3M6MD

Crystal structure of rpff complexed with rec domain of rpfc
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
118
Chain Sequence
MRMLVADDHEANRMVLQRLLEKHKVLCVNGAEQVLDAMAEEDYDAVIVDLHMPGMNGLDMLKQLRVMQASGMRYTPVVVLSADVTPEAIRACEQAGARAFLAKPVVAAKLLDTLADLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RpfF protein
publication title Structural Basis of the Sensor-Synthase Interaction in Autoinduction of the Quorum Sensing Signal DSF Biosynthesis
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase/transferase
total genus 33
structure length 118
sequence length 120
chains with identical sequence E, F
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3m6mD00
3H5LA 2VK2A 4GPAA 3M9WA 1VRVA 3MQ4A 4YS6A 4OTZA 3N8IA 5ED4A 1GUDA 3LFTA 3KLNA 3SAJA 1ABFA 1M2FA 1ZGZA 4D6YA 4OLAA 1SXIA 2AYZA 2VUHB 3UUGA 4YV7A 1B00A 2GBPA 1LBHA 1P8AA 2L2QA 3OLZA 4RKRA 4KPYA 3B2NA 4G0YA 1QPZA 4MQFB 1ZAYA 5FWYB 4IGAA 4HNRA 4G97A 4KMRA 4Q6WA 3TD9A 5KQLA 1W25A 3F6PA 3CG4A 1DC8A 4MS1B 3Q9SA 1DRJA 3JPWA 4KNYA 4DQDA 1QO0D 1RZRA 4MS4B 3GL9A 3OQNA 1NATA 4RS3A 1SXGA 5KQGA 2RGYA 3CLKA 1NXWA 5IX8A 1KMIY 4IILA 3O1IC 2PL1A 2IPAB 2RJNA 4O5AA 5JS2A 3A10A 2MSLA 4LE0A 3CZCA 3E61A 2R4QA 2MYUA 3G1WA 1YMVA 3CTPA 3CU5A 4YLEA 5PNTA 2FEPA 2FN8A 3ILHA 3H75A 1ZITA 1ZH2A 1LJUA 1P6UA 3S99A 9ABPA 4PE5B 4WXMA 1D4ZA 4HNSA 3NHMA 2JRLA 5FWXA 7ABPA 2QR3A 4RZSA 3H5VA 3N6VA 4EYKA 1AB6A 3QLVA 4WUTA 1L5YA 5EWLB 2JVIA 2QV0A 3ROFA 3DBIA 1I3CA 4KK4A 4WZZA 2LIVA 3RVSA 6ABPA 3ILYA 2PKXA 3F6CA 1XWWA 3ROTA 3KSMA 3RVRA 3BRSA 1P2FA 3BBLA 2HQRA 3SY8A 3KLOA 4D74A 3D02A 3O1HB 2MYPA 3H5IA 4WXEA 2CHEA 4G86A 4HNQA 3CS3A 3R0JA 3UK0A 4O1IA 4G0PA 1D5WA 1MAVA 2FEWB 1LBIA 2TMYA 4N41A 5HKOA 3MF4A 1J56A 5JS1A 1ZHHA 2JVKA 1MB3A 3F73A 5TPZD 1EWTA 2ID7A 4YO7A 2CWDA 5JNUA 3CFYA 1EFAA 1LJLA 1YIOA 1ZESA 2WJWA 4Z4CA 4MLDA 4MR9B 4FE4A 4W5QA 1M2EA 2WMYA 5TPWB 4G0QA 2QSJA 1EAYA 5JNWA 3FDFA 3RVNA 1YK0A 4MS3B 5TQ2B 3RQIA 4EYQA 4CBVA 4Z99A 2HJ9A 1APBA 1ZY2A 1QP0A 3CKMA 1FFGA 4RV5A 3QEMB 3HDVA 4N0QA 2E4YA 4Z4EA 2OQRA 3HUTA 3Q41A 4NICA 3IPCA 4N0PA 1DJMA 4L4UA 4S05A 3QLTA 5ABPA 1W9HA 3RVLA 4IF4A 4MQFA 1NXOA 4MRMB 4P1ZA 3HJFA 3HSYA 5FWYA 4ZJPA 1PEYA 3LOPA 3RVOA 5TQ0B 3CG0A 3KCNA 2JK1A 3OO0A 3EGCA 4MS1A 4JAVC 4RDCA 1EWKA 3O1JC 4TN5A 3UKJA 3RVJA 5B3JC 4EVSA 2H3HA 4RK5A 3QELB 4MS4A 1YMUA 2IKSA 3URMA 3VNBA 3KKEA 3GA5A 5HSGA 2NT4A 4MAAA 1BDIA 1Z12A 3GYBA 1YS6A 3HEBA 1JYEA 3MIZA 6CHYA 2PMCA 4O1HA 3LKVA 4KQ9A 1CEYA 1RPJA 2OENG 3HM9A 5BQ3A 4LDZA 3TB6A 5HQJA 2E4ZA 1Z15A 5GOTA 4YRZA 4MLCA 3H6GA 1MIHA 2N9UA 4MQEB 3EDCA 3LKBA 1TJYA 4Z9AA 1Z18A 4EVRA 3DLBA 1A0OA 4EY3A 4FB4A 3IP5A 1SD5A 3KJXA 1TMYA 1D1PA 2KYRA 3GV0A 3H5OA 2MYTA 2PUEA 1DZ3A 2GWRA 5IUNC 4G0ZA 1QMPA 4F8JA 5E3JA 4ML3A 5T3YA 1USGA 3RVQA 4ZYLA 3O74A 2HQOA 2PL9A 4MR7B 2WB4A 1GLGA 5EWLA 1Z2DA 3NNNA 2I6FA 1OXKB 2B4AA 4KQCA 4LE1A 3JPYA 1U8TA 4XFKA 5KC8A 4ZMRA 2FSPA 2JB9A 3M6MD 3JY6A 1QP7A 4H60A 4LRQA 2MYNA 3BREA 3EAFA 2IPMA 1R8JA 1USKA 2NUBA 2HSGA 3OQOA 1Z26A 3C3WA 1JFVA 2M98A 3NNDA 5KI6A 4YR7A 3D8UA 3GRCA 5CNKA 1BA2A 3NHZA 4ETIA 1Y1LA 5IUJC 2FN9A 1S8NA 3H6HA 2PUDA 3H1GA 1KRXA 2NZVG 3H5TA 5DCLA 4NCAA 2FXIA 3I45A 5IUKC 4N76A 1ABEA 4JP1A 4RXUA 1FQWA 4MR9A 1SRRA 4RU1A 1JWLA 5TPWA 1JX6A 1JDPA 1Z2EA 2XDYA 5T7BA 4MGEA 1JHZA 3HXMA 5EWMB 4Y9TA 1RXIA 4MS3A 4RKQA 5JNSA 2GI4A 4KFCA 4E7OA 5TQ2A 5BRJA 5JNVA 1E6KA 4KVFA 4L85A 2PJUA 3H5WA 1YVUA 2FMIA 2NZUG 3N0WA 4G0XA 2F8SA 5EWJB 5IBQA 3QEMA 1YK1A 3IPAA 2PUAA 1XHEA 5JNTA 1QQAA 2A9PA 1QQBA 3QLUC 4MRMA 3L49A 3LUAA 5CNIA 1QO0A 1JYFA 2R48A 3DGEC 4Q6BA 4XAQA 3FFTA 5TQ0A 4RXMA 1DRKA 2L18A 1RXEA 1URPA 3N53A 1U0SY 2FMFA 2FQXA 4NV3A 3O2QB 5DLEA 5KWSA 3G85A 4KZKA 1ZVVA 3BILA 3QELA 3W9SA 1DCKA 1U04A 1JBEA 3N75A 4YCSA 3SM9A 3BRQA 3VNAA 4OLBA 3GBPA 2FKAA 1FFWA 3OM0A 1PNTA 3P9YA 1JF8A 1DP4A 4QPJC 4H3KB 2L17A 2YHAA 2FVYA 1VLZA 3C3KA 3NBMA 4IMJB 4ETMA 2A9QA 2HQBA 2RDMA 3RVPA 1NXVA 3I5AA 1NY5A 2MSKA 4MQEA 3TX6A 5KQPA 2BGGA 1DCFA 2DRIA 1PHRA 3JTEA 5DKFA 4MYRA 2LP4Y 1E6MA 4NCBA 2LBPA 1JFTA 1PNRA 4KK3A 3MA0A 3T6KA 4UHKA 3SG0A 1BAPA 4MR7A 1GCAA 5I4CA 5D2CA 3OQMA 3O21A 2M1ZA 2VUIB 3MYYA 2IPLA 3HV2A 1C4WA 4IRXA 1DBQA 8ABPA 2WJAA 4S04A 3EODA 2PUFA 2FLWA 1PEAA 3H1EA 3QEKA 4YWHA 1AB5A 4PICA 1LK0A 1ZH4A 3DGFC 1QNLA 1GCGA 1VKRA 1K68A 3K4HA 4JASB 4MR8B 1YS7A 2FMKA 3LTEA 1DC7A 1U2QA 2FQWA 4WWHA 2CHFA 2F8TA 1C0EA 1RZRD 4QYMA 4EYGA 4MPTA 5TPZA 5B3JA 2WY2D 2QZJA 4W5OA 4XARA 4Z0NA 3KYJB 3OMWA 1NXPA 4G0MA 1F51E 2QXYA 4OATA 3N0XA 4YP9A 1ISRA 1USIA 1Z16A 4QICA 5FBKA 2R25B 1VPWA 1SXHA 2J48A 3JS5A 4PYRA 2FMHA 2H0AA 3HCWA 3O75A 4TMYA 1M5UA 2P4UA 5C5CA 2A9OA 1D2AA 1MB0A 3RVKA 1GUBA 3O2SB 3SQNA 1L5ZA 1ZDMA 4RY0A 4GNRA 4B09A 2VYCA 1T34A 3CHYA 4F11A 4F12A 2JCGA 3KS9A 4Z9BA 4TLMB 4PZ0A 4P98A 4Z4HA 1JH9A 2PUGA 3OMXA 4EGSA 2JBAB 1K66A 4RK7A 2HPHA 1NXXA 2QU7A 4RSMA 5EWJA 3IDOA 1NXTA 3CNBA 3I09A 3HVRA 2YHBA 3IP6A 1M5TA 3JVIA 2PE5A 1BDJA 2X7XA 4RK6A 2WRZA 4XLTA 2PUBA 3C6QA 1FSPA 1BDHA 4D6XA 1U2PA 1YTUA 4RY9A 3N0RA 4Z4IA 1RNLA 1TM2A 3QX9A 5IULC 3DZDA 4TLLB 3GWGA 1ZN2A 4YGXB 1KRWA 4N47A 1D1QA 1PUXA 2E4UA 1TVMA 3OLYA 4Q7EA 1ISSA 3HZHA 3CRNA 4RK1A 3LUHA 3EQ2A 3GT7A 3IP7A 4W5TA 1WETA 2NT3A 4RXTA 2B1JA 2P9HA 3GBVA 2W42A 4EUKA 2O20A 2LPMA 3H1FA 3LUCA 3DLHA 4F3TA 4KREA 5BRAA 2E4XA 2ZWMA 3A0UA 4IMIB 1IIBA 3QLVC 3EULA 2L19A 3A0RB 3E3MA 4NQRA 1MVOA 1P6QA 1NXSA 4EVQA 1DBWA 3LUJA 3KYIB 2PUCA 5BR1A 5TE9A 2ZAYA 2V0NA 4RK4A 5IEJA 2QW1A 5DTEA 2LUOA 1Z25A 1JLKA 4LZLA 4RK0A 2FQYA 1HEYA 1A2OA 3KTOA 5FBHA 3OO1A 2FLKA 3KG2A 3T95A 3LUKA 3MMNA 4LE2A 1E2BA 4QYWA 2IPNA 4HYEA 4JA2A 1EWVA 2FTKE 4UHJA 3HK2A 2MSWA 1DCMA 3QLUA 3OLXA 4MR8A 3RVMA 4DADA 3NNSA 4EYOA 3T38A 2E4VA 3Q7SA 3K9CA 1QP4A 3I42A 4E7PA 1DBPA 3FFXA 2IDMA 5JNRA 3HS3A 1CHNA 3EQZA 2JVJA 2FEKA 3A3KA 5HM6A 4XASA 4RWEA 2AYXA 2E4WA 1BVHA 5GQSA 1FFSA 3O2JA 5FWXB 4M88A 4W5NA 3OLWA 3OM1A 2PAFA 3KHTA 5F64A 5CNMA 3M9XA 1CYEA 1XHFA 2FW0A 4JOQA 4Z4GA 2CD7A 1F4VA 1DG9A 1Z13A 2ID9A 3FGZA 3SNKA 1UDRA 2IOYA 2JBAA 4ZPJA 1JL3A 3Q15C 5CNJA 3C97A 3Q7TA 3HUUA 4OG2A 2Q5CA 3CZ5A 3QK7A 3HDGA 3LUGA 4H3HB 4OBBA 2QVGA 1JFSA 4LX8A 4ZMSA 3QX8A 3MM4A 3FFWA 1NTRA 1OXBB 1QKKA 4JB0A 4KRFA 1Z17A 4N03A 1JDNA 5IC5A 2A9RA 3IP9A 5DGCA 2GKGA 2RJOA 2GX6A 4DN6A 1ZGGA 4ETNA 5CHYA 3LMKA 4FE7A 2R47A 4W5RA 5KC9A 3LUFA 3RH0A 1KGSA 4JB2A 4LDAA 5KQMA 3Q7RA 3FMVA 2IYNA 3LUDA 4PEVA 3TMYA 5IEBA 4F06A 4G0OA 1A04A 1TLFA 2WWVD 4RY8A 5C5EA 3T8YA 4Z4FA 1EHCA 4KV7A 4XXHA 3L6UA 4WT7A 3TO5A 1E6LA 5EWMA 5TQJA 2PLNA 3HO1A 1H9CA 3C3MA 3OLVA 3F7NA 3EJWA 3JVDA 2QVCA
chains in the Genus database with same CATH superfamily
3FG9A 1N36B 3N7UA 1EFUA 2DR3A 2ONJA 3SAJA 1I6MA 1XZIA 3LHFA 4HSEA 3MWEB 1WSDA 1RHRA 1GAJA 1KEWA 2NTNA 3R6WA 1W4ZA 4PZPA 1AO3A 4DSAA 3OZ7A 5DTJA 4M6WB 3AESA 3RPEA 3UPTA 4UQPA 1SAYA 3GELA 3KZCA 3V9AA 3UT0A 1DB3A 1GYPA 2WR8A 4BMZA 2A0FA 1MO4A 3QQ5A 3SQMA 2ILTA 2WQZA 3QKWA 5IH7A 5DM2A 1RKXA 3FNGA 4BCCA 3THWB 1N5RA 3PWKA 2VP4A 5BN4B 3U62A 3ZCSA 4N0EA 4B6JA 4YI5A 3PGXA 4BNDA 4Y2RA 4EJ6A 1UXOA 4LJAA 1MB2A 5SZJA 4AMUA 4DQDA 5JPDA 4K5QA 2V3CC 3K0KA 4LK3A 4PTLA 3W04A 4XX0B 2DQZA 2Q5JA 2C97A 2P1ZA 2JIMA 4IFEA 2JGIA 3H8VA 2I6XA 4PWZA 2RGYA 1IWOA 2WOJA 4GM4A 4HYQA 5G4LA 3IALA 4U2CA 1XELA 3WLKX 4H7FA 4BNVA 2QORA 4ABTA 1G17A 1EDBA 4DSTA 1BJRE 3KKOA 1BVUA 2BL4A 3P97A 4UREA 2MYUA 3TQOA 3Q3VA 1GRQA 2FN8A 5LMNB 4D5EA 2GOYA 1H4SA 5EMKA 1F6WA 1P6UA 2Y05A 5AVJA 3T7EA 5JAHA 5LYJB 3WJ2A 4C6RA 1UOOA 4IFBA 5LP6C 1E6CA 1YU9A 4IVPA 2XRYA 1POWA 5HF9A 1MB9A 2IU0A 1V39A 4P93A 3SKXA 3IV6A 4NTZA 5FOQA 4O3MA 3N8GA 1RXVA 4BUZA 3T3PB 2YV4A 4EJSA 1AB6A 1XF1A 4EYKA 2J0UA 4IZOA 2E82A 3MGBA 1JKJB 2AJ8A 5HJ2A 2QNIA 3AW9A 5KTSA 4E5NA 3T5CA 1UPUA 1WPGA 4D81A 1J4AA 1I01A 1M6EX 1PCXA 2AH5A 1BH6A 2J9FB 3HI6A 3HJAA 3P27A 2PKXA 4IH9A 1NW4A 3JTMA 3FTNA 1JZQA 3A1EA 3KEQA 3SSOA 3SZMA 1NUPA 4C3ZA 2I1VB 4NAHA 5JXGA 4U5XA 5ILOA 3KDSE 4D97A 4EFDA 1OBOA 2ODWA 2OC9A 3FYHA 3RUHA 3SXJA 1PSZA 2CW5A 1BRMA 3UJ6A 4Q7JB 3V4PB 4EMSA 5F2KA 1ECLA 4HAVA 4V0NA 2ES4A 4R6WA 1ZI9A 2EP5A 4W1PA 4S0XA 1B0ZA 2OCIA 4Q4LA 2VL7A 4DJ5X 3JZDA 1YQUA 1IFXA 4NZMA 3U60B 1YKFA 2ZSFA 2JLUA 1V1MB 4J7UA 2DFLA 3DXZA 3RU9A 5AOVA 2LCIA 3D6VA 3RU7A 5B64A 1PFYA 3LY5A 1J9GA 1K3UB 4MLDA 1RLIA 2QW8A 3LDAA 3EH1A 3QOWA 3FF4A 2XD9A 4FSHA 4LSGA 3F4LA 5DYNA 4EY5A 1J21A 2RONA 1YOBA 2QX9A 3IT3A 2Z3WA 4OB7A 3OQHA 5ALSA 1CRQA 4G5SA 2CFRA 4Q48A 1PDVA 4TQ9A 3IMFA 2W4MA 4ID3A 2FZCA 1XCBA 3L0SA 4EYQA 1AC5A 3I9LA 1CUFA 4IEFB 1TLLA 4OYLA 5EGSA 4BFCA 2E4YA 2Z9DA 3DVAB 3Q41A 4E07A 3HNPA 4LQDA 1JSZA 2QLMA 1GL3A 4PRLA 3LVQE 3AVPA 4TLAA 1VKNA 2FKNA 2BFMA 5EJEA 4GX2A 4MQFA 3S0JA 1TB4A 3J7TA 1LJ8A 3KKKA 1KFCB 5FUWA 5ERXA 3G9QA 3AM1A 1U8FO 1L4HA 2Y3IA 2FWRA 2TMKA 4NMHA 4XYBA 1CUIA 2XQVA 2GDJA 3GJ7A 4FZ3A 1HG0A 1CIPA 1HTTA 3AHIA 3EF3A 4B45A 4GT1A 2I2BA 4EVSA 1CUAA 4RK5A 1ZOIA 4DLNA 1O6CA 2CJFA 5SYNA 2ZJ7A 1SCQA 3WAKA 5IJWA 5IKXA 2JAPA 3DL0A 3RS3A 4PAQA 4FWTA 1LI7A 1Y1KE 2H7CA 4W5HA 3RANA 1N34B 2QGZA 3TGLA 2DERA 1AKEA 3MD9A 4G0WA 1UJMA 2FWJA 2YJ4A 4DMUB 1FYFA 2AGVA 4F5YA 2X1VA 5LBIA 3ROGA 5KNBA 2ESRA 1LTQA 4JA0A 4KWIA 4NEQA 5BV2P 1DQPA 2XYRA 1HOTA 5IJAA 1A0OA 4P8RA 1ZJWA 4FB4A 5DN6D 2P2DA 4L7VA 3DBHA 3DOIA 4MKZA 4QWWA 4I6EA 1W36D 2PD3A 1CV2A 1HT2E 3G5UA 3C15C 4XPZA 2JLXA 4WKOA 2IJGX 5FF9A 2YBEA 4CMJA 1NVTA 1YRWA 3NVKI 1LDNA 3IEKA 1QE3A 1STOA 3UNXA 3REGA 4IO0A 1TQDA 1T29A 1WX1A 3LLMA 4KCGA 5AM4A 3BFXA 3MCVA 4MWTA 5H83A 2W8BB 3ENZA 4AJJA 5JCJD 2B3DA 3LLVA 5F9HA 2BCGY 1QHGA 3BREA 1XG5A 4JWKA 2ALJA 4QNRA 2FUG6 1JSXA 4DBLE 2XCLA 1USKA 3PJGA 4FEEA 3TM4A 1GTL1 1OE0A 3GRYA 2Q8NA 3P9SA 4IBOA 2ZROA 3L0CA 2DFPA 4MQ6A 3IR7A 4DS3A 4CU5A 4EW2A 1NVAA 4KXQA 4C4XA 4HDKB 1ZWKA 2SHKA 2Q21A 3DEJA 2FPPA 2C8JA 3IQWA 1S7GA 3WLNA 3A4VA 1ZONA 4JBLA 1RI2A 4M7OA 4BMYA 1KRXA 4DMMA 3MJSA 4RV4A 3L8HA 1IXZA 5J40A 1ZMOA 5A4AA 4FYJA 5CR9A 4U7HA 1U0HC 2GBGA 5FPSA 3VUEA 3CO5A 1UH5A 4B4KA 4DLRA 1Y7IA 2VKTA 2ABWA 4G37A 2Q7OE 3K9FC 1JAHA 4RU1A 3W6ZA 3QVUA 4KC0A 2FRVA 3D64A 1SPBS 4MJ3A 1MA3A 4M38A 4N6NA 3W6OA 4KR3A 1A98A 3MTIA 3AIOA 4HS9A 1M33A 1HL3A 3ZGNA 1P0CA 3TDMA 1SJ9A 2JD0A 3AFNA 3V6LA 4E7OA 3I53A 1LV8A 1YJBA 3OX1A 5DWVA 1SRQA 2OO5C 2IGBA 3EA5A 4OIFA 3D0KA 3VVBA 4XWAA 5EIEA 5IBQA 2BGJA 1N1EA 3S2IA 1VJ0A 1YR7A 4E22A 1YGPA 2HCBA 2NXJA 3ACDA 4XIYA 2QQEA 3OE7A 1XHEA 1GA6A 2A5FA 2GVDC 3I2JA 4JSTA 1B74A 4ZZ2A 1QQAA 2RH9B 3ZH2A 5KKCA 5FFNA 4IOLA 1HZZA 3EEYA 5KJCA 2CSUA 2A78A 3U1VA 3TIXB 1BA3A 1DRKA 1G98A 3GJTA 4R69A 3WRYA 4IEIA 4LHSA 4NARA 1RMTA 1ZIXA 2JASA 3NPMA 5FPPA 1UBFA 3TEFA 4B3GA 3M81A 3WXMA 2B5OA 3H18A 1IN1A 3FYUB 1RVV1 3RUCA 3UJAA 1DCKA 3GZNA 4AZ0B 7AT1A 1IBMB 2C92A 2G7ZA 2YFQA 1XDGA 1W6UA 1NLMA 4JJFA 2EHDA 2WC1A 4M54A 3TLGB 1F0PA 2R6DA 3HJHA 2SKCA 1Z2AA 3O6VA 3OEHA 1EX1A 2OBNA 4GGPA 4YJ3B 4EDFA 3AYZB 4XUGB 5T6BA 1QB8A 2FVYA 3P0JA 1WQ3A 4HQOA 2FK7A 1X7YB 3IIMA 3S40A 2RDMA 1TCAA 3AERB 4MQEA 3VPFA 4N8EA 3WSTA 3IDFA 5JAZA 1LNQA 2BHTA 4DDKA 1EP3B 3JTEA 4XYMA 3C7CB 4XOIA 4TLEA 4JYMA 4QDZA 4LGCA 4R1UA 1BX3A 2QY9A 2XWJI 1KU0A 5EHNA 5KHAA 4BY9E 4KMMA 3PB3A 1CQWA 3CZMA 1OYWA 1R8XA 1DBSA 1MJ5A 2I3DA 3HBMA 4KHZA 3P2YA 5DYGA 1R4MA 1W30A 3T3OA 1J22A 3RS2A 2WWXA 5JWRA 10MHA 5KVQA 1G5TA 2GM3A 1NAIA 2MWMA 2Z5VA 4L4RA 4OHXA 5CVUA 4YASA 5GJVC 1RI5A 3ISJA 3MYYA 3WV5A 1IY0A 3ZCUA 4CCYA 4LFAB 2M9MA 4IRXA 2AMJA 1E1DA 2R8XA 4FQ5A 4H1VA 2O2ZA 3VTAA 1XGKA 2OORA 1PEAA 1Y4SA 4KR2A 1G21A 4BE9A 1QNLA 3HB1A 1OPXA 3MWFA 1F2TA 4PINA 1JMKC 2V6IA 4R7GA 3U0VA 3COSA 2ACKA 1IXRC 5B7QA 4UEKA 1T3GA 3KZOA 4ZVVA 2C84A 1T9AA 2ZTUA 4FGSA 5DGDA 5HDQA 4FSDA 5B3JA 2GAIA 3IAM1 4GR9A 3N2GB 4Z0NA 5DXJA 2FSGA 2JLVA 2DQSA 2BSXA 4RKFA 4AJHA 3S2EA 3P9RA 3VPSA 3BQNB 1V3UA 3K8ZA 2IYAA 3B6IA 1PQ4A 5B53A 4WZBB 2AG5A 2AUMA 2CNWA 3ONDA 3JS5A 3RIHA 4J4TA 3L7LA 3FHOA 2H0AA 3O75A 1MFPA 4D9KA 3ROZA 4UHFA 3V4RA 3EDYA 1E1NA 2IHZA 1XRMA 1W19A 2QAGC 3PJDA 1X0XA 2RHMA 4D0NA 1W75A 1NVBA 4IDAA 4WHMA 4Y67A 3GAFA 2P2CA 3KZNA 4GVXA 4QOSA 1IEVA 4QXAA 1Y7TA 1B26A 1VRWA 3LX8A 3GZ4A 1ONSA 4YRDA 2QU7A 1O2DA 4AMGA 3LA8A 3ZHRA 2J4FA 2ZTSA 1QOQB 1RWXA 3BCUA 1NN1A 4GPIB 4XGKA 4IQGA 3SOPA 4MTCA 1UXIA 2OFOA 3U44A 4ZO9A 2R5FA 2ZYDA 3W3AD 2PK3A 3DHYA 2ZCVA 1E1RA 1U2PA 4AJPA 5C7OO 4BQEA 2YXEA 4JMPA 3P45A 1N3LA 4JP5A 4X85A 4PZAA 3RS0A 1VCOA 4KKXB 3K0CA 4BBAA 1FMLA 3JQAD 1YQTA 4NF2A 2GFQA 1CRLA 2X9LA 3MQ2A 4J0CA 1PDWA 2E4UA 1KHHA 3IAUA 3OLYA 5FI1B 4EPXA 5CVDA 1ISMA 1ICIA 3IB6A 5HILA 3B52X 1RLOA 1LFAA 4RK1A 2R96A 2F90A 5FX2A 3O7MA 2WHEA 4JXXA 1SUDA 4RHFA 4UVIA 1DDIA 3GBVA 3GRRA 2RH4A 4K40A 1GQFA 4O4IB 4BVAA 4OL0A 5FPKA 1YZQA 2P8JA 5THXA 1K63A 3OAAA 3FSEA 1P31A 3A14A 5TMBA 5KREA 2EW1A 4MB0A 4B9AA 3VPGA 1U5BA 4BO4A 5DX8A 4UM9B 3RRYA 3C8ZA 3RIMA 3UQYS 5COBA 3GLQA 1Z5NA 5E6SA 4YVFA 2NV0A 2DLDA 4RCVA 2VP2A 3GGJA 4MUGA 3GD5A 1JAYA 1NBIA 3EIFA 3P4UA 4KUEA 4TL6A 4ZODA 2AOXA 1GNRA 1O0SA 3X1JA 1QANA 1AGPA 1GR0A 3JQRA 3DMPA 3DFKA 4XTRA 4RK4A 4CMEC 2QW1A 2FUCA 5AKYA 2VXYA 5ALXA 3QHQA 3UVEA 1X0VA 4HGNA 4DAOA 1P7YA 3PKJA 2XE6A 2J4CA 5F7OA 4DWWA 4C5AA 2IHUA 1YQQA 2QLLA 2Z6AA 4G5GA 4B85A 3Q0EA 1V41E 4RTNA 5E9JA 5GAJA 3MCZA 2I3BA 5E4JA 2BFEB 2NXNA 2JCYA 2J0SA 3AFGA 2FTKE 3Q11A 3AJDA 3QFHA 4QECA 3LP5A 1IHDA 3TR0A 5DIZA 3R6GA 2GN1A 3G9ZA 3RNLA 1ZI8A 1XLWA 3EPRA 4KYIB 4IKOA 2OD7A 4R9UC 1EDDA 3OT1A 3IEVA 2PCLA 1N3IA 5T4FA 4X66B 4CQMB 5KWVA 1DBPA 3FFXA 4FC6A 3QF7A 1NLYA 4LKOA 4XUDA 1HFJA 1KTVA 4JLWA 4WBNA 3LGAA 4FCWA 2J85A 3RUIA 3ZNOA 2CNKA 5IJ0B 2HQSA 2RHBA 3HUFA 3KR2A 3R4CA 1JEDA 1NDUA 5AI6A 1Z0KA 4O5OA 3TLXA 1P77A 3QVVA 2R66A 3NHPA 2G9ZA 4KPEC 1Z08A 2VXCA 3OJFA 2Z9BA 2C29D 4R1NA 1F8FA 3TQCA 3MLEA 1XRJA 2NZ8A 2CD7A 3OZDA 1R4NA 1M83A 1T9BA 2Z43A 3Q15C 3SEFA 3R20A 2MU1A 4OCZA 1KVTA 3AUTA 5TDHA 3SFTA 3W4KA 3OOEA 1HTWA 4AUMA 3QI7A 1JILA 4ZDIA 4LX8A 1XD2B 1L6RA 4K86A 4K81B 1YL5A 4UTXA 1E66A 3DE5X 4HLUC 1JLMA 4R51A 4L95C 4MVJH 1ZX1A 4AMVA 2P9BA 2WU8A 2YQ4A 4BO7A 1QTIA 4JLMA 4KRYA 2PJRA 3OZTA 4LQ4A 1LBEA 2FZGA 3GGCA 3KR9A 1KC3A 3D6NB 3PRHA 1S7CA 2VJPA 2J4DA 1PR5A 1FUEA 3LUFA 3RYTC 4V0KA 5BSVA 5DULA 3QTLA 2HJHA 1SCAA 1XEWY 4G0OA 5TSDA 5KNCD 1K97A 4OVKA 2FR1A 3DDZX 2C4UA 1CW2B 2FYTA 3SIXA 4BKRA 2FUNB 2HQ1A 3CT6A 4BNHA 4HWRA 5JJCA 1DIGA 2AVDA 2PLNA 5I4BA 4XGQA 1NG9A 1FNBA 4N18A 2QUKA 1WVMA 1TDJA 4PLFA 4HQLA 3H5LA 4GPAA 1QK4A 1G16A 1QBGA 2NU9A 3UC9A 5EUCA 4D57A 4D4GA 4IJWA 3FUUA 2NVUA 4PLGA 4YV7A 5HM8A 2DCUA 1JAZA 1F9AA 1JLRA 2C61A 3NBFA 4M9XA 5F77A 2ATVA 4F91B 5HG0A 3U2QA 1G2QA 3V5NA 2XUFA 4HBGA 1Y3DE 4IIDA 3WC4A 1AF4A 1OGJA 1NVVR 2FRXA 3RYCB 3AVYA 2C3PA 2QN7A 1YJAA 1RTKA 2WJIA 4KMRA 1WZEA 1DIRA 4HVCA 1Q0ZA 1QYIA 3NB0A 3FHJA 3Q0TA 2PGIA 5I01A 4QUBA 3OPYI 4TL7A 1IHYA 1YR1A 2FDRA 2KB0A 1V3VA 2C5SA 4MS4B 2R85A 3D7NA 5C8XA 3OQNA 4HRVA 1NVGA 1RAIA 1W49A 3R8FA 1LZLA 3PFGA 2X13A 1VHJA 2OBXA 2W83A 4ZOLB 3ZD8A 4LGMA 5TV2A 5DYIA 3A6HA 2VDWB 1XDBA 1PGNA 1A5BB 5CIWA 2X1MA 2ECQA 4XB6B 5JCOC 3GRUA 1J1UA 3HYLA 1ZU5A 3WX0A 2CB0A 2H0QA 1Q1EA 2V4ZA 3IP3A 2GYUA 2O8EB 3GAMA 1WOMA 3B9QA 2WD8A 4G9BA 1TC1A 4HNGA 5F4BA 2B99A 4WXMA 3VH3A 4EW1A 3PSAA 2J9YB 3HCBA 1VHWA 2XR1A 5KVAA 3I9KA 3ZKWB 3N70A 4GLJA 4AYXA 3TYXA 3EEFA 4Z9YA 3GLIE 1AKVA 3FBWA 1T2UA 2AI3A 3EWIA 2QJTA 3HCOA 4GL4A 4B87A 1XAHA 1D9XA 3KR1A 3S8YA 2HJGA 5HQ3A 3R5SA 4L9WA 2BZSA 3HY4A 2WHXA 1DEAA 4DLUA 4OYHA 3SEZA 3U4CA 3ZCVA 2QZ9A 2HUNA 5I5EA 1VCHA 1YQGA 2IK8A 1NW6A 2WZBA 4L28A 1AJEA 2GCNA 3WI7A 1JDTA 2BFWA 1WZIA 3CW2A 4JLBA 3LPNA 1ISJA 1FTGA 1RI4A 3KSMA 3BBLA 1Q1ZA 4YXFA 3GN2A 4YUVA 4Y2YA 1E9CA 3KQOA 2JIQA 4JLVA 4MCJA 1ZOOA 4XTCS 4FFBB 4WFKA 4ZD6A 5HMLA 1E58A 4D74A 4X20B 2HMUA 2MYPA 4GPZA 4QYIB 1MIOA 3K0HA 4V2UA 1R4ZA 3FAZA 3BE8A 1TUGA 3DE4X 3X2SA 4JBIA 4CQNA 2HK7A 3FMOB 4B2LA 1NAHA 3NHKA 1K08A 2XXAB 4WXPA 4TVSA 2C59A 1OWLA 3CMMA 1MZVA 2JVKA 3PZRA 4IHJA 4AF8A 5TPZD 3VRHA 4YO7A 5HJ5A 1LJLA 4TXLA 3EAQA 2O8NA 4FCTA 4G4GA 4TS9A 1SVMA 2B3TA 1VFPA 4WADA 2ZP1A 3G68A 5C1IA 3ND6A 4W7HA 1SK8A 4NMLA 4Y6SA 1Z28A 3BAZA 1O7JA 2ET6A 4RQTA 1U7WA 4PQGA 1FCJA 3LRTA 3BKWA 4NONA 1DI0A 1TAUA 4YAWA 2QUIA 3L5OA 5FI5A 1YK0A 4N54A 5C0OE 4MS3B 4FN5A 1N6RA 2IU4A 2O48X 3BTSA 3I12A 5MGNA 2Q5OA 3VR4D 1COZA 4AECA 4ALLA 1TECE 4URFA 3UKDA 3BWDD 1E9BA 4BXOB 3S6JA 2XNDA 2A14A 3DWFA 3IIKA 4K3VA 3TTVA 1TXGA 3IPCA 2QZSA 3MUNA 3FPEA 3TGWA 3X1KA 4ZHQA 3KYCB 4JVSB 3DAFA 4PXSA 4BX9A 3BAFA 4AJOA 4Y2VA 4WKPA 2FY8A 1EJ0A 4BLTA 5FWYA 5LWHA 1KJJA 1QO9A 4G5YA 1L5HA 1TTPB 1SO8A 2EJBA 1LB1B 1V8PA 2B35A 4U2KA 3D4PA 1A3CA 1ISPA 4YAOA 1FXUA 1U2EA 5J5AA 3GARA 2PRKA 3KZ1E 4B2IA 1VLVA 2BBOA 4LDJA 3VNBA 3I72A 5JBNA 3QU9A 4HWGA 3RHTA 1I33A 1XKXA 5IKEA 3LP8A 1IJFA 2VG8A 4G8BA 3CM0A 4OQEA 3OMLA 4KQ9A 5G53C 1Z7WA 4HD8A 4KI0A 2FWPA 4YAKA 3WLAA 3B9RA 2KM1A 4J0JA 2IUTA 2BHLA 1L5NA 1TTQB 5DT9A 1ULHA 1ZM2A 4NS1A 1CQIB 1XR3A 2EFEB 3BJEA 4DSOA 3EPPA 3EW7A 4IIFA 1F7VA 4JXJA 3CX3A 3HGTA 4EY3A 2O2GA 1CRWG 1TJ5A 4BZPA 5EJ9A 4ZU1X 3WKEA 2PUEA 1P81A 3PRKE 3UAWA 4JXZA 2ZSJA 1IN7A 2AMVA 4LXIA 1BHJA 1BFDA 2VH5R 4F4HA 5FBVB 1DO2A 2AFHA 2RJ3A 3L8MA 4HZGA 3E6AA 4ZYLA 5ICSA 2QOEA 5JH7A 4MUEA 2GS9A 4FDVA 3AVUA 5EWLA 1JFFB 1FVFA 2ZULA 5ICMA 4MGZR 2W2KA 3PPVA 1T2FA 1KDTA 4IDHA 5I7OA 3IJRA 1Y8RB 1NQUA 1ZZEA 1I4DD 2YX1A 3BH7A 2Q2OA 1IEXA 5HIMA 3MMXA 2UUPA 4RDXA 3SJZA 1F14A 4PLYA 4L72A 2AJDA 4M1KA 4IYJA 2IFTA 5G1PA 3D2CA 2H51A 2Z9CA 2PUJA 1E2EA 1T6BY 2GO7A 4NJOA 3I32A 4M0DA 3ZXSA 3WQHA 4LY6A 3K9QO 3RFVA 1JIIA 4NXNB 2H52A 4LJ7A 2AA3A 4XFDA 4BFWA 3PRJA 1R0SA 3WBFA 1FLVA 2QT9A 4HS4A 4INZA 3UAVA 1NBME 3PFCA 1F3LA 2FN3A 1V95A 1NN3A 1QG2A 3D4NA 3PITA 4L7QA 2PUHA 3CZPA 3UB3A 2Q1UA 5KTOA 1JP7A 3A9WA 1ZISA 2XB4A 2VNKA 2XUIA 4UFPA 1OZ0A 2ZK7A 2WYIA 2I33A 2HI0A 1PO7A 1D2MA 3EXHB 4BBPA 2EFYA 1QGUB 1R66A 2JFQA 3SYNA 3U61B 2ATEA 3USCS 4O8CA 3H5WA 1XZGA 3E5HA 4ZCIA 2BYTA 1LWOA 1GZ4A 2WMNB 1D1SA 5EERA 4IJMA 5FUYA 3SSMA 1WXDA 4CKXA 4BO9A 3PJRA 2VQ6A 3W2GA 5K3BA 4ZKEA 3AESB 1XTUA 2D00A 2H0RA 4YCBA 5CXSA 3RSFA 2UVPB 5CNIA 3LUAA 4WLNA 1U8UA 1JIQA 2JJQA 2V7WA 2X23A 1E8NA 4GZ3A 5GM2A 3U7EB 4CKCA 4H6VA 3PC4A 3V8BA 4K8OA 2HY7A 3B6JA 2YKGA 1A9QA 2GEJA 5AKXA 3F71A 4V38A 4N7MA 3KT6A 5F7ZA 3SXUA 2OBBA 4RAOA 5AI8A 3BILA 1JFRA 1JR3D 4O4LF 4N5IX 4GKAA 2V6FA 2AOWA 3VPXA 2AEMA 2FSUA 1E64A 4OXYA 4WQMA 3O73A 1R16A 4YN3A 4D0SA 3HYSA 2FFHA 1B0UA 1O95C 3E2MA 5G4KA 1ZNXA 5LQNA 3A32A 4MV3A 2GD6A 4PZDA 3QBDA 1PJTA 4FGWA 4BX2A 2BM0A 3A06A 2IZZA 4B8ZA 1B41A 3ULKA 5FAKA 2W6PA 4UBJA 1BD4A 3FN4A 1FZTA 3HA3A 1QSGA 3BXXA 3V7NA 1UM9A 2PTHA 4ATNA 3NBYC 3AVXA 3TZQA 2Y4NA 3RC3A 4MYRA 1MF7A 3OICA 1JQJC 1CR6A 1ORWA 2BRUA 4HTFA 5JBQA 5DHRA 2HOQA 4KK3A 1PNRA 4E15A 2WTAA 4HN2A 2G17A 1RR6A 1JDBC 3LIIA 2ERYA 3AL3A 3MRTA 4B35A 4HLDA 4MW6A 3T4UA 3FDZB 4ZAFA 2I03A 4AY5A 4ECEA 1JU9A 2XVZA 3X1DA 4EJSB 2ZXUA 4D25A 2QTVA 1H4QA 4JUDX 1KVUA 5KJ6A 3ADPA 4CR6A 1DBQA 3CNHA 2WJAA 5FWDA 3NHLA 3RYIB 1E1QD 1VPTA 1EK1A 4G3XA 4PCLA 3EF0A 1JVBA 2FLWA 3OKAA 1MABA 4DYDA 4CXMA 1AB5A 1TT5B 2VOEA 1AUQA 1KQ3A 1EP2B 1PYGA 3TR5A 4B3IA 5A04A 2MINB 5JFTA 2AEEA 3GH3A 3P2EA 1UM8A 2VO1A 1FUIA 1F38A 1HSZA 3O91A 3BFKA 2IHNA 3R5KA 3TRDA 3H2YA 1ADBA 5HX7A 9MHTA 1FA9A 2WQ6A 1Q2XA 1XXHE 2XRFA 2WY2D 1V8ZA 4GGOA 3AWDA 4DIMA 1II9A 4HDQB 2X6RA 4MIYA 4KO4S 3JWIA 5CGQB 4WK0B 3K70B 2HW8A 4CZ2A 4BEVA 2WTMA 2XJ9A 1NWHA 3NKVA 3RW9A 2JS7A 2RGCA 5C34B 1VHLA 1KMHA 2HF9A 4FHZA 4GFDA 1DC3A 2R1ZA 3HCWA 4QLBA 3E8XA 3CUKA 4MEJA 5EXEA 4Y7CA 3W3AH 4DZZA 3CRVA 1KJ8A 1FLDA 1PJBA 4E30A 3HA2A 4GNRA 5EUQB 4OP3A 1Q83A 3V8EA 3KDAA 1G41A 3HUDA 1U0LA 1WIWA 3K94A 5FYQA 4ALNA 5LSAA 1H5UA 1WXWA 4UBLA 3ZBTA 4IFTA 1WV0A 2OECA 1EI9A 2FFAA 4JCCA 3TINA 2BELA 4D4HA 4EGSA 1S89A 4RM2A 3VNVA 4HEA6 5G3YA 2I7CA 1HDRA 4UZSA 1P33A 1H0HA 4YLGA 4XLTA 4C29A 3T5BA 5L53A 2GUWA 1KJZA 1CS0A 5JZSA 5CYFA 4Z4IA 2RGNA 3LQRA 5IPFA 3HNOA 3NC0C 3CZ4A 1J0EA 3H86A 4UEQA 4US2R 1YL6A 4QWMA 1PVOA 4FNOA 3I34X 1YI0A 1Q77A 1QKJA 3E5RA 2GM9A 4MIKA 3VPCA 2G06A 1ZRNA 3K0FA 1I9GA 1WZUA 1FJHA 3S2FA 2AL7A 5JBIA 3HZHA 3RF6A 2BGWA 2CNNA 3EQ2A 3WISA 2IYQA 1W5EA 3FCXA 4EENA 2W42A 3EY4A 3TQIA 1HQYE 3G5MA 3JQBA 3QNMA 2PZMA 3GW8A 2XBUA 4IDBA 2WAMA 4IXMA 1YIDA 3PUKA 3CZRA 3QPCA 3SF0A 4LVCA 4EJSC 3PL1A 3NYRA 3CIOA 2GN8A 3WNZA 1DQNA 4NYIR 2EG5A 4BB5A 5JI2E 2J9GA 4HZIA 4NAVA 3WVNA 1OYVA 4PAOA 3IAEA 4EHBA 3KVRA 4MINA 1ECBA 2CNBA 4NBNA 1SBZA 1E7SA 2P0EA 1RP7A 4KLZA 4XB1A 2ZFUA 5WRFA 3AF1A 3GJ4A 2IIVA 4HPWA 1UF9A 2P78A 1Z25A 5EP2A 5EE5B 2GJAA 5SYMA 5L3ZA 5G3ZA 4EHKA 3AY7A 4ENVA 1YBFA 2YZMA 2N42A 2AG1A 4MWOA 3M2TA 1WM1A 3GJRA 1FUKA 3H97A 3QOFA 3JWHA 1JIKA 1V6AA 2YIJA 4W9NA 1P17A 3K70C 3HK2A 4BMXA 4U7DA 1QAMA 3PA6A 4MR8A 5BYJA 1OX4A 4DADA 5ITZA 2C88A 3MTQA 4PLTA 5AK5A 2FFBA 3WL7A 2QMEA 3F3KA 3IX7A 2Q4BA 1UPTA 3IHWA 2E5LB 4B4VA 2XEXA 4ZARA 1Q11A 3A4IA 1D0SA 2CL7X 2YIVX 3HS3A 4EBFA 2ZKLA 1UBNA 2BHNA 4EHAA 5BV8A 2ZUFA 1AGRA 1HQDA 2DEUA 1RZUA 5CB4B 2FPPB 2ZB7A 3MT0A 4IZHA 5I5GA 1CUWA 3BJMA 4MDHA 3RVBA 5HQTA 2O5VA 3KXLA 3NEAA 4WK6A 1LVHA 2WWGA 2YV5A 2VQ3A 4KQMA 2Z8XA 5CP8A 1HYQA 3ROPA 1FYEA 1WBBA 1CE8A 1FFSA 3WQQA 4HWSA 4TXMA 4MRSA 5BSRA 4HGOA 4JEUA 3IJPA 1GQYA 2H17A 4LWZA 4M1YA 3DQQA 3IGFA 4FHDA 1ONBA 2GUGA 2J6BA 4M0KA 4PFKA 2VF8A 2A86A 5LQUA 3PNPA 3AHFA 1EFRD 3KWFA 4EO9A 1T1GA 2CXRA 2VHWA 1QH8A 4J29A 4YIKA 3G82C 4UU8A 5GY7A 5KNCH 3DR3A 3MWLA 4ZDKA 1JFSA 3MM4A 2QLFA 1VKOA 5K3FB 2WUFA 2B7BA 1RQRA 3ZG6A 4K6MA 4FMCF 4E5SA 4CTKA 4OQMA 5JSZA 1FF9A 1L5RA 5IP5A 3ZHBA 1L5VA 1HZJA 4E51A 2RJOA 4BFXA 2O0JA 1JHPA 2W98A 4NY1A 4OHFA 4EW3A 2ZRQA 4UTOA 5DZSA 3KHKA 2JH8A 3GK3A 3LT5A 3MPOA 3OFJA 1Z38A 3ONFA 3PA8A 1SPXA 4FE7A 4S0ZA 4B0PA 4BVLA 5AW7A 3RH0A 4FGZA 1MN6A 1Y37A 1GOTA 1VMAA 3B82A 3I58A 5ESRA 2GNPA 3AEZA 2A0XA 3H0KA 3KBBA 5IEBA 3SDSA 2R1TB 5AVTA 1QVVA 4QPZA 3UPUA 1JEQA 2HKIA 3D43A 2GB4A 4IM7A 4IFIA 4BKPA 1G55A 1GD1O 4WN3A 1YR2A 3EAGA 4MA0A 3R3JA 1IK6A 2IT1A 3LVRE 5H80A 1FPMA 4BZZA 5JIBA 5EE9A 2OA0A 3I61A 5BN1A 3W5IA 2TRSB 5KUTA 2ZSUA 4BVEA 5IXJA 2ZJ1A 1XYGA 3F7NA 1YUMA 2PZAA 3KHUA 1KE1A 4DG5A 2A5GA 2H4FA 2J3LA 4XJXA 1VRVA 3EARA 4P4SA 3WK4A 3N8IA 1QRSA 5KX5A 3LFTA 2L0XA 1HDZA 4UAGA 3CLRC 2DQ4A 4OLAA 3WY9A 1H2XA 4ZDWA 4O2BF 5B2EA 4MCAA 1J1ZA 3DBRA 1UKAA 2WVGA 1FDIA 1WU7A 2B1IA 1TQ4A 1SCJA 2ZZMA 5ECGC 4PF1A 3R3XA 1A9RA 4LHYA 3SS8A 4IIEA 3AF4A 4ND3A 2PMEA 4MO2A 4G97A 1Z4QA 4M86A 5IARA 1DU4A 5AOBA 4AKTA 3P5SA 1C3JA 3WL6A 4D9FA 2CN1A 3I83A 2FN4A 1DRJA 4KNYA 2VC2B 5CT5A 3ZDCA 1LBTA 1RFLA 2C00A 2E48A 3IPLA 4TRJA 3KWJA 2P7HA 1M1ZA 2B36A 2YVKA 4UEJA 5D5QA 3WE7A 1WU8A 2A88A 3TXAA 2OL4A 4DRXA 5CX4A 4DTIA 5KQGA 2Z8ZA 4D43A 1BCRA 4WJKB 1R0CA 2RGDA 4K1XA 3S29A 4XRGA 5A3RA 1XCGB 4HYYA 2E9SA 3LE8A 1N7HA 3WK8A 5DN6A 4IDCA 5DNVA 3ZBPA 3VHRA 4DJTA 2FNAA 3T9BA 4Q66C 2QIOA 3S55A 3E27A 4XD7A 5TB5A 3L0DA 5DRTA 3G1TA 2F2TA 1J20A 4BPRA 2HLDA 1UFOA 5LMCA 4XSHA 1UBMS 1WCV1 2F8LA 2G5CA 1XALA 1E9EA 1ACJA 3DEIA 1D4ZA 3AC0A 4CF5A 3BWCA 1T4CB 1UDAA 3I4CA 3G8DA 5JVDB 1UBCA 3QE4A 3UK6A 1DT5A 5IT5A 5AR1A 3D8TA 4QBGB 3STTA 2A5JA 2VNIA 3W7BA 2JJ2D 4P7BA 3BMQA 4HYTA 5EJMA 1OD6A 3S2SA 3LWZA 4YT4A 1HZZC 2ZUBA 2HJRA 2IS1A 4LWPA 5LCXA 3HFRA 3WRYC 1G8GA 5DM1A 3S2YA 4AZ3A 3D4LA 4PZEA 3DUWA 2PX2A 2YN4A 2QDKA 3UOGA 1NNI1 2XB6A 1U0NA 2P9GA 4UEWA 4LBVA 5FB3A 3CSUA 1Q91A 2WIJA 4YJGB 1U5AA 3UFBA 3KPJA 2BGIA 5FBRB 3W4JA 3O3CA 3D02A 3OZFA 1CY1A 1RXUA 4J7AA 1E8MA 4YROA 5ILQA 1Z8HA 5CB6A 1CUCA 2OT3B 1NURA 2A84A 4JP8A 4ZIRB 4X6UA 2Z2ZA 3QGMA 4NULA 1MAVA 5HIJA 4GPTA 4Q9IA 3GLFA 3VR4H 1X8KA 4BN5A 1I7QB 1XIVA 2XE8A 4WLOA 2WJZB 3I0MA 3MCAA 4W9RA 2D06A 3VSAA 2FMUA 3KL2A 1BCSB 4XSVA 5JW6A 5CD1A 3PFWO 3EMKA 2ZRNA 3EQ9A 2E18A 4POAA 2O0MA 1VBFA 2XUGA 1NY6A 1Q57A 1Y6ZA 2HU5A 2O6HA 3B60A 1TUBB 4G0QA 2QSJA 1Q17A 3JAMA 4DCJA 3A70A 2C58A 2LKCA 3JD2A 4P54A 1NPTO 1J2JA 3JW8A 4X92A 3GLHB 5GINE 1FJXA 5K2MA 4YRPA 4RJLA 3JASA 1OVGA 2ZREA 3CW9A 5E6SB 3O8QA 1N4AA 3SNHA 5DK4A 1W0KA 2X6TA 5CPFA 4F1JA 1B43A 1PR0A 3D7RA 1DG3A 3P9QA 1L8LA 2Q9CA 3ROMA 4DA0A 2OORC 2VBFA 3QKUA 2JH3A 5LZ9A 1J7KA 1HMPA 3BSFA 4KNWA 4QELA 1NMQA 2VXOA 3UFXA 3U4AA 3C8DA 4CUKA 1CUHA 5J1SB 4JLUA 5GZ1A 1L7QA 4UUOA 3B1FA 3EF1A 4F8YA 4HWKA 5B3JC 1N5DA 4GYWA 1JVSA 1TU0A 4II2A 2WU3A 2IKSA 3ECAA 1BDIA 2K7FA 1KYTA 5JPIA 1J9ZA 3QKSA 2DFKB 3VA7A 2O3JA 3MIZA 1Q0PA 3NGLA 4DV4B 2PJDA 1S0UA 1QYDA 4IDOA 2XTJA 1F06A 1ZVKA 2WA1A 4EQ6A 2AF4C 3N0TA 3A04A 1Z15A 3GNQA 4Z1OA 2A33A 3DO6A 3RRMA 2N9UA 3HV0A 2XNCA 4WXYB 2FU5C 1K5HA 4QA9A 1Z4MA 5KYGA 2NUAB 3F2IA 3OZAA 4DPLA 3IP5A 1GHTA 4EB0A 4ZDJA 4S35A 2BBSA 4WUVA 16PKA 3I2HA 2B9EA 4Q24A 2PZLA 4Z6KA 3EISA 1JWBB 1BZYA 2V58A 3UOWA 5JANA 1X92A 4WOBA 2XOXA 3GFTA 1X42A 5ALLA 1XRQA 3EXG1 1W8DA 3KFXA 4FFDA 3GBSA 3F5DA 1RJWA 3PPIA 4KQCA 1K0UA 1KI6A 1V1JA 1FDOA 5ALIA 4JDUA 4TLBA 3K0CC 5AVSA 3PFBA 2W6JD 3GRFA 2JB9A 4Y8VA 5E9AA 3EX7C 4FE3A 5JASA 3QFTA 4CR7A 1VA5A 5JMWA 2ZSAA 3DMNA 1QGED 3IUNA 2IH5A 1GAXA 1DAEA 2X9QA 3VH2A 1XJ0A 4E5PA 1CLUA 2ECKA 3MOSA 4GR4A 2O8BB 4Y2XA 4FUTA 3H3JA 3U3MA 1L7EA 1J2EA 2D7JA 4JUFA 5AM3A 2WA2A 1T0JB 4DM7A 3GGPA 2XKKA 3DE7X 4AX8A 2IXEA 5YASA 5IUJC 1IHOA 3WO1A 3CRQA 2AWNA 3UJCA 1L5QA 3H5TA 3OQIA 1HRDA 1RYMA 2JI9A 4XWGA 1SOWA 4TZKA 4P81A 3WLOA 1ADFA 5DHPA 3DDCA 4K2AA 3SK0A 1JG3A 1VL0A 5ADUS 3KT8A 1NBWB 2PZFA 2VDLB 1EG7A 4YEDA 3HHEA 3T3DA 2JLYA 4HDNA 4OSOA 2ZGVA 1BKYA 3KEFA 2O5CA 5F78A 2KHZA 2HMAA 5E6RB 3LQ4A 5FA8A 4UXHA 2V7XA 1FEZA 5JCZA 5EWJB 4OI2A 4JVLA 1YB5A 3WSWA 1IK4A 1YK1A 3RSGA 1KEEA 2NVUB 1FLAA 4ZI5A 4B44A 1OLXA 3QENA 3I1JA 5CIQA 3TLAA 3H4MA 1TZBA 2Z0MA 3VC2A 5BUCA 4XIGS 3EFBA 3OKFA 4JYBA 1EGHA 1T3SA 1Q7GA 2HLHA 3DW1X 4X94A 4RXMA 4XAQA 3V55A 4BAGA 4EHJA 3ABRB 4DDWA 3HP1A 4GE0A 4PZCA 2ZM5A 3DR5A 1CUZA 1IEQA 1YR3A 2CZGA 2WIKA 1CR4A 5EMJA 3RSZA 2R6JA 2C94A 2POQX 4D8XA 5C46F 1KWKA 2Q7XA 3QYFA 3KV3O 2YZNA 4NYMQ 2Q6KA 4QGHA 2ZJOA 5CEFA 4IIGA 4KFTA 2C1ZA 4EABA 5LYJF 4FFPA 1WB9A 1LC3A 1JPUA 1KO7A 3SM9A 5LQDA 3DUFB 2XUKA 3ZI4A 3LTNC 4ENRA 1KIMA 2INGX 4B5KA 1VKJA 1WXQA 2WFLA 3ZE7A 2ACVA 4QPJC 2GZHA 4D3FA 1NFQA 4CUJA 3W2TA 2PIAA 3PWSA 3DCNA 2YZ7A 1U3WA 1VLLA 2AX4A 4U2FA 4RGBA 3QE2A 5CU7A 3WWYA 4J7XA 4BU0A 4WI1A 4YRCA 2P2GA 4KJXA 1IZZA 1F4LA 1HURA 3KNZA 4BVGA 1UBUS 3IHTA 4OGWA 1YBHA 3EPHA 2JARA 5J9FA 3VKWA 1FTYA 1PNVA 1R12A 3LGXA 4Q3NA 5FA6A 3ZDEA 2C3OA 1BKSB 2C42A 4UHKA 5H81A 3MGGA 4CG0A 3IDSA 3JR3A 3DOHA 4AJNA 2CE2X 5IAAA 5LIRA 3IYLW 5D2CA 5C1DA 5CCXA 2WHYA 3ESDA 1SVWA 1QF7A 5D3ZA 2H7YA 5EZ6B 5I9LA 4ED9A 1W88A 4L08A 3AVWA 2WWYA 2LW7A 3OCUA 4EPVA 4JX9A 4MWBA 3NBXX 2NO1A 3PE4A 3OM8A 5F3DA 3BICA 1UJNA 3WYDA 1PR6A 2H16A 3ISTA 4UAJA 4ZOQI 2FMKA 5BV0A 1DC6A 3TPCA 4B3JA 1TCCA 1DC7A 1RACA 4LMAA 2OCLA 3A6FA 5A02A 1C9KA 2ZB8A 1HLPA 2AZ4A 2GZAA 2VAXA 2VTKA 4NFSA 4FHFA 1ODTC 4KQHA 2GF0A 1FPQA 3AJRA 1E1MA 2PM8A 3CJTA 4QYMA 4EYGA 1MIOB 1JG1A 2HREA 2ZYUX 4G2NA 4XARA 3CEPB 2W37A 3D6JA 1SD1A 5K7SA 4DMGA 2BP7B 3N0XA 5IMBA 3QUAA 5AHWA 1WMSA 1QVAA 2ZIVB 3KX2A 3TKYA 1VPWA 1HUQA 2MHCA 1AXEA 3NHSA 1QFXA 5GMOA 5GJCA 5KNLA 1VOTA 4AJ4A 4CF3A 3TSAA 4NAUA 3T99A 5DNYB 1YRBA 1NX9A 4MUIA 4RY0A 1U2ZA 5THQA 3T3IA 3A6EA 1G6KA 2GHIA 1J8MF 3SR4A 3AETA 2YNMA 2GHTA 2QJFA 1H2BA 2FCAA 4C0LA 1W76A 1Z33A 1XZQA 3F6EX 5KEIA 4RSMA 2Q27A 5E4FA 1V9SA 4D3XA 4TMTA 5C32A 4M8KA 4JZKA 3ZLTA 3D54D 3V8MA 2GAOA 4QXOA 5K0NA 2H4ZA 3TQSA 4CI0B 1FNCA 4JOBA 2GLUA 4L8LA 4JNCA 5JARA 1J24A 2CMFA 2G1AA 2H48A 3AY6A 3PNVA 3OH8A 1QRDA 2C2BA 4NYIQ 3EZYA 4OHUA 1JPJA 2NADA 3B2QA 1NL3A 3TVTA 2PTGA 3CF4A 1NM5A 1Z4JA 2J6HA 1O9BA 3QBVA 4XKJA 3AVVA 4TLLB 4DREA 2O2JA 4HDMA 1CJVC 2H8GA 5H68A 2D1RA 2JIPA 5ES4B 3HN2A 5CDSA 2IPOA 4LYHA 1VGQA 4U0JA 1KO5A 3C5CA 3VYTB 3T12A 3B2EA 1DAOA 3EVTA 2GTIA 3HE3A 3ZV7A 2OOKA 3TG2A 3QU4A 5FDFA 2OBYA 1KFBB 3L4BA 1UZUA 3QU5A 4PQFA 2HM7A 1G3RA 2JI8A 1EFPB 1PGPA 1RMQA 3GJ5A 3GNTA 3H1FA 5F5XA 2ZTMA 3AEKA 1PKXA 2ZRKA 2HO4A 4M76B 4V1CA 4ALKA 3SJUA 4DMFA 1W4BA 3OFSA 5I47A 1TO2E 4IMIB 2HCFA 4BIIA 3CNLA 5JDCC 1SXJA 4AY2A 1FTSA 4NS4A 2NU8A 4CVNA 2R751 3HU3A 5I3CA 5JUWA 2R97A 3C6BA 2QVBA 1H2RS 3KYIB 5GONF 4G5RA 3DVSX 1G6HA 1YQXA 1L1RA 2XSZA 4XFJA 5J3JA 3QNUA 5K09A 3SEAA 3FR8A 4OJNA 4TLDA 3BE5A 4F2PA 5LZ4A 2ZWVA 5IH3A 1DIAA 2DBYA 1OH7A 1RXSA 3PU6A 1OMOA 4GQBA 3WHKA 1VE1A 1UPBA 5BNZA 2G1KA 4TYWA 4AN0A 3P9KA 1ID1A 4RPJA 2YXPX 1XDDA 3R41A 4Y1RB 2ZJ0A 1UPFA 2PT7A 3EZFA 2G9QA 2W2KB 1K9VF 3NUGA 4B31A 1DKQA 3V8PA 2IUYA 2ZJBA 3I9V6 4D26A 2EL7A 1Z4OA 3M82A 4KNVA 3EOZA 3SQLA 5LM3A 5LQJA 1W4RA 4JROA 1KDYA 3VISA 3GGGA 3A1CA 1P2GA 1EK0A 4LWQA 1T6XA 1A4IA 3OQPA 4QRIA 1CZNA 1JGTA 2EJCA 3QY9A 4PBRA 2IDMA 4BDSA 3IE1A 2NQ8A 2NTEA 4JHLA 4XR4A 5K05A 2PAAA 1S2LA 2Q0XA 3LDGA 4E31A 1T6YA 1S8AA 3EMDA 3TS1A 5T4EA 4V0LA 1GCUA 1OILA 3CLUC 3FSJX 4AI6A 3HU2A 3HNRA 3M4JA 1V35A 4W5NA 4AB1A 2F59A 3T0GA 2D1YA 3CONA 2G70A 1W73A 3C1OA 3KXKA 3WGKA 4K9DA 3CZ9A 1T26A 3K1YA 3TBKA 1XWIA 4KDRA 4MB6A 1TI7A 2XCUA 4HADA 4Q1BA 4OQLA 3OTQA 1ZM3A 3N28A 1E2DA 3QUCA 4N0MA 4R8LA 5EUBA 1I8TA 1WG8A 4RQAA 3QE9Y 1BYIA 1LRJA 3OCYA 4US1R 2X2FA 5E4YA 4GYKA 1IPEA 5ALMA 5E6UB 1M2GA 5EIBC 3VZDA 5JHHB 1ZUD1 3HVKA 3QX8A 2ZVDA 1SB8A 3AP3A 3RSCA 2JAHA 2P2ZA 4WXHA 4M0FA 1QKKA 2P6OA 4QXRA 3TRHA 2ZRHA 1JHDA 3CUUA 4DV1B 1BQEA 5FWNA 2DECA 1H4TA 4ZQEA 3Q9NA 1KDRA 3GUHA 4DN6A 3WGYA 2VTDA 4YJ3F 3N7AA 4ZXPA 5AFSA 2CBGA 3Q3EA 2SECE 2VK4A 1BROA 4LSZA 3WL5A 1FU7A 1E1YA 4DCCA 4J6EA 2ZSHA 4NPAA 2VHZA 2G1UA 3BD6A 3FTDA 1G21E 2DKOA 4LVUA 4FILA 5BQXA 2IYNA 3C4JA 4AMZA 2NYUA 2CL5A 3D1LA 3NDPA 2GCOB 4PZZA 4GICA 1KAQA 3B3FA 3EXIA 4MWZA 3A37A 4XXHA 3PPXA 1ODLA 1HYHA 3MBIA 4HNAB 5CDFA 1BH2A 4YB8A 4JI0B 5IK2D 3QFFA 1WEKA 2JIZA 4IIJA 4CCAA 3EPLA 2AEJA 3V33A 1XJWA 2CLKB 1JR2A 3P2MA 1IY8A 3I76A 4JC5A 1ORIA 1RHMA 1ZRMA 4R5HA 1QIEA 1FX1A 3BXEA 4D56A 4MHTA 2YC4C 1ZGZA 2YXNA 3HH8A 4PC1A 1RYBA 3SBOA 3ZDXB 1ZGBA 2Q4OA 2EBFX 4I5DA 3DMGA 1B00A 4FX5A 3R7SA 1BS1A 3P0FA 1U7XA 5DCYA 1Z34A 2QRQA 4RD2A 3IP8A 1MEOA 5JSKA 2H4JA 4FFNA 4MARA 4Q3CA 2CVZA 2XKBA 4B6GA 1O8CA 1OAKA 1SHZA 5EMNA 1ZINA 5EPEA 4TM7A 3TRJA 5CITA 4Y3UA 2Q5LA 1IZYA 4G4SO 1UKCA 2C3YA 2ZU0C 3HY3A 5IF9A 3VZBA 3F6PA 1KY4A 4W63A 5A0TA 1AKQA 3WKAA 1CVLA 1FBTA 1QHIA 1VP9A 4Q34A 1BGWA 1H0KA 1QO0D 1TVCA 3LBYA 4HWPA 5KNDH 4EG3A 5EE3A 2Q6TA 4PX9A 4YYZA 5AO9A 2VXBA 3UH1A 4MH0R 2QAJA 1SXGA 4JJ7A 1XMJA 4D3SA 4HX5A 5M34A 1B76A 3KOXA 5IC6A 4CI9A 2BSQA 2O8FA 4RAQA 3WLLA 2VIIA 3DFMA 2O8VA 4BGEA 1KC1A 3E61A 1JA0A 1FDSA 4JFRA 2RSLA 5BR4A 2VJDA 1E60A 2FR0A 2G04A 2GDZA 3DWGA 1GKYA 1UMCB 1O57A 2E55A 2H18A 4QFBA 1ZXLA 5K4GA 3OLCX 2HSEA 1ZH2A 3CTMA 3QTTA 2W58A 5FTKA 4RIEA 1N2EA 4PG6A 4GMDA 4NV0A 1Q3HA 2WD7A 4L75A 5A71A 1VGVA 3PCXA 3DL4A 3O94A 3Q7QA 1IZ7A 4OXKA 5REQB 4YMIA 3HJUA 2W6ID 7ABPA 4LF4B 3VYSB 1ZKMA 3ZGYA 5LQKA 3L7YA 3QHAA 2XVXA 4CKYA 3L8GA 3QLVA 2BMFA 1JG4A 3GEGA 4ZYZA 1BFKA 3R7BA 1J5EB 3O8LA 3MPUA 1U2SA 2QV0A 1TW2A 2VFAA 2XE7A 4JLNA 3ROFA 2AG6A 4DXAA 3ICEA 1LY1A 4NCKA 2TECE 3OY2A 2I2AA 2XB2A 4Z8YA 4CMCA 1TK9A 4EB6B 1N2IA 3STVA 1WUHS 3SY8A 3UBMA 4ZO7A 3EOAI 1KYIA 4NG5A 3W4IA 1LRKA 3N8HA 4QO8A 4BGDA 3H5IA 3FKQA 4DYVA 4O4IF 2R6R1 3UK0A 1CS0B 1WCIB 4J0GA 4AKHA 3AF2A 4X44A 1V7QA 3GQBA 1FRFS 3V1MA 1KJQA 4DLPA 1KF0A 4P22A 5CDTA 2RH5A 1J09A 4XDHA 3B1WA 3WL8A 4P0PB 3DFFA 1J56A 2G63A 9LDBA 5HRAA 5E2BA 2C5FA 2COKA 2ZBRA 4XM0A 1SHLA 3CMCO 2HRRA 3QG1A 2I4OA 1VCMA 1R6VA 1AKYA 2YWGA 4HDRB 1E7MA 2ZBEA 2BRUC 4MR9B 4JYCA 5ADWA 1PZEA 3QU7A 1I4EB 3BH6A 3CC8A 2IUEA 1KARA 1U8CB 4NOJA 5ESXA 4C7JA 4EEXA 3OQ1A 4D8VA 1B3RA 4YXWA 4YGYA 2C9BA 4OHMA 3LWDA 4F9FA 1NPYA 3PUXA 3KU4A 5BPFA 4DB2A 5TGZA 3ETJA 4V0MA 1BX1A 2GK3A 3HCEA 3PNBA 2NO9A 2R6AA 4UVHA 3BL6A 3QEMB 4AO8A 2XA1A 4RNDB 5G2OA 2IXGA 3DV0B 1RW4A 1MO6A 3TVDA 4B80A 2PWBA 4YFYA 4Y2SA 1A7AA 3BMOB 4LJ4A 1RQXA 4Z1MA 2PV7A 1IMOA 3IDZA 4MRMB 1NXOA 2QLTA 3PGLA 2R86A 4C22A 2DUWA 1ACMA 4EM6A 1SBNE 2IL1A 4FI3C 4G63A 3F1KA 4MX8A 2OXTA 4ZQGA 1Z2NX 1VM6A 4I2VA 1HM5A 2VDJA 5K8LA 2CXOA 2I8AA 3ELDA 3VZSA 1Z63A 4EA8A 2J32A 1JDZA 4F5EA 2NXCA 4HEQA 1EVYA 4AURA 4NBWA 4OK3A 4Y2UA 1S1MA 3PR2B 5DBFA 2HWKA 2I62A 2NT4A 4F86A 1C80A 3KQKA 2XMDA 3BJIC 1OX4B 1MC5A 3KLBA 5ITZB 4RTKA 3O8DA 4DGSA 1PDOA 4UUPA 1QH1A 2XLCA 3UK7A 4LHXA 1PN3A 4LY0A 4AMBA 2O3QA 2OENG 2QQGA 3ITDA 4IH4A 4AAYA 4E5DA 2XBMA 5HQJA 2QW0X 4YRZA 1M2VA 4YBRA 5L3SA 1JEAA 2P9YA 4E2XA 4ZYUA 2HMWA 1R18A 3E9DA 5CUQA 2NYRA 4WN9B 2OTCA 4QT0A 1FQOA 5FXMA 1X7XB 4ZV9A 3CWZA 3FTPA 4HGYA 1DAKA 1DPGA 4IDFA 3QV2A 4K6KA 4YDQA 4Z49A 1JDVA 1IRIA 3EXFA 2A5LA 1AKUA 4PZLA 1RLTA 3MTGA 1K89A 1XTBA 2JW5A 3OF2A 4IIXA 2D5AA 4QM6A 4RD0A 4EA9A 2WAOA 1NJGA 2IYSA 2OZVA 3C7KA 3FUXA 4AWBA 4CG2A 2RGNC 1SQ0A 1VC2A 2Y66A 1QVWA 2QL6A 2C8KA 3FI0A 2YV2A 4LECA 4MV4A 1QVRA 5H7XA 1HG1A 1DCTA 2X6QA 3ESQA 4B3CA 1M8PA 2IPMA 1T5LA 2O14A 2PXCA 4DARA 1EVIA 5EEGA 1LCIA 3V2HA 3EEQA 1IM5A 2AD5A 3PQ2A 2XKJE 2Q3CA 4ZQBA 1XF9A 5LOVB 3RJ9A 1QCDA 4P08A 4L5BA 2GKOA 3RT7A 1T0HB 3ZVNA 4F45A 3HBLA 1QDLB 2N1MA 3VO8A 2XVAA 3JQBC 3ZE6A 5IFKA 4KH0A 3EFHA 3RUEA 5D3QA 3UV3A 3WYNA 4ENSA 3DAYA 2DKNA 5AJZA 3JAKA 1E3JA 2HA3A 3FHCB 4HZUA 1SXQA 2ZYAA 2VYND 3GEHA 4S1VA 3KAJA 2DHRA 3KB8A 1Z36A 3BIXA 4X8OA 2C7GA 4KO1S 1RYYA 3KVNA 2HK6A 2ZEJA 1JDPA 4C0XA 5A5DA 3L7OA 1KOGA 2H7VA 1E89A 2XQFA 1O97D 4ER6A 1H5NA 3K73O 2D2EA 4GRAA 1XRPA 1ZMXA 1N4DA 4DDUA 4EKGA 3R40A 5E1OA 4CTMA 4L85A 1QIDA 4MRAA 2D1QA 1U3DA 3N2KA 1N2ZA 2DAPA 2PQMA 3AJAA 2OXRA 2QLJA 3KSUA 3PHCA 4XDZA 5EINA 4R1LA 3VR1A 2FSSA 4NX2A 4W9NC 3R9WA 1NBAA 1SQ6A 2V7BA 1MW9X 3BMNA 2H2DA 4Y9UA 1FSZA 2XB9A 3FGNA 3NOOA 4MI3A 4ZOLF 3BD7A 1F8XA 3L6DA 3H17A 4U2DA 4KAXA 1ZO8A 5CGZA 2DPYA 2H63A 5GPBA 1Y7HA 1YDWA 1IHXA 3N53A 1LNZA 4L3OA 2CVHA 3EQ6A 1JNXX 1C9YA 2A0WA 3EIEA 3GCDA 4Q4JB 3E0XA 3BULA 4S1PA 4UUMA 4EKNB 1AF7A 3BYZA 1ETUA 3QELA 4K9NA 1YQ9A 3PD7A 3ECSA 3WLFA 1T9DA 1QCZA 1I24A 1KAOA 5HUHA 2CLDX 4XX1A 1OU4A 4Y6QA 4I4LA 3FH0A 5BN5A 4DRXB 2DTXA 3OZCA 4JUAA 3E2PA 4L57A 4YPVA 3LZCA 3Q7PA 5L7YA 1E0SA 1XNHA 3HWRA 3V3KA 1E7QA 4MQMA 4C5CA 2X8BA 3GLRA 3JALA 4F9GA 1RD4A 3DJYA 3SZOA 3VOBA 2A9QA 4DZTA 4GKKB 3EH2A 2MSKA 1GGVA 2PSSA 2SKEA 1W36B 2IUUA 1XQYA 2CLCX 4NATA 1F2DA 1GU0A 4DQLA 3GHHA 3EE6A 1UT5A 1E6MA 3HB5X 5FQNA 2LBPA 5FLYA 1NRXA 4YMUA 5JQGB 4LCJA 1BQ4A 4AICA 3OWHA 1N5IA 4K7JA 2D1SA 3BIJA 3AI3A 3RF7A 1PR3A 2HO5A 3B51X 4M3NA 4ZC1A 5DSZA 4MR7A 4WXRA 4J76A 2G36A 1XLTA 3WIVA 1MC8A 3HXPA 4UBNA 3COJA 1I4LD 2PMDA 3IQFA 1PT8A 5ILGA 1Y6QA 5H59A 1O5IA 4WCVA 2VCYA 4WNAA 2AF3C 3PHIA 4JL6A 3ES9A 1IWBB 4F6CA 4Q7LA 3T4EA 5MF6A 2QSYA 3NIWA 2Q7DA 4F1KA 3PVCA 5FO1A 3O92A 2CZCA 2JNWA 4GOXA 1CZRA 4WW0A 1SN7A 2MIIA 4Q39A 2JPDA 3AI1A 2Q46A 1ZLXA 3S4YA 2EARA 4LEIA 3FM9A 4AYTA 4W5OA 4F7WA 3CRRA 3KYJB 4PG7A 2WKWA 4ZANA 2MT9A 2EBWA 3JD3A 4IO1A 4FBMA 5DBHX 1C3OB 1YQDA 3UIEA 2RC6A 2QN9A 3TCNA 5KO2A 3AL2A 2GRUA 2KW5A 3MJHA 4G1EB 3WJ1A 1XFDA 4CM7A 4WDQA 4DGQA 4XCQA 2GD0A 1B73A 1FE8A 3A9VA 4AUNA 4FYKA 4CIVA 2H5JA 1A9TA 1UMDA 1UJ4A 3AUUA 3IQIX 3EDQA 4PLZA 4YRNA 2YINC 3VTFA 2EBHX 4B09A 3U4QB 5EGNA 2DFTA 3BHNA 3L40A 4F12A 2J9RA 4Q1FA 1C4OA 1TMKA 3B9BA 3GDHA 4K9KA 4MXDA 2ZPAA 3IDOA 3I5YA 5IVHA 4GRIA 1M5TA 1KO8A 4MYTA 1NJFA 3RIXA 2HGSA 3DKPA 1IPHA 2AFHE 3W9UA 4E03A 1IM8A 3V32A 3UW1A 2V6MA 4BJ1A 2Q3BA 4I7EA 1ZC3A 4ZZ3A 2Z1DA 1A2KC 3KTDA 2HTEA 3A1WA 3AEQB 3VO1A 3DTVA 1U8XX 4FGUA 5I6DA 2Q49A 221PA 1FVXA 1ORDA 2V0CA 4TQGA 4N7JA 2HK9A 3V3TA 4FQ8A 3ND5A 1YNSA 1NJ2A 3QYJA 2E87A 3KSRA 3LJKA 4KGZA 4G5FA 4TV9B 1JSRA 2IHJA 4I08A 4RYLA 4DANA 1BD3A 2CWWA 3ZS9A 4WKBA 1BRTA 1TQHA 3LUCA 1B23P 3QMVA 2B92A 4RDHA 3DLHA 3ZHTA 2E4XA 2D59A 1RQLA 1US8A 1WD5A 3QXXA 5K1ZA 1Z6YA 1EX6A 2VBIA 4U7WA 4CIYA 3A2LA 3VKHA 5TRTA 4EQ6B 3EULA 3N9IA 3V1YA 4HBZA 4P33A 5CYOA 5B58C 3ZK7A 3B1XA 5DYYA 3RAEC 2C3UA 4BLUA 1U7TA 3N6XA 4TGLA 2Q1SA 3MRXA 1JXMA 4U8GA 4A6EA 4ZC8A 2FX5A 2I78A 2BDTA 1EEHA 1ZJ4A 1G2IA 1XTZA 2PGNA 4NDZA 3NWPA 1KMNA 1HH4A 3IUYA 4LDPA 2CNDA 2RGAA 3OO1A 3OTWA 1EX7A 1BXGB 2WKRA 3KQYA 1ZXXA 1EM8B 4AS3A 4YAGA 4JJ4A 1Y7LA 5CLHA 4GOLD 1KI6B 1G8YA 1B3BA 3W5HA 1EWVA 1Z4IA 2DWOA 3DHVA 4QUHA 4V2IA 3SCZA 3D81A 4EKIA 2FWAA 2EGGA 4GMFA 4OOEA 4X54A 4YJFA 3E82A 4M4SA 3K9CA 5F9FA 1CF9A 2KBFA 4NCJA 3W8DA 2CDNA 4JP3A 4DYHA 1GITA 4HDOB 5HNKA 1N1DA 3OURA 3GGSA 3LWNA 2WHPA 4G0VA 2JVJA 5T3UA 3W5BA 5A4IS 3BRWD 3WDSA 5HM6A 5TT1A 1XN4A 2BY4A 4EF5A 4LQCA 2E1PA 2IYWA 3HPQA 1M1UA 2I66A 1IY1A 2ODTX 4KO2S 1V11B 4X7RA 2P11A 4J7CA 1SHUX 4BEBA 4INOA 1Y3CE 4M0LA 1EU1A 1F60A 4H0CA 3IXLA 3LCJA 3UJBA 1TEXA 1EGVB 1H3NA 1M8GA 1R5JA 3IEPA 3NYIA 4FFOA 4PPNA 4FD3A 3U40A 2QM8A 3MYRA 4IJUA 4JOQA 4UNNA 4B2PA 1QFMA 1A97A 4QZVA 1Z13A 4ND5A 1G63A 3I9NA 5I7VA 3FGPA 3Q7TA 2JIOA 2XW6A 1QVZA 1ZBQA 4OG2A 4ZOEA 5EKDA 1JBQA 2OYCA 3WNBA 5ARBA 5AUNB 5FPYA 5MN4A 4JV5B 3E05A 2MCFA 3AKEA 4I5FA 3JQAB 5IZCA 1XZHA 2R87A 1FU4A 4REQA 4UASA 2P0AA 5AKJA 4ZT6A 3NS7A 4M1TA 1TUIA 4EELA 3USZA 3DPSA 2O2EA 1YI1A 1ZW1A 1XZCA 4PPFA 4W5RA 1HWYA 1XTJA 4IX9A 1TA4A 3ZQ4A 2IELA 5FWAA 4CT0A 3KDPA 4K6GA 3E5MA 3PC3A 1XMSA 3K5PA 1YBVA 3PHHA 1WVGA 3CX8A 4CQJA 4OI0A 2PQ0A 4NFHA 5LPNA 4F97A 4KV7A 1C1HA 2JLBA 3MTDA 1NU6A 4MKFA 3SZUA 2PKQP 3AGPA 1IH8A 1F1JA 1BWPA 2VHTA 1T0UA 1SK9A 3DJFA 1VXRA 3GIDA 1P2TA 1MV8A 5TNXA 3GVXA 4V0SA 3U7QB 4QD3A 4QG7A 2GYYA 2Q99A 1KXJA 2OVFA 1Y9ZA 3LCCA 2WM2A 1NFRA 3M9WA 3MQ4A 4OTZA 3CKYA 2CE7A 4AN1A 4JXKA 3QKRA 5MGBA 1Y3BE 4H08A 3Q8WA 3A6PC 1R0BA 2F9MA 3LK7A 2DPGA 5KX5B 1PSWA 3E3AA 3ZW9A 5IM4F 4ZCSA 4OXIA 3EEIA 1A88A 1GDDA 4LRXA 3ZWNA 2Y0CA 1U6IA 3C1AA 4EG7A 1QPZA 5HKKA 1IDOA 1MX9A 2W71A 3C24A 2RAPA 1KEZA 3CE6A 2C9YA 3P19A 1NF3A 2LXNA 2P8SA 3U7IA 3CG4A 4S12A 2OYSA 3HL0A 3VZCA 2WTBA 2F3PA 3QNWA 1BMTA 5AI4A 3TTTA 1RZRA 2WPDD 2K4MA 1E1KA 2R2AA 4CE6A 2I29A 4BNFA 2QY6A 3P7MA 3BRCA 5LL6P 1G64A 2B21A 4F3YA 2VJBA 1FSSA 1IL0A 1TC2A 3D7SA 4MK4A 1W5TA 4WKGA 4NOKA 2MSNA 1U7OA 1KQGA 3U9TA 3G1WA 1R6DA 1JWAB 1GUFA 3D3EA 1CJBA 4O63O 3TL6A 3ZCPA 4JQZA 6PFKA 1M0WA 4DVJA 1SZPA 4I1SA 1RWQA 4H7KA 1LJUA 3FA2A 1A76A 1VL8A 2PH1A 2VSQA 5AQEA 1X9HA 1O0BA 2PX4A 1O8BA 3AG6A 3QXHA 1O89A 4O3FA 3C74A 5LJLA 8OHMA 4ZOCA 4ERNA 5JAPA 4B32A 4OHPA 4JU8A 3TBFA 2BTOA 5BWMA 2XCRB 2WVAA 4MI1A 3TEMA 1XYYA 1DT3A 3IAAA 4CM4B 4BLVA 1IUPA 2V3VA 2O2YA 4FX2A 1PFWA 5BXQC 6ABPA 5DT2A 3C1TA 2QVLA 4H7DA 1XWWA 3VVMA 3ZVLA 1EESA 5DBEX 1C1DA 2HBRA 2GVNA 3PFNA 4EO7A 2Q3EA 3RS5A 4EMTA 2I8LA 3DFZA 2H1OA 1VL6A 5DNDA 3C43A 5H70A 4KGXA 1Q19A 5ICGA 2IYVA 5BRNA 3TSOA 1S4QA 4ZEXA 9ATCA 2BTQB 4HI0E 1T1IA 2C5GA 4A0FA 4KFRA 2NM0A 2O7RA 4K87A 1YONA 1J8QA 4TTVA 1L5FA 4MULA 2WINI 1A9OA 2QG6A 2HDOA 4LZWA 3V1NA 4IX1A 4EP1A 5CIYA 2PLAA 1W1IA 5TPWB 3H04A 2VATA 1T4DA 4WA7A 1SIUA 1E5XA 3CW8X 1IN5A 3LHSA 3C3YA 4OXRA 4V3BA 3INNA 1YNOA 5ALKA 3ZDQA 2V6GA 3IFSA 4OQQA 3MWKA 2HEGA 3WLSA 3ZI7A 4ZK6A 2X2PA 4PX3A 1NC3A 3ND9A 4R54A 5DASA 3RQIA 2NU8B 2PU5A 5LYYA 3B9PA 4BFUA 4JB3A 4IOMA 1KRHA 3U3XA 3KSAC 2R60A 1OFGA 3F7MA 1QQ5A 5CPBA 2JGRA 4Z4EA 3HUTA 4L2IA 3QLTA 3D5EA 2I3AA 2B0JA 2QJRA 4BEJA 1L3IA 2DR0A 4P1ZA 2EV9A 2R65A 3HSYA 3PCTA 4AULA 3H9UA 5KDOA 1ECGA 4RLSA 4J4HA 2Q62A 3KZVA 1OKKD 3V1UA 2J45A 1MOQA 4RDCA 3IDQA 1NLUA 1O94A 5TMEA 2CKMA 5CB4F 2H1VA 3ZWQA 4Q7MB 1D2NA 1U0RA 2P9CA 3URMA 2VDRB 4UUQA 4NZOA 5B6JA 1BU8A 1OB2A 2ZR7A 1RLJA 2LWIA 1U1FA 1OVMA 2ZKIA 3I0ZA 4H9GA 2LV8A 1UAAA 1YS6A 3B3QA 2ZI3A 4ZZ0A 1X3LA 1PP4A 1E3MA 3JQFA 4LWOA 5C3MA 2P6RA 1M2OB 3HM9A 1ISFA 1AS0A 1NJ5A 1EJBA 4LHEA 5EP1A 5GOTA 1FMTA 4D9EA 4F3NA 5D84A 1FLNA 4WESA 4O4LA 1II0A 3KHSA 4Z9AA 4RY2A 3TJRA 1IG0A 3D59A 1L4LA 1Y4UA 2YNMC 1CUEA 2VDMB 4QL3A 3LYLA 3R7LA 1CQPA 3H5OA 4HUQA 5IUNC 4KWTA 4F8JA 3R0QA 5FNVF 5JADA 3KEOA 1P29A 1KGDA 4M9QA 3TGPA 3ZTWA 1QHHA 4BKOA 1M8JA 2GEUA 4MKIA 2QM0A 2VBGA 2IYUA 1M34A 4DAEA 4DEVA 3LX5A 4RF3A 3TIGA 3OOSA 2DWCA 3IOBA 1IM2A 5AK6A 4P3OA 4JQCA 4WJLA 1NVEA 1NM5C 3G2LA 3MTJA 3OY7A 2Q4EA 3K15A 3M6MD 4YJ2F 5EJAA 3SIWA 4BBJA 4JN6B 3UJNA 1GTVA 4LRQA 4PSDA 1CZKA 2EQAA 3M7IA 3VMMA 5FEUA 1MG5A 4IJ6A 4PFJA 3W8FA 4GMHA 1XTQA 4CMIA 2APJA 2C77A 2YUIA 3PGMA 2KWIA 2PRYA 3JQQA 1U1IA 4RF2A 3L4BC 4RVFA 2H1IA 2BGRA 2HXGA 3QVOA 5A05A 4MW0A 2Y2UA 1UZLA 4HXYA 5KYWA 3S68A 3CPSA 1RQ7A 4FIZA 3CB2A 3FOEC 2Y68A 3NO4A 4N4AA 5EY5B 3H6HA 3H2BA 2NZVG 5KOHA 4N76A 1DUIA 3M6IA 5FT9A 3IKLA 4BB9A 4FGJA 3WKBA 3ZIDA 3E84A 3L01A 2F6RA 3HWWA 3SP1A 3WYFA 5BW6B 1QGZA 1RS0A 4NXMB 1P45A 3FCEA 1EQAA 3T5DA 1Z2EA 3HZRA 3N39C 1O4WA 5TMDA 2O23A 4YRLA 4G26A 3UEOA 2GYWA 4GO1A 3SC2B 4FYVA 2D1FA 3AB7A 4JBYA 4AJKA 3K0EA 3RLFA 4B71A 5DISB 4IIJB 2VZLA 2FP4A 4X9XA 4Z86A 1QH0A 2WYHA 4LOJA 5KHLB 3ZTTA 5CD9A 1J5XA 2WWRA 4N5LA 1UJBA 2YWRA 4PLHA 3PPYA 9GPBA 3ESXA 1T2EA 2VQDA 2VAMA 1SWVA 1T9CA 5DSXA 3I01M 2A9PA 3IAXA 2XD4A 5F3WB 1P5RA 1TM1E 3GJXC 3AFHA 3DGEC 4IQ4A 4MVWA 3ZU6A 4KQKA 3D6TB 1GXSB 3FYTA 4MTLA 2BAGA 1DTEA 3QFCA 5KTKA 3BHJA 2HRZA 4ITVA 3P0HA 3GAZA 4GI5A 1N6NA 3CNNA 4JK3A 1JHVA 3LBAA 2BLNA 3Q7IA 2QD5A 4XDGA 4MVJI 1H05A 3PENA 4LMBA 3N3BC 4N5DA 1U04A 3VMFA 5K6TA 3I1YA 1M6HA 2O7VA 3M0EA 3HXOA 5ICCA 4KDFA 5JYEA 4W82A 1K5PA 3WQRA 3MUFA 4I8XA 5JVDF 1T5TA 3HVUA 4DQVA 2R8BA 1QFYA 3K05A 4Q4HA 2XDQB 2GZ1A 1XUOA 1ESNA 3BXOA 3GGDA 1XZAA 2JFWA 4EECA 4JBHA 3VV2A 3GLFE 1H0SA 1H2AS 4HJRA 3RVPA 3MGAA 3MT9A 4FYIA 3SE0A 3F8TA 3ZGXA 1C81A 2LNDA 3ZV5A 3ZD7A 3BD9A 2JLZA 2Y1OA 1FL9A 2G83A 3B89A 2IW1A 1W0JD 4DLXA 3ZH9B 4OLJA 3CN9A 4PHFA 2WD7B 3U4HA 2JLWA 2CKDA 4KIUA 4JVNA 4BNTA 2ZM6B 1WDWB 3RS4A 3DNPA 3M3DA 3RVDA 1KH3A 3ZDBA 4JT9A 1TYCA 5GM1A 1Y1SA 5HK8A 2PXXA 5K0GA 4RTPA 4P5EA 1MG0A 1D2HA 1R6UA 1ZICA 1EIWA