4PAGA 3R6NA 2K5BB 1UCUA 1MMDA 2E8IA 2W61A 5CB4E 1US7B 4CQIA 5JDLA 4HTEA 3IHRA 4C90A 2Y8DA 4QWNB 4WNKA 2JJ9A 3K3NA 5FMNA 3BQIA 3NRXA 5JDQA 3KVBA 2CXLA 1SHZC 2XAFB 4Z8XA 4H9OC 5GONE 2V1DB 4AKLA 5L3EB 1U5PA 2X51A 3N9NA 3AA0B 3HKEE 3RYHE 3N9OA 5HXSA 5JRCB 3GWHA 2EHOB 2Q9QC 4GIWA 3UFEA 2ODUA 5JR9C 4U72A 4BJMA 2X66A 2DWGA 3KBTA 2IC9A 2V7JA 5JQGE 3KV9A 2N1GA 4CZZB 4E7SA 5JDHA 5LYJE 3CPZA 1WR6A 1KK7A 2LEHA 3UT5E 2CE7A 2D0TA 3LJCA 4WBOA 3UUXB 2NW9A 4UVAB 2X0LB 1D1AA 4NUUA 1X79A 1VOMA 3KV6A 3KBUA 2N9DA 3FBZA 3KV5A 4CXXA 5FYMA 4DVDA 4H63V 3HKBE 2NWBA 4TN7B 2BDEA 2LM9A 4IE6A 5JR9B 1HG2A 4L5GA 1FMVA 2BVMA 4AXPA 3U3IA 2I59A 3C51A 3AVSA 4AI6A 2RP4A 5EZYE 3L09A 5LJMA 5LJNA 5FY0A 2CCQA 4GYRA 2LOSA 2WBLA 2SPCA 3E08A 1CUNA 4YJ3E 3NRYA 1D0ZA 2XHEB 4O4IE 2WMOA 3I9WA 2X9XA 2XUEA 5L3FB 5IYZE 3ZCJA 3R84B 4DMVA 1Y64B 4IE4A 3GN5B 4CI2B 3PTRB 5FP3A 3O9XA 5JRCA 1D0XA 1HS7A 2EHOA 2IC6A 2BVLA 3K3OA 4O2BE 5FXWA 5J2UE 2VKDA 5LG4A 4PK4A 3N5LA 4QXHB 5E0OA 2HH7A 4C91A 2L3LA 2LSIA 3ONXA 1IJ5A 4UV8B 3N9MA 4JLEA 4YJ2E 2Z6EA 1OWAA 4ZI7E 3EDUA 3LK42 4OHFA 2LT3A 2XAQB 4WBNE 3L3PA 1ZBOA 2V7KA 4KBMB 1MNDA 5LCYA 5CA1E 4CI3B 2JRKA 3SWHA 5JDNA 2KWIB 3H3AA 4H63H 2H7VC 4OYKA 3ZYKA 2W62A 4X1IE 2M67A 2XAGB 3Q9DA 3RYFE 3VKHA 3AA6B 2VWAA 2NW7A 1Z0PA 2YU2A 3C64A 4UF0B 2QGSA 2CWYA 4KMCA 5DQVA 5JREA 1FIOA 4ISTA 2ODVA 1BR0A 1OXZA 4KUMB 4MALA 4AKHA 5C8YE 4IE0A 1ZKEA 2V7IA 4DBRA 3N2KE 4UIGA 3F2EA 3OYZA 5J2TE 2WAUA 5HAXA 4OYJA 3PUQA 2Y6XA 4EB6E 2MOZA 2D5UA 5TAOA 2W00A 5L3BB 3ZMZB 3C98B 3PU3A 5L3GB 2ZMAA 4L9IA 4MFRA 3LG7A 3WAKA 4YLHA 5FXVA 2VKHA 3GN5A 4ZS2A 2P9BA 1D1BA 2E9XA 3I1AA 3PURA 4OK0A 3V5UA 1S94A 2XAHB 3FHNA 1LRZA 4AQFA 2KNDA 4UXNB 1HTJF 4BA9A 1WYBA 5J1GA 2KZ7B 3ZYMA 4ISSA 4WW0A 3N2GE 5EK3A 5EK2A 3I0QA 2HPJA 4DNDA 3J7Yq 5H6QB 2XTLA 3FXEB 3SOLA 3N9QA 2D2SA 3ZYLA 3O1HA 2IW5B 3M65A 5AFUL 3VHLA 5F8PA 4IHJE 4ZHQE 5ETWA 4DBQA 2ES0A 3HR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI3 B;  4CI2 B;  3LJC A;  3M65 A;  4CI1 B;  1ZBO A;  4TZ4 C;  2ANE A; 
#chains in the Genus database with same CATH topology
 3ETV A;  3G06 A;  1BR2 A;  3AVR A;  3K3Q C;  4ASK A;  3E0Z A;  5FY1 A;  3LBX B;  3ETU A;  3NZP A;  4UF0 A;  2E2A A;  3O1J A;  2CEA A;  2V7L A;  2YDQ A;  4ILU A;  2EHO D;  4U2Y A;  1W0A A;  2LJL A;  5AQK B;  3ZKR A;  3O4X E;  4IIJ E;  3UUM A;  3SRZ A;  2KT9 A;  4U74 A;  1G8X A;  4CI1 B;  1UX4 A;  4NXM T;  2XAS B;  2BZB A;  3KVA A;  3VU7 H;  2NTY A;  2HHH T;  3LWR A;  2Q9Q D;  4AKI A;  5AQI B;  1KNR A;  3T1Y T;  5HXR A;  3S4U A;  2Z0T A;  3Q2M A;  2E9X B;  2AUS A;  3Q5E A;  4HE8 A;  3HJY A;  3ZPO A;  4PFO A;  1E7P A;  2GK9 A;  4LF5 T;  2KIN B;  2FJA A;  2D9D A;  3P4P A;  1S35 A;  1WYC A;  2L8K A;  4EYU A;  4U7I A;  5HEG A;  3BQL A;  2WM9 A;  1XDP A;  5C3J A;  1H7C A;  3WAJ A;  3P4S A;  4EIW A;  3RRC A;  1KF6 A;  4GOU A;  2LLY A;  3T1H T;  1WXX A;  4YHJ A;  1O3X A;  3Q5D A;  2BKO A;  3AB3 B;  1JNR A;  5LGU B;  3C4Z A;  5ABE A;  5HYA A;  3QC9 A;  2YK0 A;  4DMW A;  3UTK A;  4BJN A;  4JI0 T;  2WDR A;  1VCS A;  3O1I A;  5LBQ B;  1QSD A;  2WP9 A;  2PG8 A;  3LDQ B;  3MJX A;  3E22 E;  3PDY A;  2ACX A;  3CVR A;  2XQ4 A;  3X1D A;  3PJA A;  4ZEY A;  1R3F A;  4HFV A;  2AXD S;  2CPT A;  2C0S A;  2ZM6 T;  3TLS A;  3OTO T;  2LSK A;  2VL8 A;  2LE8 A;  4Q1T A;  1Y01 A;  1HX8 A;  2FJD A;  3LWP A;  3ZMS B;  2VQE T;  3AA7 B;  5M4Y A;  3LWQ A;  2E5V A;  2XQ9 A;  3C0K A;  3AEF A;  2DL1 A;  3LK3 B;  3RIU A;  4O2A E;  2J1D G;  3PUY F;  2UXN B;  5LG3 A;  4ZI2 D;  3VR9 A;  2BS4 A;  2H89 A;  4EV6 A;  4LFB T;  2WSS V;  4I43 B;  2HPL A;  1QUU A;  2Q9Q B;  3ZMT B;  3OKQ A;  4OX9 T;  2XQY A;  4ZI3 D;  4XBF B;  2LOP A;  3RKG A;  3FZK B;  5JH7 E;  3A5X A;  3ANW B;  3UUL A;  2WDQ A;  3AE9 A;  4PJN A;  3JAE A;  5KXJ A;  5AQL B;  2JPF A;  5JTG A;  1HF8 A;  1HX1 B;  2I6H A;  4ILC A;  3ZMU B;  3EDV A;  4PNI A;  3MQK A;  3OBV E;  2FUP A;  2I0M A;  4BAY B;  4YT0 A;  2HVY A;  1G73 A;  3RLF F;  2KSR A;  4YTP A;  2W0G A;  2CHN A;  4NXN T;  4YTN A;  2DCF A;  5LMU T;  3ZJ1 A;  2DLR A;  5L47 A;  5L4E A;  2XQ5 A;  4I50 E;  3CML A;  2A9U A;  2UXD T;  2LKH A;  5HWX A;  4IE5 A;  5CJ5 A;  2AE9 A;  1DU2 A;  4P0B A;  4PAG A;  3R6N A;  1UCU A;  1MMD A;  2E8I A;  2RFK A;  4CQI A;  1ZE1 A;  5JDQ A;  2CXL A;  4H9O C;  4ZZB A;  4HWF A;  2X51 A;  3HKE E;  3N9O A;  3OPC A;  5HXS A;  2BG9 C;  2ODU A;  2UU9 T;  2X66 A;  3KBT A;  2V7J A;  3P4R A;  3ONL C;  4X5T A;  2UXC T;  2UXB T;  2K3W A;  3LSV A;  4UVA B;  4LMK A;  1X79 A;  2ACZ A;  4Q25 A;  5FYM A;  1XMO T;  1HG2 A;  4DR2 T;  3M6V A;  2I59 A;  1I6Z A;  2RP4 A;  5EZY E;  5HEO A;  2XM2 A;  1JNZ A;  2W4X A;  2XUE A;  3ZCJ A;  4KX6 A;  2IC6 A;  2BVL A;  2X0Y A;  5FXW A;  5LG4 A;  5E0O A;  2JQ9 A;  4DR7 T;  2L3L A;  4AQY T;  2Z6E A;  4ZI7 E;  3LK4 2;  4OHF A;  2P38 A;  3H3A A;  3UUB A;  4H63 H;  3VRA A;  3FZL B;  2M67 A;  4LMJ A;  3RYF E;  3VKH A;  2BKP A;  2WWV A;  2VWA A;  2NW7 A;  5AQG B;  2ODV A;  3K1S A;  1N32 T;  4KUM B;  2BG9 A;  1N36 T;  4IE0 A;  1ZS7 A;  4DBR A;  4UIG A;  1OED C;  5HAX A;  1ZP0 A;  3HAX A;  2Y6X A;  1K8W A;  4DV1 T;  1IBL T;  3PU3 A;  4MFR A;  3LG7 A;  4YLH A;  3PUR A;  1S94 A;  4K0K T;  4ILA A;  2KND A;  4BA9 A;  5HEU A;  5ABF A;  5J1G A;  2KZ7 B;  3N2G E;  4HWC A;  5EK3 A;  3SOL A;  3P4Q A;  4HWD A;  5AFU L;  1W0B A;  3UAI A;  4DBQ A;  3DP7 A;  2A2F X;  3MXZ A;  4A56 A;  4YFS A;  2QYW A;  1XMQ T;  1QLB A;  3JAD A;  4QH4 A;  3CX7 B;  2J5T A;  5FXZ A;  4TV9 E;  1SQW A;  4YHH T;  3B57 A;  4L0R A;  2CA5 A;  3AE4 A;  3RIA A;  3AE5 A;  1BR4 A;  2X68 A;  1HNW T;  4EZ4 A;  4XZC A;  4ZZC A;  2E9X C;  1NWM X;  3RYI E;  2BKN A;  4TNV A;  3V5S A;  3PUZ F;  2E5L T;  1BR1 A;  4CXW A;  2AS0 A;  3UU4 A;  5KX5 E;  4FI5 A;  1Z8U A;  2UUA T;  4IDQ A;  3LDF A;  3CQG B;  3CQX C;  3LBX A;  1AJ3 A;  1KFY A;  1HFA A;  2VKO A;  2ZLY A;  3DJB A;  2K24 A;  4EEB A;  4JYA T;  4UEL A;  4EED A;  3N9P A;  2UXX B;  5LHH B;  5LGT B;  3FB2 A;  3KFW X;  4CN6 A;  2VKJ A;  1VCT A;  3AEE A;  2XQ8 A;  2A72 A;  3RIF A;  5FL0 A;  3LFM A;  2KWH A;  1D1C A;  3Q5W A;  2YU1 A;  4U33 A;  3ZLI A;  5HXH A;  4X1K E;  2DP9 A;  4UR9 A;  1FMW A;  5LA6 E;  4H9R C;  1WLX A;  4JI1 T;  5LB7 B;  4TWD A;  3TLU A;  4XAX B;  3ZC0 A;  2OA5 A;  4GK5 E;  4IGU A;  5JDG A;  4JI8 T;  3IEE A;  4P0A A;  2WWU A;  5H6R B;  3CKD A;  3RH3 A;  3ESL A;  5EK4 A;  2CBI A;  4UEM A;  3AAE B;  2DI4 A;  2XZE A;  1MMA A;  4X66 T;  3U78 A;  4DV4 T;  4EAH A;  2PFV A;  4JI3 T;  5HXC A;  4G2A A;  1HCI A;  1YQ3 A;  4EOZ B;  1X9B A;  3KV4 A;  3PUS A;  4EZH A;  2RA1 A;  2IML A;  3D0T A;  4MLK A;  3PUA A;  4QX8 B;  1UK5 A;  3ZMV B;  5J0Z A;  1FJG T;  4U31 A;  5JDM A;  4GKJ T;  2L9Q A;  4JI7 T;  2JMK A;  4ERR A;  1XNQ T;  1XWM A;  1IZN B;  2X9Y A;  3PE0 A;  3QK6 A;  1YQ4 A;  4N78 D;  5FXX A;  3W15 B;  4Z90 A;  5LOV E;  3LWV A;  3BK9 A;  1YKH B;  2YDS A;  3RYC E;  2NP9 A;  5FVK A;  3KDS E;  5LXT E;  4JI4 T;  1ZHC A;  5HCJ A;  4E7Z A;  4GK0 E;  2V6X A;  4YSY A;  1KNZ A;  1LVK A;  3M3Z B;  4UVC B;  4NUV A;  1MIY A;  4UV9 B;  2XPK A;  5FNV E;  4ILB A;  3VSE A;  3Q5X A;  2IUB A;  4I55 E;  3FBL A;  2XSB A;  3GMI A;  4G63 A;  1NEN A;  2WCA A;  4PW8 A;  1IJ6 A;  3TLV A;  2LRK A;  2LRL A;  4MBQ A;  2OLT A;  3RQW A;  3C4W A;  4LFC T;  3RIU C;  2LSY A;  3F31 A;  5DAB A;  1EZ3 A;  4TUY E;  3PUX F;  3AAI A;  4TZ4 C;  3NZQ A;  2K48 A;  3TLW A;  2PBI A;  2Y48 B;  3RC8 A;  2VB6 A;  2Q9Q A;  5JR9 A;  3HL6 A;  4LF8 T;  1VRB A;  5AQN B;  2JQK A;  2PJQ A;  2BS3 A;  4AKG A;  3ANW A;  5AQF B;  2CM0 A;  5AQH B;  3JCF A;  1UUS A;  4DO0 A;  4O4J E;  3RPU A;  5FY7 A;  5L3D B;  4PJM A;  3L8R A;  2RPA A;  4YTM A;  1US7 B;  3IHR A;  2Y8D A;  2CX0 A;  5FMN A;  2BBH A;  3KVB A;  1XZY A;  4LF6 T;  1R3E A;  4HFI A;  2OV9 A;  2HN1 A;  1CHU A;  1U5P A;  1ZOY A;  3AA0 B;  1ZL3 A;  5JRC B;  2EHO B;  3UFE A;  4U72 A;  1SUM B;  2IC9 A;  1IT8 A;  5JQG E;  3KV9 A;  2N1G A;  4CZZ B;  4E7S A;  1UOY A;  1WR6 A;  2LEH A;  2D0T A;  4WBO A;  2NW9 A;  1I94 T;  3KV6 A;  3KBU A;  1M62 A;  4CXX A;  4H63 V;  4TN7 B;  2LM9 A;  2MAW A;  3AE1 A;  5JR9 B;  4L5G A;  4AXP A;  3U3I A;  3ZST A;  1NEK A;  3AVS A;  2APO A;  5LJN A;  2IIU A;  2E5O A;  5CFB A;  4AIS A;  4GYR A;  2SPC A;  2X9X A;  5L3F B;  5AQP B;  5IYZ E;  4DMV A;  1Y64 B;  3GN5 B;  4CI2 B;  5FP3 A;  3O9X A;  2AB4 A;  5J2U E;  1WR0 A;  4O2B E;  3N5L A;  2HH7 A;  4C91 A;  3ONX A;  2LSI A;  4UV8 B;  4YJ2 E;  4DV5 T;  2B76 A;  3VR8 A;  4DR4 T;  3EDU A;  2LT3 A;  4WBN E;  2V7K A;  4KBM B;  1MND A;  5CA1 E;  3FZH B;  4CI3 B;  2JRK A;  3SWH A;  4OYK A;  2W62 A;  3AA6 B;  3C64 A;  2CWY A;  4KMC A;  4IST A;  1OXZ A;  4MAL A;  5J2T E;  4EB6 E;  2MOZ A;  2D5U A;  5L3B B;  5ABH A;  5L3G B;  3WAK A;  2LM2 A;  3FZF B;  4AIU A;  2VKH A;  1D1B A;  3I1A A;  3V5U A;  4AQF A;  1SE7 A;  1M7K A;  3ZYM A;  4DND A;  5H6Q B;  2XTL A;  4U2Z A;  2D2S A;  2IW5 B;  3VHL A;  5F8P A;  4IHJ E;  3HR0 A;  1HNX T;  4H9S E;  2H7O A;  4HWI B;  4NPP A;  3AEA A;  4DR5 T;  2J47 A;  2M6I A;  4DV3 T;  3OYX A;  4IDN A;  2KKU A;  4DUY T;  2DWK A;  2FRX A;  2JQH A;  1Q7H A;  2LSJ A;  1WFD A;  5L2L A;  2DNX A;  4HKA A;  5DQW A;  4HN9 A;  1IBK T;  3I0O A;  2V8S V;  3N9L A;  4PJL A;  3P7I A;  1YW0 A;  2KLQ A;  3AEC A;  4ADZ A;  4O8S A;  2QA7 A;  1IAP A;  3AXJ B;  2CXD A;  5AQM B;  5FL1 A;  3FXD B;  5LMN T;  5LP6 E;  3LK2 B;  3P50 A;  3CIR A;  1OED E;  3MK7 C;  5CGM A;  5DJQ C;  2N2N A;  2V7M A;  3ZN1 B;  2JIW A;  3JC6 C;  1LKX A;  1T98 A;  1V9D A;  4HEA A;  2WDV A;  3C50 A;  2ZM8 A;  2R6G F;  2MTQ A;  3IUW A;  1MMG A;  4JEU B;  3ZV0 C;  3RF1 A;  4I4T E;  5KMG P;  2V5D A;  2LSG A;  1IQ8 A;  3UUN A;  3ZEF B;  4HFB A;  3CWZ B;  3QUJ A;  1FEW A;  2ZM2 A;  2QVA A;  3IF8 B;  2V6Y A;  4TV8 E;  3M4X A;  1YD8 G;  4MHC A;  1MNE A;  4EYY R;  4HGA A;  2CLY B;  2B78 A;  1SGV A;  3I9Y A;  1HNZ T;  2LHR A;  2XM1 A;  4H9N C;  1J1J A;  1SA0 E;  3EI0 A;  3PUW F;  3ZSS A;  2LHN A;  2DHR A;  1XNR T;  2X67 A;  5HCM A;  3ZC1 A;  4KHP T;  2CHO A;  4CXY A;  5LNK A;  5LGN B;  4QX7 B;  3T8O A;  3VRB A;  3J9X 1;  5KDM C;  2CWO A;  4U7Y A;  4P1N A;  3F57 A;  4O4L E;  3NKZ A;  3RHW A;  3WI3 A;  3P4W A;  4I0U A;  2PTF A;  2W2U A;  3JAF A;  2NOX A;  4HFD A;  3NVO A;  4HFC A;  3QNU A;  2E9X D;  4PFP A;  2V6Y B;  4DR6 T;  3UU6 A;  4HFH A;  4YSX A;  2IHR 1;  3MZK B;  4F6R C;  4PJJ A;  3A7M A;  3QB5 K;  3ZJ2 A;  2FJB A;  2WU2 A;  3QB5 A;  4QXC B;  2YDR A;  3ZT7 A;  2G0U A;  1T7S A;  4CN4 A;  3CK6 A;  3PU8 A;  3HA4 A;  1W9R A;  5BR8 T;  2IAK A;  3OVU A;  2VUR A;  2YEV C;  3ZN0 B;  3IBP A;  2NTX A;  1MIW A;  3ZT6 A;  2A3D A;  4KHZ F;  2XJ7 A;  1KNP A;  2KMF A;  2D0U A;  5L3C B;  5JVD E;  4IE7 A;  1ZEE A;  4QH1 A;  1MIV A;  5LHG B;  4M1P A;  2VQF T;  2EHO C;  1ZV4 X;  4A98 A;  4HFE A;  2K5B B;  5C2T A;  1J2B A;  3AE3 A;  3D79 A;  3EAM A;  4JBW F;  4WNK A;  2JJ9 A;  3K3N A;  1WXW A;  3QOF A;  2WS3 A;  3BQI A;  3UU8 A;  4DV0 T;  3RGL A;  2XAF B;  2V1D B;  2M6B A;  2WB5 A;  4HWH A;  2Q9Q C;  4GIW A;  5JR9 C;  4QH5 A;  5FKY A;  4BJM A;  2DWG A;  1WK2 A;  1GQE A;  5LYJ E;  3CPZ A;  3ONJ A;  1KK7 A;  3UT5 E;  3LJC A;  2X0L B;  4NUU A;  3FBZ A;  3KV5 A;  5AQT B;  4DVD A;  2NWB A;  1UUR A;  2BDE A;  2F4V T;  5AQU B;  3C51 A;  2FBW A;  3L09 A;  5LJM A;  2LOS A;  3E08 A;  1CUN A;  5HEJ A;  3NRY A;  2XHE B;  4O4I E;  3LWO A;  2NR4 A;  4IT4 A;  4YY3 T;  4IE4 A;  3PTR B;  5JRC A;  1D0X A;  2V5C A;  2EHO A;  2VKD A;  4QXH B;  3N9M A;  4JLE A;  3L3P A;  1ZBO A;  3UQ4 A;  4YXD A;  5JDN A;  2KWI B;  4X1I E;  3Q9D A;  4X64 T;  1Z0P A;  4UF0 B;  2QGS A;  1FIO A;  3A8Y C;  4X62 T;  4IRE A;  4AKH A;  3SFE A;  5C8Y E;  3N2K E;  3F2E A;  3OYZ A;  4WYV A;  1R8I A;  5TAO A;  2WQY A;  2W00 A;  4L9I A;  5FXV A;  2XY8 B;  3GN5 A;  4ZS2 A;  2P9B A;  4OK0 A;  4A97 A;  2J4G A;  3FHN A;  4X65 T;  1HTJ F;  2VVN A;  1ZE2 A;  4ISS A;  5AQO B;  5AQQ B;  3ZYL A;  4ZHQ E;  4V1A v;  3UFG A;  3DTO A;  4JI5 T;  4QHO A;  1LVF A;  3RKO A;  3AE8 A;  4DV7 T;  4H9Q C;  3HKC E;  3RQU A;  3U28 A;  4ZI2 C;  2UUB T;  2LKG A;  2ZM0 A;  3C4X A;  2W66 A;  3M6U A;  4KP3 C;  4A5X A;  2BS2 A;  2YOE A;  3PUG A;  5BMV E;  3H37 A;  5F5W A;  3AAA B;  4LML A;  4ZI3 C;  2VAS A;  2WY2 A;  2H88 A;  1WRD A;  4AQF C;  1NAF A;  3K8P C;  3EVY A;  3TLT A;  4IL4 A;  4B3T T;  1T5Y A;  1YXR A;  2X0H A;  3GA8 A;  4JUY A;  4X1Y E;  1B7T A;  3M6X A;  2Q07 A;  4GYS A;  2CXF A;  2CWW A;  1UGO A;  3FZM B;  3CX8 B;  4WZX A;  1UX5 A;  5IHY A;  5LBM A;  4DUZ T;  4DV6 T;  5HWY A;  3RC3 A;  3EHZ A;  3HJW A;  4J2C A;  3M6W A;  1U4Q A;  3L39 A;  3RX6 A;  2C5K T;  5F3J A;  1T8B A;  4NIQ A;  2KXP B;  3H3M A;  1N33 T;  4U3C A;  4JEH B;  2V26 A;  2NW8 A;  4ANJ A;  4QXB B;  5LHI B;  2CLY C;  1MMN A;  2XQ6 A;  4ZS3 A;  4FJO A;  3AXJ A;  4O4H E;  2XSA A;  3CQC B;  5HEH A;  1L0V A;  3NWI A;  2BG9 E;  3CX6 B;  4AKR B;  3VKG A;  2B1E A;  2YIN A;  1XNE A;  2X9W A;  4DV2 T;  2XQA A;  4EXT A;  5AQV B;  2IDO B;  2CRB A;  4X20 E;  2ANE A;  2C5J A;  3TKL B;  3N2O A;  2CBJ A;  2XQ3 A;  1E1H B;  5AQR B;  2HN2 A;  4LFA T;  2JMH A;  4PK6 A;  3OJA A;  3EUH A;  4AQG A;  5ADX L;  5A1L A;  3B13 A;  2CX1 A;  2XQ7 A;  3MKD A;  4EGW A;  4KI0 F;  2WU5 A;  3B5M A;  4JV5 T;  3IA3 A;  2WMN A;  3NBX X;  3AE6 A;  4TX5 A;  4QKN A;  2MBG A;  4K0U A;  4YSZ A;  3RI5 A;  4DR3 T;  3RRW A;  1YKE B;  3AA1 B;  3SS1 A;  4UVB B;  5JDF A;  3UQ7 A;  2H3R A;  3KIN B;  2QRX A;  4H9P C;  2MYS A;  3ZCI A;  2J5V A;  4GKK T;  4IDZ A;  2K9A A;  4ZOL E;  4IDP A;  5IUX A;  2YKS A;  4B3M T;  2FJE A;  3PV0 F;  4DID B;  4PK5 A;  1IBM T;  3ZT5 A;  3PJA J;  2UUC T;  3AE2 A;  4B6X A;  2XAJ B;  3MAC A;  1KEY A;  3PUV F;  1T72 A;  3P8C D;  3MA9 A;  4Z91 A;  1TE7 A;  5CA0 E;  2W63 A;  2JQQ A;  2C5I T;  1D0Y A;  2MPK A;  5AQS B;  2VK9 A;  2X9H A;  3HI2 A;  4P09 A;  3HKD E;  3JC6 D;  4B3S T;  4TWH A;  4OFZ A;  3BQK A;  2YN6 A;  5HXE A;  1W09 A;  2CMR A;  3AEG A;  4LF7 T;  2VVS A;  1HG5 A;  4DMG A;  2W67 A;  2W61 A;  5CB4 E;  1N34 T;  5JDL A;  4HTE A;  5AQJ B;  4C90 A;  4ZXL A;  4QWN B;  4LF9 T;  1E2A A;  4TWF A;  4LF4 T;  3UU3 A;  3NRX A;  4CN1 A;  1SHZ C;  4Z8X A;  5GON E;  1J5W A;  4AKL A;  5L3E B;  3N9N A;  2EY4 A;  3AED A;  3RYH E;  3GWH A;  2VL0 A;  5JDH A;  2CE7 A;  3UUX B;  3ABV A;  1D1A A;  1S04 A;  1VOM A;  4IDO A;  2N9D A;  3HKB E;  4B3R T;  4IE6 A;  1J5E T;  2BG9 B;  1FMV A;  1WCR A;  2BVM A;  4AI6 A;  1OED A;  5FY0 A;  2CCQ A;  2WBL A;  4YJ3 E;  1D0Z A;  2WZH A;  2WMO A;  3I9W A;  3AEB A;  4F8H A;  3R84 B;  1HS7 A;  2WZI A;  3K3O A;  4PK4 A;  5IWA T;  5ABF B;  1IT7 A;  1IJ5 A;  2J62 A;  1OWA A;  5ABG A;  2XAQ B;  1HR0 T;  3UU5 A;  5LCY A;  4TNW A;  3SFD A;  2H7V C;  3ZYK A;  2XAG B;  4JI6 T;  3EAB A;  2BBJ A;  2YU2 A;  5DQV A;  5JRE A;  4IL9 A;  1BR0 A;  1XDO A;  1ZKE A;  2V7I A;  2WAU A;  4JI2 T;  4OYJ A;  3PUQ A;  5L4H A;  3ZMZ B;  3C98 B;  2ZMA A;  4DR1 T;  2E9X A;  2XAH B;  1LRZ A;  4UXN B;  1WYB A;  3AE7 A;  4WW0 A;  5EK2 A;  3I0Q A;  2HPJ A;  3J7Y q;  3FXE B;  3N9Q A;  5FVL A;  3O1H A;  3M65 A;  4COF A;  5ETW A;  1OED B;  2ES0 A; 
#chains in the Genus database with same CATH homology
 3ETV A;  1BR2 A;  3AVR A;  3K3Q C;  2A2F X;  3E0Z A;  3MXZ A;  4V1A v;  4A56 A;  4ASK A;  5FY1 A;  3LBX B;  3DTO A;  4H9S E;  4YFS A;  3ETU A;  2H7O A;  4QHO A;  1LVF A;  3NZP A;  4UF0 A;  3CX7 B;  3RKO A;  5FXZ A;  4H9Q C;  4TV9 E;  3O1J A;  2CEA A;  3HKC E;  2V7L A;  4ZI2 C;  3OYX A;  3B57 A;  4ILU A;  2ZM0 A;  3C4X A;  4L0R A;  2CA5 A;  2EHO D;  2DWK A;  4KP3 C;  2LJL A;  3O4X E;  1BR4 A;  3PUG A;  5BMV E;  3H37 A;  2X68 A;  4IIJ E;  2LSJ A;  3AAA B;  5L2L A;  2DNX A;  3UUM A;  3SRZ A;  4HKA A;  4EZ4 A;  4XZC A;  2E9X C;  4ZI3 C;  2VAS A;  1NWM X;  3RYI E;  5DQW A;  2KT9 A;  4U74 A;  1G8X A;  4HN9 A;  1UX4 A;  1WRD A;  4CI1 B;  4AQF C;  3V5S A;  1NAF A;  2XAS B;  3K8P C;  3I0O A;  3N9L A;  2BZB A;  3KVA A;  1BR1 A;  4CXW A;  3EVY A;  3VU7 H;  2NTY A;  4PJL A;  3P7I A;  1YW0 A;  2KLQ A;  5KX5 E;  2Q9Q D;  4AKI A;  4FI5 A;  4ADZ A;  3GA8 A;  3CQG B;  4JUY A;  3CQX C;  4X1Y E;  1B7T A;  3LBX A;  4O8S A;  1AJ3 A;  2QA7 A;  5HXR A;  1IAP A;  4GYS A;  2CXF A;  3S4U A;  3Q2M A;  1HFA A;  2CXD A;  2VKO A;  2ZLY A;  3DJB A;  2E9X B;  2K24 A;  3CX8 B;  1UX5 A;  3FXD B;  4UEL A;  5LP6 E;  4HE8 A;  3LK2 B;  3N9P A;  5IHY A;  2UXX B;  3ZPO A;  5LHH B;  5LBM A;  5LGT B;  3FB2 A;  4PFO A;  2GK9 A;  3KFW X;  3MK7 C;  2KIN B;  5HWY A;  5DJQ C;  2VKJ A;  3RC3 A;  2N2N A;  4J2C A;  2V7M A;  1U4Q A;  3RX6 A;  1S35 A;  3ZN1 B;  2A72 A;  3JC6 C;  1LKX A;  1T98 A;  1WYC A;  2C5K T;  3LFM A;  5F3J A;  2KWH A;  2L8K A;  4EYU A;  1V9D A;  3BQL A;  4HEA A;  2WM9 A;  3C50 A;  2ZM8 A;  2KXP B;  1H7C A;  1D1C A;  3Q5W A;  2YU1 A;  4JEH B;  3WAJ A;  2V26 A;  2MTQ A;  3ZLI A;  5HXH A;  2NW8 A;  1MMG A;  4ANJ A;  4QXB B;  4JEU B;  4X1K E;  4EIW A;  3RRC A;  5LHI B;  2CLY C;  1FMW A;  1MMN A;  4GOU A;  4H9R C;  5LA6 E;  4I4T E;  1WLX A;  4ZS3 A;  4XAX B;  3ZC0 A;  5KMG P;  2LSG A;  2OA5 A;  4GK5 E;  4YHJ A;  1O3X A;  4IGU A;  5JDG A;  4FJO A;  4O4H E;  3IEE A;  4P0A A;  2WWU A;  5H6R B;  3AB3 B;  3CQC B;  3DP7 A;  3UUN A;  3ZEF B;  5LGU B;  3C4Z A;  3CKD A;  3CWZ B;  3RH3 A;  5HYA A;  3CX6 B;  3QUJ A;  3ESL A;  4AKR B;  3VKG A;  3QC9 A;  2B1E A;  1FEW A;  2ZM2 A;  2YIN A;  3IF8 B;  5EK4 A;  2YK0 A;  4DMW A;  4TV8 E;  3UTK A;  2X9W A;  4BJN A;  4UEM A;  1YD8 G;  3AAE B;  3O1I A;  4EXT A;  4MHC A;  2DI4 A;  1MNE A;  4EYY R;  4HGA A;  1MMA A;  4X20 E;  5LBQ B;  2CLY B;  1QSD A;  2ANE A;  3U78 A;  2C5J A;  4EAH A;  2PFV A;  2PG8 A;  5HXC A;  4G2A A;  1HCI A;  3I9Y A;  3TKL B;  3N2O A;  2LHR A;  4H9N C;  4EOZ B;  1SA0 E;  1E1H B;  3KV4 A;  3MJX A;  3PUS A;  3E22 E;  3PDY A;  4EZH A;  2ACX A;  2RA1 A;  3CVR A;  2LHN A;  3D0T A;  4MLK A;  2DHR A;  2JMH A;  4PK6 A;  3OJA A;  3PUA A;  4HFV A;  4QX8 B;  3ZMV B;  3EUH A;  2X67 A;  2C0S A;  4AQG A;  5ADX L;  2LSK A;  2VL8 A;  5A1L A;  5JDM A;  2L9Q A;  3B13 A;  2JMK A;  4ERR A;  3MKD A;  3ZC1 A;  2LE8 A;  1HX8 A;  4CXY A;  1IZN B;  2X9Y A;  5LNK A;  3PE0 A;  5LGN B;  4QX7 B;  3QK6 A;  3ZMS B;  2WMN A;  3NBX X;  3T8O A;  3AA7 B;  4TX5 A;  5M4Y A;  4QKN A;  2MBG A;  4K0U A;  3J9X 1;  4N78 D;  5FXX A;  3RRW A;  1YKE B;  5KDM C;  3W15 B;  3AA1 B;  5LOV E;  3SS1 A;  4UVB B;  3LK3 B;  5JDF A;  4O2A E;  2H3R A;  2CWO A;  2J1D G;  3BK9 A;  3KIN B;  2UXN B;  1YKH B;  4ZI2 D;  3F57 A;  3RYC E;  4H9P C;  2MYS A;  4O4L E;  3ZCI A;  2NP9 A;  3KDS E;  4IDZ A;  3WI3 A;  2K9A A;  5LXT E;  1ZHC A;  2WSS V;  4I43 B;  4ZOL E;  4E7Z A;  2HPL A;  4GK0 E;  1QUU A;  2NOX A;  1KNZ A;  2Q9Q B;  3ZMT B;  3OKQ A;  1LVK A;  4UVC B;  2XQY A;  2E9X D;  4ZI3 D;  4PFP A;  4XBF B;  2LOP A;  4NUV A;  1MIY A;  4PK5 A;  4UV9 B;  5FNV E;  5JH7 E;  3A5X A;  3ANW B;  3UUL A;  3Q5X A;  4PJN A;  3MZK B;  4F6R C;  4I55 E;  3FBL A;  2JPF A;  3GMI A;  4B6X A;  4PJJ A;  1HF8 A;  4G63 A;  4PW8 A;  2XAJ B;  3ZJ2 A;  1IJ6 A;  3MAC A;  4MBQ A;  4QXC B;  3C4W A;  2LSY A;  3P8C D;  3MA9 A;  3F31 A;  5DAB A;  1EZ3 A;  3ZMU B;  3EDV A;  4PNI A;  2G0U A;  3OBV E;  4TUY E;  5CA0 E;  4BAY B;  1G73 A;  2W63 A;  3PU8 A;  2JQQ A;  2C5I T;  3HA4 A;  3AAI A;  4TZ4 C;  1D0Y A;  2VK9 A;  2X9H A;  2W0G A;  3NZQ A;  2K48 A;  2PBI A;  2IAK A;  2Y48 B;  3RC8 A;  2VB6 A;  2Q9Q A;  2YEV C;  5JR9 A;  3HI2 A;  3HL6 A;  4P09 A;  3ZN0 B;  3IBP A;  2NTX A;  2DCF A;  3HKD E;  3JC6 D;  3ZJ1 A;  1MIW A;  2DLR A;  2A3D A;  4OFZ A;  3BQK A;  2KMF A;  1VRB A;  2PJQ A;  4I50 E;  2D0U A;  4AKG A;  3ANW A;  3CML A;  5L3C B;  5HXE A;  5JVD E;  2CMR A;  5HWX A;  4IE7 A;  2CM0 A;  4IE5 A;  1HG5 A;  1ZEE A;  1MIV A;  4P0B A;  5LHG B;  4M1P A;  4DO0 A;  2EHO C;  4O4J E;  3RPU A;  5FY7 A;  5L3D B;  1ZV4 X;  4PJM A;  4PAG A;  3R6N A;  2K5B B;  1UCU A;  1MMD A;  2E8I A;  2W61 A;  5CB4 E;  1US7 B;  4CQI A;  5JDL A;  4HTE A;  3IHR A;  4C90 A;  2Y8D A;  4QWN B;  4WNK A;  2JJ9 A;  3K3N A;  5FMN A;  3BQI A;  3NRX A;  5JDQ A;  3KVB A;  2CXL A;  1SHZ C;  2XAF B;  4Z8X A;  4H9O C;  5GON E;  2V1D B;  4AKL A;  5L3E B;  1U5P A;  2X51 A;  3N9N A;  3AA0 B;  3HKE E;  3RYH E;  3N9O A;  5HXS A;  5JRC B;  3GWH A;  2EHO B;  2Q9Q C;  4GIW A;  3UFE A;  2ODU A;  5JR9 C;  4U72 A;  4BJM A;  2X66 A;  2DWG A;  3KBT A;  2IC9 A;  2V7J A;  5JQG E;  3KV9 A;  2N1G A;  4CZZ B;  4E7S A;  5JDH A;  5LYJ E;  3CPZ A;  1WR6 A;  1KK7 A;  2LEH A;  3UT5 E;  2CE7 A;  2D0T A;  3LJC A;  4WBO A;  3UUX B;  2NW9 A;  4UVA B;  2X0L B;  1D1A A;  4NUU A;  1X79 A;  1VOM A;  3KV6 A;  3KBU A;  2N9D A;  3FBZ A;  3KV5 A;  4CXX A;  5FYM A;  4DVD A;  4H63 V;  3HKB E;  2NWB A;  4TN7 B;  2BDE A;  2LM9 A;  4IE6 A;  5JR9 B;  1HG2 A;  4L5G A;  1FMV A;  2BVM A;  4AXP A;  3U3I A;  2I59 A;  3C51 A;  3AVS A;  4AI6 A;  2RP4 A;  5EZY E;  3L09 A;  5LJM A;  5LJN A;  5FY0 A;  2CCQ A;  4GYR A;  2LOS A;  2WBL A;  2SPC A;  3E08 A;  1CUN A;  4YJ3 E;  3NRY A;  1D0Z A;  2XHE B;  4O4I E;  2WMO A;  3I9W A;  2X9X A;  2XUE A;  5L3F B;  5IYZ E;  3ZCJ A;  3R84 B;  4DMV A;  1Y64 B;  4IE4 A;  3GN5 B;  4CI2 B;  3PTR B;  5FP3 A;  3O9X A;  5JRC A;  1D0X A;  1HS7 A;  2EHO A;  2IC6 A;  2BVL A;  3K3O A;  4O2B E;  5FXW A;  5J2U E;  2VKD A;  5LG4 A;  4PK4 A;  3N5L A;  4QXH B;  5E0O A;  2HH7 A;  4C91 A;  2L3L A;  2LSI A;  3ONX A;  1IJ5 A;  4UV8 B;  3N9M A;  4JLE A;  4YJ2 E;  2Z6E A;  1OWA A;  4ZI7 E;  3EDU A;  3LK4 2;  4OHF A;  2LT3 A;  2XAQ B;  4WBN E;  3L3P A;  1ZBO A;  2V7K A;  4KBM B;  1MND A;  5LCY A;  5CA1 E;  4CI3 B;  2JRK A;  3SWH A;  5JDN A;  2KWI B;  3H3A A;  4H63 H;  2H7V C;  4OYK A;  3ZYK A;  2W62 A;  4X1I E;  2M67 A;  2XAG B;  3Q9D A;  3RYF E;  3VKH A;  3AA6 B;  2VWA A;  2NW7 A;  1Z0P A;  2YU2 A;  3C64 A;  4UF0 B;  2QGS A;  2CWY A;  4KMC A;  5DQV A;  5JRE A;  1FIO A;  4IST A;  2ODV A;  1BR0 A;  1OXZ A;  4KUM B;  4MAL A;  4AKH A;  5C8Y E;  4IE0 A;  1ZKE A;  2V7I A;  4DBR A;  3N2K E;  4UIG A;  3F2E A;  3OYZ A;  5J2T E;  2WAU A;  5HAX A;  4OYJ A;  3PUQ A;  2Y6X A;  4EB6 E;  2MOZ A;  2D5U A;  5TAO A;  2W00 A;  5L3B B;  3ZMZ B;  3C98 B;  3PU3 A;  5L3G B;  2ZMA A;  4L9I A;  4MFR A;  3LG7 A;  3WAK A;  4YLH A;  5FXV A;  2VKH A;  3GN5 A;  4ZS2 A;  2P9B A;  1D1B A;  2E9X A;  3I1A A;  3PUR A;  4OK0 A;  3V5U A;  1S94 A;  2XAH B;  3FHN A;  1LRZ A;  4AQF A;  2KND A;  4UXN B;  1HTJ F;  4BA9 A;  1WYB A;  5J1G A;  2KZ7 B;  3ZYM A;  4ISS A;  4WW0 A;  3N2G E;  5EK3 A;  5EK2 A;  3I0Q A;  2HPJ A;  4DND A;  3J7Y q;  5H6Q B;  2XTL A;  3FXE B;  3SOL A;  3N9Q A;  2D2S A;  3ZYL A;  3O1H A;  2IW5 B;  3M65 A;  5AFU L;  3VHL A;  5F8P A;  4IHJ E;  4ZHQ E;  5ETW A;  4DBQ A;  2ES0 A;  3HR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...