3M70A

Crystal structure of tehb from haemophilus influenzae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
286
Chain Sequence
MKNELICYKQMPVWTKDNLPQMFQEKHNTKVGTWGKLTVLKGKLKFYELTENGDVIAEHIFTPESHIPFVEPQAWHRVEALSDDLECTLGFYCKKEDYFSKKYNTTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENLNISTALYDINAANIQENYDFIVSTVVFMFLNRERVPSIIKNMKEHTNVGGYNLIVAAMSTDDVPCPLPFSFTFAENELKEYYKDWEFLEYNENMGELHKTDENGNRIKMKFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tellurite resistance protein tehB homolog
publication title Crystal Structure of TehB from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 73
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m70A02
1HMYA 1D2GA 5DXJA 3FX3A 1QAOA 5K0EA 3RIEA 5K03A 2OB2A 5I8SA 1QXRA 4GUAA 2PAEA 3G8AA 3ELNA 3LA3A 2ZZNA 4HN0A 1M0EA 3OU7A 2WFPA 3S7EA 2GB4A 3BXOA 3A4TA 1ORIA 1EQAA 4Z07A 4PIZA 4XFAA 5GINE 4Q0SA 3EO6A 5HZMA 3P97A 4JTOA 5LSAA 3LDFA 4M38A 1NYWA 4N9HA 2ERCA 2IXIA 2IXLA 1P91A 4FBFA 2QYOA 4O9GA 2FMYA 1HNNA 2ET1A 4I01A 4LUKA 2XVAA 4RTQA 2PHLA 3EEYA 2OA2A 4L2NA 3IHTA 2P17A 2MHFA 3HQXA 2VDVE 3PS9A 1WGPA 4I0AA 3UKTA 5T64A 4RTPA 1P1BA 3OGJA 3TNPB 5ICGA 2XL9A 2P40A 1RL3A 1ZGJA 3Q87B 4BHPA 3REOA 2NYUA 4GQBA 5HIJA 3HVKA 3HNRA 1JQ3A 2PXXA 3GWZA 3HTXA 2IGTA 3CF6E 5JUWA 4AQ6A 3WW1A 4IESA 2QM3A 1SG9A 3TM4A 5CVDA 3G7DA 3IDBB 1WXXA 2ONYA 3CVOA 4P58A 3KQVA 4QDJA 5K0NA 1SQFA 2KXLA 3E5QA 5CCBA 5F2OA 3TMAA 5E1RA 4OA8A 3JZVA 5BP7A 2MNGA 2N47A 3BGIA 2Z6QA 3IBMA 3FUVA 1VBFA 2CL5A 3NWEA 5C6CA 2BR5A 1ZHFA 1EYBA 1RJFA 3DLCA 3HEMA 5FULA 3D2LA 2OYZA 2FCAA 2ZSUA 2IXJA 5C1IA 3EEOA 3LZZA 1EG2A 2PA7A 3MERA 1Y3TA 3K0BA 4FT4A 2AN3A 5E9JA 1VQ1A 4ZU7A 2DULA 3P8ZA 1VL5A 2CWWA 3KR0A 5EMLA 5K0FA 4HRAA 1U12A 5BW4A 2K9ZA 3QOPA 3N4MA 4F7ZA 2EJTA 3MQ2A 1G6Q1 3DV8A 2ZW9A 3JWJA 4PNEA 4XETA 4X6RB 5I0TA 1JR4A 4ZU4A 3OCPA 2G1PA 5KHGA 5JSOA 2BNMA 3HT1A 3WSTA 4GC9A 5EG5A 5DTQA 2BNNA 1SUIA 1NW6A 4LTAA 3E97A 5ICEA 4XUDA 3RW9A 1JQEA 4YMGA 4BY9E 3A26A 1ZZ8A 4ER6A 2E9QA 5DPMA 4CXMA 3HP7A 3AJDA 2ZIFA 5BXYA 4XF9A 3LAGA 2Q0AA 3KR2A 2GZWA 5HFJA 2OY0A 2VP3A 3UKNA 1NBHA 3EVDA 3SSMA 5FWAA 1WA4A 1FT9A 3V8VA 3E5XA 2NP6A 2D40A 2V09A 2NXJA 5CM2Z 2OZ6A 1YZHA 2H1RA 1WY7A 3OU6A 2UYQA 5KQRA 1FP2A 4GULA 1XDSA 4IEUA 5FHRA 3PVBB 2HV9A 2P41A 3DLIA 3A27A 5GP1A 3C3VA 2V74B 2BEOA 3ETQA 4DF3A 4JVAA 4RVHA 1R8YA 1Q3EA 5C8WA 2B8MA 3PT9A 4RTRA 4XF1A 4JV4A 4V0QA 3O14A 3PLAE 1OI6A 2JG3A 1F38A 3I7DA 4C08A 1VPTA 4KDRA 1O7FA 3LHDA 4QTTB 4PYKA 4CTJA 1L3CA 4PCAA 3G2PA 5T3NA 2YTZA 5DX8A 3MTEA 8MHTA 1O3SA 5CD1A 3EPPA 4U7PB 2FHPA 3USSA 5HIIA 4UBHA 2GH1A 3AY0A 1KPHA 2EVXA 2OBFA 4MIKA 4LA2A 3EVEA 4EKGA 5K0LA 2P8JA 1NE4A 2JHPA 4A6DA 2EFJA 1YF3A 3LCCA 5E2BA 3BWYA 4QXKA 5IH3A 1SFNA 2UY9A 2XYVA 4J1XA 1J58A 1I4WA 3TOSA 4R8HA 4XFFA 3FRIA 2XGXA 3PVCA 5E1DA 4R8SA 3KPJA 3GDHA 2FK7A 4M36A 3U10A 5EKXA 4AX8A 5CVUA 3D82A 2VDUE 1AV6A 4CKBA 2K4MA 3FTFA 2R6ZA 1QYRA 3QACA 5MHTA 1PJZA 5FPZA 1QANA 3SCGA 2OXTA 1TW2A 2C7PA 4EWAA 1LKNA 3CBGA 3TLJA 2XYQA 4HBNA 3EJKA 4XFBA 2PV0A 2GLUA 1G8AA 5FA8A 3SXWA 1G55A 3DXXA 1JSZA 1ZZ6A 3NDJA 1I6XA 5E9WA 4O9EA 1ZZBA 3UJ6A 1L9KA 2UYCA 3UJAA 3LBYA 4PYQA 2UYBA 2H11A 4HSGA 5CVRA 4X63A 4MGIE 5DM2A 2I62A 4DMGA 2CAUA 3I59B 1YLLA 4HG2A 4BIFA 3UA4A 3OU2A 5E8RA 2CGPA 2PVCA 4YARA 1PMIA 2ZCWA 3A7EA 5E1BA 3EVFA 5GM2A 2WK1A 1CAXB 3GRVA 2YVLA 3FPFA 3PLQA 5DM4A 4I3PA 5CVEA 4QDKA 2UZ4A 3O31A 3KQYA 2FK8A 1XE8A 3TNQA 4PINA 1ZNPA 1O54A 1CAVA 3A7DA 3JWIA 5LQRA 4PYIA 5CU1A 1WG8A 3AXTA 3UFBA 2NP7A 4E2ZA 1VR3A 3ELDA 5K0JA 2PXCA 1UWVA 1CX4A 3E05A 3NWBA 1O5LA 1J3RA 3KQMA 2XYRA 3CEWA 3P9NA 4GEKA 5DX1A 4Q0QA 2JJQA 1NV8A 5DLYA 1YFUA 2UYHA 1ZKDA 4P7KA 1BKYA 1H1IA 4CKEA 2LD4A 3GRZA 3KR9A 5EOVA 3M33A 1QY4A 1IPKA 4R6WA 4MGKE 5ICCA 1PRYA 4RVDA 1Y9QA 5I8TA 2ZZMA 1NKVA 1ZZ9A 1SKMA 3ME5A 3M70A 5JSPA 4YUVA 2PAMA 1UD1A 4FT2A 5KHKA 3D0SA 4ER3A 4AXOA 3A25A 1ZREA 1FPQA 3TQSA 5FADA 3BUSA 5LQJA 2IH5A 1RJDA 3H3UA 2ESRA 4C06A 4C07A 4PYJA 4X6QB 4RWZA 5T67A 3DOUA 1X19A 2I6GA 4GC5A 1JG1A 3TKYA 4LECA 4MGYE 1KP9A 2EA7A 4MZUA 2B9EA 5KQSA 3ES4A 1X82A 3WW3A 5FLIA 1Q43A 1ZX5A 1RJEA 2PXAA 4YUXA 3BGVA 1I5ZA 3OZRA 3GIWA 3K6RA 4H7LA 3S0MA 5I0RA 3E6BA 2NXEA 1RGSA 3FPHA 4AZWA 4XFCA 1O9HA 3FTCA 1G8SA 3LX6A 3P9CA 1N7IA 3GNLA 1XXLA 3ACLA 2QE6A 4K6MA 2OPBA 1H1MA 3H1WA 3EBRA 1Q5OA 1HW5A 4C4AA 4ISCA 3MPBA 4HLTA 2GS9A 4FAGA 4XFHA 3DMHA 3C0KA 3LA7A 2JH8A 1L3IA 5BXXA 3FUUA 2B9UA 5DM1A 3H1MA 4LG1A 5K0GA 2B25A 3MCTA 4EV0A 4RYLA 3C6KA 2DCTA 2ZULA 1YFXA 4PWYA 4GOMD 2IDJA 1KXZA 5DRYA 4FT8A 2IP2A 5EKUA 3OF1A 5FTWA 5F1RA 3SGLA 3CJQA 5EGSA 3E6DA 3UZUA 4HTFB 3HVHA 2D5FA 4QGLA 1VIDA 3ROUA 2IBSA 3M6WA 3E7PA 2IFTA 2ZBPA 3FWEA 3SVZA 3OCJA 4QVKA 2B5HA 3FE5A 3U81A 1X7NA 3MTIA 4M7RA 3KPWA 4AZSA 3FUTA 2FYTA 1QAQA 3VC1A 3FTEA 4P9GA 1SQGA 2VQAA 3LL7A 3H9AA 4GOOD 2QRVB 4FGZA 2OYRA 4E2XA 3G88A 4XCXA 4XUEA 1WLTA 1NW3A 4AVCA 5E8JA 1O3QA 3EMDA 3NW4A 3I5UA 2ZWVA 1F3LA 1N7JA 4PCLA 1YWKA 3OTFA 3UJDA 4KW7A 2ZLBA 3FUXA 2XLFA 2AOUA 5J7MA 3U0ZA 3ANXA 3LKZA 3O4FA 4EVIA 2XHKA 1G60A 2BNOA 4TLFA 1Y8CA 5BV6A 1JG4A 3ERCA 5FQNA 1WS6A 2BR3A 3NMUF 1T43A 2PX4A 3B3FA 1RC6A 2PT9A 2HWKA 1J1LA 2QCSB 4QPNA 3TR6A 3LDUA 2IH4A 3NTVA 3CCFA 1UW8A 4ORFA 2Q41A 3DTNA 4RD7A 4R8RA 3MDPA 3DMFA 4WBBA 5CVJA 2XKOA 4Q0PA 3G8BA 4IKPA 2DPMA 3CJXA 4E2QA 1UFKA 3LECA 1R8XA 4HSJA 3L8DA 3NSTA 1RI4A 4E2SA 1EPZA 2ZWAA 4UXAA 1G6NA 1TQ5A 1YFYA 3OZSA 3NVKI 2CV6A 3M6XA 4MGZE 1XDUA 2HMYB 4PIXA 3LCUA 4WVLA 2GC0A 1R18A 4MUVA 4N9IA 4V0RA 3HM2A 10MHA 2BGCA 2ONZA 4Z82A 2AOTA 3ER8A 1LR5A 4FSXA 3BWBA 4D7SA 3ES1A 3NW9A 4RTKA 3LGAA 1CAXA 2JH9A 4IEXA 1MHTA 5LEJA 2AOXA 4XFIA 5KHHA 3CGGA 5JR3A 2O57A 3H7JA 4HGZA 5EFUA 1R74A 5I0SA 3KQQA 2WA2A 4UOEA 1MJFA 3HA7A 4NVPA 3EGIA 4AZTA 2Z2SB 1RUNA 3EVGA 4XFGA 3E5UA 2YQZA 4AVBA 3NKTA 5EHIA 3LCVB 1SEFA 1IY9A 5EVJA 2FPOA 3SXJA 4YYOA 5CADA 2PY6A 3C6MA 3U11A 3T7TA 4GOND 3PB3A 4YV2A 2NNWB 2ATFA 2ZZKA 5FA5A 2H6BA 4YNIA 1CAUB 4QGNA 5BY5A 3O7WA 2D5HA 4RTLA 3HCFA 1YFLA 2AN5A 4EMSA 4L11A 3UJCA 5CUQA 4KWCA 2IXHA 3GRUA 3FZ3A 1DZRA 5FUBA 5LRRA 3FFQA 4AZVA 4XF0A 2ZTHA 3QOXA 1EY2A 5FQ0A 2EX4A 3THRA 3HA5A 3KQTA 2Y1XA 1RI3A 3B5IA 3IWZA 2ZBRA 2IBTA 3LWCA 5BUVA 2BH2A 2AOWA 4OFGA 4X60A 3L2HA 2NXCA 1RI1A 4RSRA 5E1OA 4X41A 1ZRRA 5JSRA 3D0JA 4UBGA 5DTMA 1P39A 2AOVA 1GQGA 1JG3A 3R3HA 3SCHA 4KVZA 4IEVA 3OD0A 1YHFA 3DN7A 3P2EA 5BW5A 4YUWA 3EVCA 2OB1A 3RODA 5E9QA 5CIYA 3VYWA 1RJGA 5KYGA 2BM9A 4MHTA 5HOQA 1H1DA 4RVGA 4RV9A 3NVCA 5JCTA 1XCJA 4KL1A 1XE7A 2OKCA 3DR5A 1DGWA 2ETEA 4PYLA 1J3QA 1ZRDA 2C0ZA 3B3GA 4OQDA 3FJSA 2FRXA 2Y1WA 4WZCA 4FZVA 1I9GA 3VHRA 3IEIA 2YX1A 1UIKA 3IDCB 4L7VA 3G2QA 2G70A 4F86A 5HIKA 2P3LA 2AVNA 4FP9A 5KVAA 3BZBA 3TM5A 1O4TA 2O07A 2Y0OA 3FPGA 2YR0A 3RYRA 2GC3A 3NDIA 7MHTA 1XDZA 4MTLA 4LEJA 1BC5A 1D2CA 3EQEA 4ZTBA 2AZTA 1OMIA 5EHGA 5LR6A 2ZKLA 5J3UA 3QV2A 2GC2A 3FTDA 3ORHA 3S68A 5B1SA 4HTFA 1KHHA 2IIPA 1SUSA 4RTJA 3BU7A 5F2KA 4BLVA 3B7PA 5CCXA 1FJXA 3KGZA 4PONA 4Q0VA 4EWDA 5K0CA 2QRVA 4HH4A 4CKCA 3HCAA 1YUDA 3GJYA 3PFGA 3HIFA 5DSTA 4JTNA 3H2BA 3EVZA 1EP0A 1O9GA 2P35A 4OA5A 5G02A 3KHKA 4QX5A 2IH2A 4PYOA 2YXDA 3Q7EA 3UJ9A 4Y30A 2O06A 1JUHA 1NT2A 5DT2A 4HVRA 4J1WA 2NXNA 2HTEA 3H1YA 4IEWA 2HR1A 4RX1A 2PGXA 3PX2A 4YUYA 2PT6A 1WXWA 1TW3A 3RYKA 2D93A 5EPEA 2Z6AA 4QVGA 2C7OA 4MH0E 2CMGA 1QAMA 1FI2A 2O8QA 2UY8A 3E6CC 1X1DA 4QQNA 1QWRA 1XJ5A 2ORED 2XL7A 1ZVFA 4CWAA 3GRYA 2Q1ZB 1X1BA 5IKMA 1VP3A 4BLWA 1RUOA 9MHTA 1DZTA 5K8SA 3IV6A 2B2CA 1U2ZA 3R0QA 4IV8A 2EAAA 1JQDA 3OE5A 1L3BA 5CVVA 1XTPA 2PHDA 5JR7B 4KWKA 1Q0TA 2PSSA 4ER0A 1R6AA 3LKDA 3CLPA 2C7QA 1YZ3A 5GOZA 2EJUA 5EZQA 2CAVA 5DX0A 1Q0SA 2VZ9A 3KCCA 2B3TA 4EKIA 3BB6A 5JAXA 2XKPA 3KU1A 3KR1A 3NJRA 3NL1A 2VECA 1VP9A 5EMKA 3ZDSA 1RTVA 3OE4A 2I9KA 2KW5A 4FR0A 1N2XA 4HZFA 1NE6A 1UCXA 3RYPA 3FZGA 3G89A 2C7RA 1YB2A 4YMHA 5KS2A 4O29A 1SVUA 3MHTA 3V97A 3MCZA 4PYMA 1NBIA 5I93A 3WW4A 4OQEA 3G7UA 4A6EA 3LOIA 3DL3A 4LLOA 1V39A 4BYYA 5GWXA 3M3IA 2AR0A 2OO3A 4I02A 4IV0A 4R05A 5HI0A 2ZIGA 2QNKA 2VDWA 5DSXA 3T0IA 1X1AA 4BP1A 2Q30A 5FLHA 2I45A 5K01A 3WW2A 2UYOA 4A2UA 4F85A 1YUBA 1EJ0A 5HEKA 3OFJA 3FRHA 3THSA 3CL1A 3EGEA 3M6UA 2WA1A 3KPVA 1P1CA 5EZWA 4DM3A 5EC8A 1NW8A 4OBWA 2JHCA 4RTOA 3GRRA 4WXHA 1CAWB 2BR4A 3H7YA 5U4XA 3SSOA 5FCDA 2BM8A 3BALA 5E2AA 1G38A 5C9ZA 4YV1A 4XUCA 5M5BA 3BT7A 3G5TA 1EAMA 2PWYA 4H0NA 2PLWA 2P3OA 4YRDA 2ADMA 3ELWA 5K0BA 5DM0A 1INLA 1JG2A 4HVOA 1ZZ7A 4PGGA 1BOOA 4WVZA 4JXJA 5KHJA 2K0GA 3ELYA 4FSDA 3VC2A 4IEPA 2YXLA 3KQWA 4HMZA 3P2IA 3P9IA 5ICFA 1GQHA 4I2OA 1PM7A 1M6EX 4QMAA 2EG5A 5EEGA 1IM8A 4E70A 3KPUA 1OFNA 5E1MA 4HVQA 1LRHA 3ER9A 5BPXA 3KMHA 3T7SA 4E2YA 3B3JA 4LWOA 4KIGA 1CAVB 3RDIA 2MPFA 4C05A 4ZU5A 5K05A 4META 3UJ8A 2CMHA 4OBXA 1XVAA 1EJ6A 2XBMA 2P7IA 1YFJA 3PFHA 3HT2A 5EMJA 2HJIA 3GXOA 1VE3A 2Q4SA 2WC2A 2YXEA 3G2MA 5LQKA 5T6BA 4KU8A 4I0BA 2AVDA 3BWCA 3NVMB 5FWDA 4LA3A 1OD5A 1L1EA 3IYLW 4MV2A 1KIAA 4BP3A 3FUWA 3I53A 1NW5A 4HN1A 4ER7A 4E2WA 4DZRA 1QXJA 5EIWA 5FPXA 2G71A 1Z3CA 4FS8A 3CJRA 4RVFA 1D2HA 4F84A 3I59A 4PIMA 2P1DA 5DXAA 3UJ7A 4QTUB 4Q29A 3UBTA 4CYDA 4PJYA 3KKZA 2YUIA 4R6XA 3KGLA 5LEKA 2A14A 3M4XA 4KDCA 4DCMA 1X8EA 4ONUA 3PNAA 3KQOA 4RTNA 3FYDA 3SX0A 1RI2A 3SM3A 1LB2A 4PIPA 4POOA 4RTSA 2N7GA 4FAHA 5EQJB 3E23A 3CO2A 2ZCJA 2F8LA 1KPIA 1QZZA 3P2KA 4F8AA 1J59A 1FXZA 3DULA 4E2GA 2PAKA 4NECA 5GM1A 3JWGA 5I0UA 2O0LA 3GO4A 4Q0UA 2AN4A 2AS0A 3SMQA 1ORHA 1X8MA 1NZCA 5DTRA 1VP6A 3MZHA 1ZG3A 3OFKA 1DUSA 1ZRFA 5E16A 3UA3A 5LQAA 1AQIA 2FQPA 2PWPA 2B78A 2ZIEA 2GA9A 2QJVA 4I09A 4GF5A 5DRTA 2ZFUA 2V7EA 2F4PA 3ID6C 3P9KA 4K8FA 5KHIA 4R52A 4C04A 4X1OA 5FDBA 4OLLA 4B17A 3PX3A 3FHIB 2OZVA 4MX3A 3EMBA 3R6TA 5P8WA 3EVBA 1DCTA 3H50A 1XCLA 3KPYA 5K09A 3I64A 3DMGA 4YSFA 4EK9A 4AUKA 3DXYA 3R9XB 5J48A 4P7GA 4E32A 3IIAA 2XLGA 5GIPE 2OZJA 3MGGA 4Z2YA 4IWNA 3LBFA 3MAGA 3R24A 2ET7A 2H00A 4PYNA 1M6YA 3KSCA 4QQKA 2UYAA 2BYVE 5I8YA 2GAFA 4IEZA 4XF3A 3G5LA 3KQPA 3TPZA 3GYDA 3BPZA 3TKAA 2E5WA 4QM9A 3I9FA 4E33A 4DINB 1OR8A 2PBFA 1DGRA 4KIFA 3MB5A 4HC4A 3S7IA 3CJTA 3DH0A 3SMHA 5F2NA 1X1CA 2AOUB 3T7RA 2VPVA 1XRUA 3I58A 5LQNA 3BWMA 2O1QA 3EHKA 1RI5A 5AVPA 1WZNA 4MWZA 4LUMA 1EIZA 3OZTA 4DQ0A 2G72A 4AVAA 4XEZA 4HGYA 2PKWA 3HA3A 4QPPA 3BKWA 3FPEA 4KWJA 1NE2A 2PFWA 4GOLD 3LSTA 4IEOA 2JHAA 3AXSA 3DUWA 3CKKA 1UIRA 3BGDA 1ZQ9A 3RPQA 2QDRA 4PGHA 2QVSB 1ZZCA 4E31A 4EQZA 3ELUA 3EVAA 1IXKA 2GAUA 4B29A 1CAWA 2ZVJA 1KR5A 2VS1A 3HCBA 1V70A 2G8NA 2H6CA 2IPXA 1YFWA 1ZRCA 1NV9A 5ERGB 3DKWA 1CGPA 2P7HA 5FCCA 3BKXA 2GC1A 5I91A 2OPKA 4IEYA 5FHQA 1B42A 2O05A 4OX9Y 3I54A 1UIJA 3G2OA 1L3JA 3F4KA 2AOTB 5HILA 4YUZA 4PIYA 4RTMA 4ATNA 3M6VA 5EMMA 3UWPA 2P3QA 3KQSA 3C3PA 4U7TB 3H8UA 5DWQA 4XF4A 3TRKA 5D1IA 1NXMA 4BLUA 3B02A 4IETA 3GGDA 2Z6UA 5FLJA 5LQUA 3SHRA 2CKDA 3P71T 3UJBA 1KYZA 4EWEA 2H0VA 5LQCA 1UPIA 4KRGA 5K8VA 5HIMA 3HCDA 4X61A 4G56A 3X0DA 2PX5A 2IC1A 4C03A 1AQJA 3UKVA 5KBFA 2R3SA 3NJZA 4E30A 4AQ2A 4QM8A 1AF7A 2PX8A 4D7TA 4GBED 3RNSA 4IERA 3PTAA 3R6SA 4LULA 1J3PA 1O3RA 3DXZA 2PQQA 3VSEA 3GCZA 5D1HA 4DCGA 1DL5A 1ZGAA 3SSNA 3E8SA 1TPYA 4IEQA 5FQ0B 3FPJA 4LWPA 2IDKA 2HNKA 2GU9A 3C3YA 1JTFA 4P7FA 5EZSA 3ST7A 3QOWA 1FBNA 3HCCA 2HKXA 3CC8A 5GIOE 4DA4A 4EROA 1O5UA 2IXKA 4QGMA 5FQOA 3GU3A 3MYXA 4HSLA 1JTEA 3FYCA 4BH9A 3SCFA 3SR4A 2PX2A 3LA2A 3BCWA 2PTMA 1NW7A 3LPMA 4KWLA 3AWIA 3HCEA 2BZGA 2XVMA 4CTKA 3GBFA 2GPYA 2XLAA 4ER5A 3JWHA 3H3ZA 4KU7A 3EGVA 5EEHA 1R00A 5D1NA 2QY6A 1I1NA 1VJ2A 1IPJA 4M37A 1CAUA 2PJDA 3TFWA 4YV0A 2GH2A 5H02A 1SQ4A 4MQ4A 5LRSA 1O3TA 1VLMA 1KPGA 3OPNA 3RZZA 1KYWA 3B89A 4Y2HA 1JSXA 4P7JA 1FP1D 2ZBQA 2PYTA 2IXCA 1BHJA 3HVIA 2Z69A 5C0OE 5EIFA 3HVJA 2I7CA 3LDGA 4DKJA 3DP7A
chains in the Genus database with same CATH superfamily
1CY6A 1IHUA 4R54A 5ERXA 2DR2A 2JLSA 4GD3Q 5I9BA 2QMOA 2GXAA 3GDBA 4QOEA 1G291 3RRMA 3WCSA 2SHKA 4BL5A 3OOSA 1V00A 4AYXA 2PCJA 3S7EA 1ZUNB 2QQIA 1PX3A 1X86B 3R6DA 2EQAA 4DIFA 1DT5A 3EO6A 1PAUA 3L6DA 4DGQA 4XZ3A 3GLQA 1NYWA 4OI4A 4PR0A 1BDJA 4N9HA 1X1TA 1AX0A 2WWWA 3N3BC 3ZWMA 1G16A 3JQWA 1RAFA 1ISFA 2O48X 4YXWA 5EWMB 2VZUA 1LVGA 1ULTA 3LPCA 4Q03A 3ZK7A 1E6KA 4F3TA 3SXPA 1PUJA 2P30A 2FEXA 4KLAA 2H57A 4GLJA 4IIBA 1R9JA 1B00A 1XNGA 4CEJB 2NACA 1XTTA 4MULA 1P31A 3Q87B 3HJNA 3R3SA 5H82A 4MHRA 5KX5F 1IQRA 3H1BA 2XPCA 2OO7A 2RKWA 3KQVA 4QDJA 4LVOA 1FMTA 4GX5A 3WRXC 3Q7QA 3WE7A 1UPXA 2RG1A 4QZVA 1T5TA 2A0YA 1W85A 5HBAA 2HYKA 3ROZA 3KSMA 2Z6QA 1KI6A 3AV0B 5DO9A 4CG3A 3RJ5A 3DQZA 1SDDB 1B8PA 2BJWA 2AK2A 5DW3A 1GKYA 5FULA 5HCIA 5HKOA 2OYZA 1SCUB 3W3AD 1RBQA 2AUMA 4BU1A 3KLOA 3AI3A 5I9TA 4L6AA 3VKHA 4C4XA 5I48A 3AYZB 2ZRBA 3GC6A 1L7XA 2C83A 1WBDA 1KRWA 5IK8A 2AWOA 1KO1A 4KXWA 4GD4A 1NOVA 3Q9OA 2YVKA 3R4DB 3COYA 1G98A 2JGDA 3IVMA 1YL6A 1I3LA 3N4MA 4JB3A 4A10A 5BRAA 4F9FA 5A33A 1KAEA 3D5QA 1W90A 2I67A 1NRIA 1E1QA 1U3GA 4JHLA 4YRBA 4M3NA 5MGBA 2Q27A 5CG1A 2JFFA 4AOCA 1QYVA 4TMFA 5CIQA 3LUPA 3AVXA 1P2DA 3SIRA 1ZZ8A 4OK6A 4FDVA 1NQVA 3NNSA 4DAEA 1IE3A 1VSVA 3V8VA 2J1EA 3E5XA 4DLVA 4YFVA 4MQEA 3W5CA 1PM4A 1ZGHA 2UWBA 1Q44A 4MR7A 1OB5A 4GYWA 4HQFA 3D81A 3H5RA 1OREA 1VMFA 5FHRA 3C43A 5CLFA 1C1LA 2CJYA 2Q3LA 1PJ4A 1BJQA 4Y5Z0 4EL5A 3ECAA 2FWJA 3W59A 4C89A 1MHPA 4Y1FA 4RTRA 3VZPA 2OCBA 4I14A 1F38A 1H8TC 3MJRA 1L7QA 1BDIA 2P9GA 2VNHA 1IEVA 4Z4GA 4RK4A 2YTZA 4OB7A 1J2RA 2Y6VA 2ZB2A 3ED1A 4UXHA 1ZCZA 4RZQA 2VP9A 2GH1A 4TT3A 3DVLA 3THDA 5AOAA 4WCFA 2YWFA 3EZXA 3BSYA 1AJEA 1CRPA 1G9XA 3Q7PA 1JEYB 2WUDA 4HETA 2ZACA 4CEYC 2PRYA 2ZGPA 4B73A 1TMF3 3QNUA 4ZYVA 4OLAA 1I4WA 3GIDA 1KFKB 5CEFA 5B2GB 5E1DA 4XLLA 3U4MA 3GDHA 4U7JA 3TLAA 5EKXA 1H9PA 1UM9B 4AX8A 5CVUA 3VI3B 1VIMA 4R5MA 4WWHA 1YR3A 3E5HA 3RJZA 1UU4A 4OGGA 1AURA 1UKYA 4U00A 5LNK1 3LUFA 1XB2A 1SUBA 1KP3A 1BRTA 2R2GA 2DBRA 2EG9A 2VBPA 1VJRA 4X1KA 3I9MA 3G1WA 3DYOA 1ZW6A 3PVNA 1XE3A 1OWPA 4JI6B 5AICA 3NDJA 5AW5A 4ZVRA 4AHWA 2EKQA 1G5PA 3QE2A 3UJAA 4PCVA 3ZV6A 4DQVA 1N5LA 1JA0A 1AL0G 1TUIA 5IH7A 3FYUC 2Q8DA 4UM9B 2PUGA 2P9CA 3NC1C 3OU2A 2GALA 4QPWA 5KR7A 4HWPA 2IIBA 5E8RA 3B9QA 2PVCA 1EUCA 1PR9A 1R8SA 5GM2A 5CGZA 2OHJA 5DM4A 2JIGA 3K6SA 1T0PA 1EFTA 1AS2A 4Z3OA 2FDCA 4EB0A 2AEMA 2G9GA 4OHWA 2OCIA 3FKQA 1T9GR 5E7IA 1ZNPA 4EBBA 2BGKA 2V7GA 4YEDA 5FH9A 4CMAA 3T6KA 4O4IF 2JDIA 4NCIA 4EHHA 2EJCA 3KEOA 4DQAA 4Q1FA 1QGYA 3DF9A 2QVYX 3CJIA 1J3RA 2OG1A 2TRSB 3ETLA 1W36C 3LP6A 5KOJA 3DE6X 3MELA 2Z83A 1D6JA 3E03A 3JYNA 2HY7A 1UOGA 1Z0IA 4EGAA 3QBEA 2FZVA 2J31A 5AM4A 3GRZA 4PPYA 3RCBA 4MGKE 1LZKA 5I8TA 3CW2A 1UFOA 2LCQA 1M54A 2ZTSA 2QZSA 2OFPA 1JSLA 3IEVA 1XQNA 3ICEA 2PHWA 3GX1A 5FPVA 4L9BA 1ZREA 2QN9A 5FADA 4C4TA 4LO7A 5EPOA 3U3MA 4PYJA 3SCZA 1DP0A 1JZ5A 1FV3A 4E5PA 4ZRMA 1JG1A 4YW3A 4C7BA 4MGYE 4MZUA 3ZHCA 4UW3A 3WW3A 1L5SA 4EW1A 2PXAA 4R41A 3VGPA 1BHGA 4L3OA 4Q4HA 1C1DB 2DPGA 2ZJAA 3DGEC 4LBJA 2JLCA 2E7TA 2WINI 2AC2A 2CXPA 3R44A 5KNDA 2YMPA 3WHIA 1CZNA 3VJMA 4TTGA 1NYLA 2CT8A 2ZE7A 3FNIA 1QHHA 4N43B 5T50A 3WG4A 2GZHA 3HB0A 4Y20A 1NN3A 1HW5A 4LCEA 2WTMA 4KYUA 1SHUX 3C0KA 1GYQA 4P0QB 4KYTA 1G8HA 4GR5A 4Y3UA 3TN7A 4ENSA 3NX4A 4BO0A 2XNHA 2OHGA 2IDJA 3WJ7A 3UJOA 2SNIE 1KJLA 2VDNB 4US1R 1WETA 2E0IA 5FTWA 5B55A 1ZD4A 3SGLA 3VN4A 1NLRA 1QHIA 1S2EA 3CPEA 3A6LA 1WHTA 2V8BA 2DFLA 4HQNA 1N1YA 3FOFC 3ZZMA 5TJ9A 3BMQB 4HDSA 1S0JA 3IP1A 3JR3A 5ARDA 2XH8A 3VGIA 3NBFA 1N25A 3KPWA 3BHJA 1NVKA 1YUMA 1LNZA 5A4KA 1YTLA 2BF4A 1Y1TA 3GT0A 4R4ZA 3A8TA 3U3XA 4M0LA 3M1HA 3I9V1 4GE3A 3KJZA 4HEQA 4PCLA 1HEUA 3TEFA 3UJDA 2BH9A 3WLEA 3N9QA 1YKFA 1KSFX 4H2AA 2HSEA 2JCXA 2ADFA 1NZJA 3TI7A 4GX2A 3F3SA 2ZTUA 1FNYA 1Y7BA 3INRA 1STOA 2NPFA 1ARZA 4Z9XA 1JYNA 2PX4A 3OVMA 1QJFA 2PHRA 2CLSA 3D8BA 3OQHA 2HWKA 2BHTA 1Q8VA 5AOCA 4FQ8A 1VL1A 4XSVA 2JS7A 4MVYA 4WKCA 2KB0A 3UK6A 3QVVA 2XKOA 4TQ9A 4TM7A 2CFOA 2YWGA 2PXJA 2QTMA 5JZ9A 1QO0A 1UQTA 1P2TA 3AT1A 3HVUA 2HRBA 3IHWA 3EIXA 3O7OA 3OSUA 2O3JA 4ZOLB 1HB4A 4WJZA 4OYYA 3IAUA 2DMRA 5K7PA 4Z82A 3AMPA 1XZNA 4OUEA 5L9AA 3CINA 3WF1A 4NSNA 3R05A 4ARUA 4HGZA 1Y1PA 3MILA 2ZUFA 2QTNA 4QQ2A 2I1QA 3NBZC 2QG4A 2EIXA 1ZRIA 3LCVB 1COV2 3ICWA 4TWTA 3AR4A 5FMOS 3UMGA 1VBB3 3HKEA 4UHHA 1R8QA 2FZCA 3K2QA 2DBVO 3UYKA 2ZUUA 5FXVA 2OESA 4M9RA 4YNIA 3N53A 4ZVOA 1W94A 5EY5B 1RZVA 2V98A 1U8EA 4R7TA 3UJCA 5FL3A 4CG0A 4M0PA 4YC7A 2DU0A 4MCAA 2E63A 3RSQA 4G4JA 4QXMA 3FFQA 3F8TA 2G76A 3PPYA 5FJIA 1XLWA 2CK3A 1ZWLA 5T57A 4G0UA 2AMJA 3DCQA 1LB1B 1JMVA 1I10A 4B9AA 2IC5A 4YI5A 2H51A 3B5IA 2K5UA 1H30A 1YB7A 1D4OA 5J09A 1J49A 1KD7A 4WA8A 1XTIA 3JYLA 2HDNB 1GNRA 3OPQA 1IBSA 1DB3A 4MCIA 4ZC8A 3VO8A 3UHAA 1R6TA 4G86A 1UKCA 2FQXA 4FWIB 2P2KA 1DXHA 3GJ3A 3QBDA 5KYYB 2ZRCA 2WWYA 2YW2A 1OX5A 1TCCA 1Q5PA 4QG3A 2CDPA 1RJGA 1TUGA 3B6EA 4FFFA 1DKRA 1HO3A 1L7VC 4QRDA 2DWUA 2MR5A 3A70A 1FSPA 1FTQA 1XRQA 3TRJA 1BFKA 2Q9BA 1FQOA 4HAZA 4CDWC 3UOWA 3TXYA 2IYTA 4RMIA 3NHUA 5J1XA 1NW9B 1XCGB 2VOVA 3G13A 4XEUA 4UJ3A 5EXPA 4FZRA 1N8TA 3K73O 4JGYB 3ZBPA 3JPWA 3AFKA 3JATA 5KVAA 3BRWA 2J6CA 4HYYA 1PZXA 4HQKA 4UFOA 1BC5A 5DHPA 1D2CA 4OFZA 1YD7A 3CG0A 2P1BA 6ABPA 3DBIA 2WI8A 4NBKA 1I6KA 3UV6A 4H16A 3ZCVA 1F8VA 4XPVA 5GJBA 3E6AA 3I62A 2A59A 5JIAA 4U9UA 1MXHA 4YASA 1KTVA 2ZREA 1YQDA 3ORSA 1Y9EA 2HEGA 3A6GA 3OY8B 4ZEWA 4CUJA 3BE4A 3CKLA 3IEXA 1XCOA 1K5MA 3NU1A 2ZRAA 2GN1A 1E3WA 4MR9A 3EJ6A 4TLCA 5CKQA 1U31A 2JGNA 3EASA 1WU7A 2O06A 2IPOA 4QYMA 2E32A 1W48A 1NKGA 3F7OA 2QEQA 5IFLA 4J1WA 3NMBA 1WV1A 2R041 4YUYA 3D9QX 3PHIA 4CIWA 4KHPB 2QTGA 4JK3A 4XLZA 3HL4A 4D69A 2ORED 3K8YA 3A28A 3T5TA 1LOBA 4IXDA 2W48A 3QU2A 1XDBA 3WWZA 4IM7A 4HYQA 2G63A 4RR3A 1U6IA 5GONB 2FF5A 2LGJA 4MXVA 3MJCA 2DPHA 5CVVA 4KMQA 4CUGA 5I7EA 2PHDA 3MOIA 4Z6KA 4ESVA 1EDEA 1YHYA 4FFRA 3OQIA 3OCZA 1AJOA 1V3QE 3GZ4A 1YZ3A 1RUG2 1XHLA 5DWDA 5GOZA 4Z0HO 2RHTA 4YQEA 1E9AA 1T5BA 1L5FA 2QTLA 5JAXA 5KSYA 4FW8A 2V65A 3UOAB 2C58A 3LNTA 4BXOA 2W4IA 2WPNA 5CFPA 3V1TC 2VECA 4AY6A 5EMKA 4QX3A 3DCJA 1TMKA 2Q0HA 2IU6A 1AHIA 2C9ZA 4YX9A 2Y0CA 4E21A 3L1VA 3I28A 4X71A 3L7YA 3V97A 3QVJA 1M2FA 2JFWA 1TJ4A 4Y2JA 2FP4B 1KIFA 2GNPA 4K6HA 3RREA 1XMXA 2XITA 3NYRA 4BMCA 2G25A 4LOIA 5TS3A 5FPLA 3GV0A 5CNJA 3UAZA 2VDWA 2O8EA 3DLHA 3LIGA 2JI7A 4QUAA 2I45A 4A2UA 2WTXA 3MCUA 1G5FA 4JASB 1QVVA 1QFZA 3FRHA 4AEDA 3ISVA 1LLQA 1PHPA 2VNVA 1MQTB 2F2TA 1AF4A 1ZZEA 4WX2B 1CPMA 4O4HA 1DVRA 2BF7A 5FNZA 3NRUA 4FKMA 3NZEA 4KFTA 3QUCA 4OFWA 4MS1B 4F5DA 4XD2A 5CVTA 5EIAA 3V1NA 3O95A 3U4SA 4C0BA 2PGOA 3RNOA 4DCTA 3ZHYA 2LVBA 3VC2A 5CFCC 3NAPA 2JBAA 3P2IA 1AGXA 4HNHA 2OG2A 4WFIA 1UH5A 4LIPD 2Z8YM 1J70A 2WWTA 3ILXA 3I04A 4FDMA 4L27A 3QLVA 3GFSA 4F6CA 1BYHA 1AKVA 3POFA 2FZLA 2OV2A 3HNMA 4RETA 2K7FA 4AQ7A 5LP6A 2PA3A 3W8NA 3BX1A 3FUOA 1XDGA 1KJ9A 1QOZA 5DHFA 3Q3CA 2V58A 1OKQA 1IK6A 5T6BA 1RWBA 1JJAA 1KSHA 4EA8A 1OD5A 2X0FA 1W9HA 3RYHA 4AURA 2P9ZA 4AJKA 4BP3A 1DJOA 1TA0A 1KSGA 4XRRA 4NKRA 1OLXA 2A5YB 3KV3O 3AI7A 3H65A 3ZXEA 3V0AB 1ZM9A 3T95A 4ZZ2A 3UJ3X 3DCNA 2PUBA 3E9YA 3ETPA 4CIBA 3C39A 3KQNA 2PZAA 4W5HA 4K9MA 4BK4A 3EXEA 4DRZA 1RCFA 4Q00A 3WZLA 1JU3A 1RI2A 3SM3A 1ODLA 3X1JA 2OP0A 4ZVSA 4IR7A 5C32A 4LGVA 5FPTA 4MGZR 1FXZA 3DULA 2E7AA 4MGHA 4E5VA 4GQIA 1JDTA 4G09A 3LUDA 4CP0A 4HOOA 3MBIA 3VDDC 5B6JA 4AQYB 1DBWA 2ZETA 4OB8A 5EESA 2DUOA 2ZYSA 4PHZA 1TAHA 1VMHA 1X8MA 3GEGA 5DTRA 5AK6A 2LTAA 4I1RA 3KHTA 3BL8A 1W04A 4CM8A 3DFKA 1U2GC 1MB0A 4PO8A 2DUUA 4K87A 4YLGA 1YTUA 1RMU2 4BNKA 2F4PA 4J29A 3NATA 2WW8A 4JIGA 5C9AA 3S8EA 2Q8NA 4X1OA 4OLLA 2H1VA 3EDQA 1WUJS 1FXSA 3BIWE 2OZVA 1OZFA 1NAEA 1CDEA 4G2NA 5A3PA 4G8CA 3T2OA 2QUIA 3MGGA 5ANNA 2R30A 4G0XA 3WGVA 2AC7A 4QPIA 2VDOB 4F4IA 4EKDA 4JEIA 4EG4A 4DR2B 3BVCA 1P7YA 3LNCA 1XYGA 1NNI1 2R79A 5FRDA 4R2JA 2IT1A 2PBFA 3I4FA 4LBZA 4HC4A 4HTAA 4FGJA 4IQPA 4PI0A 5C7OO 5AW2A 4C4ZA 4KQKA 2H9IA 2PK3A 1I1QB 4JY7A 4P0TA 3E9DA 3OZTA 1E2LA 5HG0A 5CXSA 3TAYA 3TIVA 3LRTA 2LIVA 3RSCA 1KJNA 2J9FA 3HA3A 4KJZA 3FPEA 2WLPA 1M66A 1NE2A 4Q3DA 3T1LA 5FZ7A 3VV2A 2CFIA 3EVNA 2FG7C 4GICA 4UCFA 4AI3A 1ZZCA 4BLJA 1TVMA 4GMDA 4S2FA 2VXJA 1IWBB 4Y5SA 1ULBA 2ZB3A 3EXIB 1NV9A 3SPXA 3BN3A 2G1MA 2HEVF 1HT2E 4GZ9A 1XPJA 3KD4A 4ZDKA 4I9HA 2AF3C 2ZGTA 3M9XA 2ATXA 1LPPA 2XUQA 4PIYA 1HRV3 5A33B 3MLLA 5PGMA 1CQPA 5DASA 1I33A 4HFNA 3EWSA 2FG5A 3OUIA 3POIA 2ZMLA 3H8UA 1U8AA 5CLQA 3IDAA 1GGNA 3X3HA 4UM9D 2IY8A 2WYVA 2VR4A 2GK3A 5FXZA 3PJGA 1NUUA 4Q1DA 4L8LA 1B8NA 1YB4A 4BNZA 3EY9A 1KITA 2VOJA 1KI4A 4PM4A 5JJBA 2PX5A 2Q1MA 4C03A 4MQEB 4E30A 1CE8A 3K72B 3RNSA 4NHXA 1MAHA 1WX1A 1JQKA 2DHCA 1U28A 1H6YA 5NULA 4GOXA 4OYLA 2QN1A 3P0RA 1DL5A 4O1MA 2HIMA 4B6EA 4JJ4A 3PYXA 3CU5A 4OULA 1D1PA 2CD7A 2CNLA 2H08A 3PGXA 3WJAA 4MVTA 4LJSA 1RRGA 3ZWKA 3KQ4B 1MDBA 3DOCA 2XBO1 3EFOB 1RZUA 1AHNA 3TEWA 4QLOA 2Q6OA 4W8GA 4LFCB 2CYCA 4YJ3A 1GCUA 3SCFA 4JT9A 1J1UA 2IWHA 2OHFA 3AZZA 5EMHA 1U6JA 2RC5A 4HGQA 3EGVA 1X42A 1HG1A 3G2NA 4CVUA 3UB4A 2YHUA 1PJQA 1U9JA 4MWSA 1COV3 4YP0A 1L5LA 1ZD8A 2ZGVA 4MRPA 3L8FA 1DQ6A 1KP2A 3PRKE 2RH8A 2HO5A 3RZLA 2GP5A 2LS6A 5JYDA 3W5HA 2V45A 4MI9A 1NXVA 3MPOA 4OB6A 2Q5CA 2K87A 3SS9X 4QO8A 3FGZA 4E7PA 2GETA 1TYDE 1HL3A 2ZRNA 5EA2A 3H3FA 4C2UA 1YZVA 3OZ7A 1IHOA 1EXMA 4CR6A 3LUGA 1PK8A 5ENDA 4WDQA 3P97A 4TVKA 4MUEA 4W7SA 4E4SA 5T8KA 2YJ5A 4JOQA 3VBUC 1N1SA 3KKMA 4MGSA 4JX9A 3ZN5A 1L8XA 1T2VA 5FY8A 2QYOA 3PUQA 5DIFA 2E89A 4PQ9A 3HN2A 1RUJ1 3BMNA 4L2NA 2WS91 1U8ZA 1L1RA 1GTSA 1HXS2 2BRUA 2HBQA 2VMDA 3LJKA 1GP4A 4DLNA 4Q6BA 2FR8C 2MSKA 3D6MA 1N3BA 1Q50A 3K6SB 2FWNA 4GPZA 3ANSA 4NZNA 3QD6A 3TLZA 3HOBA 1NVGA 2ECQA 3B36A 2X9VA 3T3EA 1FU8A 1LJLA 4WKOA 1OBHA 3CFYA 3VR5H 1VRWA 2FFAA 3BJRA 3JZVA 3AIIA 5A2QA 1UT6A 2N47A 3FUVA 5A3QA 1KJQA 1I2MA 4BOYA 5C7GA 2EQ5A 1EE2A 4FQ4A 3L6UA 3IIMA 4ZQFA 1GUAA 4YMUA 3E2PA 4G1VA 3ONDA 2FCAA 3HO1A 4ZANA 2VPIA 2PA7A 1THZA 2R6GA 5E9JA 5SV2A 3ZLVA 3P8ZA 1H5NA 4QFBA 3IAM6 1T9CA 3CRZA 1Z28A 4UHBA 1YDWA 4IGOA 1DKMA 3V7NA 1NLFA 2C2WA 3ZHZA 4PAGA 4KDEA 1SC4A 1PFVA 1FFCA 1R1A1 3RFRA 2JI9A 4X6RB 4AG4A 1O0BA 3KT0A 1SVMA 4QIHA 1WCIB 3I9OA 4UQLA 3D3QA 5LBEA 5DTQA 1P6QA 3CLSD 3TOXA 2X8WA 3QX7A 4ER6A 1QHHB 5IJ9B 2E9QA 2GNDA 1ZUIA 1SH7A 3OO0A 4YCSA 4G1UC 1HBJA 4O2LA 4Y20B 3PYMA 3WNOA 3MIHA 5C5DA 3QVOA 4UVHA 1J5PA 4RGVA 3AZQA 3MRSA 4NWIA 4BGDA 3OU6A 3AZYA 2UYQA 3WP6A 1FP2A 1W3XA 3OM0A 2F4LA 1W5EA 3PNKA 4KK3A 2HV9A 1Y8RA 1MVQA 4KQ6A 3A27A 1H0KA 1SZJG 4UVDA 3R4CA 1IS3A 1CJKC 2WTUA 2XHEA 2YHAA 1EU1A 3ZDFA 3CUUA 1HNWB 4CI0B 4XF1A 2YZ4A 2IUEA 4V0QA 1UXJA 1OI6A 4G4FA 2H2HA 5JZSA 4FTSA 1XRNA 4GNRA 2ZATA 3KTAB 3KUXA 4HDSB 4C08A 4ZCMA 5I9NA 2QYHA 1AMOA 4QXOA 3PHBE 2HHAA 5TNXA 3E61A 3K5HA 3KLSA 3VZDA 2XJUA 3KEGA 8MHTA 2WNVC 4JJKA 1NJ8A 4QXCA 1II9A 1GNLA 1MAWA 1RZRA 2H1WA 2N46A 4LSWA 4EB6A 4EKGA 5K0LA 2ZT7A 1LV8A 4HOYA 4Y9RA 5FBLB 5FV4A 4DXZA 4YGDA 5H70A 3EXHC 1KQPA 1J58A 3FVVA 1GCIA 3TOSA 3KBOA 4G36A 1Q2UA 2WIFA 2I54A 4MRSA 1ZC4A 4Y1EA 3HGTA 3Q9SA 4KP7A 1CR2A 4G37A 2K4MA 3OJLA 1QYRA 5EUMA 1PJZA 3OBZA 4WNAA 1Q22A 4GWKA 1A8PA 2A7QA 5IVFA 5JOYA 1LKNA 4GPBA 4XOUA 4F3RA 2UU8A 2FVXA 3GJRA 4B6OA 2G6TA 2KWIA 3N39C 4EI2A 1ZZBA 4JP3A 4WCVA 3NEPX 4RV4A 4GMP0 3IUMA 1ZBA2 2GF2A 1MACA 1X13A 2I62A 3LIIA 4B8YA 4X66B 4URXR 1PMIA 3QHAA 5H5JA 1XC6A 3EVFA 3DHEA 4BMBA 4W6YA 2FZ4A 1GWLA 4RDHA 4X5OA 1A04A 4H17A 4NCNA 4UE6A 1BQ3A 1KYYA 3KXPA 2WIAA 1DO2A 2B3DA 3IB3A 3QVWA 2XGSA 3JWIA 2C57A 3KZXA 3WBBA 1KO8A 2D7JA 3TH5A 1GRRA 1TO6A 3IESA 3NGXA 3HKEB 1K27A 3ZXJA 1JZ2A 2W6QA 3MN1A 4Q0QA 5JPMB 5K2OA 2OCGA 2DLCX 3RFUA 1VPDA 4LHZA 5C8YF 3AEKA 1WWYA 3BMCB 2PHTA 4IE0A 4AGGA 4IV3C 2A5LA 1Z6TA 3DHVA 4W8JA 1HRI1 2IV2X 2CY6A 2ZOSA 1J8VA 2Z1DA 4MH0R 2O1EA 3U61B 3QNWA 3L7CA 3AEUA 1NC3A 4HWGA 4YM1A 4LMBA 3NH9A 2JA2A 3KKLA 3I9LA 4PX9A 1D4VB 3O47A 1NC1A 2VT6A 1H9CA 1X19A 1W0JA 2F1HA 1Z8HA 4U2GA 1J21A 1JTZX 3IHLA 1UCFA 1C4WA 4YGBA 4QQRA 1ZL0A 3SBOA 4AL4A 4PSKA 1DKNA 3FPHA 2QD2A 2FFBA 2IYYA 3I6YA 4DGSA 1V43A 2ZU0C 4GKXA 4BC0A 1ZP6A 1OD3A 2H6EA 4CT4B 3LC7O 4RQBA 4C4AA 4J25A 4MPTA 1BHO1 1RHQA 1EK1A 1RUC3 4XHXA 4UYBA 4QUHA 721PA 5BXXA 1ESDA 5HDQA 3L4BC 1LI4A 2R8XA 2C4NA 1QWOA 2Q46A 2J22A 4S1WA 3Q15C 1ACCA 3LK6A 2HADA 1NA1B 4OHZA 5AW7A 5LBIA 4PWYA 3BDIA 2RDQA 3JD71 1KDZA 1RMU3 5BNFA 2OKGA 5F1RA 2H4JA 4KWIA 1IS4A 5ITVA 2A71A 1SKYE 4NPMA 1EWVA 3MS7A 3HB7A 4TZKA 5E4YA 4NNPA 4A9AA 1ZK3A 2YOFA 4UU8A 2C2GA 3KB1A 1TYCA 3IOMA 5D84A 3DFZA 3LT2A 4M9XA 1KAGA 4RPKA 2ADDA 1XOYA 3PGVA 3GBWA 2QMUA 1JX6A 3W0LB 3M3DA 5E8JA 3HU2A 4H6WA 1K5MB 1R3DA 4M00A 2VMCA 1E3WB 3HI6A 4MR9B 1EA7A 3QQPA 3IUSA 6CHYA 1G3RA 4KW7A 4I9NA 5K8LA 3MG9A 1VKHA 1GP2A 1RZ3A 4ZTZB 1BVP1 1FS6A 1H8ED 2NO0A 1XHEA 3A4VA 3MIIA 2DTDA 3OOXA 4DWJA 5CFMA 1UN1A 1GY8A 3HU1A 1PIV2 2YUTA 2E6VA 4FPLA 1W35A 1Z5OA 4B45A 1CZOA 1W5TA 3ZE9A 4WOBA 1E64A 5G0UA 2YICA 3IPLA 3NTVA 5CM8B 4XWWA 2ZZJA 4MVJM 4LN1A 3PFNA 3DMFA 3SHFA 4LO8A 3EHEA 2C5HA 3M82A 4RR3B 1BKDR 3PTZA 2OBMA 4AR2A 3TE6A 3TQCA 1LLUA 4A7YA 4II7A 4UXAA 4AS1A 1YR1A 3T9AA 1JODA 1L5WA 3OQIB 1SKQA 1W8WA 1L4LA 4KOAA 3HM2A 1QGLA 1SBYA 4N7MA 1CY2A 3H2IA 4TZDA 3WS7A 4WV8A 8GPBA 4X7MA 1TCVA 5CB7A 3VAYA 2AOXA 3P45A 4JWTA 1BA2A 1A9PA 4BXOB 4U4AA 2QW8A 4EN0A 3CNEA 4Q93A 1PDOA 2EZUA 4C78A 2P2DA 3GJ8A 5AHKA 3FCAA 3M4NA 2HLPA 2PZMA 5A9SA 2VL4A 2WQZA 4RCZA 1H1LA 2L2QA 4Q19A 4ZZIA 2BUAA 4QKDA 4P32A 4UCXA 3LQYA 1T15A 1S01A 2IYXA 3KS7A 1YJ8A 5KCMA 4YFYA 5C8VA 4PT6A 3CY6A 2VCAA 4G1BA 2XZLA 3EUWA 3GJSA 4ARSA 1MDFA 3T06B 2D5HA 2G04A 4AVYA 5K0UB 3BTYA 1XKXA 2XKBA 5G40A 3IXLA 2W92A 1GAQA 1H9AA 2VDWB 4GKKB 1ZMBA 3G5MA 3J9SA 4OFBA 2ZTHA 2BGWA 2KA3A 3VH2A 1UC9A 1GICA 3ADBA 1M1ZA 2J5BA 3KQTA 3A1TA 2GZSA 3JTEA 2IBTA 1X8KA 1EVIA 4XXPA 1PG2A 4O4HB 2BFPA 5L4SA 2QQKA 1GZDA 1HG0A 1GQQA 2VQ6A 1QJCA 4FYXA 1ZRRA 1NI4A 1PJSA 1R092 2JCBA 3PJFA 3VBRB 1Y3BE 4HAXA 4Q4JB 3V4RA 4FO9A 4P36A 1OLUA 1MPTA 4JGZA 2HWF2 3NAPB 1DJMA 1N75A 2JBAB 3U9TA 2O8NA 3HBAA 4RVGA 2EIEA 5CA1B 5JNRA 2HJ9A 1CULC 3IIKA 1RLIA 2COEA 1YIPA 4ENUA 2D5CA 4XFKA 2HSGA 3SKYA 2JAUA 3W4JA 1R4ZA 4LHKA 4ARVA 4QWWA 3WLAA 1L5RA 1YBMA 4D9BA 1JFFA 3WSWA 4GH4A 4QD2A 5AI5A 4HNUA 3C3DA 2VHVA 2R6AA 1DWPA 4PSUA 2P3LA 2JIPA 4RYDA 4ASUD 4KFCA 1AL22 3FTNA 3ZCQA 5TEVA 2J9RA 3EQEA 4KYIB 2AZTA 4Q4V2 5LR6A 3DXFA 3U60B 1Y1KE 3I05A 3I2JA 3TW4A 3M6LA 2YGMA 1U0RA 1TLTA 4DT1B 1LPMA 2BKEA 5JVVA 4MKHA 4MEAA 2NMOA 2JIDA 3L4EA 3KGZA 1XP5A 2M2IA 4Q0VA 4AJ1A 2Z5WA 2WZR3 1QHFA 4JVMA 4AQDA 4BA6A 1E2IA 3MVEA 3Q2OA 2Z30A 2SECE 5FIUA 4XTMA 3ET4A 1SOMA 3VHQA 4E3WA 4N53A 1V6JA 3R0RA 4M83A 2YXDA 3UJ9A 2P3JA 3WDVA 4E4HA 1SMKA 3GLHA 1KMIY 2VUAA 4MX8A 2VP6A 2H5EA 2YJ3A 5DVZA 1GPJA 4CCAA 2WO7A 3I32A 4BV8A 2PT6A 1ENXA 3TUJC 4DWOA 3GZNA 3OWHA 1MAVA 5ELMA 2BFBA 4MGQA 1A71A 2I4IA 1MEJA 2C7OA 2RARA 4MH0E 1OXBB 4ZOLF 3ZWAA 2P34A 4OUDB 4EYKA 1X1DA 5EP3A 5DK6A 3OUUA 2BUKA 1ZVFA 1DTWB 4IIDA 1RE1A 3VAAA 3OM1A 2LKCA 4D9HA 2WNSA 4CM8B 2AFHA 1XGKA 2WD8A 3JQDA 4Q4CA 3OBIA 4ROTA 1QHGA 1A1SA 2FN8A 3B6KA 2GCEA 2PLRA 2G5CA 3ILNA 1T5HX 4H1VA 2VRCD 5FPAA 4CM3A 1CD5A 3SK0A 2XKPA 4P8RA 4DE5A 5T52A 4TLBA 3EISA 4Q1BA 1TVKA 1DLLA 4YVWB 3MIBA 2QMHA 3OYWA 3HZRA 3ZH2A 2R0QC 4WINA 1I5OA 1QMGA 1QIKA 3GELA 3V8EA 4QPIB 2PZKA 1LDBA 3ZZ0A 1U0SY 5D3KA 3GGJA 1HQLA 1VBA1 1DCKA 1KH3A 2IYNA 5EUBA 4OQEA 4R1LA 2XMPA 1N8NA 4MGYR 2ZRFA 4QJ5A 2HGSA 2EBWA 1Z17A 4QYWA 2FW9A 4K03A 3R3YA 4R84A 1I36A 2YY5A 1EAH1 4QAJA 4BP1A 4Y2UA 3V00A 4OHKA 2P6PA 1RUF1 3HB4X 4HT1T 1HUQA 2J9FB 2FW0A 3ZTYA 2HA7A 1JKJA 1T5OA 1XX6A 1DCSA 4Q4X3 4IXNA 4QULA 2LRHA 1A8IA 5I5GA 4WXHA 1USIA 2GN6A 3ETCA 5C9ZA 4PF1A 2DFNA 2OBYA 4NU5A 1WA6X 3NRBA 3FSGD 3TGWA 1NVTA 4ZARA 3LE0A 2RONA 4JOCA 3J81k 4RMHA 2BZ1A 1CQ9A 5BR1A 1UWKA 3ICCA 3X44A 2DF7A 3VO9A 1W75A 1RXFA 1UZVA 2ZHKA 3FVQA 3RTCA 4QMAA 3QRWA 1F1JA 3B82A 1H3EA 2AEEA 4MUBA 4NV1A 5C5UA 3C8DA 4BMEA 1YBFA 3B85A 5E1MA 3U14A 3HCRA 4B4OA 1SJ9A 1T2EA 3AP2A 3B3JA 4LWOA 1C7ZA 3RBZA 1W6NA 1AR62 4HG6B 1N2CE 2YINC 3QXHA 3WNLA 2JGKA 3R75A 3JQPA 5IVCA 4G3XA 4DLXA 4W6QA 5EN4A 2HCFA 4DZZA 2ARCA 2YXEA 4HKLA 2YU1A 4OLBA 2AVDA 5FWDA 1HRDA 5TQ2B 3IYLW 3SF8A 2WHXA 1J84A 1CE8B 2AG1A 4FGWA 2QD1A 1NW5A 4TMXA 3A36A 4IW3A 4AP9A 5JE8A 4PHCA 4PZLA 4H7IA 3OAAA 2P1DA 5AW9A 4Z7JA 3ZVLA 3UBTA 4WM8C 4PJYA 2ZTNA 2OZLB 1ZBA3 5C80A 3CNOA 1RAHA 2YWCA 4CLRB 3TYJA 4I1YA 5KC9A 3SEEA 1UK8A 3P52A 4ONUA 1A98A 3L7OA 4YJ3B 4PG4A 1H9BA 4ZKTB 1LB2A 4IJVA 5AK4A 4EG8A 1CXZA 3G5UA 2EFYA 1SXJD 5KYTA 1H6DA 5GONF 2VJQA 4WADA 5BYBA 4PLGA 4FBLA 4NEGA 1XU9A 3UV7A 3GO4A 3T0GA 1VP6A 2EAKA 3EQ8A 2PH1A 3THTA 3GCXA 4LE4A 4EGCB 1ZM7A 3L9WA 4RFLA 1NFFA 5HQJA 5KC5A 2DP4E 3CX4A 2G17A 4I09A 2JI8A 2XA1A 3DV2A 4D6QA 2ZFUA 2QQGA 1IKQA 2Q3MA 1ULAA 1KZ6A 4CMEC 3T1TA 3M9WA 3CX7A 2W87A 3DYVA 4D0LB 5KHIA 3RRBA 1D6NA 3ROPA 3VNQA 5FDBA 3HBZA 4Z53A 1W6PA 3T4PA 3L05A 1W0KA 3WV6A 3M49A 4XUTA 1FMFA 4CCNA 4DA6A 3EUEA 3A4UA 2A6XA 1ZD2P 3A1DA 3EWNA 5BWOA 2V5AA 3NHLA 5AVWA 3BMNB 2GWHA 1SIWA 4AF6A 3JQFC 3BVPA 1W6QA 3WBFA 4P22A 4X6XA 3H6HA 5LMUB 4DMIA 2BGLA 3USZA 1PWEA 4MRAA 3MB5A 1G2PA 2ATEA 2FZ1A 4XR9A 2VF4X 2Q6VA 2V7UA 3OHSX 4WI1A 4BXFA 1O95D 2QROA 4DCCA 5AVPA 1OTYA 4OXXA 3RTBA 3WINE 3HCOA 5AKEA 1VMDA 4U2BA 3C3AA 1A4XA 1N1GA 2WSSD 2ZJ1A 1D2RA 4PAMA 1Z2NX 4XDYA 1SKYB 2CLLB 3IT1A 5GJVC 4ZVMA 2HWB3 1MX1A 5DLPA 4F1JA 1U5AA 4P98A 2RHWA 4UAJA 2YJNA 1G8FA 1QF6A 1IBMB 2GSDA 3HFGA 2AFHE 2VUDA 2IFRA 4D56A 2MEV1 3G2IA 4NHKA 1WIWA 4TL8A 4PHFA 4B4PA 2O5CA 4EN6B 2AOTB 3I34X 3OF3A 5FZLA 4GPD1 1VSUA 3KP1A 2JEYA 3W5BA 4BS9A 3W78A 3GVIA 1HL7A 4FMCF 4AWAA 5CURA 3Q7IA 4GUDA 4NY1A 4W50A 2X7HA 1ZI9A 5JAOA 2HJHA 3IP6A 2Y1OA 3AMVA 2VTXJ 1MS5A 1C0IA 4H08A 3NC4A 2HEYF 3PSAA 4IPTA 4OK5A 5C53B 2H4FA 1I30A 4L0MA 5E6RB 1N3OA 2REBA 2RK6A 2R3SA 2B5VA 2QAJA 2RHGB 4UVGA 2JDUA 1SCQA 4AN1A 2YPDA 6YASA 3ZU3A 5FUVA 4DV1B 3ZZUA 4HDNB 2HEIA 1AU9A 2X5XA 2E1RA 4DCGA 3MW4A 4I1OA 1JDBC 5GZ3A 3AESB 3ZPYA 4GMP3 2HWC2 4UEOA 1OXSC 2HU7A 3L07A 1B6RA 1XSQA 3I45A 5KTTA 3I2KA 1T3TA 3HCCA 3CC8A 4TXLA 4HSLA 1S9HA 4HXGA 1YE3A 4EF4A 2PX2A 2CMKA 4IJWA 3FFAA 3D8HA 4KNWA 4BKQA 5E4FA 3AVOA 2XVMA 1TQ8A 3W06A 1FZTA 1NR7A 4NK5A 1NX9A 4IICA 3H1FA 1M33A 4YRSA 3V1LA 3FI9A 2EBUA 3OEHA 5DNWA 2QY6A 4EB6B 1IPJA 3SX2A 3GZTB 5K1ZA 1ZM4A 3KVAA 2DVBA 4DV5B 4EHNA 3DKQA 3ZXAC 5TV2A 4G1MB 5CM9C 1QP0A 3CR3C 2I2WA 1GD1O 3RIEA 3SKJE 2Z2IA 3NHKA 1WD3A 2IHJA 2XUEA 4EATA 4IOMA 1M0EA 1BDHA 2C95A 4BMXA 4PBOA 2D74A 4HNGA 4WNAB 4KX3A 4F60A 3CX6A 3GCGA 2BUCA 4CIDA 4CUAA 5HZMA 1WW5A 3NH6A 2XCSB 3AM1A 4LYEA 4QFCA 4ARAA 1H93A 1P91A 4ZQGA 1SXIA 2F1RA 3TEXA 5DH9A 3KKKA 4BTLA 4O9GA 1VBD1 1N6OA 1VDMA 4DV6B 4L76A 2OA2A 2H7CA 5KNBA 1OFTA 5IT0A 1UQUA 3U39A 4IP0A 4PTLA 4KFUA 1N9GA 3IAXA 2XVKA 2HWF3 3T3YA 3WLMA 4YW5A 5KNDH 1DNPA 4ZU3A 3HNRA 4KBGA 4KQMA 1P2BA 1M1NA 5JXIA 1AKWA 2Q0QA 4EI9A 2ZS6B 3IR6A 5AI8A 2HRCA 2F8TA 2C42A 1KKUA 1KU0A 1ISHA 1AUXA 4IIUA 2QRKA 2PAAA 1VJ5A 1F5FA 1FNSA 3VTKA 4NX2A 4KXNA 5ICSA 1S2OA 3ZGVA 1J0AA 2F55A 1V8DA 1DRWA 2QR3A 1ZHFA 5KTYA 3WYDA 2QJFA 4TYYA 1AL23 3AEKB 2BEKA 1JHOA 1JEAA 4Q3OA 3HYNA 2OBXA 3LZZA 1EG2A 1T2AA 5GZ6A 2OWEA 1RUD1 1J33A 5CHEA 4P82A 2NN3C 2ZI7A 4DUZB 4KSCA 3ZCTA 4YCLA 4TGLA 1N0VC 4IZHA 3TSWA 5F3EA 5CA0A 3C5HA 2BVNA 5IM4A 1I6WA 4F3NA 4LBOA 1CJVC 5CT9A 1N8KA 2I4LA 4HNRA 3USES 3KXLA 5BW4A 3P9XA 1UPUA 3LSEA 5K99A 4HH1A 3MQ2A 4MA0A 3AYAA 5KNBH 4QKFA 4ESOA 1G41A 4RESA 4DIQA 5ER9A 1SU6A 4G8DA 4IY1A 4C5BA 3V0BB 3GLGA 4ZU4A 2G1PA 4XUPA 1HWYA 5AOBA 1JECA 5A7PA 2A73B 4H14A 4MB0A 1RYNA 4XUDA 1JLSA 2C98A 2C7GA 2WT1A 3NXKA 3OSDA 2C4MA 1R0CA 2H16A 5TX7A 4UEWA 4ACAA 4HUJA 4O4LF 3LFHA 2ZIFA 5BXYA 5GZFA 5IVVA 1BWRA 1KZ1A 3M4JA 3UKNA 4N0EA 3FKJA 3SX4A 1KAMA 3BORA 1YV9A 1KTIA 2BPOA 2P65A 2RJKA 4DXDA 4IFBA 1HYQA 3AP1A 2JNWA 2HLHA 3KYJB 1FK8A 4NG5A 4J9VA 2KLHA 1LODA 4CIVA 1U04A 4DF3A 2XUJA 5KKCA 3F49S 3I6MA 1Q3EA 2AXNA 1XO1A 4BFYA 4JV4A 3P27A 3O14A 4DZTA 3KBBA 4NYJR 3LLSA 5CK5A 2X4IA 2VAXA 1R0XA 1YEWA 2I80A 2V9CA 1XOIA 3LO8A 2NVUA 5AVKA 3B9PA 5FZCA 2BOVA 3USSA 2O2IA 4BEJA 1ORRA 1YRBA 2E82A 3C6QA 2RJ2A 2JFPA 1U5BA 3AERA 4NYIR 1UQXA 1PKEA 3DE7X 3QUBA 2WVAA 1BAPA 1EK5A 2X5IC 1JBKA 2JWPA 4L8FA 3U5ZB 3TIGA 5A1AA 2WMNB 1LENA 4I7EA 1XF1A 3ICOA 3PVCA 1US2A 3LVFO 1XQVA 4OYRA 3KPJA 3U10A 4FOVA 5C8CB 2CJPA 1XQWA 4J9UE 4DBLC 1VCNA 1ORVA 1K86A 2GOYA 3AKTA 4CF3A 1WSAA 1XQ6A 3JWPA 5G1PA 3CW9A 2XYQA 3W2GA 2VP5A 3K05A 5DG1A 2NLOA 5FA8A 2OCPA 1ODCA 4KCGA 4KLCA 3VZCA 1HYHA 3ZE2B 5FY0A 4ZHQA 1NOKA 2PL1A 2EERA 2CLKB 3D6JA 3RGBA 3IDEA 4HNQA 2RIRA 5E1BA 1GTMA 3ZWYA 1QTRA 4UATA 1UADA 4PI2A 1IULA 4EF6A 4NYMQ 1L5VA 4XVHA 1GPBA 4QYTA 3KOYA 1I7SB 2J32A 1E5RA 4D41A 4EJ2A 1N2CB 2HBYA 5C1DA 3A7DA 1RC1A 3EPRA 1B0UA 3KXDA 5A9SB 2QP4A 1HN1A 2ZYHA 2JFBA 1KL7A 1ZA7A 5WRFA 5BR8B 2RM21 1UY0A 2ZITA 4H1HA 3OIVA 2YVQA 3LVQE 5TT0A 1UEIA 5KQPA 1FFBA 3RTAA 4B40A 3ILVA 3FBMA 4DJJA 1A9XA 4HLUC 3KOMA 3OC6A 1SVIA 5A4DA 3KR9A 3KZ1E 3SOZA 5B3AA 5JRJA 4V1PA 2ZZMA 1SFYA 1IN1A 4DR4B 2C26A 2JAHA 3N7KA 3K0CA 2VAPA 4ZAXA 1W9SA 1IK4A 2XNDA 3RJTA 3PHLA 4X7PA 1T1RA 2PGJA 3PV0A 5IUJC 1TYAE 4ASLA 3KF3A 3K9NA 3TJMA 3AVTA 4XB1A 3H18A 2OFWA 4RH0A 3H17A 1U5YA 1T3LA 3AONB 3V1KA 4DLTA 3WGQA 1WW4A 5HSGA 3E6BA 2OV1A 3KDPA 3A0NA 1GNSA 2C00A 1OLUB 1LHUA 3ZIWA 4IIXA 5ALVA 1IJBA 1OFUA 2OPBA 5E9AA 3O94A 3MJHA 5ECGC 2DFDA 3DZCA 3O1JC 1AKYA 3H19A 3ZHOA 3SICE 3WSVA 3FPLA 2Z8XA 2A1XA 4EZ4A 3NS7A 1TZOA 4FDUA 3DNFA 1FDSA 1FDTA 1JFFB 2C2BA 3MCTA 5J5CA 1X8XA 3NRCA 1AKUA 1UMIA 4DSOA 2KHZA 2RG7A 2E4AA 1O94C 1UMKA 1O96A 4KRYA 1VIDA 3JB4C 4Z1VA 2I78A 3KZOA 4PCRA 3LT1A 3AZPA 3A2MA 3FE5A 4B46A 1XVTA 2DECA 3FUTA 2F3PA 1XFDA 3LL7A 4GOOD 1PQPA 1W49A 1D1QA 4RC9A 1TK3A 4YM3A 2YDXA 2XMZA 1N77A 2WZDA 5DXDA 1KDKA 2A86A 2V5UA 1AUYA 3TD9A 2MTBA 4N53B 5ESDA 1POV3 4Z0NA 4FCTA 1VTKA 3CU7A 1DGWX 4TXNA 1FX0B 3P19A 1DO8A 1L5KA 5FOSA 4H7PA 4AWBA 4LJ7A 2PS1A 2XYGA 3GJ5A 4ENTA 3GLGE 1JZSA 4EOGA 4QQHA 2R84A 2OV3A 2X1VA 1LTHR 1OLQA 2E18A 2PLNA 4YLZA 1NGSA 4CZ2A 4D92A 4XOGA 1UYXA 1VHWA 4GI5A 4B4QA 1Z9BA 4MVXA 3RIXA 2I34A 3R7FA 1NL3A 1COZA 4ZCTA 3IBGA 2ID8A 2AFHB 3G8BA 2ZJ6A 3P26A 5ALPA 3ND7A 4A5SA 4ILKA 1EDOA 4Y33A 2W4MA 3VYRB 5BN1A 2TMGA 5KI6A 5ACA1 4YCJA 3BK2A 3O0DA 1WXHA 4HJXA 3OJEA 3H97A 3KHCA 3SBDA 3NW9A 821PA 1TM4E 4L8VA 4WKPA 4IEXA 4ZPXA 4NOKA 4TYPA 1RDFA 1S2DA 3LYUA 2F8SA 2A3NA 2IBMA 1AMUA 2FRDC 2GHQA 1J20A 4I1UA 4PSDA 1ZN7A 3VZSA 2JI4A 3K70B 3EVGA 3LZ6A 3QFHA 2ZQYA 5EHIA 3I1FA 1SEFA 5LBFA 4PAQA 3F7TA 1U9ZA 1E6LA 2WM8A 2P5BA 2QORA 3DE3X 4BWOA 3MTDA 3P9RA 4K05A 4CG1A 3JQ9C 3O7WA 4SBVA 3CF2A 1YFLA 1U0AA 3VTAA 1OPOA 2R1UA 4UFJA 2VNKA 4UFIA 1RHUA 1LU9A 2OGWA 3AR2A 3RLFA 4B3CA 4E5NA 3QOXA 4D3XA 3BA6A 1MABA 3PTLA 1QIQA 5J1SB 3OC0A 5E3HA 1JKJB 2BMWA 3RM3A 1GWMA 3DMNA 1TXGA 2NWQA 4H60A 3CNQS 3GJ7A 2ZBRA 4EHDA 5BUVA 2KM2A 4LOJA 3VR5D 3A3YA 2OQ6A 5E4TA 1B15A 2CXSA 3OCUA 4ARXA 5DTMA 3H2JA 1JB1A 2RS11 1SR8A 3VC3A 3F2IA 2Q6KA 2V7VA 3DFIA 1Z6QA 4YUWA 3W6ZA 4IDCA 1HK7A 4M6WA 3IBSA 4F1WA 4BE4A 1A8UA 4E4ZA 1YO6A 3H9GA 1XRMA 3U19A 3TOVA 4JOSA 4UMFA 4NK4A 5DFAA 1G8WA 1EP1B 1PJAA 5D3QA 3B3GA 5K9YA 4OQDA 5ERYA 2GPWA 1J0EA 2Z98A 1B76A 3T3IA 4D9GA 3WAGA 4RF3A 1TC2A 4J6GA 2PTHA 4KQGA 1CR6A 4QQLA 4LMRA 4F86A 2BWCA 5FYZA 3IDZA 3KB6A 1M34A 4ND7A 5PNTA 4AKSA 5JJLA 1W85B 4RW0A 4UM7A 2WDBA 5KREA 3E81A 5E8AA 4YRFA 2GC2A 1KI6B 1ZJZA 4WESA 2W08A 2JD0A 4PNPA 5B1SA 1KHHA 1G9TA 2NV2B 3UAWA 1M6NA 2JGFA 3SF8B 4IDEA 5FP4A 4OJTA 2NUAA 4BIOA 2D6NA 1YQXA 2VZSA 4D9FA 4MARA 4N5MA 5FREA 3TQHA 1ODNA 1HSOA 3NHYA 3VBOC 4B4VA 2PGNA 5KVSA 4PHTA 3UHPA 2VQFB 4HBGA 4GBGA 2OV4A 4AMYA 3ZI0A 3NP9A 4UQPA 2P4QA 1EP0A 4OA5A 2FQYA 3IMMA 1YZTA 2JGDB 1R0RE 2WWJA 3R3JA 1RFLA 4C1BA 1DQ1A 4IEWA 3AB7A 4RX1A 1EUTA 1UJMA 2RHHA 1JSCA 4K0KB 3LFMA 1SC6A 1ADFA 4UCWA 2O3SA 1Z83A 4K6OA 5F4BA 2VXBA 4XQCA 3KZNA 5JCOC 1VL2A 3CXUA 2ARBA 1QRAA 1XJ5A 3LKVA 3QE4A 4MQFA 1W8HA 1XSEA 1VP3A 4P9YA 4EL0A 3HU5A 2G06A 2G9FA 5EHDA 1MOQA 1FFAA 3R0QA 2RGBA 3OE5A 1NASA 4MR7B 1HXHA 4C2AA 4TS4A 3G17A 3I8OA 1C2TA 3GP8A 2D7CA 5KCZA 5IHPA 2R16A 1A7KA 4CDQC 4ZCPA 2O54A 1Q0SA 1FFXA 1Y33E 3J8F1 2HW8A 3EIQA 2LM3A 1D4FA 3OHPA 1PGW1 1I2AA 1CJPA 1Y37A 4A03A 4HB4A 4ALIA 3N0WA 1U7OA 1LPSA 4ZFNA 3ZDSA 3H84A 5FOWA 3LQ4A 2QRHA 1Z6AA 3C87A 4IS2A 1WL8A 3S1SA 5IVKA 3EIFA 3DNMA 1K8RA 1SCAA 1W6QB 5M34A 2J3JA 5HDBB 1A2OA 4E12A 3NKLA 5KTRA 1DEOA 1J1IA 4WCFB 1XNJA 2V59A 3MWDA 4EEXA 1X7YA 2AR0A 2I4NA 4I02A 1ZXBA 1S4CA 1KMQA 1T6NA 2X9GA 3I3OA 2J3EA 2P9EA 2P27A 5EZYA 4FTEA 4IIFA 4DG5A 2BKAA 3QBJA 1ISRA 5FUYA 3K4DA 4NRQA 3PXAA 4BFZA 5CPBA 4GRDA 1A95A 1I13A 1SEPA 4LJLA 2WD7A 1YSCA 3U7JA 1TZ2A 2XE6A 1QJY1 3LUHA 2PH7A 2PHFA 4XASA 1IPEA 4OBWA 1L5YA 2BR4A 4X1KB 1V1JA 1EP3B 2CKMA 3EDOA 2I3ZA 4YV1A 3BT7A 4O0MA 2ADMA 4HAUA 5ESXA 1H3FA 4MADA 2HIGA 4XWAA 1NBOA 3S0JA 4JX0A 1EUCB 4BQWA 3P9IA 3NGLA 1XZMA 1M6EX 2HJRA 4DBVO 5D2AA 3U26A 5BYNA 4FOSA 4EELA 2XONA 5EV7A 3SS8A 3RUAA 2WJWA 3VPCA 4EITA 4GWGA 1LRHA 3I09A 1ZBDA 1G7CA 3B5JA 2I3BA 5AKHA 4OBXA 3WP5A 1APBA 1B6TA 1QPBA 4CDXC 5JLJA 3FE2A 2P7IA 3EXG2 1IS6A 3CJIB 1T9KA 3O9VA 3GXOA 2LTNA 2HFJA 5KOJB 1S4MA 1MEEA 1XD2A 1OBCA 3VDQA 4MB6A 3BWCA 2WMDA 3WG3A 1C80A 3FWNA 5AK0A 1KIAA 1E9RA 2P3YA 1XZHA 1EINA 4C1XA 4NJOA 2ZAIA 2ABWA 4FS8A 4YO8A 4YI3A 2A9JA 2D0OB 1ND2C 2A5FA 5IC5A 2XUKA 1XNCA 4B3SB 3NNGA 3UTCA 5SY9A 4XWKA 1HEYA 1QCYA 3KGLA 3ZDBA 1RT9A 5A6YA 4OK3A 4LHNA 3HLYA 5THQA 4F5ZA 4IG9A 3PJYA 4C43A 1VMEA 1TJYA 1WW3A 2XOKD 3PNLA 1Y8QA 1SWVA 1U7TA 1VPEA 4M1MA 3K09A 1WXFA 3SYLA 4PRYA 4KQIA 1PQ4A 1H0SA 1WXDA 4LI0A 4Q4HB 3RTGA 1MVEA 4W4ZA 2ZEXA 3VX3A 1PZ8A 1GZ3A 1KZYC 3UO8B 4NOJA 2W6PA 3A1NA 2O0LA 3O9ZA 2HWYA 3OKAA 2AN4A 4PLVA 1C1YA 1P60A 3BJZA 3X43A 2F1KA 1QORA 2CZGA 5IU6A 3FHQA 4WEOA 2GAOA 4UTRA 4X94A 2J8ZA 2LIPA 3ZJTA 4P92A 2BQPA 5FO9B 1ND5A 2VQ3A 5HCAA 3KCXA 1ZJYA 3OF2A 3IIEA 3RG8A 521PA 2RE9A 3AOGA 3P9KA 3TTUA 2HWD1 5LA1A 2G3YA 5DYNA 2XZOA 1E94E 3PWKA 4YG0A 1M34E 4A0QA 1QG6A 4MX3A 2E31A 1FPN1 3RC1A 4I1VA 3R8XA 1JA1A 1FFWA 1WHTB 1HPLA 2JVJA 3I64A 1RUG3 2EVWX 2AE1A 1W2UA 3FNQA 3D8UA 2PSHA 2FJPA 1NVWQ 3REQA 4L5CA 1O0CA 5CFNA 1OIVA 3U31A 2RH9B 4F12A 1CUCA 4CP9A 2C07A 5L73A 3G2HA 4R9UC 2F17A 3V34A 2GAFA 5I4BA 4NZPA 4YWJA 2P62A 1M83A 3TPZA 3TKAA 1CJDA 2OO5A 1W52X 2XGMA 2B1QA 4B6SA 1OR8A 4JI2B 3AJEA 4KIFA 3BFVA 3O4JA 1M76A 5F2NA 3GNTA 1C7FA 5A1FA 4FZ5A 2QAGA 4J2TA 2GJ8A 4E09A 4Q16A 4AW9A 4M9CA 1DDLA 3DPIA 5JMPA 4K8OA 4HGYA 2CJXA 3WT3A 4GOLD 2IYWA 1Q3HA 1GU0A 3KELA 4C9BA 1EP9A 2JJMA 1F8XA 1P0FA 4MXWA 1ZQ9A 4M01A 3ZU5A 3F5FA 1HFKA 1R8JA 1BE0A 1LPNA 3UG7A 2JATA 1N7HA 1X9TA 4DHEA 4DSAA 2QUKA 3UXEA 2RAFA 4BB5A 4DVGA 1AR72 2R8EA 1YVUA 1R2QA 2IPXA 4Q8KA 3ZD7A 2PR7A 3AEQA 4AO6A 4ITVA 2ZVDA 5FCCA 5T5QA 1X8LA 2IP4A 2W71A 4K9DA 2EDCA 1CKEA 5LK5A 4D9JA 5H9SA 1YS6A 5AKGA 2XB4A 4RPJA 1OF4A 3G2OA 4N5HX 4P9WA 3N9IA 1Q1GA 1JN2P 4YAKA 4OTZA 2XUDA 3LBHA 3AFMA 3GLGB 2R1DA 5FBJA 4XF4A 3CRMA 1VJCA 1NHGA 1ADYA 4NFYA 4M9QA 2C9KA 3HKCA 4G1CA 5KWIA 2Z79A 2VK1A 2FOXA 2X53S 5D01A 1QH7A 4TUYA 2QPLA 1QJ4A 1UFVA 2XI4A 5GZCA 4EN8B 1RRMA 6LDHA 3EG9A 4FC6A 1KJZA 3ZSKA 1GLHA 1QNYA 2BKLA 1RC8A 4AJIA 1NM5A 3PLNA 4WJLA 1L4BA 4B3FX 1HOXA 5ALYA 5KYUA 1HY3A 1PS9A 1XZAA 2PLV1 3DM5A 4A6PA 2FW7A 2RGNA 5G0TA 1U1GA 4IEQA 1ULHA 2CWMA 2IDKA 4ETWA 2HHCA 3L84A 3KT7A 3OCXA 4BNIA 3ASIA 3QOWA 1E66A 2QX9A 4CE8A 3IUEA 2PDAA 3COSA 3Q6NA 4KI5M 2HDWA 4DN6A 1Y9DA 3L1HA 3LPMA 1ZESA 4D7AA 3B9IA 1HZZC 2NVUB 2G4VA 4CTKA 3GBFA 4WXPA 1NRWA 2EC5A 4GRAA 2Q7XA 3ODPA 1JAIA 2GPTA 2J5XA 3GUYA 4Z9FA 1W19A 3L1KA 1I1NA 1IQPA 4BMDA 3H83A 3TRIA 2RHBA 3X1MA 1RWWA 4GW3A 3B89A 4NJ4A 1FMD1 4OCZA 4YRCA 1CG6A 3PDHA 2VH1A 3FB4A 1HIXA 2AJTA 1HMYA 3LTNC 1Q17A 4PBRA 4EY3A 4U7WA 4G67A 4AI9A 1CPYA 2XF8A 3RZMA 1GPUA 1XFAA 1KFUL 4ZDWA 3UB2A 3E2MA 4JEMA 1JT9A 2GN2A 3O1VA 3JATB 3CLRC 3LDHA 4ONEA 5AIAA 2ETVA 2XIJA 4Q0SA 4B9EA 1BE8A 2BKVA 1Q7TA 5CT6A 3VTZA 1G8KA 2ZRJA 4KXMA 4KXFB 1QRSA 1CC1S 4PW0A 2WMYA 3L41A 1R9NA 2O9JA 3BGAA 4FCAA 4G41A 4WMLA 2IYQA 1DU4A 2F7SA 1AMNA 4HFRA 3VJKA 2VDVE 4A8JC 3HO8A 1EVKA 2FCTA 4F1KA 2BKXA 3SDSA 2AT1A 5DP2A 1P73A 3L8EA 3D4LA 4IHJA 3FWKA 4JQCA 4EHFA 2AW3A 1RWMA 4N4AA 5HIJA 3U9LA 4ZO9A 3UUGA 2AEJA 3ETEA 3HTXA 2CXUA 2DBYA 2B4YA 3KZVA 3OGSA 1RMQA 2QM3A 3GDGA 4H6VA 4P5DA 3AHHA 4P58A 4UNSA 3GM8A 1QYCA 3WGGA 4RPLA 3FFZA 3MNFA 3L49A 1XYPA 1RLTA 4I9UA 1EWYA 3RU3A 1NYRA 3UC9A 1LGYA 1TEHA 2XSZD 3EZLA 1VBFA 5CCEA 2WC1A 3LQ1A 2ZR8A 3TOJA 4GYKA 2GJKA 3NNMA 3V42A 3ENQA 4ZO6A 4TSFA 1YJBA 4CCCA 4ZJYA 2OUKA 2QG9A 1J97A 1LPBB 2G5PA 1CP2A 4QM7A 1WDTA 2H7YA 5KKAA 1Z6ZA 4EW3A 3PPWA 4NCHA 3RTDA 3TZKA 5K0FA 4LSMA 5KWVA 5JRZA 4LK7A 1XF9A 4WK6A 3KFXA 1UPBA 2X2EA 1IQDC 3U3DA 1G6Q1 4F2PA 5FZAA 3FIUA 4FXPA 4HAIA 2GTIA 3J26N 4YQYA 3BTAA 5HF6A 2YWBA 1GCAA 4BLOA 3O92A 2G67A 2QV0A 3HT1A 5A0VA 1N5RA 1K8QA 2PSDA 1LBQA 1SUIA 3FF1A 1ESMA 1MEC1 4FQ7A 3RW9A 2YZ2A 3F1KA 4OI0A 1RVF2 3KUUA 4JR1A 4B8WA 5ALQA 3A0UA 5HPOA 3TKLA 3INYA 1GLVA 5HFJA 3B69A 5BSFA 4X3CA 1QE5A 3FLAA 3KETA 1CUFA 2VH5R 3NQHA 3RR2A 2NP6A 3GEPA 2DWOA 4GKAA 5J4HA 3K70D 2IYLD 1JKMA 4UHEA 1QKQA 4GYJA 4M1SA 5DN9A 5AKLA 1S0GA 5H68A 2O8EB 4YP7A 5DN6D 3RIGA 2GBFA 1CQIA 4CQLA 2Q4RA 2R97A 4MS4A 4CV0A 4R1PA 2CLCX 3L2OB 4DY4A 1SMVA 1JXAA 4AEDB 4PY2A 1FATA 5AR1A 3AYXB 1ONSA 4V3BA 1MV5A 5JV5A 2MSWA 3JD1A 4RHEA 4X1YA 3DL4A 1W6MA 1XTUA 1L4FA 3LHDA 4Y2VA 1A3KA 2VK4A 2Y71A 4C76A 4PCAA 3KCNA 2HB6A 1RYDA 5JOQA 4C5CA 2ZUTA 4CU5A 5HIIA 3NOVA 3CEJA 1IC6A 1VE0A 2P9HA 2COUA 3KEFA 4D6XA 1Z34A 1KEXA 4Y6SA 2EFJA 3LCCA 2I1LA 2KSQA 3RS9A 4IE6A 5DM60 4RGYA 4UEKA 4MLCA 2ZU6A 1A78A 1TEIA