3M70A

Crystal structure of tehb from haemophilus influenzae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
286
Chain Sequence
b'MKNELICYKQMPVWTKDNLPQMFQEKHNTKVGTWGKLTVLKGKLKFYELTENGDVIAEHIFTPESHIPFVEPQAWHRVEALSDDLECTLGFYCKKEDYFSKKYNTTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENLNISTALYDINAANIQENYDFIVSTVVFMFLNRERVPSIIKNMKEHTNVGGYNLIVAAMSTDDVPCPLPFSFTFAENELKEYYKDWEFLEYNENMGELHKTDENGNRIKMKFATMLARKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tellurite resistance protein tehB homolog
publication title Crystal Structure of TehB from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 73
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m70A02
2AR0A 2NP7A 2XYVA 3IDCB 5EZSA 3TFWA 3ELDA 3KQWA 3I54A 4WZCA 1KHHA 4P7FA 5IKMA 2DULA 1T43A 4PONA 4IEYA 5F2NA 1L3BA 2YX1A 2NXCA 2IGTA 3JZVA 5J7MA 3WW1A 1JG3A 1J3QA 2GH1A 5CCXA 4IEUA 2Q4SA 3UJ7A 4X1OA 1PM7A 5KHGA 3A25A 1EAMA 1KPIA 4Y2HA 5EQJB 2GB4A 4GC9A 2CGPA 4XFGA 3FTEA 3OPNA 2V7EA 3G7UA 2WC2A 3BPZA 3EGIA 3HCBA 4PYIA 3H1YA 4PYMA 4XF3A 5B1SA 1JTEA 1WXXA 5E8RA 5K0CA 4HG2A 4GF5A 3AY0A 3BALA 3DP7A 5K0FA 2PA7A 3CC8A 4Q0PA 3KKZA 3VC2A 4RTRA 1SKMA 3NVCA 1CAVB 4B17A 4IEWA 2B2CA 3A7EA 4R6WA 3G8AA 4BHPA 1VR3A 5KHJA 2H6CA 1VP9A 4XFCA 5FULA 1I6XA 3U11A 1UW8A 2WFPA 4UOEA 3C6KA 3U10A 4HRAA 5K0JA 2Y0OA 2BNMA 1O9GA 1L9KA 1H1IA 1LRHA 5D1NA 4YNIA 3GO4A 5MHTA 3OU2A 1RI3A 1FPQA 5BUVA 4TLFA 5EMLA 4JVAA 4I0BA 3UA4A 3ER8A 3BKWA 3RODA 4F8AA 4FS8A 3E97A 3RYPA 1X8MA 5GOZA 1OMIA 3NDJA 5FCCA 2BNNA 3FTFA 3HM2A 3IIAA 5CD1A 2AS0A 5DM0A 2UZ4A 2MNGA 2UYOA 1VL5A 1YHFA 1Y3TA 4KIGA 2PT6A 3LKZA 4RTMA 3A27A 2QJVA 1R8XA 2P3QA 1O4TA 4POOA 2OPKA 3KU1A 1JTFA 5FPZA 2Z6AA 1G55A 3N4MA 3L2HA 3UJ8A 2Z69A 1OFNA 3L8DA 2HR1A 2BZGA 3MZHA 1VIDA 4I01A 3THRA 3M6XA 4FP9A 3BGIA 5F2KA 2EAAA 4KW7A 4HSLA 3G88A 3R6TA 1VBFA 3O14A 4RTNA 3BWCA 1HW5A 5FQ0A 3HVJA 5DM4A 2UYQA 4LUMA 2P7HA 4WBBA 4HTFA 1P1BA 5DSXA 4XEZA 2WK1A 2V09A 5E2AA 1XXLA 3HT1A 4Q0UA 2AOWA 1SQ4A 2UY9A 1SQFA 3MERA 1ZRRA 3HP7A 1LB2A 1JQDA 1KPGA 5I0RA 3NTVA 2AN5A 1EPZA 5EZWA 5KBFA 4M36A 3THSA 4GOLD 3DMHA 3LA7A 2Q41A 4EWEA 4RTLA 5FADA 3GJYA 3FUTA 4OFGA 1J59A 2FYTA 3EVGA 5CVDA 4PNEA 1XDSA 2H1RA 1RGSA 2O07A 1HNNA 4DCMA 3PT9A 1YFWA 1BHJA 4BLVA 5T3NA 5DM2A 2BR3A 3LSTA 2PWPA 3TNPB 4BY9E 3S0MA 5M5BA 4YV0A 5K0NA 3HA3A 4HH4A 2CMHA 3DXYA 4U7TB 3TLJA 3IV6A 4MTLA 3TM5A 3D82A 5EHIA 1AQJA 4YMGA 2PXXA 3LKDA 5E9QA 5E9JA 4QGNA 3S7EA 4RD7A 3LAGA 2OO3A 2C0ZA 2UYCA 3NKTA 3MHTA 5CCBA 5FWDA 3KQVA 1I1NA 4GOND 4I0AA 3UKVA 2ADMA 3D2LA 3CLPA 3UWPA 4AZTA 3H1WA 5EVJA 1NW8A 3G89A 1D2GA 3I64A 2DPMA 1WG8A 4FGZA 3LCCA 5I8YA 5HZMA 2PSSA 4MGZE 5CM2Z 1LR5A 4MGYE 3BWBA 2BR5A 4AVAA 5DT2A 3GBFA 3OCPA 1X19A 4LG1A 1ZZBA 2DCTA 3FZ3A 5LEJA 5DXAA 5K03A 5K0BA 2GLUA 3EVFA 4FT4A 3SX0A 1UIKA 1KXZA 3LDFA 3KQMA 3HCAA 4QMAA 3EVAA 4NVPA 5C0OE 2XKPA 3KPVA 4QTTB 3DTNA 4N9IA 3R0QA 3B5IA 3BT7A 5AVPA 3AWIA 5LQAA 4DINB 2AN4A 2YQZA 5JR7B 2EFJA 4M38A 4AUKA 3RIEA 2ZZNA 4LEJA 3CJTA 1UD1A 1AV6A 2LD4A 5EEHA 4YSFA 5GIPE 4C04A 5K0EA 2OB2A 3WW4A 4GUAA 5E16A 1JQEA 2P41A 4PJYA 3UJ9A 2ZBPA 4PCLA 4EWDA 4AQ6A 4O9EA 4GOOD 3TNQA 4PIPA 1VJ2A 3ACLA 2FRXA 3EVZA 3MB5A 1ZREA 3ELNA 3H8UA 4IETA 3P8ZA 4L2NA 3FFQA 5HIIA 4PYJA 3DXZA 3S7IA 1VPTA 1G6Q1 4KDCA 4MGKE 3GYDA 2C7PA 3IYLW 1VP3A 4E2XA 1OI6A 1G6NA 4HGZA 4KIFA 4ONUA 3A4TA 3H1MA 3IHTA 4GEKA 2FCAA 1RL3A 2PV0A 1CAUA 5JUWA 2EA7A 1J1LA 4OBXA 4Q0SA 3P9CA 3LX6A 1O5LA 3HA7A 2Q30A 4PGHA 3MGGA 3NVKI 2O1QA 3CL1A 2O0LA 1NV8A 5U4XA 2D93A 3FPEA 3CO2A 5FQ0B 1V39A 4IEXA 3KQYA 1CAWB 5CU1A 3DXXA 2I62A 4QPNA 5FHQA 1XDUA 3AJDA 5GP1A 5EIFA 5FLJA 2YXLA 3FPHA 1ZRFA 2PBFA 1X1AA 4WVLA 3PVBB 3BZBA 2B78A 3BB6A 1DL5A 4A6DA 2ZZMA 5HILA 5FCDA 4QGLA 1YFXA 1VE3A 2FK8A 4IV0A 10MHA 3SXJA 5DX1A 5E1RA 1IY9A 2EJUA 4MX3A 2PXCA 4YUWA 4IKPA 4E31A 3KHKA 3C0KA 2GC0A 5EMJA 3MDPA 3U0ZA 4DZRA 4XETA 2CL5A 4F7ZA 2BEOA 1NW5A 2OPBA 3ORHA 2OYZA 1ZZ9A 3PVCA 2EX4A 2Y1WA 5CIYA 3CVOA 1NKVA 1R6AA 1V70A 1SUIA 4AX8A 3MPBA 3A7DA 3G2MA 5FQNA 3HCDA 4P58A 3O7WA 3DV8A 3F4KA 3ELUA 2Z6UA 5I8SA 2G1PA 5HIMA 2IXKA 2AVNA 4R52A 3B7PA 2HWKA 3RNSA 2ZBRA 2F8LA 3G5LA 4E2ZA 3UKTA 1R18A 5ERGB 3P97A 3UZUA 3PNAA 3SCFA 1IXKA 3FUWA 4IEOA 2FQPA 2GA9A 2BYVE 5BY5A 2ET1A 3E7PA 3MQ2A 4EKIA 2YXDA 4GOMD 2BM9A 1YLLA 1ZQ9A 3IBMA 3TMAA 1ZX5A 1F38A 5FUBA 2QNKA 5JSOA 1ZHFA 4LWOA 4MGIE 3E5UA 3B02A 3LWCA 2AOXA 5CVVA 3ETQA 2IDKA 2Q1ZB 1Q3EA 3MTIA 4LA3A 1O3SA 2IXJA 5DRYA 3GCZA 5K01A 1DZRA 3TR6A 1TW3A 5EC8A 5KVAA 1CAXA 2ZCWA 4XFHA 3BWMA 5I93A 2PFWA 5LQRA 3S68A 3VYWA 1UIJA 2PT9A 2XLGA 3AXTA 3LL7A 4RYLA 2NXNA 2ZWVA 3E8SA 2XL9A 1DCTA 4MIKA 5FLHA 5EZQA 5GM1A 3E05A 4JXJA 3EEYA 1JSZA 4QXKA 1LKNA 3I59A 4KU8A 4RSRA 4EMSA 4OQEA 4QQKA 1JG4A 3EEOA 1R00A 4PIYA 4KL1A 3JWIA 1O3QA 2F4PA 5K0GA 1O9HA 1X1BA 2Y1XA 1BOOA 2PJDA 3EGVA 1XDZA 4L7VA 4PIZA 4R8HA 2K0GA 1INLA 3LBYA 3ME5A 3KR0A 1G60A 2NNWB 2MPFA 2I9KA 2HKXA 4PCAA 3HIFA 4GC5A 2IFTA 2NYUA 3FTCA 1M6YA 3KPYA 3FWEA 2AOTA 2O05A 3NWEA 1FXZA 2FPOA 1XE7A 1P1CA 1IPKA 4XF0A 1XRUA 4ATNA 2VPVA 3FUUA 1FP2A 3LA3A 4D7SA 4KU7A 1NW7A 2GC2A 2OZVA 3G2QA 3E6DA 4J1WA 4HLTA 4UXAA 2V74B 3GDHA 4FBFA 1PMIA 9MHTA 1TQ5A 1NW6A 4YV2A 1CAUB 3OZRA 3QACA 3OE5A 4HGYA 4ORFA 1RI2A 5DLYA 2IXHA 4RVFA 1Q5OA 4C07A 4OQDA 3LCVB 3BWYA 3TRKA 2WA2A 2OZ6A 4BIFA 5GINE 1O3RA 5FPXA 2B9UA 2E5WA 2IH5A 5CVJA 3LHDA 3P2KA 3PFGA 2B9EA 2QCSB 1NXMA 2ZULA 1ZRCA 1ZKDA 3T7TA 2ZTHA 3H9AA 3PX2A 3VC1A 4GULA 4X61A 2P35A 1R8YA 4YUZA 1XCJA 1CAWA 1I9GA 4V0RA 2H6BA 2R3SA 3OU6A 1YUBA 4RVGA 2HNKA 4YUVA 4FT2A 2ZCJA 4OA5A 3M4XA 3EO6A 4CXMA 1ORHA 4LWPA 4H7LA 2QRVB 2B3TA 4I09A 1YUDA 2HJIA 1PRYA 4AZSA 4HMZA 2VDVE 5FLIA 2JHAA 1NZCA 4EVIA 1RI4A 3FX3A 4H0NA 3LZZA 3JWHA 3DL3A 3WSTA 5CVRA 2O57A 1FP1D 4META 4YRDA 3FPJA 1L1EA 5LEKA 2QYOA 3GNLA 4I2OA 3CEWA 1NBIA 3KQSA 4E70A 1AQIA 3NJZA 3TKYA 3DUWA 4XF9A 4QX5A 5LQJA 3CJQA 3SSNA 2O06A 1ORIA 3GRUA 1EG2A 3FYCA 4Z2YA 1MJFA 3ES1A 1XE8A 3UKNA 4R8RA 4GQBA 4DMGA 2G70A 1XVAA 5BP7A 3MCTA 3BUSA 4CTJA 3D0JA 5EKUA 1CGPA 2XLFA 1P39A 3H3UA 3EMDA 4IV8A 4YYOA 3OU7A 2UYAA 2ZBQA 4FAHA 3UA3A 3I9FA 1WA4A 5GIOE 2C7RA 5JAXA 1EYBA 3OTFA 3HQXA 3KGZA 1NE4A 4HN0A 1QXRA 3D0SA 1KPHA 1Q0TA 1WY7A 4E2GA 4M37A 1WZNA 5DWQA 3ELYA 1CAXB 5BW4A 2JHCA 3LBFA 4RVHA 3PFHA 3P2EA 5HEKA 5JSPA 5LQNA 1OD5A 1D2CA 3RW9A 1GQGA 3V97A 4MZUA 3NVMB 3I53A 2BNOA 2KW5A 5FA5A 2ZSUA 1ZNPA 2ZIEA 4CKCA 2AN3A 2IC1A 4DKJA 3DLIA 3DLCA 3OZSA 3BU7A 3I59B 4P7GA 4XFFA 5DXJA 4XUDA 1RJFA 4Z82A 3ES4A 3G2OA 4IEQA 3RPQA 2FMYA 3HVIA 5ICFA 2XL7A 1YFJA 1NYWA 5LSAA 4LTAA 4EK9A 2H0VA 1L3IA 4QDKA 5J48A 1NBHA 4E30A 2EJTA 4P7JA 2AOVA 1I5ZA 5LQCA 2IBTA 2G8NA 4MQ4A 5HFJA 3RDIA 3KQTA 2Z2SB 3HCCA 3TPZA 1X8EA 2AOTB 5KHKA 3RYKA 3KR2A 4PINA 5K0LA 3QOPA 2P3OA 2OXTA 4I02A 3NW4A 4YV1A 2EG5A 3VSEA 1YF3A 3SMQA 1YFYA 3SMHA 2ZIFA 3EVEA 3Q7EA 2D5HA 3QOWA 2IXCA 4X6QB 1RJGA 3B3FA 2XLAA 3IWZA 2ZIGA 4BP1A 4RVDA 4AQ2A 3SR4A 3P9NA 3OF1A 5T64A 4AZVA 2A14A 5LQUA 3HT2A 3VHRA 3OD0A 2XVMA 2CAUA 7MHTA 3U81A 1RUNA 3LOIA 2IH4A 1KYWA 4GBED 3O31A 4ER7A 3SSOA 5CADA 2P7IA 4LLOA 4XFIA 1KIAA 3GWZA 2CKDA 3NJRA 5DTQA 2E9QA 5EEGA 4C06A 2JH9A 3M6VA 1R74A 2GAUA 5HI0A 2IBSA 2VS1A 2ET7A 1PJZA 4J1XA 2PTMA 4UBGA 1RI5A 5KS2A 2UYHA 1H1MA 4XF1A 3LECA 4ZU7A 1QAOA 4PWYA 3TM4A 5E9WA 1J3PA 1JG1A 3E5XA 1QAQA 3SM3A 1JR4A 4R6XA 3PTAA 1RC6A 3ROUA 3SGLA 3SVZA 4DA4A 2CMGA 3UJDA 5DRTA 2P3LA 4DCGA 4PYQA 3A26A 1Y8CA 3G5TA 4CYDA 2QRVA 1NT2A 5CVUA 4HC4A 4C05A 3CF6E 4KDRA 2ZZKA 2AZTA 4LECA 2VQAA 5HOQA 3IDBB 1MHTA 4LULA 4FAGA 4PIXA 4HVOA 2CAVA 1QXJA 2JHPA 2PLWA 2B25A 3QOXA 4XFAA 2PHDA 2VECA 1VLMA 3REOA 3EGEA 4ER0A 4MHTA 4N9HA 4A2UA 3ER9A 2D40A 2GU9A 3GRRA 1Y9QA 2PWYA 2PX2A 1ZVFA 4QDJA 3HVKA 5H02A 2FHPA 4QTUB 3KQQA 4KVZA 4IEPA 4XFBA 3RZZA 1TPYA 1ZGJA 4PIMA 5EKXA 3H7YA 1M0EA 3NMUF 2PX5A 2XVAA 4PYOA 4LA2A 1G8SA 3E6CC 3ELWA 4O9GA 4MH0E 1YFLA 3R3HA 1QY4A 3M6WA 1ZZ8A 4JTNA 2UY8A 1SUSA 1X1DA 4QVKA 4X60A 3H3ZA 2FK7A 1Q0SA 1O5UA 1EIZA 5LQKA 3EHKA 4F86A 4OA8A 1UCXA 3KQOA 3FUXA 4RX1A 3WW2A 2HMYB 1NV9A 1JQ3A 3HA5A 3GGDA 4OX9Y 2YUIA 3PX3A 2Q0AA 4U7PB 2G72A 3LCUA 2N7GA 4E2WA 4EKGA 4EWAA 2WA1A 4E2YA 2PYTA 4JTOA 5C1IA 4CTKA 4RTOA 4R8SA 2GZWA 4AXOA 3FHIB 4P7KA 2P8JA 3KQPA 4A6EA 4X6RB 3EVBA 3C3YA 2IXLA 5EOVA 4CKBA 4HZFA 5CUQA 1QANA 5LR6A 3K6RA 3NDIA 4OBWA 4AVCA 2H00A 2C7QA 3FTDA 2OYRA 4XUCA 3FPGA 3DOUA 2PX8A 3JWGA 3T7RA 1SG9A 5T6BA 5KHIA 5DX8A 5D1IA 1EJ6A 1M6EX 5HIKA 4RTJA 2QVSB 4QQNA 3DKWA 3OE4A 4DF3A 3C3PA 3G8BA 3R9XB 5FQOA 3LDGA 2GAFA 5BXYA 4FSXA 1HMYA 3JWJA 4G56A 1O3TA 2IP2A 4YUYA 4AVBA 4ZTBA 1JG2A 1BC5A 2GC1A 2CWWA 3H50A 4IERA 2ONZA 2AVDA 5BV6A 5DX0A 2IIPA 2I45A 1EJ0A 3P2IA 5FTWA 4NECA 4FZVA 2OY0A 3HNRA 3FRIA 1FJXA 3KPJA 2NP6A 4O29A 5JR3A 3FRHA 4ER6A 1YZ3A 5E1BA 4BH9A 1DGWA 4UBHA 1Z3CA 4LUKA 4KWLA 2VP3A 2QDRA 2K4MA 2NXJA 3PS9A 5F1RA 5P8WA 2XKOA 5DM1A 2CV6A 3UJAA 1KP9A 4PYNA 1RI1A 3BKXA 3K0BA 4Q0QA 4E2SA 5ICCA 3TKAA 4B29A 2HV9A 5K8VA 1H1DA 4FSDA 1RJDA 5EPEA 4RTSA 3CJRA 1EQAA 4K6MA 2BGCA 3UJCA 1X82A 2JJQA 3T0IA 1RUOA 2MHFA 1ZG3A 5C9ZA 1F3LA 3OZTA 1J3RA 3SCGA 5EGSA 4ZU4A 5E2BA 1GQHA 4BLUA 2H11A 2JG3A 1KR5A 3MAGA 3M70A 5C8WA 4P9GA 1VP6A 4PYKA 3C6MA 2BH2A 3P9IA 3DN7A 3EBRA 2GC3A 2QY6A 1UIRA 2R6ZA 4HSGA 4K8FA 4BYYA 4QGMA 2EVXA 2PAMA 4V0QA 4DQ0A 3E5QA 4KWCA 2C7OA 3M33A 3P9KA 3SCHA 4RWZA 4RTQA 3GXOA 3GRVA 4FT8A 5EMKA 1IPJA 4BP3A 5F2OA 3KR9A 1SQGA 2VDWA 1WXWA 4ER3A 3CJXA 1FI2A 2BM8A 2ETEA 3I5UA 3KMHA 3HEMA 4F85A 4FR0A 1WS6A 2PAEA 1UPIA 2IDJA 5HIJA 4JV4A 1EP0A 1XJ5A 2OBFA 3KSCA 1IM8A 1JUHA 5E1MA 3C3VA 1ZZCA 2PAKA 4EQZA 3NW9A 3OFKA 5FWAA 3E23A 1SEFA 1SFNA 2O8QA 4HSJA 4RTKA 2PVCA 5EIWA 4E33A 2AOUA 3GRYA 3GU3A 2G71A 5GWXA 3R24A 3CGGA 2ESRA 1QYRA 3BGDA 2ZW9A 3EPPA 5KQRA 4F84A 3V8VA 3ST7A 2ZFUA 5EG5A 5DSTA 4QM9A 3LDUA 4WXHA 1QAMA 1YB2A 1O7FA 1SVUA 2PY6A 3RYRA 3PB3A 5DTMA 5GM2A 5K05A 4KWKA 2HTEA 2XHKA 5KQSA 5EHGA 1J58A 2IH2A 3BXOA 3HVHA 1XCLA 3R6SA 3TQSA 3UFBA 3LPMA 4C4AA 3BGVA 2QM3A 3EQEA 1QWRA 1KYZA 3B89A 2GS9A 5KYGA 4Y30A 5DTRA 4Q0VA 2XGXA 3DR5A 2JH8A 3HTXA 4YARA 4IEVA 4MUVA 2VDUE 1JSXA 3SSMA 4CWAA 2ZVJA 4EROA 5LRSA 3H2BA 1NE6A 3ID6C 1RJEA 4HVQA 4AZWA 4Z07A 5I0SA 3EJKA 2P40A 2ZWAA 3NSTA 3ZDSA 1ZZ6A 5J3UA 3ERCA 1VQ1A 3AXSA 2VZ9A 2ATFA 1WGPA 1G38A 5E1DA 3SHRA 1D2HA 4E2QA 2I6GA 3FYDA 5JSRA 3KR1A 4BLWA 2XYQA 1CX4A 3KPWA 3I7DA 3T7SA 1CAVA 1L3CA 5T67A 2OA2A 3EVCA 1FBNA 3EVDA 5K8SA 4KWJA 2QE6A 2IPXA 2K9ZA 1X1CA 5I8TA 1N7IA 1X7NA 3MCZA 3OGJA 3KCCA 1AF7A 1ZZ7A 5JCTA 1NW3A 1TW2A 4XF4A 4D7TA 5ICEA 3M3IA 3I58A 2ERCA 2B5HA 2OB1A 3MTEA 5BW5A 5EFUA 4RV9A 5DPMA 4X63A 4XUEA 3SXWA 2PGXA 2B8MA 3GIWA 3CKKA 1N2XA 3ANXA 3KPUA 4EV0A 1YFUA 4C08A 4IESA 3O4FA 3OFJA 3UJ6A 4E32A 1ZRDA 2IXIA 3G7DA 1BKYA 1I4WA 2D5FA 2N47A 3FZGA 1N7JA 4DM3A 4X41A 3UBTA 3FPFA 3UJBA 4ZU5A 3QV2A 4IWNA 5FHRA 2XBMA 1DZTA 5BXXA 3USSA 3GRZA 5CVEA 2YTZA 4QVGA 2YXEA 5E8JA 3CBGA 1U2ZA 5FA8A 5I0TA 5G02A 4HTFB 3P71T 3IEIA 5IH3A 2P1DA 1EY2A 4MWZA 3KGLA 1QZZA 5I91A 3HCFA 4QPPA 1B42A 3X0DA 4MV2A 3OCJA 2Z6QA 3LA2A 5FDBA 4M7RA 4PYLA 2UYBA 3DULA 3HCEA 3BCWA 1O54A 3CCFA 3DH0A 3B3GA 1L3JA 5LRRA 2PXAA 1U12A 3E6BA 3LGAA 3M6UA 3G2PA 5ICGA 4OLLA 2GH2A 3FUVA 1NE2A 4YUXA 2PX4A 4HN1A 4I3PA 2ZKLA 3TOSA 4IEZA 1YWKA 2YVLA 3B3JA 3NL1A 2YR0A 1WLTA 4XCXA 3MYXA 3WW3A 2PHLA 3EMBA 2I7CA 2ZLBA 4CKEA 3DMGA 2PQQA 5E1OA 1RTVA 1XTPA 2XYRA 3Q87B 3PLQA 3FJSA 2AOUB 2OKCA 3PLAE 5K09A 1Q43A 8MHTA 2PKWA 4RTPA 1G8AA 1DUSA 4Q29A 4YMHA 2BR4A 1FT9A 3FE5A 4HVRA 1YZHA 4L11A 2ORED 5C6CA 1P91A 4WVZA 5D1HA 2OZJA 5KHHA 1UWVA 2GPYA 1DGRA 4KRGA 2P17A 3NWBA 5BPXA 1UFKA 2KXLA 4ISCA 3H7JA 5I0UA 4QM8A 3DMFA 1ZGAA 1OR8A 4PGGA 4R05A 2ONYA 5EMMA 4C03A 2NXEA 4HBNA 4ER5A
chains in the Genus database with same CATH superfamily
5DZSA 5KNBH 2NADA 2VYNA 3W1EA 4Q4CA 3A1VA 3K3NA 4RD1A 5JV5A 3EZ9A 3LA6A 4DA0A 4PHCA 4RR3B 3QF7A 4H6VA 1PFQA 1J84A 2QQFA 5JALA 1FU8A 2CXQA 2Q4SA 2H2GA 1TVKA 4BNDB 2MYNA 5IUJC 5ESDA 1HDRA 1MH9A 3MELA 1VBE3 2QYHA 3MTAA 5KJFA 1WKYA 5ENDA 5ABJC 5JDIC 3LUJA 1AGRA 3HCBA 1KDTA 3AXEA 3AFMA 3U7QB 4V0KA 3BWEA 5HQTA 4BTLA 8LDHA 1MJNA 5AM5A 3CC8A 1AMOA 3VC2A 1TJ4A 1SKMA 1Z5VA 3K16A 3RS3A 1SKUA 4MP8A 4R6WA 3ZYCA 5FFFA 4XFJA 1BXZA 4BOYA 1ZNQO 5FOVA 5B3LA 3CY6A 2C20A 1AR63 1KI6A 2VVFA 4IXTA 1ZZGA 3ZNPA 5F6LB 3BGSA 2QX4A 3WLOA 1OFTA 1JE1A 2AUMA 3RADC 2QRGA 4ESOA 3BRQA 1U63A 2GUWA 2XLBA 4N9WA 1CFZA 2G9VA 2WSBA 3OIDA 4M0FA 1UMHA 3WLUA 5DUVA 2EZ9A 3OGRA 4UW5A 4YWHA 4YJ3A 1AN9A 1W9SA 5C5EA 1AHHA 3DYIA 1Y3TA 1V11A 4PLTA 5TMEA 1R8XA 2OPKA 3W9BA 2F1KA 4PQFA 3HQ4O 5IAAA 5EJ9A 2WLPA 4GYJA 4EGSA 3MV11 3M6XA 5F2KA 1PJ4A 3L2YA 4MV5A 1PZ7A 3HDGA 2P6UA 1B09A 2ARXA 4B8WA 4R51A 2VVEA 1B93A 4PBSA 1L5GB 4QEZA 3SXUA 4RH1A 4D56A 4K3UA 1RDFA 1C9MA 4WEQA 3LO5A 1P9WA 1ZRRA 1TZOA 2OQ2A 3SEQA 4NCKA 4ZEMA 3MA0A 3K1TA 3TLGA 3UG7A 4QYTA 4R31A 1E96A 1RWOA 1HNNA 4WY5A 3KYCB 5DM2A 1U2GA 3X1JA 3TNPB 3GMIA 1H8TB 2FAXA 4OP3A 5MN6A 3OM8A 4Z9AA 4XDQA 4BZXA 2R1BA 4NATA 4H6XA 4A8JB 3A9VA 4AWBA 2L82A 3OQ1A 4D9CA 1SCBA 1E1NA 4HKLA 1L1RA 3LY5A 3SMVA 3MGKA 2JIZD 4F9TA 1XKQA 4ZYUA 2ZR8A 5HQJA 5DAXA 4KAXA 3OD4A 1QCYA 3IHKA 5I8YA 1Z6GA 4NHOA 4CDRA 4Y2GA 1ACLA 3QMWA 1UZMA 3OPWA 3O4RA 1Q16A 3ZKAA 4WCFB 1OH4A 5CXSA 4GZ6A 3OOJA 3GMSA 3PXAA 1KK3A 3PRHA 4GE0A 4P81A 2WI8A 4KQXA 4MO3M 2RDMA 5F37A 3DDOA 1L5HA 2PGAA 3DDHA 3EIXA 3JW8A 3WQ1A 5JI3E 4OYLA 3NKLA 4F83A 3HRIA 2VNVA 2O3RA 4AY6A 2BMVA 1C9JA 2YHSA 1E66A 4OM8A 4S2FA 2XOEA 2EJVA 4HH1A 2VOKA 3D6UA 3T3IA 3K70C 1RMU2 1ONNA 3I09A 3DWFA 1YS6A 3T3DA 3M6FA 2QRKA 2AMYA 4GBJA 1QZUA 2PX6A 3ADDA 4YGBA 1FVXA 1XYNA 1I33A 1M6HA 1U0AA 2P5TB 3VKFC 5KNCA 1GKIA 3JQCA 2IU3A 1NUUA 1OXKB 3D02A 3SNKA 1ABBA 1RJ7A 3FVWA 4DR6B 4HWKA 3CH6A 1NURA 2DUMA 3MJEA 1QQAA 5AC91 4WX2B 4YJ2B 3OEBA 4DQAA 1WSBA 3LTEA 4QPZA 4UJ3A 5I7VA 2GMMA 4MKFA 4OPMA 4XFDA 2IPMA 1KAGA 2Z2JA 4PLYA 3VTKA 4F6RA 4DJFC 1S8NA 1NVKA 4AI6A 4YJFA 1XZFA 2C5FA 3VTFA 4PR3A 3N9PA 3CO5A 3OX2A 3NIGB 4PGHA 4DIFA 3VPBA 2CLFB 1EX9A 1XYGA 3CPJB 5U4XA 3GLIA 2XUIA 2G9GA 3N9LA 2IUEA 3LQ1A 4QRHA 3RVBA 3ZGZA 3TN91 4TV8A 2EEZA 3DXXA 1Y8RA 4XURA 1R7RA 2AUTA 9ABPA 1A1VA 3OKCA 5L6MB 5KIAA 1ZRFA 2KLBA 2X42A 1SXJB 5AQEA 3ZXXA 5ALSA 2B78A 4CP9B 4L4RA 5HILA 3MJ4A 3BK2A 1FNMA 4C4ZA 2GCOA 1LDNA 2E7AA 4RJTA 3B1YA 3VC3A 1LPSA 2B6HA 3CPSA 4G0PA 3VDQA 1ODJA 1FA9A 1TJ5A 4YPVA 4LZWA 4LYHA 3WB0A 1COWD 2W68A 4UDXX 1YS4A 5A3JA 3O4JA 5EZYA 4IH4A 5F2SA 2A94A 1IJEA 1OI3A 4IE4A 1V70A 4ZO8A 3A7DA 3O7WA 4ZCLA 5TPWA 3I3SR 4OVEA 2IXKA 2AACA 3W8NA 2ZRBA 3OEEA 3DBVO 1Z15A 1ZJWA 4P4LA 3CKHA 2TNFA 1RC0A 2J3EA 2O59A 3M82A 5ALTA 4EKIA 2DFCA 3IXLA 2UXCB 3KV5A 4C5CA 3EQ2A 1PGPA 1ZQ9A 4LBNA 2LXNA 1PIV1 2JDHA 5T7BA 4F60A 4LWZA 3WF3A 2EFDB 2TYSB 5JI7A 3CIFA 2G19A 4LA3A 1R0CA 2R063 5K01A 3MJTA 5HZKA 2V65A 3WLFA 1FFHA 1V9U2 4M0DA 2QRUA 5FYCA 1R093 1GEGA 2VK4A 3TB0A 1ISHA 1CQXA 3EXG2 4X9XA 4RLHA 4Y6PA 1G63A 2FI1A 2XL9A 4HNVA 4KAAA 1DCTA 2HFJA 4ZT4A 5FLHA 1F8XA 5IBCA 3I9V1 1NXD1 3E7XA 1ACCA 1XCMA 4GKJB 3HO1A 5C4GB 5I47A 4KL1A 3KJQA 4DMKA 1X1BA 1E7QA 4BKOA 1U8CB 3DAGA 1AR72 4P0PB 3X2SA 3PGVA 1GU3A 2ZYTX 4I30A 2J08A 1KY2A 3FTCA 2EJWA 5G0VA 2VSFA 4L9BA 2PZ8A 5BWCA 3D6AA 2O48X 2KBEA 3WWCA 4J2TA 1IWBB 1REEA 5TRTA 5FBJA 4S04A 4DMCA 3UH0A 3WCSA 4F06A 1RC1A 4ZCQA 2VUSA 1BJQA 2PBLA 1TQ5A 2LDXA 1P7PA 4EG8A 4DQLA 2NZ2A 1ANKA 4I6JA 4EX6A 3VHPA 2Q6LA 3GDOA 1NX6A 1N77A 4OCTA 3BWYA 2RMU2 2E5WA 1JZ6A 2GUGA 3LHDA 3I3EA 1A9SA 1NGSA 3BBPA 4CG2A 5K2MA 3VBFA 2C98A 5FXMA 4K03A 3V48A 4Q0MA 4J1SA 3PNKA 4BMEA 4MQEA 3LBIA 3OGVA 1CAWA 4L0PA 3VVMA 2O0MA 2YC2C 1EUDA 4J4BA 2Q0SA 3M4XA 1W2GA 3IAS6 5JAQA 4DHWA 5LIPA 2YV4A 5A71A 3OBIA 4MWSA 3VVCA 2IYEA 4GUDA 4NHKA 4URHA 1XD2B 4LNUA 1OVSA 3U1XA 3RKSA 4NLLA 4BUJA 3SLRA 1WW6A 1S9HA 5CJJA 5BPFA 2A3YA 3FHQA 5A6YA 2BQPA 4MGKR 3GNLA 4XTPA 1Y0BA 1IEXA 1SMKA 3OQOA 3NJZA 1PLJA 1JSCA 3SSNA 2C26A 4TXHA 1O0BA 2FCUA 1PJQA 3OBRA 2UVDA 4KTTE 5CA0F 2ZI4A 5ALZA 2PK3A 5BVGB 4D79A 3N75A 3LW7A 3TRHA 1CSEE 4CU2A 1K75A 2ZTSA 4YDSA 4HOOA 1SOMA 1B6RA 5EIBD 1NY71 3U44B 3W78A 3K0AB 3TE7A 2WNUC 3E15A 2N0SA 2LALA 2G25A 1E2IA 1KI3A 1OFHA 4MRSA 2OBBA 4KMMA 1U1IA 1QCCA 3T3HA 5IVBA 4P3PA 3CTPA 4GSKA 2X7XA 4X00A 3YASA 3PNOA 2X5XA 2NZ9A 1OUSA 4ZI7F 1QFYA 1CF4A 1UOFA 1T5OA 2WFF2 2RHCA 3RW9A 4QU1A 4B73A 3HH8A 4AKHA 3WG1A 4FQZA 1W49A 1WMBA 4TSVA 1S0CA 1ZP6A 2BRTA 3HU2A 3V1YA 3KV4A 4XJXA 5A05A 5CH5A 2VRCA 1HX7A 2CE2X 2FMYA 1C3OA 3SM9A 4LTAA 3CE9A 4CN8A 4Y98A 3O90A 1AUOA 3FOCA 4U9HS 4IXDA 5B58C 1DBQA 2P37A 5FV4A 4RZQA 2Q5OA 1I5ZA 1LU2A 3IAFA 4LOSA 1U8UA 4CCMA 3NM6B 2A58A 4BIIA 4MVJE 1QH1A 5EV7A 5FI3A 1TEIA 3ODGA 4RIHA 2GCIA 2JVKA 2OXTA 1BMTA 4DCCA 5LMNB 3MO4A 3SYMA 3SMQA 2F3TA 4ZVMA 2P79A 1OROA 3SJBA 1IK6A 4CLOB 1PGL2 1EBUA 4XJUA 4RH3A 2CLSA 4PFKA 4OZOA 5IVIA 2WFLB 2WRAA 4MQ5A 3K5WA 4OREX 1RZVA 4WZAE 2ZOSA 3BXXA 3CF4G 3O1VA 3IRVA 1W581 1RYMA 3LCMA 4O3FA 5AI8A 3MF9A 1QBKC 2BAGA 1A9XB 5H70A 1U7DA 4J7CA 3HL0A 4Z8YA 4ZT2A 2NU8A 2BGLA 5WRFA 3DEJA 2DWPA 1GNRA 1BU5A 1UDWA 1OH6A 3L1HA 1OF1A 2JH9A 4RNCA 4UBGA 3JALA 1HF3A 4QUBA 4WECA 1E89A 1V7CA 1X0XA 5JLVA 1CQ9A 4PHTA 1M54A 2GMPA 3P9SA 1QB8A 3TTSA 1CJTC 1O5OA 1K9SA 1G7SA 4RXUA 5C8YF 2J6IA 3HEBA 4HUJA 3EPHA 2F2TA 1F7UA 4GIQA 1Z6XA 4LECA 1M5TA 4CF5A 1GARA 2PUHA 1P62B 5E6RB 2XVLA 1QHNA 4FQ4A 5JQGA 4AC9A 3NKVA 1KMCA 5K2OA 4I1UA 2LCIA 3CB4A 4IG4A 2FEAA 4XM0A 1C8BA 5A62A 5HJ5A 3QHQA 2ZE6A 3TQHA 4BFSA 3AI7A 4MV8A 2PMBA 4YW4A 3AR6A 3LJKA 3U4MA 5ALQA 3DDNA 3CR7A 3BCRA 5EVCA 1HXS1 3HBJA 2ORZA 4P83A 4WOBA 2O1SA 2FHPA 5F64A 3F73A 4FEGA 3AFHA 3FBGA 5F5XA 3M2TA 4YVFA 3RAPR 4BKMA 2AA3A 4MUBA 3GMTA 2JLZA 2X2EA 3EPLA 3ZK8A 5FLXA 1W2AX 3UOGA 3MLJA 4EH1A 1MOQA 3NBQA 2B6NA 2A6XA 1YGYA 1X1DA 2CNBA 5K3SA 4X60A 3H3ZA 1SXPA 1GGHA 2QZ9A 3LSYA 2EX0A 2X3FA 2KLHA 3ILFA 4ZAYA 2XGMA 2RJKA 2P5BA 1ONPA 1CZUA 4CG0A 3L4SO 4MYUA 5BPHA 2E4VA 3F71A 1HB1A 1ZBA3 3B9PA 2X6RA 2ZBDA 2XT9A 5FTMA 4L9WA 2GZHA 3CSSA 2P8JA 5FR3A 1CUFA 2C8LA 1N2JA 2Z2ZA 1L5NA 5LR6A 2RGGA 1AR93 3DOUA 4QBGB 2HYIC 3LNCA 1OX5A 1QIEA 2PHWA 1W6MB 1P45A 2EF1A 3BGWA 3UXMA 4GU5A 1Q6ZA 3I92A 1UAAA 1RZUA 2Y0CA 5C4IA 5CB4F 1N0HA 1WABA 2BEVB 5TNXA 3RK4A 4YGXB 4BKUA 2HADA 4G56A 1XI2A 1N1DA 4LMPA 2AG0A 2SBAA 3HCOA 3EEQA 4MARA 4LWQA 2AVDA 2WL1A 2IIPA 2I45A 1DDIA 5JCJA 4F3JA 2WHEA 3SZLA 5H16A 1YS7A 1KGSA 1G86A 1AXKA 4CE8A 3FPAA 4KBBA 2ADEA 4KWLA 3MLBA 3GGGA 3CX3A 3UJAA 2PPLA 4A0HA 3QEJA 2ARCA 3AL2A 1RACA 3D4LA 2OBNA 1RQLA 1F51E 2ZDQA 4Z0TA 4E4HA 3V8MA 3L6OO 4AYWA 4UTOA 5EN4A 1AL22 2M1XA 4Z4CA 5K0UC 2GKGA 1JDPA 2A0WA 1D1TA 2ATVA 1UYYA 1ZCBA 5EJFA 2MEV2 4Q4X1 3CLVA 2UVQA 1QHYA 2P78A 4GXTA 2KHZA 1PW7A 3LK6A 4GB31 3I6QA 1BOFA 4KCGA 1ENZA 2REQA 4GWMA 4U1RA 5AIBA 4FK8A 5E2IA 1IY8A 4MPTA 3WGTA 2AL7A 5K1ZA 4ZQIA 2JDMA 1X42A 1RZ3A 4TROA 1ZI8A 4B4RA 4MEAA 3R5HA 1JFFB 1Z45A 1WXWA 3D5TA 2OPWA 1I2DA 1CUXA 3OX4A 2JGEA 3AMMA 4S05A 3KMHA 4G0UA 4AN1A 3ZXSA 4TTJA 1EP0A 5JI2E 3LSEA 1IK4A 1DXYA 4O4HF 4BNLA 2B5OA 1MQTA 3C3VA 3BDAA 4AX4A 3X43A 1R0ZA 3KQKA 1SFNA 1PFGA 4E33A 2X1HA 4DLRA 2PZKA 3C4QA 3PUVA 4G9EA 3EPPA 4N7JA 5CB6A 2YXNA 3VUOA 4Z1MA 1M9NA 2IL1A 1E4VA 2H54A 5DSTA 2W6QA 4S1TA 1EUYA 3RQIA 1SVUA 3RS4A 1M0TA 2V03A 2F6BA 3T5TA 1KAHA 5THXA 3W58A 4K9RA 3RAFC 3QKRB 2A1UB 2GILA 5D86A 2OBYA 3JQ7A 4NCNA 1K97A 2HF7A 4B09A 3N2ZB 2PIAA 1JHUA 1V6LA 2Z79A 3I2IA 2J8ZA 2A0FA 1E2PA 2DZDA 1SIOA 1TGYA 3IQIX 4BGVA 4OQXA 1JGTA 4IEVA 4QIHA 4V1CI 3QM1A 1NR7A 3SVLA 1R083 4PC2A 3T8YA 1ZNXA 3AJ8A 3PDIA 4Z07A 1D6MA 5C7IO 4C6HA 4KTVE 3N3BC 1DTSA 3D6VA 1UU6A 4G24A 4IEEA 3G0IA 1T91A 1DJOA 2I33A 3C97A 4P9LA 4PNPA 1N2CB 3MYYA 4GOJA 2CUNA 2P9YA 2H85A 1ZYBA 3RT9A 1P8AA 4Q66C 3KHBA 1WNTA 5AO9A 1S9DA 4BDSA 1DKLA 3O1LA 4KBYA 3RQSA 3G7SA 2PSFA 1USVA 2VRBA 3FCSB 3WX0A 3SYLA 3VN4A 2O9JA 3AX6A 1H66A 5BW5A 5K4LA 4LO8A 3S5AA 4AP6A 2G82A 2J0VA 4KE8A 2OCAA 3T99A 2AG8A 3ONEA 4X63A 3RIGA 1QO0D 1KVTA 1XD9A 2OS2A 4F4JA 5CG9A 2VHUA 2VW1A 4PSUA 1XDBA 2I8AA 1ADFA 1M8KA 1WETA 1GTVA 1D2QA 1CUGA 1KMIY 4LOAA 4UVEA 3QTTA 4TN7A 3IAQA 2WYSA 1UMBB 2R8EA 5IANA 3H16A 2X9VA 2FPIB 5I7AA 1D4VB 3WR5A 4HTFB 1T9AA 3S3TA 1PZNA 1ZYUA 3THDA 3GI1A 3KZKA 3K92A 1E9CA 4U8HA 4QPPA 1A9QA 5G4LA 4MV2A 3WWDA 4H55A 4PBTA 5FUPA 5L9AA 4GL2A 3HCEA 2FMUA 3M6UA 3QGMA 1H6DA 3S6JA 2XA2A 2QQGA 1V0JA 5DHPA 4NRQA 2A4KA 2V7PA 3PKIA 4MW0A 2PX4A 4Q4Y1 3QNWA 5JE8A 2XHZA 4ND1A 4YMSA 1TPZA 3JQ9A 2W8BA 3F6PA 4ZVQA 2DURA 1XGKA 1Z2CA 4HGNA 5FL7D 2F8MA 2CXXA 4FMDF 3K7EA 3F7NA 4P3KA 4KG0A 4FSHA 1M8JA 4FYIA 3OH8A 2IUWA 4RAQA 5TC4A 1DUSA 4YFVA 1HY3A 3JRNA 1OLOA 2X9LA 4Q4V2 4AEDC 2VOEA 5CW2A 4F9EA 1O08A 5TE9A 4IHJA 3SITA 2V55B 5TS3A 2FN7A 3QUBA 4UCQA 3L8CA 3QE9Y 5J2UF 5AI4A 5EZSA 3V80A 4H1TA 2Z1NA 4JJ4A 1XE3A 1QK3A 1YDEA 1F4PA 3JZVA 4KO8A 1DEHA 4AE2A 1ZK3A 3FGOA 2XOXA 4FPXA 5CCXA 2EP8A 1M73E 4JLOA 3HBMA 1THGA 3WGIA 5GVRA 2GB4A 2G6TA 3D4NA 3BEOA 4TZ6A 2FN3A 1J2RA 2VQ6A 3INGA 4NP6A 4BQWA 2G3YA 3JYPA 3W9UA 1N5KA 4XF3A 2PUWA 1SOAA 4CMKA 1XQ1A 3UV3A 1CAVB 4JLDA 3GLRA 1W30A 4KIJA 1ZNYA 2OYCA 3OOSA 4BNJA 4A26A 4PDWA 2LGJA 5K0JA 2BNMA 1L9KA 3A1CA 2C96A 4WY8A 5ALJA 3C7CB 5BUVA 5EUQB 1EFVA 2BHSA 3RV3A 5I0DA 5JCZA 1N2EA 2BNNA 1X7XB 1LLFA 2GNDA 4M3CE 4YP9A 3O0XA 2IZ1A 3FFXA 1BMV1 2PLFA 3OQJA 3RCBA 3U6KA 3LZCA 2A67A 1U90A 4C1NA 5FPZA 1XCGB 4K8OA 1B2LA 1GM5A 3RSZA 2AXEA 2MSDB 2VDJA 1YNAA 3MT8A 2IYZA 4DUGA 4GIBA 2DT8A 2H1WA 2ZDGA 4RHV3 4YW5A 3EQ7A 1OA1A 3MW2A 3CRQA 2WF7A 3LD9A 5DHFA 3A6KA 4DJDC 4U02A 5FZ3A 4QT4A 4J49A 1AG9A 3HB9A 1JAHA 4XEZA 1CR6A 3LGRA 3NEPX 3NEYA 2AOWA 5FPYA 4UC0A 2X5OA 3I9OA 1MR5A 4GWGA 3KSAC 3BIJA 3E3NA 2R5NA 2CXPA 1RITA 3H9EO 1I94B 3I9JA 1S4CA 5KCMA 4Y0NA 5FZHA 4LTDA 1QJY2 2QP3A 1KSHA 3O3CA 3WLPA 4Q1EA 4OQZA 3A3PA 5FO9B 4PNEA 5JOZA 3T0AA 1NXOA 4MJLA 4DCMA 3UB4A 2Z95A 4WLNA 3NWOA 1Z0IA 4S35A 2CNKA 3N9NA 1BVUA 3PFBA 2NYRA 4HDNA 1FVHA 3X29B 1D03A 4FNOA 4Z86A 5GMOA 3WGVA 3DHWC 1LOEA 3KKOA 1H22A 4BWFB 1QDOA 4B81A 4QGBA 5BNTA 4QGNA 4LY6A 1LGBA 3AF5A 2A9KA 3FIJA 3U5TA 5CCBA 4WWHA 5FWDA 4WKBA 1SVLA 1YR3A 2IHJA 1HLDA 4E4ZA 3GUHA 2WKWA 2EXKA 2RGNC 3WK5A 4XGRA 1TLTA 4MGZE 1N78A 2VHTA 4MWOA 1KQ3A 1GFF2 2XDVA 1DBPA 1Z0KA 5DAPA 2ODNA 4GO1A 3C6ZA 3BD8A 1SBDA 3TCXB 5CJPA 5LWHA 1DWUA 3RVKA 1YBMA 4CZ2A 4KLCA 4NVPA 5BMVB 3DV0B 5C0OE 2WBKA 3DPRA 2X19A 3SPXA 5AVZA 3C4JA 2O3QA 3STYA 5FK7A 3TTXA 2FH5B 3R8FA 4MUHA 4BJ5A 5AVPA 4TMWA 4V0NA 4DINB 2ZTLA 1PQ4A 3U0VA 4Q4HA 5JR7B 4E46A 2C95A 2ID4A 3NHFA 4X54A 4YGCA 5KJCA 4NRPA 3NZEA 1AV6A 4IDCA 3GV0A 4YSFA 3N2EA 5FZAA 5C7YA 1EFRD 2WDBA 5HJ2A 4P14A 2WVGA 3Q0TA 2PZJA 1UZAA 2FMHA 1ATIA 5FTNA 2Q2NA 2NZUG 3RBVA 1G0NA 4B74A 3ELNA 4ARSA 3THWA 1FP4B 5FNVB 1K98A 3DECA 3EXEA 1Y4UA 3COZA 3ZGOA 2I4IA 4ARIA 1WEHA 3GYDA 4TTAA 1IJFA 2QRZA 1H3EA 1FXWA 3IE1A 1KH3A 4JZRA 1O3YA 1RUJ2 3OP1A 1NW4A 3ETNA 4NZZA 2FCAA 4DLPA 4CCCA 1WXHA 4URFA 5BQXA 3P9CA 4QPGC 2OR3A 2YYZA 2B99A 3HY4A 1OGIA 4UE6A 1CUJA 1JPJA 3LIHA 5BNIA 1JLKA 3DL2A 2OBMA 3C6BA 1MF7A 2I7DA 3CO2A 3VGPA 4F1JA 1TZCA 2LRPA 3WNMA 5IAJA 3O47A 3F1LA 4OQ9A 3AJDA 2OHJA 1PNFA 3ZIUA 3ZY5A 5H81A 3H9BA 3AHCA 3PVBB 4WK4B 3COJA 2G4LA 2P2KA 1DL5A 5UKDA 1Q6YA 4XIOA 2W4QA 1VE3A 4LE4A 2GCNA 3CU5A 3TLZA 10MHA 3IAUA 4R8KA 2HZ7A 4KU4A 1ZL2A 2MCFA 3E2PA 2UUCB 2JA1A 1O6BA 1CUDA 2X8LA 3ORHA 2AN9A 3EPKA 2QS9A 2XJQA 3GGPA 5EIXA 3MNFA 3CLTC 5CBLA 1RFLA 4XXPA 1GITA 1DLLA 4GH4B 3CVOA 1XRQA 1B23P 2ZIXB 3TFQA 2AE1A 3ZR6A 4DB5A 3OTHA 1W6UA 4YALA 1OT3A 1T9HA 3WP5A 3QLTA 1CUEA 3TNYA 4OHFA 4RA0A 2WO2A 2ADDA 2WU0A 4LJHA 3OWOA 1FRFS 5GLUA 4R52A 4Q19A 2HWKA 5LP6C 3E58A 3RJZA 3K2QA 1VLLA 1N5JA 3SQOA 1EGHA 2Y1LA 1XAHA 3LZDA 4ZAWA 1JS9A 2FQPA 1E8MA 2BYVE 3OAAA 2QQMA 4PTLA 4WERA 4UFOA 2EZ4A 2QGNA 2ODAA 1RUD1 4EMTA 3OLXA 3FNGA 1WTCA 2BPOA 1X1SA 3FJOA 5HFAA 3NTRA 3UW3A 3PUSA 2CTVA 5BQOA 4JYZA 3HZOA 2IXJA 2J5BA 5EERA 5B64A 5FPAA 3BB3A 2A7QA 4M21A 5EWMA 3F2ZA 3WF4A 1X0VA 3T34A 2ZGOA 1II9A 1VXOA 2NXNA 2FA9A 3EG9B 5C1BA 1ZISA 3ZY2A 5EHNA 5IK7A 3LO8A 2WT2A 2J9GA 4KU8A 1E2UA 7GPBA 2P8SA 1UXOA 5BW8A 4ZMBA 1KAEA 1WCQA 4XAQA 2AKEA 1MS3A 2H3EA 1YDGA 1RUG3 4FZJA 1MPTA 2PJZA 3DAFA 1UKCA 3JUUA 3SKJE 5IT9A 4LORA 4NPMA 1A95A 2XVXA 3ZFFB 3R4CA 6NULA 4OKIA 2AOTA 2ZB8A 4C43A 2HLNA 5CVCA 4B87A 1G41A 4E8DA 3RK0A 1QK5A 1E9VA 2H7XA 1GWMA 3VDXA 3LA3A 3T61A 1ZHOA 1H6CA 3E6DA 2V74B 4X8HA 3KCNA 5CCEA 4AF6A 3L1IA 3LD8A 1SU4A 1LRJA 1CT9A 3OZRA 1Z07A 2ORVA 1DRVA 1NVDA 5EJEA 2APJA 5FJIA 5I4CA 1FFSA 1OXBB 3DKVA 1ZBE2 3WMRA 4C07A 1NQUA 2LPMA 4UPVA 3WYGA 1O3RA 5FWYA 3WZMA 3FMPB 4KBZA 4RD6A 3LVQE 1H23A 1F2DA 2BJHA 3ZJUA 3RZKA 3OEAA 3GEEA 5J58A 4KMQA 1OBNA 4RHTA 1JLRA 2CDOA 5EKTA 4L16A 3O0WA 1E7WA 2HNKA 3GZNB 4MVJA 3N9MA 1HSZA 3OYWA 1D0HA 1OTXA 4OP1A 1AIPA 1RMQA 3U7GA 2GVNA 2WVJA 5K4AA 3OBTA 2Y1OA 3HV2A 1POQA 4P9IA 1RB8G 4JKOA 3DYMA 1A82A 3VJLA 3P0JA 3OEWA 3IPCA 5H8WA 3ZK9A 4IIFA 1JQKA 3FPJA 2JFPA 4W5NA 1Z7EA 3UWSA 3K4HA 1CTQA 1NBIA 4WZAA 2GPBA 1EGVB 1D7PM 5AVJA 5M3BA 4DS0A 1C9KA 3GDFA 1W8UA 5CXQA 1R15A 2LTAA 1RWKA 2QU7A 3GLQA 3LDBA 5H9QA 3L0DA 3ZVNA 4WJLA 4P3NA 1BVYF 3NC1C 4UNQA 4QOGA 3PT5A 3IVAA 1X7ZA 4CDUB 3EZFA 3FG9A 1J49A 2VDPB 2ZJ5A 4F21A 4P9JA 1UAGA 3ES9A 1U2EA 3BA1A 3CZCA 1Z37A 3ZOIA 3R5KA 3SHTA 4ZVRA 2B61A 2Q50A 5C46F 4NWVA 2CXHA 2NIPA 3VDDA 2VI5A 1DOHA 3ZWOA 4M2LA 4MDYA 1WEKA 3S5QA 1YNOA 2DTDA 5AQ1A 2YJGA 3H19A 4JR2A 3LBFA 3P2EA 3I6YA 3VKGA 1D5CA 2JFVA 3NVMB 3IDOA 5J1SB 5DW3A 4JCKA 2JRLA 3O95A 1T5LA 3CONA 4IJKA 1MU0A 3DLCA 4J4HA 3SZ3A 4UUMA 3E6AA 1KYYA 2ZB3A 3BZUA 5F2EA 5BVHA 4YGEA 5FPLA 1NG0A 1RWXA 5J48A 2P67A 4GICA 3CRMA 4Q3LA 3C5EA 1JXNA 3T15A 4DDTA 4F91B 3EUWA 1JVBA 2R84A 4ZYXA 1SVWA 2WJAA 3VBUC 1C9EA 1GP2A 4CNBA 1XZAA 2P3OA 3Q98A 3C7KA 3H4IA 4PPYA 1N75A 2JDIA 4HR7A 2C29D 4QO7A 3WXMA 3IT3A 3STXA 3AEUA 2HEGA 3I2DA 2UAGA 3S7ZA 1Q22A 2C57A 2GZDA 1VG0B 1RSZA 5FEUA 4LIUA 4PBPA 4RGYA 2GF9A 4MGIR 1GQPA 2O8DB 3IWZA 5CB0A 3AKYA 4FDVA 3QE3A 1HG0A 3WAKA 2DFPA 5CLFA 5F35A 1AF4A 1CRPA 2R9VA 3ROMA 7MHTA 5D3ZA 4GBED 3O31A 2BP7B 1KF0A 4FYPA 2FBEA 2VXCA 2CWDA 2H1CA 4J91A 4B40A 2BKAA 1IJBA 4JGBA 3SQLA 4RETA 3MJSA 2ZIZA 1T4BA 3USUA 4OG2A 1LENA 4Q4JA 4NYMR 1OH3A 3P0IA 1HRV1 5E9WA 1JG1A 3C43A 1V6IA 3JPWA 3SGLA 1A6CA 3FM9A 1OBOA 4TXJA 4JHTA 1EH5A 4D0QA 3M1IA 1CY4A 1A88A 4OM7A 4FO9A 1NT2A 3BIWE 3EMKA 2VE1A 4ZXKA 3CF6E 5HOQA 1ADGA 1T6YA 2WNEA 1AHSA 1BFDA 2CAVA 3TUIC 1A9PA 1DCMA 3H84A 4TT8A 5DUXA 4H1WA 1YU9A 1NI3A 3ETGA 3RGBA 4HAYA 3KZOA 4JR0A 2GU9A 1P4RA 3ACDA 1WB6A 4YVWC 3AI3A 3AVWA 3FNIA 1ZOOA 1L4YA 3DVAA 1KRWA 2ZPUA 2C0CA 1NM5C 4ACAA 1AKNA 2HWD3 2YN0A 5L7WA 4ZIRB 3TLKA 4ETIA 5T55A 1AV7A 4O9GA 2XMLA 1EK1A 3ZG6A 1R0YA 4N12A 1R5NA 3KKKA 3RVOA 1O2DA 2H4ZA 4XHBA 4NYIQ 5KOHB 1PVC1 2XADA 3HS3A 5M2QA 3NR2A 4H2AA 4ARAA 4EI8A 3D5QA 3K31A 2ZE8A 4UNSA 3K2BA 4F86A 1QC5B 1J8QA 2A70A 3ZQJA 4W99A 1EFTA 4QX0A 4FFPA 1S0GA 2AK2A 4I55B 2DCMA 1DC7A 5F3CA 4CKCB 4TV9F 3QX7A 2FN8A 3CX6A 3H2SA 4AEKA 4R8SA 1U7WA 4D3SA 4P7KA 1Q95A 5M29A 2DPGA 4ZVVA 1RJ9B 2FWNA 2PS3A 1OQDA 4OBWA 3DCQA 2WNSA 4ZREA 4WM8C 4LF7B 1NOJA 3L84A 5FPHA 3R7WB 1EK6A 1L8XA 2PTGA 3LGSA 1EFHA 1XC7A 1QYVA 2V3VA 2P6HA 2O8NA 4L4ZA 4QQNA 1ZIOA 1FL9A 2ZK7A 4DF3A 2PMWB 4Q3KA 1DAEA 4KRXA 1G9CA 1J0AA 3I3QA 3KLBA 4OK6A 5FZMA 4I81A 4UBJA 2C4HA 2K2WA 3TQIA 1K63A 3MK31 1DDOA 3KTOA 2K2SA 3RRBA 1C50A 1MENA 1EDEA 4DY5A 2BM0A 5GGYA 3K53A 5CNKA 4ZN6A 1NQJA 2NP6A 1D2NA 3T3EA 2R6GA 1DKPA 5I8PA 5CD9A 2HHAA 3FWYA 3IMEA 1RTTA 2AUNA 4A0SA 1MACA 4LUKA 4ZK6A 1H9WA 4L27A 1KIFA 4KI0A 4I50F 3LX4A 4NHEA 4EUNA 1KQNA 3K2IA 1MVOA 5ICCA 2YJNA 1QLWA 1KOGA 1WB5A 4U3JB 4IMJB 2F1OA 2ZRFA 2QUOA 4GH5A 3ENNA 1WV1A 4O4LF 3VDMA 5K9YA 1E8DA 4JKYA 3KDSE 3OJLA 1EQAA 4JX8A 4K8RB 2OXIA 1ZD8A 1I0IA 3O3NB 4DLSA 4L72A 1VRBA 1SQ6A 1OFUX 4D57A 1NTOA 3ND7A 2EBFX 5LC1A 3AONB 1IB0A 3QFRA 2IEYA 2C5DA 1KR5A 3WWZA 3CNOA 3V3KA 3S1SA 2BH2A 2OM6A 4LF6B 4YRBA 1J8YF 4MGHA 2FB9A 4BBPA 3EBRA 3NUQA 4BS9A 4XA8A 3B6ZA 4YMVA 2Y60A 3E5QA 1GAJA 4ZAGA 2ZQYA 4YCCA 1WL8A 4MUGA 3HNBM 1XIVA 1JDZA 1DE0A 2E37A 5JO0A 5CG8A 4P5DA 1RBMA 2ETEA 1AJKA 3LT0A 4C4OA 4F85A 4RGGA 4QXBA 2B5VA 4X85A 3KQHA 3RWKX 3UPDA 1W9MA 1NLYA 3WKEA 1W8WA 2GJSA 4AJPA 1RCUA 1LOFC 4NV3A 4JKLA 5C7OO 5LVAA 4YEDA 4ZK2A 1DWOA 5HIAA 4FDLA 4EELA 2ZW9A 3JQ6A 1KS5A 3BDVA 3WBKA 4AN4A 4KPUB 1PZFA 5CFNA 1YIFA 3UWKA 4IV1A 4TUYF 1A4UA 4QOSA 5LZ7A 1OAKA 4L4SA 1T8RA 5DTMA 5GM2A 3GA0A 3Q10A 4LDAA 2HPAA 3INNA 2DRIA 4BV3A 3PSHA 2XHKA 2OCXA 5DHTA 1SA0B 4BKRA 2ZBFA 2W83A 3RHZA 5F5AA 3OPYA 1DIBA 4GI7A 5BN4A 4AG3A 4P08A 2WZR1 1RCFA 3VKLA 3IAPA 1TIPA 1KYZA 2V54A 3VDBA 1RRFA 4Y30A 2AR7A 4K9NA 3LPDA 3LG2A 2JH8A 1TAUA 4J0DA 4C5BA 1R4MB 4IKOA 4ZYTA 1J1ZA 2NZYA 3QU2A 2IYSA 3HSSA 4CEIA 1F9AA 2BGMA 4DMMA 1I3NA 3NAZA 3V9AA 3HB7A 3ABIA 4UW3A 4F1WA 2NW6A 1RRMA 3LE8A 1RUE1 3VBEA 4OX9B 1YVDA 1HN0A 1L7RA 2O1XA 4FMCB 2VSQA 4K2HA 3GAZA 4DV0B 1NYRA 4IZ6A 2O2DA 2XUOA 1XDWA 2RKWA 3PZRA 2O19A 4CUBA 1Q8SA 1VE6A 5FLEX 3EVCA 4IDZA 1XXNA 1C7IA 3LRTA 5LYJF 2WQZA 2OCDA 1P0MA 3WK6A 2IXDA 1JAIA 1P75A 2QJTA 2SCUA 3FDXA 2BMAA 4OXIA 3K3OA 3I58A 3MTEA 4HFRA 2Q1YA 3BH7A 5KOYA 2MSWA 2Q1SA 2XZPA 3EFHA 1Z2DA 3UUGA 3H1GA 4A6XA 5SZKB 5LOVA 2Q3JA 2H4HA 2QEQA 1U1FA 2IXIA 3UHOA 3OLWA 3CISA 5B6PA 4KQ7A 3QV2A 4UASA 4KRYA 2XBMA 1F4VA 1Z0DA 5T3UA 4IKEA 3D0KA 3C3WA 4S1PA 3S2ZA 2X10A 1IS6A 2WSSA 1VMAA 3WOVA 4ZV7A 3DMTC 3QVGB 2QAGA 4FPHA 4UU1A 2VYVD 3V4PB 2OLEA 5JOWA 1JIXA 3H2YA 2RBGA 4J6GA 3FCYA 3OA0A 1NLRA 4EYQA 2VT2A 4YYZA 1NA5A 2VO1A 1XZDA 3A0RB 1GNZA 3N36A 3FF1A 3IQWA 1JIUA 3KHTA 1YKFA 1C9YA 4ZJZA 4ZZ0A 3PFNA 3E61A 1XTBA 2WNVB 4X1YB 1CQJB 4IQGA 2B1QA 1KEEB 4XD7A 2GNAA 5DG2A 1K8RA 1T3LA 1HL7A 1YWKA 2PN1A 4DSUA 1U9CA 2EAKA 3W7AA 2G76A 3I23A 2H92A 3DW1X 1H2AS 4BQ2A 1UBLS 1J0BA 4MMYB 2Y6HA 8AT1A 4D3YA 1FNZA 1JEYB 4DDMA 4M3CA 2Y93A 1G8AA 3NHRA 1TME1 4PO9A 1KORA 2D3PA 3AF3A 3AEQB 3GBVA 4F46A 1E9AA 1HV8A 3SAJA 4BV8A 3ZXLA 1MEEA 4EJ0A 1DLJA 1WMEA 2XOMA 4YO8A 4PZZA 3OZGA 4TN5A 4Z54A 4LBWA 4IR7A 5KTRA 5I0UA 4JJ6A 1U3UA 3K0HA 4DV5B 2PS0A 3FWPA 3IDCB 4G0OA 1BKDR 1GKUB 1N9GA 3A4IA 2E5FA 1COZA 3WCRA 2BLNA 5JAZA 3COWA 1JG3A 2JLAA 2EF6A 1B76A 5FOUA 2PRKA 2PUAA 4B8EA 4BV2A 1UJ6A 1UPAA 1CESA 5LD2C 5FD8A 4Z0PA 3GBWA 1J7JA 2DJIA 2FEOA 4JLUA 3UKDA 2ZSHA 1JOPA 3FKSA 1TE1B 2YNMA 5C2JB 2XDQB 5JZGC 2JENA 2Z8ZA 3HPRA 3GEDA 1WDMA 2VDQB 3QF4A 1TE2A 4E21A 5E8RA 4X64B 1DU3D 4TM8A 4ZHNA 3TXXA 3RARA 4RTRA 2ZWMA 5ITZB 2R4TA 2WWXA 1K89A 2VPQA 2HSJA 2GBPA 3PQ8A 4WIAA 2ZU6A 4XFCA 1QH6A 2ZMKA 1GNVA 1UW8A 4PLNA 5IK5A 4GPZA 5CW1A 3CUVA 4FFMA 4N43A 1OXXK 1L1FA 3AVQA 1GA4A 3TJZA 1TM7E 3D1JA 4LNVA 3ZD8A 1GZDA 3RYPA 3GBGA 1OMIA 3JVIA 5GOZA 4N48A 3A10A 3E2MA 1E8NA 2C4TA 1VZ3A 2UZ4A 3R3WA 3EDCA 4WUTA 2I54A 3AB3A 3HM9A 3DEAA 3AMNA 1EJBA 4RABA 3TVDA 1WKVA 4ARZA 2V0GA 3FDFA 1M75A 2IX3A 2BV4A 3E3AA 1G55A 4IJWA 5EQTA 1E6KA 3L8DA 1HEYA 3BGIA 4I8DA 3GUZA 4ASLA 4RXMA 1OIVA 3JAMA 2ZBEA 1ISMA 4F5YA 1PS9A 5DSXA 2V09A 4W9NC 5E2AA 3LZ6A 2OILA 2BFAA 4Q0UA 4QFDA 3DCJA 4HX9A 2UY9A 2W1WA 2QVBA 5LDHA 2QLNA 4WVMB 3MBWA 2AQ8A 1RXYA 4CM1A 3V1UA 3STHA 2H63A 4CFSA 4RKEA 2WHYA 1I2MA 1TIKA 4DLKA 4HKWA 1GNYA 3THYA 5KOJA 5HUQA 1WOMA 2VQFB 1GIAA 2Z43A 3IMGA 1PUIA 2CLHB 1A3KA 2Q1FA 1TD1A 1SKBA 3VU0A 2PAFA 1IS4A 3ZM8A 3FSEA 4C0SA 4RIIA 5F23A 3HA3A 2VK1A 4KREA 4I46A 2H65A 4UEKA 3UGGA 5E9QA 1C2TA 4ENUA 3UJQA 4RD7A 3LAGA 1QLHA 2OO3A 3WGOA 3GD7A 4HN9A 2NZXA 3HKDB 2QX7A 1CYDA 2HEYF 1SC6A 2NM0A 3ACGA 4KH0A 3R9KA 1ND3A 3ZHUA 1WW5A 1L8AA 3J81A 2UWAA 1JG6A 2R6R1 2QG4A 1UKRA 4IVQA 1U8AA 3ESRA 3UMJA 3WOGA 1JEOA 4AQDA 1Y42X 2A5FA 1OYVA 2W2IA 3ET5A 3WQ0A 2J3LA 3U3OA 4LG1A 5E7MA 3ER6A 3IURA 3LW8A 2C4UA 4OXRA 2VZRA 2YQ4A 3ZW8A 1YA6A 3RHSA 2Q62A 4AHYA 1SHWB 4KR6A 5LBIA 3IIMA 1FYUA 1FRQA 4M87A 3CBNA 2QPOA 5GLZA 1F2UA 3O8RA 3BT7A 2FUCA 3WNCA 1RUH1 3EEBA 5FPPA 5KQMA 1P2GA 3POGA 1W48A 3AV3A 4A0QA 1IN1A 1N8KA 5HKKD 3WHLA 3ZH9B 4XR4A 4HQFA 4WBNF 1FATA 1D09A 1QPBA 4MW6A 4MRPA 2YIJA 3DDSA 2PRYA 3H6GA 5K4HA 4QU5A 3NOQA 3VZKA 1HFKA 1XJQA 2VMEA 4EN0A 2GZRA 2YMMA 2FRXA 5FREA 1C1DB 4G89A 1AY0A 5IEBA 1QJZA 2QYTA 3B01A 5JPDA 1E9FA 1ZJ4A 3EZ7A 3G02A 2CSUA 3VUEA 5AYVA 1U31A 1G6Q1 4JC0A 3X1YA 4RS5C 5A3RA 2QVCA 3EGXB 3WQRA 1H2MA 1WVMA 1R3DA 4MA5A 4C0HA 2EERA 3UMRA 1WOYA 4GPTA 5ETJA 4TXLA 3D2BA 1FOD3 2A0KA 4KKVA 3P27A 5FZGA 5JC8A 2IHTA 4JUAA 3O91A 2E32A 1E69A 3A1DA 1TMF3 3ILVA 4RMIA 1I6KA 1XLVA 2BLLA 3ETDA 1FDSA 1UKVY 2HWF3 2I62A 3ZY6A 4EJSA 1W6PB 2ZITA 4G67A 5FLJA 3RZMA 4BQ4A 4GP6A 3JQBC 4EB6A 1X1AA 4C2UA 2EHDA 4BQIA 3H1EA 1PDVA 2I3GA 1DADA 3GJ8A 4FNGA 2Q2VA 3V4OA 1MD9A 1P74A 3G8DA 1SUDA 5LM3A 3G6KA 3F4LA 3SYKA 3FMFA 3ZKWA 1QGYA 2W6NA 4DKXA 2XNSA 2CL5A 5C35A 1NW5A 2VJXA 1BU8A 3R2JA 3E9MA 3EDOA 1XMXA 3GRFA 4AY5A 4D8MA 3LBAA 1HB2A 4MI9A 1R5OA 3CURA 1H85A 3O1JC 2D6MA 3IILA 3DV8A 1KYVA 3ELUA 2XAUA 2CMFA 4GOKA 1AMUA 3VBRC 4ND8A 2IWRA 2LE0A 3GLHB 1YZVA 1AM4D 3UZUA 5E4TA 3FUWA 4CXYA 2QI9C 1DX9A 2AWNA 3SFTA 1PU2A 3MGUA 3DKRA 4ROSA 3P26A 3AUKA 3OUJA 3KYJB 1AR82 1U0SY 4R3UC 4EVSA 5D85A 1NVBA 1Z0SA 1KZYC 3LQCA 3R5JA 5H4HA 5C9AB 4DR4B 1U2PA 3OQPA 1VA5A 2HWB1 4D0NA 1Q56A 1UBNA 3WF0A 1NP6A 2MDTA 4WY2A 4LK2A 4NFSA 2VNOA 2ZCWA 4NULA 3VYWA 4S1VA 5CT9A 4NBUA 1KO5A 4YMLA 2O8VA 5EY5B 2BOVA 1SHKA 2ZSJA 1GA6A 1XNHA 4EPWA 1I80A 1E4EA 1O97C 1D6SA 3E05A 4FOPA 4MV6A 4I9NA 2PO5A 4OXNA 4UHEA 4OCZA 1CC1S 2UWCA 1Z6PA 5IT6A 4KX5A 3WHUA 5JDCC 1PX3A 1BOOA 3VBSA 1INLA 3LBYA 3D6TB 2ZQ5A 2B8TA 4IJ6A 4JI8B 2SKDA 4PCAA 3WMGA 1FUEA 2V8OA 1XN1A 1Z7GA 2G06A 4AG4A 3A1SA 4GYYA 3K0KA 1ACJA 3WBJA 1W05A 4AFAA 1D04A 3GG9A 3WAJA 2HNAA 1TM2A 2QQOA 1XRUA 3WK7A 2QN2A 5EPAA 1QFJA 3CSDA 3MEQA 1HDKA 1Z5GA 3QIVA 3NHWA 4ZQFA 1XQXA 1SAYA 3I45A 5L7OB 4WCVA 5IT5A 2LM3A 2D6LX 3CV3A 1VCIA 2WAXA 3T2QA 4K81B 3L3BA 1UO9A 4CDXB 4HK4A 3GEBA 5K3AA 4RZXA 2XRMA 3WX5A 3K8QA 2I4LA 3R3SA 3DLAA 2BMJA 1E0AA 1KC1A 1VKNA 3IVGA 1O95D 5CVJA 7REQA 3T9FA 3P2KA 1JA0A 2D8AA 3NDBB 3N0TA 3HU3A 1RRKA 1E99A 2QKYA 1HR0B 1B16A 2IE8A 4RKWA 3H9AA 1Y5RA 4RADA 4UDYX 2P35A 3U26A 3ND5A 4JGZA 4FFLA 1VIMA 3IMFA 1FSPA 2WE8A 3PWSA 1XHFA 3WGLA 3STUA 2ZABA 3U61B 1OAOC 2HJIA 1LBQA 5FZFA 4QE3A 4IE7A 3SR3A 5JHHB 1JBKA 1NZCA 2XNDD 1G8WA 4X1KA 3OIFA 1K4KA 4I3HA 1C4XA 4Y2PA 3N59A 5HA5A 4EATA 3L0ZA 3UK9A 3IO3A 3VZPA 5L3RA 4I2OA 4DCJA 1LPBB 2D8MA 1T8UA 4CEHB 3IGFA 3C2UA 2O14A 3QJGA 5LQJA 2OD9A 3PNLA 5I9LA 5DYWA 1ORIA 1GVNB 5IVDA 1YVEI 1NSYA 1T4CA 3SICE 4EW6A 3MCTA 2MINB 3VKWA 4Q9KA 3WL8A 4HX5A 4MRVA 1HDGO 1CEYA 1P39A 1P5HA 1E5VA 2H0AA 1TIBA 3LUAA 5T5QA 5KVSA 4RFT0 1UWWA 1WXQA 4QGGA 1LJLA 3K8OE 3TNJA 3RSHA 1DTWB 1YJAA 2RCNA 2PSHA 2YIDA 2HIGA 1UKAA 1QXRA 4G8JA 3S70A 3AB8A 2R6FA 1NVGA 3RD5A 4RD4A 3QX8A 4CM9A 5HS4A 4E0BA 5C3MA 4MVJP 3VISA 1OREA 3BIWA 1ZUNB 4HZGA 1GLNA 1R1A2 5LQNA 1UK6A 1M2WA 1TI7A 1LRKA 3DYPA 3KELA 3ZQUA 5ALKA 2W70A 1MOSA 2BFFB 1U3FA 3B1ZA 4AKSA 4B3JA 2PBRA 2YOHA 1I6MA 2VC9A 2COEA 4MS1A 3WWPA 1CJVC 1A7UA 5M04A 3NLLA 2R16A 4C21A 5A5FA 4MV7A 5KSPA 1DXQA 2W6JA 4TMKA 4EG7A 4ZCRA 2EJTA 4JLVA 2G8NA 2JANA 4P2GA 1P7VA 1SZJG 1MQSA 3RDPA 3TWIA 3K0FA 3TPZA 5H9PA 4NCXA 4O33A 3SI7A 1KITA 7ABPA 4RQTA 5DBEX 1DXOA 2QFEA 3OUZA 2PUJA 3QH7A 5JSHA 3PXDA 3QELA 4EYUA 1QU0A 4GZ5A 1RQNA 2H06A 3QOWA 16PKA 3D9QX 1ISJA 2LROA 3BF7A 1PLLA 1ZEMA 1VPDA 1ZK2A 3B3FA 1X87A 3NM4A 3CWQA 3VBOB 3AR3A 2C94A 3VVLA 3TS1A 3V7WA 5T64A 5EJ2A 4G0QA 1CY0A 2W6ZA 3WYCA 1L7LA 3ORRA 3WNDA 4QM6A 1DJPA 5GZGA 1NJ8A 1G59A 3LY9A 4L2IA 1LFAA 1IHPA 2B8JA 4BE9A 3N9IA 2XEDA 1DC3A 2Q5IA 1JSLA 3IBYA 3SSOA 1XMVA 4AULA 3PIIA 3JYQA 5D3MA 4M88A 2I7VA 4IIJB 2PQ6A 5T3YA 1EP3B 2GAUA 4NBTA 3H3JA 4RW0A 1KYTA 1XQ6A 4CEJB 2OCLA 1IN5A 3DBRB 4FIZA 4XQWA 3LECA 5HQ3B 2H4YA 2RGXA 2ODBA 1C4WA 3E5XA 1MZFA 1CUAA 5KTTA 3LKJA 3W5IA 3PTAA 1C4KA 4FSJA 1ZAKA 3VD4A 4MLCA 1V5WA 3T12A 3EYPA 2ZZKA 4RVUA 1E60A 5JTTA 2HRRA 2DHQA 4U2KA 2ZGTA 5CB7A 4LULA 4J0KA 5B7QA 3L8YA 4PG6A 4Q21A 2QJRA 4J0GA 3THPA 5K3BA 2B0JA 1A50B 3W7VA 1JDVA 5LFAA 4A2UA 3DTVA 4WAUA 2JBWA 1X8KA 4MUYA 4KNWA 2I1QA 4MYSA 5AC93 2QZPA 4IEPA 3EQ6A 3TI9A 1GN9A 1BQEA 1VKOA 4PYOA 1VG1A 1YAJA 1DIHA 5F39A 3C3AA 2MJLA 4CM5A 1B4DA 1UOPA 5CNJA 4QPJC 1VLHA 1DT5A 1ZJYA 4DUPA 3M6WA 5SYAA 3U75A 3BMNB 1JWLA 3DGEC 1Q7EA 4YA6A 4QPIC 3S29A 1OLRA 1UK9A 4X94A 2D97A 1T2EA 4BO2A 2JFZA 3KQOA 4LPKA 4FMPA 1FFYA 3KYBA 4G2TA 4Z6KA 1YE5A 2ZTMA 1HRI2 4WD3A 2HRCA 2XR4A 3OI7A 2R11A 3GEIA 4J0HA 4ITUA 3B6IA 1VDZA 4F7WA 3CEAA 4W4ZA 4CV2A 4A15A 1RKBA 3AETA 5FP9A 1B8OA 3FWZA 5EYYA 5KOIA 3QX9A 2FZKA 3H5IA 3UV6A 5BV7A 5KHIA 4G01B 1RWPA 1OF3A 3POEA 1M6EX 1GPWB 3N7UA 5EP4A 3DMDA 2BKEA 3GGLA 3GHMA 3UUFA 4HH0A 1WQ3A 2ZRNA 1UMDA 1YXMA 5CFDA 3V5NA 3ROKA 2DBZA 3CNHA 4EY7A 3LDGA 1HMYA 3ZC3A 1YQ6A 4UPDA 1IZZA 3ZWAA 4EL5A 1QHSA 3H11A 1YB4A 3PEFA 2D0PB 4WTOA 2Y2UA 3OB8A 4CL2A 4IE0A 1JAZA 1DXHA 2IYQA 1TMKA 3UH1A 3C87A 1LBTA 2OY0A 4FHDA 1WBBA 1XCBA 3TEMA 5BN5A 2FWIA 2P3IA 4GQ7A 3QLUC 4URZR 2UV8A 1SBTA 5HX7A 1SG3A 2HF2A 4ID3A 4XJ8A 3JR3A 4UCXA 1APBA 1NN0A 3W5NA 1PIV3 3V4ZA 2J1VA 1CHNA 1M1ZA 3SQMA 2E6VA 1JIKA 3IQEA 2C5EA 3VOTA 4YLZA 1N5OX 1U8EA 1HXHA 3IAS1 5F5QA 3H8WA 4FX5A 2C7GA 2Y92A 2W2LA 3BFKA 5ARBA 3T3GA 2QUBA 2KMLA 1IN6A 1YJBA 5CKNA 1J3RA 1BX0A 1SRQA 1XJWA 2BDEA 3L7MA 3CEJA 1P7ZA 1JFVA 3G8YA 2OSBA 3MAGA 1IWPB 4B2PA 2PFGA 4ITVA 1SXQA 2VPTA 3N2KB 3DN7A 1R0XA 3DD1A 4WXMA 3K2OA 2QSJA 3Q8EA 2FHSA 3ND8A 3MRXA 4DBVO 3REQA 2A9FA 2V1UA 3AUSA 4KWCA 4BEBA 3HKBB 4QELA 5D5QA 4YVSB 2UYGA 3LC1O 5F2OA 2IV2X 2F6RA 2HCFA 4F38A 4KB5A 4HPKB 1XEXA 1DGQA 3DT8A 3CLRC 3II6X 1U1DA 4YJ2F 5JU6A 3ZGVA 4EBFA 3S4YA 4H60A 4CUZA 2PHXA 3MT0A 1CN1A 2WWWA 1YKGA 4PPGA 1JUHA 1V8OA 1M1YB 2PUFA 3FZQA 3WMWA 3WXBA 3DFUA 3I3BA 1TADA 4QODA 5C18A 3OF3A 1EGQA 4YM3A 2IIBA 3W59A 4HS9A 2QVZX 2WKQA 3S1AA 1ES9A 4GLJA 2V5DA 4REQA 1B15A 4C76A 4DS3A 1XTJA 4RA6B 1SCUB 3MAAC 4X95A 1ZH2A 3RYRA 4FCWA 5C1DA 1W5EA 1W36D 2O8EB 2H8KA 4I9FA 3ZWNA 2ZYHA 1OMOA 3E22B 1N6NA 1J58A 2DQSA 1Z0UA 1KI9A 1N33B 1USKA 3PFCA 1XCPA 5A06A 3B7MA 2Z5GA 5LATA 2P6MA 4LO5B 3EDRA 5ANRB 2XNJA 2GS9A 3M81A 4CFYA 1KKMA 3G2KA 4RV5A 4Q0VA 2XF8A 2EQ5A 3WLLA 5FP7A 3MBKA 3W8EA 1XG5A 1M2HA 3C6XA 2Q5CA 5KSYA 2DUNA 1YB1A 3A58B 4WV3A 4ABTA 2D59A 1CQIA 1I5RA 3KTAB 5JBNA 3BWXA 2ENUA 3B7WA 3DE3X 4R83A 4NTZA 1VYVA 2B83A 2EIXA 1M6NA 2H5EA 4MO2A 5L45A 1P19A 5J3UA 2FP4A 4CIVA 2ATFA 3FSGA 1EFAA 3OJBA 2R7AA 1UQTA 3EXHC 1YC5A 3DYVA 3ZOKA 2V7UA 3G2HA 2BOJA 2I1LA 1HJGA 3EVDA 1IIRA 3RBAA 4N3GA 4KWJA 2UVPA 4I4LA 1TJ3A 3WL7A 1NQXA 1E9SA 5JCTA 4KXNA 3WZ2A 3LT1A 5AJHA 3SEZA 5HYVA 2II6A 2W71A 4RV9A 3WJAA 1QJCA 3JVDA 4FZ5A 2CL6X 2P6PA 3IBTA 2I80A 3ANXA 4RD3A 5AKHA 2J0SA 2CWSA 2E4YA 4KGGA 1ZRDA 3RYFA 2XCSB 4WFKA 4RD0A 3ENVA 3FPFA 3KOWA 4QUGA 1WZCA 1MMFB 2QT0A 4DA8A 4G86A 3WDXA 2OCPA 1PCXA 4O2RA 2Q8CA 1BH6A 1VBB2 2B4QA 1NBWB 3K15A 4L9SA 2RM21 3TOXA 4JI6B 4P1ZA 5EE0A 5EJ3A 3RUFA 3LGXA 2C24A 2RS51 1ZJJA 2VZUA 4ICIA 2VJMA 2Y1CA 1L5VA 3NHAA 1VE9A 2OHIA 3JRWA 5LRRA 5JVDF 1TB4A 3NKFA 5U9CA 4IEZA 1YVUA 3NL1A 3NHLA 3EASA 3OE7D 1NNI1 3DFFA 3EMBA 2MWMA 2W90A 5C8DA 2G1MA 4HXCA 5F9FA 1AUVA 2Z8YA 5H82A 1GPKA 1OBFO 1DS6A 3M2PA 1KY4A 4OP2A 4Q29A 1FT9A 3QTLA 5BT8A 3H2ZA 1P4GA 2JE8A 2YS7A 5TEWA 4I3GA 1UEXC 2IEIA 3R7DA 1V4NA 1RUI1 3EG5A 3PNSA 2C00A 3L4BA 2QMHA 3OZ7A 3H7JA 4PC6A 4CVUA 3PUHA 4PAMA 4LOKA 3CXUA 3AERB 1BJTA 1B8NA 1X7GA 3QW2A 2XRYA 5HFNA 3K9FC 4QBHA 3RS8A 5EXEA 1CEEA 5JEEA 4KMRA 3WAGA 2O7SA 3OT1B 2YINC 4LI0A 1E0DA 3OSDA 4WDQA 1IZ3A 4HAXA 1PYGA 4ENPA 4IEUA 4TYNA 1CDZA 1C7EA 2RGWA 3MT7A 4JXKA 1OXUA 4MYRA 2JDAA 1P0CA 3AYXB 1VCMA 1N6IA 1MVLA 3FWNA 4HATA 1V4BA 3FBYA 2BMEA 3BPZA 4R98A 4HF7A 1SUCA 1KDZA 1L5RA 1LWOA 4RORA 5A6SB 3QQPA 4YCLA 2XA9A 3E2IA 4D4KA 3VH3A 2M9MA 1M2GA 4XCQA 1KEZA 3MIBA 2IOQA 1OIWA 4MPJA 4MUFA 4OQMA 5C8ZA 1WCWA 1H1IA 2WG0A 2B94A 4MB6A 5D1NA 3ONDA 3EGDA 4YNIA 4E03A 4BE3A 3OU2A 4PANA 1FPQA 5AW2A 2XOKA 2J1RA 4TLFA 1FSFA 4JVAA 1KFKB 4LJ6A 5EYXA 3IDFA 2BGIA 1X8MA 4G1EB 3QVMA 3I01M 4LZOA 3TAUA 2J22A 1DAGA 2F3QA 3HYNA 1LHUA 5JRDS 1EJ2A 4WESB 2UYOA 4EYOA 3PX7A 1G9DA 2YBEA 3NAQA 4KRFA 2CDBA 3ILNA 3GC6A 3NRBA 3E1KA 4HEA1 3KQRA 1KZHA 5CNAA 4KW7A 2W1SA 5BXQC 4OULA 1HW5A 2AUYA 4DRYA 5DM4A 3BILA 2VDNB 3AW9A 1O8BA 3TNDA 4BEVA 3DW3X 2PN5A 1NXVA 1NXXA 4D0SA 3S30A 1QJU1 1X1RA 1AVTA 5AXBA 1PZ9A 3CKMA 3T06B 5JSUA 4LZJA 3DYBA 4IDNA 5JSZA 3AF2A 4QQ2A 4RIFA 5DIFA 3WLTA 4NKRA 3H17A 1V35A 4G5GA 2D43A 5EZWA 4HFMA 3AZPA 1G3MA 5F32A 1G5HA 3K0EA 5LQMA 4GI1A 4IQ4A 4RTLA 3KQUA 4LDQA 2AJ8A 4G5FA 3OFND 4QTZA 3KFVA 1Q91A 3CVUA 3MPUA 2H1RA 4LXYA 4HB3A 3UGJA 3FLRA 1Z0JA 5IVEA 3WF1A 4MWGA 1C8VB 4FE7A 3R0RA 5IK4A 4QXQA 1U65A 3NETA 4BB5A 4AMBA 1JZ5A 3SHQA 3E82A 3DXYA 4B1LA 5A3PA 4IAOA 3VZBA 5AVAA 2PYIA 1V7ZA 1DARA 4OY3A 2DU0A 3GEHA 5FV7A 2A0UA 2J1UA 3PTLA 3A2MA 5CFCC 4HEJA 1JFRA 3KQVA 2GAOA 3KLPX 4MCJA 4HQKA 1NMXA 2WZEA 5FWJA 3KVNA 2GHIA 5IARA 1H2EA 1WG8A 3L41A 1R2QA 2GRAA 4LJSA 3WDUA 2W6IA 3VBHB 3VO9A 2YDEA 4AVAA 3OCPA 1POXA 1ZZBA 1W06A 1AK2A 5HE8A 5FWEA 4ARCA 3T0BA 4Q4X3 4DMIA 4INOA 4Q3DA 3PC8C 4E09A 1XZCA 1PR9A 3Q11A 1XPUA 4GB33 2FV8A 5K0TA 4B4VA 2HMWA 4IDDA 1VRH2 4JN6B 4I2VA 3RGGA 4IL5A 3FFTA 3DE6X 1DFHA 3ZIDA 1VPEA 2BGPA 3I4IA 3B5IA 2EGGA 2HREA 2XWSA 2QV0A 3WV4A 2VYFA 4ZONA 4M38A 2MSCB 4AUKA 4FONA 3RIEA 1NI4A 4AY3A 2RHPA 4LYEA 3VKMA 1GO2A 3WVJA 1BYIA 5GZ6A 3V2GA 3GRPA 5JWOA 1SBFA 1Z7WA 2CXUA 4MVTA 1M8GA 2K6GA 5A03A 1VBD2 2FPXA 3UK2A 1FV3A 4CDWA 4AQ6A 4UOZA 4LSGA 4E5MA 2XCOA 5DULA 4KWHA 1W94A 2R7KA 4H14A