3M70A

Crystal structure of tehb from haemophilus influenzae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
286
Chain Sequence
MKNELICYKQMPVWTKDNLPQMFQEKHNTKVGTWGKLTVLKGKLKFYELTENGDVIAEHIFTPESHIPFVEPQAWHRVEALSDDLECTLGFYCKKEDYFSKKYNTTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENLNISTALYDINAANIQENYDFIVSTVVFMFLNRERVPSIIKNMKEHTNVGGYNLIVAAMSTDDVPCPLPFSFTFAENELKEYYKDWEFLEYNENMGELHKTDENGNRIKMKFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of TehB from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
molecule keywords Tellurite resistance protein tehB homolog
total genus 73
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m70A02
5FQ0A 3PVCA 4OBWA 1JG3A 2HWKA 2UYAA 3G2PA 1Y9QA 5K0FA 2ETEA 4WBBA 2IXKA 2Z2SB 1J1LA 4M36A 1ZZ7A 4BHPA 1CAVA 1CAXB 2P3LA 3C0KA 5FA8A 3NKTA 3KQQA 4LEJA 5DT2A 1I9GA 5H02A 4CKEA 3S68A 2AOXA 4F84A 4DKJA 3SGLA 3ST7A 4LG1A 1BOOA 2H1RA 1NE2A 4YV1A 1ZKDA 4FSDA 4LA2A 2FK7A 1G6Q1 5DSXA 5FHRA 1N2XA 2P8JA 3GRYA 5LRSA 1NBIA 3G7DA 5B1SA 2GU9A 1EYBA 1ZRCA 4AZSA 3R9XB 4UBHA 2IP2A 2MPFA 3MCZA 1L3JA 5LSAA 3TNQA 1F3LA 2ZZMA 3ZDSA 3EJKA 3HQXA 2FRXA 3N4MA 1NW5A 2GLUA 3DP7A 3H1WA 4DMGA 4OLLA 3GRZA 1IPJA 3DKWA 3LCUA 3R6SA 5HIJA 2QJVA 3B3FA 1DUSA 1M6EX 2PV0A 2XL9A 2PBFA 3FZGA 5BUVA 5ERGB 2CAUA 4XF9A 4FBFA 3IDCB 5CVDA 2BNNA 1O4TA 3P8ZA 3UKVA 4E2XA 3ANXA 3BALA 4CXMA 4CKCA 3NW9A 1Q3EA 1XE8A 3D0SA 1UWVA 1RI2A 3VC2A 5HIIA 3ERCA 5FCCA 2FCAA 3ACLA 3DR5A 3M6XA 1VP9A 2HJIA 2F4PA 3EMBA 3I5UA 1VL5A 1O54A 3R6TA 5BW4A 1M6YA 2Q41A 3MGGA 4ZTBA 1FP2A 4A6EA 4XUEA 5EZQA 2JJQA 3H50A 1KPHA 3H1YA 2IPXA 1WG8A 1JQEA 5FWAA 3E5UA 3DL3A 4KIGA 4GULA 2P17A 3H2BA 4QTTB 3KCCA 3BGVA 4PGGA 4KL1A 5EIFA 5DRTA 3ETQA 3BGDA 3GCZA 5DTRA 5FA5A 1IPKA 3TPZA 2XYQA 3ELDA 3EVEA 1FBNA 2I62A 4GOLD 3RPQA 4E2YA 1MJFA 1G8SA 5K0GA 5KQSA 3UKTA 3SX0A 4IV0A 2IDJA 2V74B 3FE5A 3PB3A 4MZUA 2YXLA 3HVJA 4JVAA 3NWEA 5T6BA 1O3RA 1R74A 2QRVB 4X60A 1RJGA 2OZJA 2Q1ZB 2AOUB 2LD4A 3A4TA 3FPEA 1NYWA 5JR7B 5K0NA 2Y0OA 4UOEA 5EIWA 1YWKA 4HN1A 2B25A 4GEKA 5BXYA 4DCMA 4XF4A 3RYRA 4DQ0A 3UBTA 2ATFA 4QDJA 1D2CA 2PVCA 4AXOA 4XFCA 3WW1A 2WK1A 1QWRA 1RJFA 4BLWA 1ZZCA 3H3ZA 1Z3CA 4QGLA 3AWIA 1KYWA 4QPNA 3E05A 4BYYA 4K8FA 3QACA 4I09A 4U7TB 5LQJA 2XKPA 3G8BA 2EA7A 3RZZA 3BWMA 3A7EA 1L9KA 4HC4A 2QCSB 5LRRA 4BP3A 2H6CA 2ET1A 1RJDA 3T7RA 5CM2Z 3TFWA 5CVVA 5JAXA 2PHDA 4AQ6A 5EKUA 4AVAA 1SQ4A 5LEKA 4GC9A 5K8SA 4KU7A 4BLUA 4RTOA 4FT4A 4PIXA 2PQQA 3OU6A 4LA3A 3MQ2A 2H0VA 2C0ZA 2WFPA 1G55A 4DZRA 1MHTA 2JHCA 2IGTA 2ZVJA 3LL7A 4M7RA 3OTFA 5T67A 3E97A 4EWDA 4IEUA 1JQ3A 3DUWA 4GC5A 5HIMA 5HI0A 5I8TA 4XFFA 3H7JA 5T3NA 2QY6A 3KQTA 2H6BA 4DA4A 5DXJA 4UBGA 3DXZA 3DV8A 3EVBA 4Z07A 3LOIA 5KS2A 5BV6A 4X1OA 5EQJB 1U12A 3RNSA 3F4KA 3HCCA 3KPUA 3BT7A 4J1WA 1CAWA 3QOXA 3CCFA 3S7IA 3CKKA 4XFAA 3DN7A 5E1RA 5LQUA 4IWNA 2Y1XA 3D82A 3HM2A 1X8MA 3GJYA 5KHGA 1RI4A 3EVDA 1CAXA 3FUVA 2CAVA 2VDVE 3EBRA 1NW7A 1RC6A 1OR8A 3KQPA 2GS9A 1X19A 5KHJA 3TMAA 5I93A 4MGZE 2YUIA 3LKDA 3RIEA 1Q0TA 2PA7A 4EK9A 1I1NA 2EJTA 2PX8A 4YMGA 2K0GA 2NYUA 4PONA 5FPZA 1ZGAA 3FTDA 5GM2A 5I8SA 4QXKA 5EEHA 2VDWA 2P7IA 3P9CA 1R6AA 1EJ0A 3HCAA 3KHKA 5GOZA 1RL3A 1ORHA 3K0BA 3OZSA 2AOTB 4CYDA 4JTOA 1VPTA 4XUDA 5IH3A 3NJZA 2IH5A 2QNKA 5BPXA 3FTFA 2OO3A 3BXOA 2Z6AA 3EEOA 2ONZA 3OU7A 4QM8A 3OF1A 4XCXA 1R8YA 4IEWA 4EMSA 1AF7A 3KQSA 2GC0A 3EVZA 3HVIA 5LQCA 1N7JA 2PX2A 1CAUB 3TQSA 4ER5A 2JH8A 3ER9A 3DOUA 3HIFA 4Z2YA 2B8MA 4OX9Y 3WSTA 2IXJA 1VP3A 5DSTA 3DMFA 3DLCA 1YFLA 2QYOA 1YZ3A 1SQGA 3FUXA 2IH2A 4E2WA 2BR4A 2CMHA 3EVGA 3G2OA 1O3SA 3NDIA 5EMLA 1INLA 4CTJA 1RI1A 4GUAA 2ZTHA 5CD1A 5LEJA 1JSZA 4F85A 4GOMD 1IM8A 1VJ2A 2XLGA 2NXEA 5F1RA 3O14A 5DWQA 5CVJA 3KGZA 5DM2A 2P40A 2WA2A 4P7GA 3WW3A 4L2NA 3P9KA 5DM0A 4HTFA 3LPMA 2ZKLA 2HMYB 2GZWA 2VECA 3FWEA 3FZ3A 2IXHA 2PHLA 3ELWA 3L2HA 2HR1A 2EAAA 4PYQA 5EMMA 3BWYA 3U0ZA 1QXRA 3M33A 4AZWA 3BGIA 1I4WA 3ELUA 3PVBB 1CAVB 2NXNA 4E2SA 4WZCA 1ZG3A 3P2KA 4TLFA 3REOA 3LGAA 4I01A 4P9GA 2GAUA 3G5TA 4IETA 4ISCA 4LTAA 1FP1D 1NBHA 1J3QA 2EVXA 1KPIA 4ER6A 3PS9A 3KPWA 5KVAA 1R18A 3LZZA 4OA8A 4EWAA 3IDBB 5LQAA 3PX2A 3MTIA 3DTNA 2EFJA 1UD1A 3IV6A 3UA3A 4RVHA 4C05A 4QGNA 4IV8A 1O3TA 3THSA 2O1QA 2P1DA 5EMJA 4YYOA 5F2OA 1QZZA 4MV2A 2OPKA 3KGLA 2G71A 3NJRA 3UJ6A 4HVRA 3EPPA 4PYNA 2I6GA 3KMHA 5JR3A 2PLWA 2NXCA 3FPGA 2UZ4A 2ZBRA 4QQKA 5BP7A 2CMGA 3SVZA 4HMZA 3DULA 4FAGA 2Z6UA 1CAUA 5J48A 4WVZA 2GA9A 5EG5A 4PYIA 4XFIA 1SUSA 2ZSUA 3BWCA 3P2EA 4J1XA 3RODA 3LX6A 1P1CA 1KIAA 5ICGA 4M38A 4JV4A 1O9GA 2XYVA 3D0JA 4PCLA 3JWJA 5C9ZA 2Z6QA 3UFBA 4RTMA 3OGJA 2ZIGA 3T7SA 1QXJA 4AUKA 2G8NA 3NVKI 1RI3A 1L3IA 2C7OA 2JHPA 5EFUA 2AN5A 2ZLBA 3G7UA 3NTVA 1UW8A 3C3YA 4PJYA 2CKDA 3I59A 4FS8A 5FQNA 3HCFA 2YR0A 1T43A 3SR4A 3VSEA 2E5WA 2BM8A 3DLIA 5FLHA 1P91A 3U10A 4HG2A 4PYMA 3E7PA 2PXAA 3RDIA 1P1BA 4H7LA 3C3PA 3GBFA 4KWLA 3FUTA 2O0LA 3PX3A 2CGPA 3AJDA 5BW5A 3MHTA 2CL5A 3ID6C 5FLIA 1ZHFA 2R6ZA 4IESA 1QAQA 4RTSA 3BZBA 3EO6A 2O07A 2P35A 3G88A 1VBFA 4CTKA 3FPFA 4C06A 3TNPB 3M6UA 3FPJA 1JSXA 3CF6E 5KHIA 1SKMA 1R00A 5EZWA 4FGZA 1JUHA 2IBTA 1YZHA 2ZIFA 3LSTA 4YUZA 4GF5A 2P41A 2GH2A 3CBGA 4MGIE 5FUBA 4NECA 4X61A 3E5XA 3RW9A 4XEZA 3TKAA 1CAWB 1Q0SA 1XCLA 5F2NA 3BUSA 4V0QA 3CJTA 3KKZA 3P71T 1QY4A 2PX5A 4PYKA 3Q7EA 2DCTA 4GOND 1LKNA 3E23A 2IXCA 3CLPA 2OPBA 5I8YA 2PAEA 3HCBA 3I59B 4HSGA 2GAFA 2IIPA 4R52A 2PYTA 1FT9A 5I0TA 3G8AA 1UPIA 1SVUA 3Q87B 2I9KA 7MHTA 3SXWA 2B78A 2PTMA 2OB1A 3LA7A 2AVDA 5C8WA 2O05A 4CWAA 4RSRA 3UJAA 3U81A 3LDGA 4X6QB 1JG1A 3O31A 2Q30A 3MERA 4OFGA 5JSOA 2AOTA 3LCVB 2XLFA 3C3VA 1WGPA 1NXMA 4Q0VA 2B9UA 1OMIA 5DX1A 3OU2A 4FT8A 4RVFA 4KDCA 5KYGA 1FJXA 1UIRA 2OYZA 4L7VA 3OE4A 4RTKA 1JQDA 5D1IA 3OE5A 1PM7A 2VPVA 5DX8A 1TW2A 2XHKA 2PSSA 3HNRA 2IXIA 4E31A 4L11A 3TM5A 1WY7A 2UY8A 5AVPA 3I54A 4KVZA 4ER0A 5KQRA 5I0UA 4C07A 4I0AA 1ORIA 2UYCA 2ESRA 4HGZA 4YSFA 4RTPA 1YFYA 3PLQA 3P9IA 3MB5A 3IYLW 5CVRA 5KHHA 4LWPA 2V09A 3KU1A 4AZTA 4YUVA 3LDUA 5E1MA 2G72A 4OBXA 4RTNA 3QV2A 4R8HA 1EJ6A 3O7WA 5HEKA 4RVDA 1I6XA 4LUMA 1XDZA 2E9QA 2MHFA 1L3CA 1PRYA 3IHTA 5FQOA 3IIAA 1QYRA 1OFNA 2AN3A 2ZZKA 3EEYA 3FRHA 3FUUA 2FQPA 3OFJA 3AXTA 2ZBQA 1PJZA 5FDBA 2BZGA 1IY9A 3SSOA 2BEOA 2IC1A 4HBNA 4PCAA 5DTQA 4JTNA 1X82A 2ADMA 3A25A 5FCDA 4IERA 1RJEA 5I91A 2PJDA 1BC5A 1UCXA 4BIFA 5GINE 10MHA 3NL1A 2GH1A 3LECA 2JH9A 3MCTA 4MQ4A 1EP0A 1LB2A 3G2QA 3UKNA 4Q0QA 4LUKA 1R8XA 3I58A 3MPBA 5JCTA 5EPEA 3KR2A 3A26A 3OZTA 4HVOA 1XJ5A 3UWPA 4RTLA 5LQNA 3WW4A 1H1MA 1EAMA 1ZGJA 4E2ZA 3UJDA 5FTWA 3LAGA 4FR0A 5U4XA 4X6RB 4KWJA 1BHJA 2CV6A 5EVJA 1UIKA 2K9ZA 2AOWA 3HVHA 1JTFA 4ZU5A 3I53A 1AQIA 1UFKA 5DM4A 2NXJA 3NW4A 1NKVA 1NW3A 1Q43A 4JXJA 8MHTA 5EMKA 3HCEA 2PWYA 3BU7A 1OD5A 3EVCA 4HSLA 3JWIA 2AOVA 2D40A 5E1DA 1CX4A 3QOWA 5CU1A 5BXXA 1TQ5A 2BNMA 2XVAA 4E33A 2Z69A 3P2IA 3EHKA 3GXOA 1X1CA 2PGXA 3M4XA 4E30A 4FT2A 3C6KA 1SG9A 4A2UA 4XFBA 4P7JA 5K03A 2XVMA 1HNNA 4PNEA 2YXDA 4RYLA 2GB4A 4BH9A 4MWZA 1ZZ9A 3NSTA 3VYWA 3TOSA 1YFXA 1JR4A 2QDRA 5T64A 4I0BA 4QGMA 1Y8CA 4U7PB 2P3QA 3KQYA 1YFUA 3SCFA 4PIPA 3GRUA 2BH2A 5E2BA 1CGPA 3T0IA 5GM1A 1D2GA 1QANA 2ZIEA 3OZRA 3V97A 3EGIA 3O4FA 5DX0A 1EPZA 4KDRA 2PAKA 4ATNA 1ZVFA 4O9EA 2UY9A 1AQJA 3RYKA 3GDHA 4C08A 4I2OA 2XGXA 3HCDA 3H9AA 3EGEA 3PFGA 2H11A 3CEWA 4D7SA 4BP1A 4EV0A 3ELNA 5CUQA 5K05A 3MTEA 1BKYA 5GIOE 1HMYA 5JSRA 3BWBA 4GOOD 1RUNA 1DL5A 1J3PA 2ERCA 4AVBA 4LECA 1EG2A 2BNOA 1GQHA 2BYVE 5C0OE 4OQDA 5DLYA 1O3QA 4MIKA 3FFQA 5G02A 5FADA 1JTEA 4RVGA 4Q0SA 2YTZA 4YMHA 2DPMA 1P39A 3B02A 2D93A 2AR0A 3UA4A 3ER8A 5CCXA 2C7RA 4KRGA 1X1BA 4HRAA 3QOPA 4QM9A 1XXLA 4MHTA 2I7CA 1ZREA 4IEQA 5CCBA 2C7QA 3THRA 3E6BA 3GYDA 4MX3A 2EG5A 4C04A 1O5LA 4EKGA 5FLJA 4IEYA 2ZULA 4O9GA 1SQFA 2QE6A 4E32A 4R05A 3KPVA 3NMUF 4QX5A 3CO2A 4ER3A 3OPNA 1V70A 5MHTA 1YFWA 4X41A 4DM3A 2AVNA 1SEFA 1VR3A 4R6WA 4RTQA 3HEMA 2OXTA 1NV8A 3PT9A 2HKXA 2VS1A 1J3RA 1KHHA 4QVKA 4B29A 2WC2A 4FSXA 4HH4A 4R6XA 1NZCA 3UJBA 4DINB 3PNAA 5EOVA 3G2MA 4IEPA 4OA5A 1G6NA 5LQRA 5CVUA 3G89A 2VQAA 5K0JA 2NNWB 5LR6A 2ZZNA 5K8VA 5E8JA 5EKXA 4YRDA 2AOUA 1WA4A 1G60A 5HIKA 4Q0PA 2QRVA 4MUVA 4P58A 1KR5A 4EROA 4XETA 3UZUA 2YVLA 1ZRRA 2QM3A 1DGWA 4RTJA 3LWCA 1YUBA 2ZWVA 2XBMA 4FZVA 2UYHA 2JHAA 3R3HA 5K0LA 2WA1A 5ICEA 3OFKA 4LULA 2FPOA 3ROUA 3AXSA 5C6CA 2AS0A 1WZNA 1B42A 1M0EA 1YHFA 3IBMA 3H8UA 2B5HA 3M6WA 1DCTA 4F7ZA 3ME5A 1JG4A 3VHRA 3D2LA 1XE7A 2OB2A 4PINA 2GC3A 4IEZA 2UYQA 2EX4A 5E1BA 1U2ZA 3H3UA 3EVFA 4KWKA 1XRUA 4MGYE 4PYJA 4PIMA 2UYBA 4C4AA 2K4MA 4ONUA 3UJ8A 3MZHA 1ZX5A 1KP9A 5ICFA 3CJRA 1DZRA 1YUDA 1Q5OA 5JSPA 3SHRA 2PKWA 1O9HA 5E8RA 3WW2A 4K6MA 2DULA 5E9JA 1N7IA 3SSNA 5K09A 2XL7A 1ZRFA 3BPZA 4LLOA 4PIZA 4IEXA 4LWOA 5GWXA 5EHGA 1VP6A 4YNIA 4IEOA 3JWGA 4ORFA 2XYRA 2VP3A 4HSJA 4WVLA 3B7PA 4PYOA 2B3TA 2YXEA 2I45A 5FWDA 3M6VA 2OYRA 4P7FA 1L3BA 4AX8A 3LA2A 4A6DA 4AQ2A 3SSMA 4XF3A 5IKMA 3OCPA 4Y2HA 2PFWA 4AZVA 4IEVA 2D5HA 2FK8A 1SUIA 3SMHA 4G56A 1ZNPA 1X1AA 2G1PA 5J3UA 1ZQ9A 5GIPE 1G8AA 3LDFA 3E5QA 1NT2A 3HA7A 2ONYA 5DM1A 3HA5A 1NV9A 2HTEA 1XDUA 5FHQA 3A7DA 1XDSA 2ORED 2Q0AA 3I64A 3LA3A 1EQAA 3LBYA 2O06A 4UXAA 5E1OA 4BY9E 5K01A 1XCJA 2KW5A 3HTXA 2ZCJA 1NW8A 2NP6A 5D1HA 5EZSA 4E2GA 4MH0E 4RX1A 3OD0A 2VZ9A 1KPGA 4B17A 3GWZA 2IDKA 1YLLA 4RV9A 3KQVA 3MDPA 2IFTA 4O29A 2O57A 1RUOA 4E70A 4AVCA 2IXLA 4MGKE 2F8LA 3GGDA 3V8VA 1ZZBA 3S0MA 3DXYA 3LKZA 3KR1A 2BR3A 5M5BA 1XVAA 5BY5A 4H0NA 3KSCA 2YQZA 2FYTA 3EGVA 1H1IA 1JG2A 4BLVA 3FTCA 4GQBA 2PWPA 3BB6A 4HN0A 1IXKA 4META 2FHPA 4X63A 1RI5A 4YUWA 3TR6A 3BKXA 2A14A 5E2AA 2MNGA 5FPXA 2QVSB 4GBED 2AZTA 4EQZA 4Y30A 3HT2A 3KPJA 3FHIB 1V39A 4DF3A 4YUYA 2CWWA 4YV2A 4N9IA 3JZVA 4QDKA 1O7FA 4I02A 4YARA 3CVOA 2G70A 2N7GA 5D1NA 2GPYA 4E2QA 4QPPA 3H7YA 1G38A 4EKIA 3ES4A 1ZZ8A 3SXJA 1VIDA 4HZFA 2EJUA 1YFJA 3EMDA 3EQEA 3NDJA 2XLAA 5ICCA 3DXXA 4QVGA 3CGGA 2XKOA 2ZW9A 1YB2A 3E8SA 1KYZA 2ZCWA 3P97A 3R24A 2Q4SA 3KR9A 5E16A 5HOQA 3S7EA 2PXCA 3FPHA 3KQMA 3HVKA 2AN4A 3T7TA 5JUWA 1VQ1A 3HA3A 4YV0A 5CVEA 4F8AA 2BR5A 9MHTA 3CJQA 4ER7A 4KIFA 3B3JA 2PY6A 3SCGA 3H1MA 4HTFB 4POOA 3NVMB 1I5ZA 2V7EA 3A27A 1DZTA 1LR5A 4I3PA 4RWZA 1FPQA 2OBFA 3M70A 1AV6A 3M3IA 5EEGA 1HW5A 3E6DA 3IWZA 4HGYA 5E9WA 2IH4A 5EGSA 1YF3A 1X7NA 1OI6A 2PT9A 4M37A 4R8RA 3SCHA 3MYXA 5EHIA 5HILA 3HP7A 1L1EA 2ZWAA 4IKPA 3TLJA 2BM9A 5E9QA 5C1IA 1NE4A 3FJSA 1D2HA 3FYCA 4ZU4A 2OA2A 3FYDA 5DTMA 2PAMA 4HVQA 4Q29A 5K0EA 3GU3A 4NVPA 1J58A 1NE6A 5HFJA 1X1DA 3KPYA 3EVAA 3BKWA 2O8QA 2H00A 3GRRA 5FQ0B 3CJXA 3UJ9A 1X8EA 3FTEA 3DH0A 1ZZ6A 4F86A 3DMHA 3L8DA 3G5LA 2PX4A 4QQNA 3GIWA 3GNLA 2P3OA 3NWBA 2NP7A 2OKCA 4FAHA 1EY2A 3GRVA 3TKYA 2BGCA 3BCWA 3CL1A 2VDUE 3TRKA 1WLTA 2OY0A 4R8SA 4XF0A 1QAMA 2HNKA 4RTRA 1WS6A 4EVIA 3MAGA 4QTUB 4PWYA 1SFNA 2P7HA 3DMGA 1VE3A 3GO4A 3P9NA 5CADA 4CKBA 1DGRA 3JWHA 1GQGA 3SM3A 3AY0A 5KHKA 1EIZA 3UJCA 2OZVA 5FULA 1H1DA 3I7DA 3E6CC 3ORHA 1LRHA 4V0RA 2ZBPA 5K0CA 4XFHA 4D7TA 2FMYA 3LBFA 3HT1A 2GC2A 1UIJA 3LHDA 2ZFUA 3LCCA 3RYPA 1WXXA 3VC1A 1WXWA 4FP9A 1F38A 4DCGA 3B5IA 3KQWA 1J59A 5I0RA 5HZMA 3I9FA 5KBFA 5EC8A 3SMQA 2YX1A 3PTAA 2IBSA 1QAOA 5GP1A 1ZRDA 4PIYA 4Z82A 4C03A 5DPMA 3ELYA 3IEIA 1NW6A 3ES1A 5J7MA 3KR0A 4EWEA 2PT6A 2N47A 1VLMA 1RTVA 5I0SA 1TW3A 4XF1A 2OZ6A 1PMIA 3CC8A 1XTPA 3TM4A 3UJ7A 2B9EA 4KWCA 3X0DA 4MTLA 3U11A 4WXHA 4HLTA 4PYLA 3KQOA 3PLAE 3K6RA 5P8WA 3OCJA 2D5FA 4P7KA 4Q0UA 3PFHA 3USSA 2ET7A 3B3GA 2R3SA 1FI2A 4PGHA 3FX3A 2C7PA 1O5UA 2UYOA 5CIYA 4OQEA 3R0QA 3FRIA 4QMAA 2JG3A 3C6MA 4ZU7A 2PXXA 5K0BA 1FXZA 5LQKA 1Y3TA 4YUXA 2Y1WA 1KXZA 2HV9A 2KXLA 3FUWA 3NVCA 4N9HA 4KU8A 4XFGA 5F2KA 2B2CA 2GC1A 1TPYA 5DXAA 3B89A 4XUCA 4RD7A 5DRYA 1RGSA 4KW7A
chains in the Genus database with same CATH superfamily
3Q8MA 3PVCA 3ZV4A 2UYAA 4P9LA 1TF5A 2DH5A 4JCOA 3AK0A 3L49A 2JJ1A 2VMHA 4EPWA 4FI3F 1XTZA 2YV1A 1MN6A 1BK1A 1Z4OA 4BHPA 4KYVA 5IH7A 3KQQA 4LEJA 3LW8A 1M2VB 4L6IA 1JEOA 3VOAA 2HHAA 1D1QA 2CN1A 1L6RA 1S4MA 5FZ8A 1YVUA 1TMGE 2RJLA 4E9KA 3OM1A 4YYZA 4CG3A 4N65A 4HO1X 3WP5A 2K2WA 1W5EA 4PLCA 4AG6A 4JP2A 4COUA 5F1YA 4XOUA 1W25A 3VSDA 4MR9A 4F2WA 5CB4A 4CFSA 3D81A 1N2XA 1BCXA 3GD7A 4F5EA 1KFJB 1CRWG 3RFFA 3RH0A 3DNFA 3SBXA 1UBJS 4LV5B 5JZSA 1DAFA 1S7CA 4EE2A 4LHLA 1KJJA 3B52X 4HFSA 4TZDA 1LEHA 2OK8A 3QNWA 4HN4B 3E22A 1H9WA 1WAMA 2Y68A 5CG2A 1OILA 2QJVA 3D59A 2VJOA 2EJBA 2VL4A 4W5HA 4PQYA 4W6YA 2CAUA 4KR0A 2RS53 4Y2QA 4K6BA 4HETA 2EIEA 3ANSA 3MD0A 3TX6A 1P4AA 4CIBA 4Y0NA 4D0QA 2P27A 2HWWA 3WCRA 1BK0A 3INRA 1SG6A 2OMKA 1WUYA 5GZ3A 1LDMA 4KLAA 1A5AB 2DUNA 1KWKA 1YZGA 3INNA 4YBRA 1DIHA 3NHRA 4P32A 4KQIA 4B4RA 1E77A 3F5SA 3EFOA 2JKVA 5BN4B 3N5CA 2ABWA 3EVEA 1G9AA 4DIEA 3IP9A 4C14A 1G8SA 2BKUA 3RYFA 1DWOA 1X8LA 2VP4A 3ICVA 2GZHA 2I6SA 3VR0A 5T6BA 1VLHA 4QJBA 3ROMA 1QVVA 4C7KA 3HHEA 2VSYA 3H8JA 3P0IA 3LQQA 1I3NA 2JIRA 4R1QA 4Q9AA 4HN1A 5BQPA 2C9KA 1VGVA 3BU0A 4DQ0A 3UBTA 1YBFA 4C0LA 5B1HA 5CITA 2ZIUB 4R1NA 2Q0SA 4BLWA 1ZZCA 4K8FA 4QU5A 5CM9C 3ZDAA 4U7TB 5LQJA 4L2IB 2XKPA 2H52A 1ZK3A 1YI9A 1PQUA 2HA2A 1S55A 2SICE 2J9YB 3JQGA 2R0FA 1LDNA 2YN2A 4U9HS 2JNWA 4YRMA 1FEZA 3ESBA 1U2DC 4TV8A 4FDLA 4J0IA 4QGHA 1V6KA 3MQ2A 2XXAA 2RHBA 2PLAA 4WBNA 2C0ZA 3M0EA 1AKMA 1PZFA 4AI9A 4HDQB 2V3WA 1JEQA 1NLRA 2EJVA 3NHBA 2BAGA 4RSHA 3MT0A 4TSKA 3E97A 3K1AB 4RPHA 3VI3B 2J32A 4BNLA 1QFXA 3D4PA 2RHCA 4CG2A 3HEBA 2AH2A 4KMQA 2CF6A 1Z4LA 1OX6A 4UBGA 1RWKA 4RKRA 4IJ5A 2JLZA 4Q7EA 3RARA 2HRRA 5CK4A 4KI0A 5BV6A 3NKVA 4AEDA 1KA9H 2A0FA 1L4KA 1NN1A 1YHNA 4TUYA 3LT5A 1ZXLA 2JJ2A 4ZCQA 2P0YA 3ETPA 3GFGA 4AI3A 1PJBA 2HEIA 4QPGC 3AP5A 5IHPA 2AJLI 3CG4A 2V98A 1SBCA 2PKQP 1DOHA 1FYFA 3FUVA 2CAVA 5SYMA 3D8RA 5KR7A 1NC1A 2V9PA 3MNFA 5HCAA 3OPYA 3TTVA 5J5VA 1FQOA 1OA2A 1W2HA 4ZI7B 1JPVA 3FHLA 4YJ2F 2QD2A 4F06A 1UDRA 2FMUA 3FTDA 1M8PA 4AEKA 1NYRA 3DAGA 1LK0A 4XSHA 4URZR 3FH0A 5AUOB 3UETA 1Z5WA 4YNBA 4RHXA 4RQPA 4Y2JA 3CRW1 1RC8A 4DCOA 1OBHA 1Z8FA 4D8MA 4JT4A 3RK1A 2IH5A 2ONZA 3L0IB 5HXMA 3F2IA 4J6FA 2HM7A 3E22B 2C00A 1Y37A 3HIFA 3LFHA 3PHMA 4O4HF 2TBVA 4ES9A 1E5VA 3HRIA 3SBOA 3FUXA 1SLAA 2KLHA 1V7ZA 1GFWA 1NG0A 1E1QA 3BWDD 4DXAA 5I6DA 5KX5F 4CTJA 2ZTHA 1JSZA 2JDNA 3U4CA 3VNAA 3ZDDA 2IUSA 4W50A 1U1CA 2VF4X 1FYEA 3H9BA 5HM8A 1V6CA 4RZXA 5LP6B 3AX6A 3P9KA 1XDWA 4HTFA 4RHFA 2I2SA 5C8XA 1TM2A 2IXHA 4RKYA 4BVKA 4YGBA 4RS4A 4G0UA 5KX5B 4TS3A 3OZ7A 3DMTA 1R0LA 1QHIA 2M6SA 1K6EA 2EAAA 3RYFB 4AGRA 1X7XA 5A1FA 2XNCA 2C8VA 1VLJA 2WO7A 3QUTA 3ZCPA 2C2YA 1ZG3A 3VUOA 4DNFA 4WUTA 3LGAA 4QHSA 2UYGA 4EG8A 1GZVA 4N48A 2DF7A 4XVCA 1EAH2 1VKNA 4ISCA 4MRPA 1C57A 4ZAGA 5BSGA 3T6KA 4OTZA 2OFFA 4M4SA 2FMKA 5ALZA 5L3SB 1QIIA 2WAYA 2W6JD 4X94A 3F78A 5ES4B 3V46A 4HGQA 1BX0A 3H4IA 2H2DA 1DEKA 2XYGA 3IC5A 5JALA 2AQ8A 1UK9A 4I50F 4Y2TA 1PGW2 1CIPA 5K7PA 3ETCA 1BJKA 4KDFA 5GZGA 3LEMA 2V7QA 4QQKA 2FZVA 2BSXA 5FYZA 1Y4UA 1TRHA 2LROA 3VKOA 4WV3A 1RQGA 3HVRA 1AJOA 4BRUA 3MJEA 2ORYA 1SUSA 3EF1A 2CK3A 3BWCA 4V39A 3ACHA 1PGW1 4YONB 2P0AA 2IZZA 3BXPA 1MO3A 5EJEA 1RAHA 3IPYA 3ZOIA 4AKSA 3ZE2B 4RKEA 2SKCA 1TC2A 2WNVB 1IWPB 1C4WA 4BDSA 1R9GA 1G98A 1C3OA 3NYWA 3K73O 4FEGA 3A58B 3I59A 3IM0A 4QB2A 2IS4A 3CH4B 3DP9A 3NKFA 5AUNB 1ND2B 5DCYA 3ESAA 2Q0HA 4QUHA 3TL2A 2FXIA 3RDIA 5IDYA 1MORA 4IV1C 2OVFA 5BW5A 2CCJA 1U1IA 2HX1A 2HGZA 1W4LA 1QIDA 2DQZA 3EO6A 1AN0A 2ODQA 3UYJA 5FBKA 4CTKA 1ZUHA 1I2DA 2XAUA 4EO4A 1R8SA 1UOEA 1W6NB 1T25A 4HATA 1EUYA 3ZTTA 4DPLA 1KSHA 2E6KA 2YZNA 5KYUA 1S1AA 4OO3A 4DIUA 1LTKA 4M9UA 2Z98A 5IYZF 4F4CA 2DUWA 3R6LA 5EKDA 2VPTA 5FY9A 5E89A 3TTSA 3F5FA 1N1VA 3O8DA 5JDIA 2DCTA 3WLRA 2H5JA 3KZMA 2UU8A 3L3BA 2QLBA 1IVYA 4XJWA 3G8AA 4GKXA 5TLSA 4RF5A 2Z8ZA 2W46A 5C46F 2CNAA 3LPFA 3L7MA 4MGYR 2O05A 2RHJA 1VKZA 1OXSC 5ABJC 1TME3 3LDGA 2ANCA 3ZWOA 4F3NA 3S2EA 4EN8B 2I2BA 3EXAA 1M75A 1U4NA 4KGVA 2IFWA 3BZWA 2ZXUA 2VPVA 3SJCA 1XXHE 1NRXA 4F4DA 2QI9F 4QQRA 3ETGA 3OLQA 3EEFA 4HB3A 1J5XA 2GFHA 5ESWA 3CKLA 4UT5A 3WJAA 2JZCA 4GOKA 1DFQA 1BXHA 2VQ0A 4M0CA 1VKHA 2XUJA 4MK4A 2Y71A 2OQIA 3VR6H 3M3HA 2P68A 3E84A 4JT2A 3M1YA 3CWCA 4V1CB 5ALQA 3NTQA 3ZTYA 2WUFA 3DBRB 4A8HA 1AQ6A 4WA8A 3HQ4O 1APNA 1MHPA 3N35A 3QEKA 1RUJ1 1XZPA 4A8JB 2HF2A 5KOYA 1XDZA 3MRSA 3S1SA 1DBNA 1OY1A 3K5IA 3KJGA 2Q7DA 2Q6IA 1FMCA 3H2GA 4LJAA 4W6ZA 2RS13 3VBRB 1LRKA 3NETA 4AFNA 2VDRB 2RHMA 3CVXA 2NT4A 5K8IA 2ZBQA 3KT3A 2QNRA 3C41J 3W5HA 4MNTA 4C5CA 3ZKYA 1CF9A 1B6SA 5I91A 4O25A 4ZT3A 5BV7A 4PLVA 4BX2A 2IELA 1EUCB 4IQPA 2RS12 1Q91A 3A1NA 3EZXA 1WRBA 3RU7A 3AP6A 4EMTA 4RHV2 3T8YA 4Q93A 4UM7A 1OPMA 3O82A 4RTLA 2IHVA 4JWTA 4WH0A 1MAHA 4M3CE 4OXNA 2RMU3 3LB9A 4BX9A 3TSOA 3N2IA 3BM5A 2QNIA 4AR2A 3VH1A 4DLYA 1FMD1 2I33A 4UTNA 1XHFA 3V0AB 4A7KA 4ZAVA 1YI0A 4H6XA 2OQVA 4QD2A 2IYFA 1QZTA 2V9CA 1TQ5A 3D8NA 3BSSA 5E0OA 1LSJA 1OUMA 3LF7A 3SXUB 4RJKA 3Q3CA 1M4WA 3AUJB 4KQEA 5L3QA 3JY6A 1U8UA 3H11A 3STVA 4ZVTA 4BMOB 1W36B 1RWOA 3LGXA 1DBWA 1HRV3 1JR4A 2FQQA 3BSFA 3QTLA 4XAEA 1GL6A 2I9PA 2JGAA 1FTNA 5JBNA 1QCDA 1ZU4A 1IC6A 4F4JA 4QUJA 5I48A 4RN5A 1DNPA 4PS0A 1HN0A 2Y67A 3DPRB 1VG9B 3OC0A 2SLIA 4IDDA 1P8JA 1D2GA 3DG9A 3SJUA 4DY3A 2AR9A 1Q14A 2WWIA 2J9FB 4H7IA 3FBMA 1R083 3RYCB 1U7TA 4M2LA 1W4BA 3FR7A 3R77A 5AHOA 3E0XA 4RW0A 3CEWA 1W29A 3KKQA 4MVXA 1IOZA 4EFMA 2V8BA 3FPCA 5BUQA 5LMZA 3ELNA 3SOZA 1BXRB 1W05A 2B1GA 1T2UA 3QKUA 2D2EA 4DXDA 4NMWA 1ZJ5A 3AESB 2FEWB 1W28A 1K63A 1CRLA 3BMCB 4FYMA 2GJSA 3FFQA 4BP8A 3Q88A 1DP4A 1W8WA 2RK6A 3UA4A 2C7RA 3SKVA 4HRAA 1UL9A 4QM9A 1C4OA 4LJ6A 1L7LA 3W77A 2QVGA 4TTPA 2OAQ1 1G2OA 3FPKA 3RNLA 2BV3A 4D82A 4EKGA 2ZULA 4B6RA 3C2UA 5DUWA 3MSCA 2VDNB 4BFVA 1ZS9A 4CMBA 1LV7A 1MIOB 3ZX5A 3FFZA 3IDFA 1PBNA 2AMVA 3NEJA 1BDBA 4ZOLA 4H1WA 3PQ4A 4YUAA 3RSZA 2OXRA 2ZUEA 2AGVA 3TLEA 5IJZA 3KF5A 3LDHA 1G16A 2QQKA 2V4VA 3RUEA 3SYNA 3GEEA 2H8KA 3PNAA 4XB2A 4XEHA 1A5TA 3NEYA 1W88A 4PQQA 2F6RA 2VQAA 1CJTC 3IJRA 3GBPA 3GJ4A 5CVTA 5ALUA 1L5HB 2ZJOA 1UJBA 3UJHA 2OR3A 2LCIA 3P2OA 2HEGA 3SBDA 1GGHA 3FDJA 1CQ9A 4YXFA 3GGCA 3DCYA 1LSSA 4OMDA 2JG8B 5KVCA 4R9CA 4P58A 3SQNA 2VHQA 4YJ3F 5J58A 1XCBA 3VBRA 1YUBA 3ASYA 2GHRA 2JI7A 3HFSA 1S8OA 3LO8A 4LULA 2DWCA 4FC6A 3ROUA 1JOBA 1EGAA 1YHFA 3CISA 5JG7A 4XDZA 1LOFC 4OM8A 3ME5A 4PTZA 3ZWDA 3U7GA 4IUCS 4XJ8A 5EWSA 5IATA 4OAOA 4PINA 3KSUA 3INTA 4E03A 5E8AA 3BZUA 3A21A 4KKXB 1O4VA 1JZ4A 2J3MA 3ONFA 3SC2A 4YG6A 3N7UA 3U7FB 3NJYA 1E5SA 1FOD3 1H2HA 3IUPA 4YJGB 2XUHA 1YQXA 3D3AA 1CZOA 4FBMA 4G0VA 1H3EA 1CUBA 4QQFA 1JKXA 4UHJA 1HKUA 2ODTX 3JWGA 4ORFA 2G9UA 3OSDA 2IXDA 3EIXA 4PYOA 1U0JA 1MO4A 2I45A 1DFGA 1M8GA 1A9YA 2JEYA 4KO1S 4YI5A 1KDKA 3PJEA 3PLNA 6CHYA 4LBQB 3AG5A 1O94C 2EKLA 3BJIC 2D5HA 1M2JA 2VPIA 5ADWA 2VZ0A 4S2GA 2ID9A 3EW9A 3VHLB 1TNDA 3QD6A 3KBBA 5HRAA 2D74A 1DAKA 4ROSA 1SOAA 2MT9A 1MRNA 5LC1A 2MSWA 2JF0A 1ECCA 4FSHA 4R2XA 3ZEAA 3VZOA 2ZIAA 2ZSIA 4NS4A 5EZSA 5BR7A 3NC4A 3OZWA 3QFHA 4GPBA 3ZFGA 4M60A 1SH7A 3JQWA 4XDGA 2Y6VA 3R6GA 2IW3A 2OXCA 2GXSA 5T6MA 2G40A 3WWEA 2YV3A 2A5LA 4FMDF 5EV7A 3C7FA 3S0MA 2Q8PA 1W2UA 3LCJA 4XJVA 1BXZA 4P08A 3OC6A 3EGVA 4FOYA 1U5XA 1X80B 5G05L 4BDTA 2KMLA 3MWLA 1NBEA 5E2AA 3VV3A 2X4LA 2O6HA 4WOPA 5K6AA 3W06A 2OZPA 1EXMA 3ZWKA 3BULA 4R1TA 2Y64A 4MGHA 2R30A 2V7TA 3TZCA 1XCPA 5CT6A 5IM5A 3U4QA 4CMGA 3CUVA 1NY71 4K9LA 5FZHA 1EFRA 4D42A 1N78A 2BUKA 2P1RA 1EM6A 3JUUA 1QOSA 3ICOA 2ZEXA 4Y1GA 1NN3A 3QRWA 1KYZA 3W9YA 1F8XA 4GM1A 2OPHA 3RK4A 7ADHA 2Q4SA 3VV2A 1VBMA 2XA2A 1TUBB 2AN4A 3T7TA 5JUWA 1EESA 4XRGA 3FWZA 4HL0A 4K2AA 3N8GA 4EYEA 4CCJA 4QDUA 2WE7A 4A5SA 4FILA 1O6GA 2PZFA 1I5ZA 1T1GA 3QI2A 5DBGA 4TZKA 4RR3C 3CHYA 1BWSA 5FYYA 2EFGA 4KGZA 3CW2A 1QYVA 5F5QA 1I4LD 4NICA 4X3OA 1EDZA 2F3RA 1OI6A 3TFOA 4ESEA 2QKYA 3ET5A 3N6VA 4NENA 1YB4A 2VZ8A 1CLUA 4ERXA 3AWDA 4ZYWA 2NT3A 1F5NA 3OJCA 4IKPA 2VCHA 3DC2A 3MI8A 4EYKA 3ZK9A 2O3JA 5LXTB 3DAFA 2PUVA 1PZXA 2IY8A 2Y1GA 1IIBA 2J1EA 1OVSA 3A1FA 3AI3A 4ECAA 2JX9A 3C4QA 4BO3A 4CUJA 4ECEA 3K9HA 1CWUA 4ZT7A 2W6MA 3U40A 4HAIA 1NXOA 1H1AA 1IJKA 2O0MA 3G02A 5C51B 4OXXA 4XMAA 3KIPA 1W9WA 1L5KA 4ENSA 4XLTA 4LZOA 1HV8A 3OT1B 4PZZA 3HFRA 3BCWA 2QJRA 2VYCA 3ESCA 3MWGA 2O2CA 4X9XA 1TO1E 4FPGA 1UC4B 1NIJA 2DUMA 1S0JA 4HNVA 5A4KA 5LJIA 3B6JA 1W7AA 1CUDA 4OSEA 2WFF1 4BVGA 4BMNA 1G63A 5EESA 4Q8LA 1VALA 3CNHA 1JGTA 3RGBA 4A82A 4P4UA 5BNZA 4OQ8A 5KYKA 1TYEB 1DV1A 5GJVC 3LBFA 3HT1A 3T1HB 1XL1A 4G9GA 4DCGA 2WYIA 4I08A 2Y8KA 2X13A 3SMQA 3IKLA 2Q6OA 1L0BA 2PQSA 2CNWD 4PGAA 3NC0C 3H9UA 5JDCC 1VPEA 1E6MA 3L4SO 1PLJA 4D25A 1GRQA 2B9EA 2R44A 4N43C 2GD6A 3RG0A 5BT8A 2NU7A 2DVAA 4DJFC 1KMMA 2ET7A 3K8QA 4Q6BA 4RHYA 1T8PA 2GDJA 4E21A 1I7NA 1AGXA 1D04A 3JU3A 2PQ6A 1TKCA 2QVXX 3WG1A 3V4OA 3R7AA 2FPMA 2Q45A 2HK9A 2JI6A 1WSBA 1E3WA 3VHOA 4XAQA 5JI9A 5AKJA 1U99A 1T5SA 3WDVA 1U0GA 2NU6B 1YR8A 2J9XB 5IAKA 2MR5A 2C5SA 4DJTA 2A5GA 4JQZA 4L08A 3T9CA 2YBPA 4KU8A 2IOFA 2EKBA 4W8HA 5J23A 3BGWA 1NCQB 4FIDA 5F2KA 3G9QA 4KAAA 4WHMA 4NE7A 5AKHA 1S1MA 5ALXA 3HCWA 1W8NA 1ZVVA 3QSGA 1Y9QA 4M99A 1UQTA 1L5VA 1WDTA 1IATA 3AESA 1RAGA 1XQYA 5IUNC 1FU7A 4RLFA 1LJ7A 4QDQA 1I6KA 4YEDA 3RKRA 1GVHA 2EOAA 3DHNA 3LWBA 1CIWA 3O8QB 5A0FA 2B8EA 2FW8A 3ZXFA 3BHMA 1AZWA 4KE9A 4NE2A 4CKEA 3OQ1A 3S68A 1QOZA 4F84A 1MPXA 1PFKA 2ZUVA 3TOJA 1KAHA 1QLWA 2PUAA 2IYUA 4JROA 1G6OA 2OBNA 4GD3Q 4QGGA 2IHKA 3S40A 4RPCA 3RJ5A 1ZD3A 2BE9A 3AETB 3LUJA 1NASA 1L5RA 3HO6A 5B1SA 4YFWA 2Q8CA 1G5PA 1RJ9B 2MPFA 3MCZA 3R3UA 2JZOA 3A0KA 1MEEA 5LSAA 2NZXA 2ZZMA 4JCKA 3ENRA 2VHEA 5EIXA 2JENA 5E38A 2B4TO 3G2HA 4KNVA 1NYTA 2XB4A 4OLLA 4IV3B 3U3RA 3JQ6A 4E11A 3IP7A 4RV5A 2FWNA 1T36B 2PV0A 1I5RA 3NYQA 3V7WA 4CDWB 3GZ4A 2AFRA 2NPOA 2P6CA 2R11A 4LZPA 1O4TA 4M55A 1LA2A 621PA 1ZJ4A 3VC3A 4I8IA 2B69A 1U9ZA 2WNIA 2DQ4A 2Z30A 1UWVA 4L3WA 4IW3B 5HIIA 3ERCA 5FCCA 3JBG2 3CNEA 2X2OA 2F4PA 5HUQA 2XMCA 3NIBA 2VPWA 4TKUB 3M3DA 4IHQA 5DOZA 2IPXA 2JBHA 1VC2A 4BV8A 1XDDA 1YJAA 3VDMA 3RAFC 4YCCA 1OAOA 1HGXA 5CTJA 1VE6A 4LKRA 2H3HA 4CQMA 1BQ3A 1UY2A 4KPYA 1I33A 3I62A 3FE5A 2XMLA 3ZHBA 1HEIA 2X7JA 3PIJA 3AZOA 5FO1A 4F72A 3QLVA 2OECA 2XB6C 4X60A 1DYPA 2NSYA 1V25A 1YR7A 1OH4A 3HKDB 4G85A 2W2MA 2AOUB 2CMFA 1SXHA 5JYDA 3RS7A 2C4MA 3IODA 3U7EB 4B6JA 1Q0HA 4RKWA 2B25A 4GEKA 4GZLA 4A23A 2AXPA 4OPMA 2H7VA 1NMSA 3PRYA 4DPKA 2DUPA 4OHOA 3GYGA 2YWXA 3GT3A 4YCMA 5EJFA 2YY1A 2QRPA 3UKOA 1H6CA 4HDRA 1JMKC 3QKSB 3PVNA 4UXHA 4XYBA 3GG9A 3MCWA 2XRZA 3G8BA 2ZUWA 1OC1A 3VO1A 5EJ9A 2R62A 1RUG3 2XG3A 4NBLA 3ENWA 4XMIA 2FSIA 3ZXDA 3TFWA 2H4FA 1N33B 3WLAA 4KVFA 2EKDA 3OMXA 3IT2A 1K92A 2CLCX 3C5EA 1UMBB 4GKJB 3EISA 5P21A 4Q4V2 3VR2A 4X1IA 4II2A 5JD3A 3TOXA 3VZPA 4JLUA 4JGIA 3UV6A 1Q7CA 1ND3B 4Q2FA 5C71A 4M86A 3TQIA 4CI0B 3TUZC 3STTA 1S2GA 4BQOA 1V96A 3THXA 5FP4A 3FLPA 3IS3A 3K35A 3K4ZA 1WCWA 1A8HA 2FDJA 4ETIA 2D44A 1VB5A 4X8PA 2OBBA 1VG1A 1RQNA 1P80A 4G3XA 2WRAA 3DTVA 1Z37A 5CH8A 1X8MA 2XQRA 1V8DA 3W5SA 4F4UA 1BDIA 5ER9A 6PFKA 3RB8A 4RVOA 4DMRA 2WOOA 3WNBA 3WQBA 3OIVA 5TMEA 2D13A 1GRNA 1C4XA 2ZS7A 5KHJA 3MJVA 4LJ8A 3CLRD 4LYEA 4MGZE 1MQAA 4H1UA 4P86A 3T9AA 2GD2A 5HQTA 4XQEA 4MINA 1VG8A 2K0GA 2GM3A 2HA5A 5LFAA 5GM2A 4DWJA 3FKSA 4QFMA 5CG1A 3HABA 1UBLS 2P7IA 4GL2A 5TVGA 1P4RA 2VNJA 3BERA 1H3NA 1RL3A 2BH9A 1E1KA 1WMBA 3K48A 1XZNA 2DFNA 2ZZQA 4Y18A 1ABEA 4CQNA 3RS4A 3I01A 4CDRA 2QM8A 2VDJA 4WADA 1A96A 4QM8A 3OF1A 2QQVA 1TYBE 3FHAA 3OZCA 4ND6A 2VMIA 1AF7A 2JLSA 2GC0A 4Y6QA 4IQGA 1GPMA 5A7WA 4XPIA 1N8KA 2EF6A 1POXA 2Y1KA 1PO22 2A94A 3FSEA 4BNGA 3LUAA 5HCHA 4Q47A 5TQ0A 3U26A 2QP3A 1IEVA 4COKA 5I9IA 1E2KA 1AX0A 5GONF 4PDWA 3AMNA 2UKDA 5FYDA 4O3MA 3IUMA 5C4MA 1Z62A 3BD7A 1J56A 4ZO7A 4ZI7F 2R8XA 1IM8A 1RUI2 1VJ2A 1TLLA 4LHYA 3V4ZA 2GMMA 3JALA 2P40A 3MV11 4L7QA 1KO7A 1ZL0A 2JAQA 4NAOA 4LBWA 1ODJA 5L3VA 2PHLA 1SHTX 2C42A 2EZ4A 3DD5A 4Q8KA 1L1RA 4G4SP 2QLTA 2AYXA 2C9DA 4IXWA 3JYNA 1L5FA 1AUYA 3RJZA 5LM3A 2PYZA 1I4WA 2K5UA 3RHZA 3A10A 5IW0A 2FEOA 4MRSA 3WMWA 4WZCA 3P2KA 3KCNA 4ZJZA 3WVJA 5AVYA 4PGFA 2QQLA 3TQRA 1NBHA 4RXUA 5EJAA 2R8PA 2EFJA 5ICMA 1Y5NA 2TECE 4Q7JB 1AHHA 2DHQA 1N1MA 1ZCZA 3N2KB 1N0UA 2VJPA 4G5RA 5F2OA 4Y2YA 3S2SA 4FBLA 2G71A 3LG2A 1OREA 4A0GA 3BK7A 4JXXA 4O1HA 1JIXA 2C4KA 1J9GA 3WRYC 4H9GA 1M83A 4AHYA 4AQTA 1RHI2 3QWIA 3G2KA 3SZLA 2EFHB 1NCRC 1H2MA 1PVDA 2FSUA 3FD8A 1T3ZA 1NTRA 5C5UA 3F3MA 3QWFA 3QBEA 1KIAA 3K8ZA 2VJKA 4CM3A 1HE1C 3P9ZA 2UUAB 4L0DA 1T0HB 5EFUA 4R81A 2I99A 1ZOOA 1UBMS 3R7SA 3C74A 4ZQFA 4G97A 1AKQA 1E2QA 1F8UA 1OXMA 1QO0A 4UUBA 3ZLVA 3MM4A 3J8F3 2P6RA 4B7XA 2VQFB 1OBFO 1R4AA 4BQ2A 2E5WA 3U10A 4RA0A 3KWJA 1E7RA 3AFKA 1WPQA 4UCQA 1TU0A 5A6VA 1E5QA 1UT6A 5I47A 2AUTA 2HF9A 2A0YA 1TVMA 2KE5A 2R6GA 3GZUC 3LOBA 3OEED 5FUNA 1QAQA 3O5AA 4IFIA 4E6EA 4FLMA 3QVGA 2JD1A 4C2BA 1LNZA 2RV9A 4UDYX 1VBFA 3PXGA 1P6UA 4KAFA 2PUBA 2EAUA 5C4GB 3TQTA 3KZ1E 5FWYB 5THQA 3GJ0A 1ODSA 1PVC1 1YZHA 3IVRA 1KSJA 3K3OA 2CVZA 4JBIA 4BMZA 4FWBA 4HYTA 1TEIA 1O6ZA 4NECA 3E5XA 1CQZA 1W6PB 1UPBA 2N46A 3I8SA 2ASEA 4CMIB 3WI7A 3H5VA 3FYUB 5DBEX 3TXYA 4DJDC 3SPXA 1QZXA 4ZXKA 2QBYA 1QJFA 4AE2A 3GH1A 1RC0A 4LO5B 4BAGA 4B2YA 1YUMA 4YP1A 3M7IA 1EP3B 3UJAA 2VTEA 3OYWA 4PFKA 4X6QB 4GZ5A 2B6HA 4TMTA 2D2VA 5HKAA 4PPNA 5TGDA 4JJ6A 2W71A 1KBZA 3IQFA 2PO5A 1PG0A 3OU2A 4E3ZA 3DD1A 2K7FA 5LA1A 5DN2A 2JLUA 2HMWA 4RTKA 1WTCA 1JQDA 1PZ7A 5KTRA 1AS3A 3BPSA 3T4EA 3TTTA 1XQ9A 3G2JA 4L5IA 1SB8A 2PSSA 1GWNA 1MC5A 5A04A 4NMMA 4ZJYA 1ZBDA 3VISA 3ORQA 4JYZA 1PQWA 1DMRA 1AKYA 1TADA 5JXJA 3D9QX 2DBNA 2C07A 5F7XA 2GHTA 1U90A 3QV1A 3HY3A 1GPH1 5BVGA 1L5OA 4DJ5X 2FZGA 4LJ4A 3KE9A 3LPAA 5BPHA 1DAEA 3L9JT 1RM0A 2WM9B 4BKOA 2BFNA 1REEA 3GPDG 1N0IA 2HWC1 3DFFA 4RTNA 1EJ6A 5EN4A 3HQUA 4A16A 5I9MA 3ZJUA 2DERA 4TYMA 1TQ2A 3LIHA 3M89A 4QOFA 3DT8A 3N2LA 3EW7A 5H80A 2VYQA 2OENG 1OA0A 2GEKA 1GNHA 4GMFA 3JQ7B 2BZGA 2BF7A 2GILA 1VJTA 3WJ1A 1JG6A 4X93A 4KN6A 4JOCA 4TWIA 1BCSB 1MACA 4Q1AA 4URFA 4ZS2A 1SB9A 1J39A 3PNOA 3U14A 1UCXA 3TDMA 2BGKA 5ENDA 1JEDA 3G2QA 3D8HA 4IV3A 5DE3A 1WPGA 2P2CA 4QNRA 3ZE1B 2R072 2JI4A 3RYIB 4BXOB 4Q9NA 5JVDF 5CW2A 4YRJA 4ZEXA 3GLTA 1DFHA 3FBWA 2JCVA 2CEKA 3E48A 4XE5A 4FFDA 2VT7A 2P2DA 3OJBA 3USUA 4CLOB 2CV6A 1F51E 1UIKA 2IQ5A 5SZIA 3WHIA 4TMVA 1U98A 1VJRA 3KM0A 1OSGA 1F8GA 1C9KA 2F59A 5AI5A 1WW3A 5LLSA 3CR3C 4FGLA 1Q43A 2RKBA 3NHUA 4BNMA 4JKKA 4C7OA 2ZGKA 3ZBUA 4NONA 1WZIA 3RZMA 1VIMA 1OT5A 2XVAA 3ADPA 3KOXA 2I66A 3EHKA 2P4QA 1Y5IA 2PGXA 1L1FA 5C4IA 4FT2A 3EXFB 2DKNA 3OX2A 4A2UA 4XFBA 3M83A 5BURA 4D9MA 3IHLA 3GEBA 4WOJA 4O2AF 4PAQA 3UFXA 1VLQA 3VYWA 2QDRA 3L1IA 4JLDA 3ZXIA 3SCFA 3GFSA 4EZ4A 4C5BA 1VZ3A 3F6CA 5JAHA 1JT2A 4AFBA 5DX0A 3FAZA 2BTOA 4FDMA 1K45A 1S2BA 1PL0A 1YQQA 3PUJA 3N86A 4BFSA 5F1KA 2EXKA 2YMQA 1SDDB 3PFGA 3RI8A 5C53B 1H22A 4UFJA 1YSCA 1LDEA 2CLHB 4DQKA 5K05A 2TMGA 1SO8A 4DNXA 4M8NE 3CGWA 2HC9A 3U07A 2HK6A 2XJ4A 3QY0A 3VPSA 4YPOA 1HG0A 4RMJA 1N3LA 4YGYA 4E5DA 1GAWA 2BRUC 2FUNB 3L6UA 2WICA 4CGZA 1DAGA 4KC0A 2W8ZA 3C39A 1OD3A 1EH5A 1ISSA 7AT1A 4J03A 3RYIA 3V1YA 4DDKA 1HX6A 4Z51A 1XXLA 3CSDA 4WZFA 1CKEA 1VCOA 4LFBB 2XBO3 3GYDA 1H23A 1FNCA 4IJUA 3CIFA 5T50A 3REQA 1TVGA 3BTYA 1SQFA 2BM1A 2P2KA 4KQ7A 1D4VB 3DQQA 2Z2ZA 4ALJA 5GJCA 4DO0A 5MHTA 5B37A 4FZ5A 3K4QA 4HWGA 1EMDA 3FROA 2NZ2A 4IHKA 5BN5A 1QQBA 4NNJA 4XM0A 1QR6A 2VS1A 5A5DA 5NLLA 4NI5A 2A59A 4KQCA 5AUQA 1E1LA 1NVBA 3RVPA 4L9SA 2NSJA 3FVQA 3F73A 1UBUS 4R83A 1M1YB 4EG0A 1XNBA 4CNBA 2Z3VA 1BMTA 5ECWA 5LR6A 3RRYA 5E8JA 4PPYA 3CH5A 1RWNA 1WA4A 1RLJA 1WY5A 2WPNA 2C3MA 2A58A 2WE8A 3ZLBA 1Z7EA 2J1LA 3ETLA 1EJBA 1YI8A 5FZOB 4QOGA 1LQ2A 3UMRA 5K0LA 4X91A 3K9QO 5CG8A 2E7AA 4U8GA 3U56A 4LC1A 1QO7A 4DT1A 1UJ2A 4BFLA 5CLFA 1IN8A 4C6SA 3AHDA 3TAUA 2YGLA 1LBHA 1ZM1A 2LVBA 1W75A 2EW8A 3UGTA 4HZUB 4KWKA 4ONUA 4DUGA 1DZRA 2PKWA 2W8BB 1ZBA2 1IRXA 3AF6A 2GF2A 4LVUA 1K5JA 3G68A 3GLIB 4ZFNA 3I3EA 4TL6A 4QXMA 3F49S 1RVF3 3MTDA 4UJ3A 1DO8A 1TM4E 1VMJA 1ZR4A 4IEOA 3VR6D 1S4QA 4RLHA 4PDWB 1L7NA 1RWBA 5EUQB 2I76A 1CQPA 1Q2XA 2FG6C 3CJIA 1IKQA 1MABA 1UP4A 2VXRA 4IH4A 3LD8A 3R0XA 1EBFA 2IC5A 4UPEA 5DFAA 5BYJA 2OILA 4Y2HA 1WE2A 4F12A 3ZCRA 2I4MA 4HYQA 3MJRA 1IHMA 4G56A 1GNYA 2DWRA 4CG1A 4CZSA 2OKXA 4X8LA 1LOGA 1EKXA 5LB2A 2QUJA 2JFXA 5KNDH 4FXPA 1KU6A 2FGJA 1ZIOA 4YRGA 1C8LA 2TMKA 3L1VA 5E95A 3QPWA 2WQ7A 2ZATA 1KPGA 4B17A 2BOIA 2FQXA 3N9LA 3IRVA 1Z5GA 1Z5ZA 2IZ7A 3CN7A 1E89A 4I5GA 2BN4A 1PFGA 1YZLA 4LY3A 4HB2A 5M5BA 3FSJX 1N1TA 2ADOA 3HJTA 1JG2A 1YVRA 2GPWA 2FHPA 4X3PA 2BQPA 4GGMX 5KNCA 3AJRA 1PDOA 4W8GA 4LX8A 5CBLA 4CUCA 3UAOA 4Y30A 4WM7A 4FHGA 5AC93 4KZKA 2M6RA 5ABJB 4JLJA 1QK5A 4ES8A 4N9IA 1BBT1 4BKQA 1QQTA 1V2GA 3P2YA 4HDNA 2RGDA 4BXSV 4A27A 2DG2A 4QBGB 3COYA 4CU7A 1VIDA 4LI0A 4G0WA 3E7DA 2BP7B 4W65A 3STWA 2VZPA 5LLDA 2P9QA 2QE3A 4RPJA 5JNTA 5IBCA 3RZGA 4MQ6A 3HXPA 5JIBA 2BY4A 4NV3A 2XBO2 2SECE 2QTHA 1TZBA 5KXEA 4OMUA 5A4DA 2GJ8A 3GDFA 3HCNA 4B79A 1RUH1 3A22A 2O8BB 5A6SA 1TZ2A 4B0PA 1GIAA 4X92A 4AJOA 1AV6A 2ZT8A 3IQDB 3OUHA 1Y1PA 3I12A 1OJ7A 3NP9A 3EXHB 2QM7A 2VK1A 2QU7A 2WJJA 2GZRA 5I7OA 3KL2A 2VLIA 2QTWB 2Y0PA 2NVBA 2R1VA 2X5JO 5GLVA 3B6EA 3UT5A 3WMFA 4J90A 5DZEA 5DVZA 1DJMA 3H3XA 1DBVO 1P75A 4WXYB 2XZOA 5K0EA 2CDPA 2Y6LA 2CE2X 3TIIA 3WK9A 4RGBA 4GLLA 3R8CA 3RK0A 2O8QA 1OLSA 2H00A 1DOAA 3FHTA 5H81A 1GQFA 4LC9A 1S3FA 4XUOA 4B75A 3HMYA 3CKHA 1GG9A 1IUNA 4IIGA 3LT2A 3CL1A 4D4GA 1LENA 5H4HA 4R8SA 4G4SO 3GFPA 1RRPA 4PRKA 1DQ2A 4ESVA 1BVVA 5IFTA 2G5PA 4RR3B 2ISQA 4JAAA 1FSFA 2HSWA 2EC5A 4EUSA 3CR8A 1GCIA 3LWNA 1GQGA 2C5AA 1WUJS 3UJCA 2YZMA 1TJ5A 4GPTA 2BBVA 4IVQA 5KSYA 5D51S 4W9NA 5CDTA 1N6OA 2PUEA 2BGOA 2PZEA 3H3JA 4RPGA 4LHZA 2O5CA 2ZFUA 1GP6A 1SUAA 4C89A 1VRH2 3CKMA 4WNIA 5HZMA 1IMJA 1ZJYA 2QUHA 1M9NA 4XBNA 2Q1WA 5K0TA 5JSUA 2XJSA 3FLTA 4FO9A 1NW6A 3RZKA 4NABA 2Q6VA 1J25A 4ZRNA 1RTVA 1DC8A 1RUF3 3F2VA 1E2MA 2ZBGA 4LC0A 2WHQA 3LYAA 5E3IA 1QKJA 4Q4W2 4U63A 3H5LA 3WBKA 4Q0UA 1O6BA 3O6VA 5IP5A 4QX8A 2VYND 2D3WA 3T5AA 4WCFC 4WLVA 3ZYPA 3PT5A 1QF9A 2IW1A 2QXYA 1UFOA 1Y3TA 2PUDA 2CVFA 4YXWD 5GLZA 3EXG2 3OA0A 1RUF1 4IYJA 2CSUA 2VPZA 2KXLA 3UAZA 3PHJA 4M3CA 1NJGA 4KLZA 4TXWA 1TGVA 5BNOA 3UYLA 2GC1A 3IQGX 1U5IA 1JG3A 2BRUA 1FXUA 2P2YA 3G2PA 5GJ6A 1RVF1 5KXBA 2V7VA 3ANTA 4CDQA 4I36A 4ACBA 4TQUS 1ZDMA 1NRIA 2YJ4A 4D8XA 4P4NA 3R7FA 4UNIA 3FPSA 1QQP3 8AT1A 1KE1A 5DT2A 5FK8A 5E4FA 3K0FA 1KMNA 1DEXA 5IDVA 4I6EA 5D21A 1P6XA 3PNLA 4U00A 1CC1S 4LG1A 5FY0A 4BFUA 2RMU2 3UYKA 1BVRA 1ZKDA 2IUFA 3ZVXA 3REQB 3L05A 3PUXA 4JC4A 3V4SA 3E53A 5LRSA 3USUB 4XE9A 1T4CA 2GU9A 1ZRCA 2OG1A 3R9XB 1G4AE 1GKBA 2ARAA 4ZAZA 2QR2A 5THKA 3KQNA 1EAYA 4R9NA 3LKJA 5FPYA 4JQRA 4TKMA 1LV8A 2H4YA 4OGGA 3T7JA 3P5BA 3ZDSA 1PK8A 2DKOA 5C8CB 2HU2A 3T4HB 3F3YA 2QN3A 1J0EA 2O3UA 3V4LA 1I7SB 1YGPA 4NPRA 4DR4B 2AJTA 2ZSAA 1ZL2A 1QWSA 1DUSA 3MBOA 4DFDA 1XYOA 2G5GX 4OUDA 3AILA 5IKEA 1P61B 3OOHA 2WTEA 3EVTA 4JXKA 3IDCB 5EZYF 3HRKA 3FN9A 3AKPA 3OCXA 4Z2WA 1AT1A 4MSUA 4NZZA 1RVDA 2QQNA 3GEPA 2IIBA 1FNDA 2HJIA 2JPDA 4HDCA 1O54A 4JZYA 4BPRA 5T8KA 3CEPB 2FG5A 3OKCA 2O14A 5FLKA 3E5UA 2JFGA 3AY3A 4WXEA 3H2BA 2P4EA 2VDMB 2IXFA 1G66A 1A8MA 3MUZ1 3BRCA 3WMRA 1HTWA 3AYDA 4KRFA 5AHWA 1AK2A 4QX0A 1OGJA 4GRDA 4PXYA 3UTDA 3EXEB 5KQSA 1EXWA 2WKSA 2M1ZA 1BEUB 4DNQA 4GALA 1AA9A 2ZOSA 1GPUA 4IQ4A 4QFCA 5FPUA 1DX9A 4E4TA 2BEWA 1MG5A 1PL8A 2O8FA 1G9CA 1KY5A 1RJGA 1M1ZA 1FDIA 5AI4A 1HQYE 3P96A 1NYWA 4DR7B 4K9NA 3M1HA 1N2BA 1V43A 3S0JA 1P7WA 1QRRA 4GGOA 1VHWA 3VXKA 2OHGA 1NJ1A 3INYA 4B3FX 1ONSA 3WW1A 1QWRA 4EI2A 3D3JA 1Z3CA 4HAWA 1ND3A 3DEHA 5IN4A 3QLVC 2J3QA 1ZKMA 1T2XA 3V33A 4ENTA 1MAUA 4AO7A 1E5RA 5ANRB 3MLEA 2QCSB 4KOAA 6ADHA 1SKYE 5A71A 4PC1A 4LAFA 1OAOC 1PX2A 4LRUA 3RZLA 1TXGA 4HKLA 4BISA 3OY8A 2Z1DA 4UVGA 3SCZA 1G55A 3RV3A 1MHTA 1P9LA 5FY5A 1DXYA 1HDRA 3A3KA 1VCHA 3A9TA 4AN0A 1D5WA 1HJGA 4PZDA 3IOEA 3PUKA 3DKPA 1TCCA 3PXXA 3GJTA 1JQ3A 5T5OA 2AK2A 4CQJA 3LH5A 1DG1G 2ZMKA 4BMEA 2QZJA 3TW6A 5FJJA 2JCXA 4J2TA 1U12A 4GMHA 5G40A 4ZYZA 1NM5A 2FUG1 3GUCA 3CCFA 2NSDA 2BERA 5JSHA 4XFAA 5H16A 3LPGA 1JAZA 2XF8A 3G7SA 1WLYA 4H3VA 5IZCA 2ZWPA 4LYYA 2IWHA 2Y1XA 4A41A 3WLUA 1QK3A 4MDYA 1CJVC 2ZGNA 4S1NA 1XRMA 4C4XA 1UWLA 3NHAA 3BODA 2H48A 4IM7A 1CR6A 3FBYA 4PLOA 3K4HA 1USVA 2GS9A 1DG6A 4UZEA 3F8TA 3PHBE 1I24A 3K75B 1RTKA 2H1VA 3BH6A 1Q0TA 3HEAA 3BE8A 1R4ZA 1XRNA 1XSEA 3GELA 3WYGA 5I8SA 3W59A 1PMJX 3PR1A 1W3VA 1JMVA 5LBTA 1IS5A 1EJ0A 3SYTA 3TUIC 2QV7A 4ZV9A 3UL2A 5FOVA 4YIHA 2Q21A 2NV2B 3JALB 3WLQA 4XWOA 4CN9A 3ILYA 2CJXA 4BMXA 3BMOB 3I2OA 1GTZA 4MW6A 2OLKA 3DOUA 4RFSB 1T6NA 4XABA 1I4DD 3O9MA 4OX9Y 3WLNA 1SCUA 4W6XA 2O0OA 4D9KA 2BEUA 4B46A 4M1SA 4R9AA 4RK5A 1PQ4A 1AR91 1T1SA 3U5ZB 2JFHA 1AL21 1YU6A 4CL0A 5LBCA 4BVBA 2O23A 2B6NA 4RGKA 1JF8A 3KZNA 1FUEA 3WFIA 5LUAA 3DBVO 4J4BA 3DAPA 2ZSFA 1AKUA 1X9HA 4DLLA 4F60A 2XVGA 2LRPA 4N54A 3HY6A 3CH6A 3L1JA 4O59O 3FWEA 1QVAA 3AY7A 4D3FA 4DM4A 3OPWA 1Q3KA 2XODA 5LZ4A 4HAVA 4MV7A 2B9VA 4O4JF 4N5LA 3OQIA 4S0XA 1UX6A 2BELA 5J43A 3LT1A 4KMRA 1BGVA 5K3SA 2Q8OA 5LQMA 3PGA1 3C3CA 3PVBB 3EGXA 3L4BC 2G82A 1T6ZA 2FE4A 4M88A 4TLFA 1HK7A 2ECOA 1UEJA 2F1IA 3PFCA 5JJBA 1C8VB 3ANNA 5DP1A 3CU7A 3T38A 1D6JA 1JKFA 4YPFA 3I49A 4IYRA 4AEDC 3UCEA 1ADJA 1KEEA 4QUGA 1GUIA 1IQPA 4BOYA 4I1VA 3SC4A 4ZCIA 2O8DA 4LO8A 1KYVA 5I5GA 4BUCA 2PFKA 4BUJA 5K8CA 3EXUA 5ERXA 5TQ2B 2D54A 2O1QA 1M7HA 4KL8S 3EPPA 1LTHR 5JS1A 2X8BA 5BW8A 3V0BB 2R4TA 1AYN1 4EFDA 3LEKA 3NT5A 2O3SA 4HMZA 4DUZB 1POWA 5FYTA 1Q8PA 4C2UA 4WVZA 2IVFA 1CR1A 3GPBA 4KVAA 3Q3IA 3T35A 3PHCA 2H5EA 3RODA 4LE0A 3K09A 4L8YA 3H2KA 1G17A 3E70C 1IHDA 3UFBA 2CDNA 4LZWA 2XKBA 3HR7A 3GY0A 1A8SA 3HN1A 4LQ4A 3NVKI 4RYDA 1J8VA 2EWMA 3F3SA 1J6UA 4YCNA 4R7ZA 3MEQA 1T9CA 3OJEA 5EWMA 1JE1A 3NTVA 1OVMA 4XX1A 2XJUA 3GN2A 1ZMRA 1FYUA 1PVOA 5FUIA 1E6LA 1Y8RB 2PE5A 3ZFEA 2YZ4A 3JZDA 1ULBA 4K26A 1R6UA 1F5SA 4QYMA 3IZOA 4UPDA 2IYRA 3WF1A 1UY4A 4DNPA 4ZPIA 2LE0A 1T0IA 1NLYA 3UWDA 2W6PA 3AJDA 2CL5A 3ID6C 4GX1A 4ZVOA 3DZIA 1BEV1 3B2QA 1X33A 1IQDC 3X1JA 2XQKA 2NO9A 4O4HB 2ZAIA 3FPFA 3ZHVA 5JYBA 1V3QE 3GCWA 2Z2XA 2G8LA 2RS31 4U2DA 2BWJA 5J37A 5EP9A 1QB8A 4Q15A 4NAHA 2OXEA 2WJVA 4HH1A 1GYQA 3AQIA 4AWBA 1EGVB 4FK8A 4AZ0B 3RW9A 1U2SA 5H3CA 1QTRA 3R6DA 1RB8G 3EMVA 2H1OA 4QYXA 2GNPA 2BUAA 1LBIA 4INPA 1SBNE 2X5NA 4RUKA 3BK1A 2JB8A 1QJZA 2VJNA 1FT9A 1UPIA 4CXYA 1WP4A 3T4XA 5FRDA 4JUAA 3ODPA 1LVUA 2PNFA 2ZGPA 4BZ4A 3SFTA 2X14A 5EJIA 4Y22A 4BQFA 1RYNA 1XPOA 2QG4A 3CDZB 2FX2A 1R15A 3O31A 4OIMA 1E2NA 4MKXA 2ZI9A 4AGGA 2AOTA 1Y3IA 3WP1B 1Z4KA 4GKYA 2WJSA 2IZ6A 4OQFA 1MVQA 4BN0A 4KDCA 1NAEA 4YH1A 1B09A 1UIRA 3DO8A 2RE9A 4J0JA 1AM4D 4POAA 5FZ4A 5CPFA 3B36A 3I5XA 5BV1A 2WS91 1ZZEA 3B69A 1NI3A 1TA0A 4OQNA 1HE8B 2X8JB 4L11A 3I42A 3ZNOA 3O1PA 1RQ7A 2QEQA 3L7OA 5HHTA 3GJQA 1RITA 1E0DA 3HUDA 3GDOA 3EFHA 3IPCA 2ONJA 2W0XA 1HURA 1N2GA 5I0UA 3W5DA 1GWMA 3NFYA 3ITKA 3V1LA 1NJ8A 3NV4A 2REOA 2J1UA 1VTKA 4Q9LA 4JLBA 5CVRA 4FFLA 3KU1A 2RHGB 2D2XA 1P5RA 2OQ7A 3HJCA 2CDOA 5FL7A 4LQCA 4K3UA 1DHRA 2P3YA 2XW6A 1R4MA 1C1HA 5D6OA 3WAKA 5DPNA 3GGLA 1G3RA 1LGYA 3OTIA 2C2ZA 4E3WA 1WHSB 3KLBA 4FNAA 3FA2A 3ZKWA 1QU3A 1SLBA 4UFOA 4GH4A 4TZTA 4DR6B 2BKAA 1PT9A 1PVC3 3JZMA 1GUYA 3RHFA 3GGOA 4JR0A 5FWXA 3W7VA 3B5LB 1HQCA 4PCAA 4YP7A 2LTAA 1L4NA 3E5RA 5BORA 4IERA 1YCDA 5CLLA 1UY3A 2QQJA 1KJIA 5LCXA 4BQEA 1KP2A 3WLLA 3ANMA 2XKAA 1LK5A 4PU0A 4K9RA 3UKNA 4Q0QA 1WU7A 3U3MA 1R3UA 1R8XA 2HCRA 1ELOA 1VFPA 3H1GA 3TNJA 3HH8A 1LS1A 3TTYA 2I07B 1VE9A 1EAMA 1T36A 2OP1A 4O4JB 2AF3C 3AINA 2K9ZA 3PJDA 5EHNA 2XMGA 3EQ7A 1UFKA 5HF5A 1MX9A 1FFHA 2FMTA 2NXJA 3H16A 1XRQA 2HW8A 2X2PA 4ZK6A 4MUJA 4QULA 3UG7A 4XD7A 1F6DA 4YMLA 2UZIR 5BRJA 5D84A 4FP3A 6NULA 2A0UA 3ZGVA 3GXOA 4NCKA 4J1TC 1AS0A 1X1CA 4E30A 2H2GA 2ZTUA 1MQTB 5E7QA 5FY8A 1RWXA 1SU7A 2B1IA 1HNNA 4E14A 5F4ZA 3WAJA 5JPCA 1OOPC 3VPDA 3TW4A 3QI7A 1MAWA 3O8OB 3N74A 2IZ0A 1TA9A 3DKIA 2Z3WA 3B9QA 3VAZA 3DWEX 3GNEA 1C1XB 2O1SA 3Q10A 4LZZA 3ALQA 1PHMA 3K3NA 4GZMA 1YIOA 2ZIEA 3B9RA 4Z4HA 4I9HA 4NO4A 5L9AA 5EQUA 1JUIA 3U4QB 1GNZA 3L46A 3LSDA 3HCDA 3JB4C 5HVNA 1KVQA 5AOBA 3F95A 2XT6A 4N53A 4ZHQB 3ETJA 2I4LA 3AVUA 1X8JA 2ZHMA 2VMGA 3CH7A 5DWVA 1DADA 1IEWA 1Z6TA 3WVNA 4WM8B 4FYIA 1ZK2A 3ZS9A 2PZGA 5A7WB 4XPIB 5ECYA 1DKRA 4TMWA 4BN5A 4K1ZA 3K71B 3OPXA 4YLZA 3AEZA 4DABA 2CCGA 3M7AA 4MIKA 1MEC1 2ZPXA 2XGOA 2EIGA 3NTRA 4QUIA 3DZHA 4QWMA 3TBHA 3M3EA 4O4IF 1FFAA 3CCCA 4I4TB 1QONA 3HE3A 3LJKA 4J1SA 2HA7A 1O5LA 5FLJA 1SFRA 2E51A 1U65A 4AJEA 3WGVA 1PGPA 4TMYA 1E3TA 4GI3A 5KWSA 1APBA 2VE1A 3COWA 3KFLA 1W6PA 3O1HB 3JSAA 1JFFB 1M74A 1OOEA 2WC2A 1E2FA 1W0JA 3N8DA 5AM0A 4NSNA 1REQB 1TTTA 1VSQA 3EPKA 3O4GA 1JKIA 2FFRA 4OL0A 4IE5A 2ZZNA 5ALIA 5HJ2A 1GYKA 2Q1UA 3TSWA 2VFAA 2HBZA 1QOOA 1QGUA 3DKRA 4NPHA 5AM1A 3GJ7A 3A2NA 1TT7A 5B55A 4YVSA 3L8HA 4UU8A 4Q3LA 4EG6A 3KQKA 2G9GA 1DU3D 1XLWA 1ZWKA 3O83A 1FFBA 2W98A 4G0MA 1CEYA 2GHIA 5JO0A 1XZMA 1QGZA 1TEZA 1JDJA 3E0QA 2QW8A 4KK4A 3JW8A 1GFIA 5JWHA 3SHTA 5HJEA 4CM1A 4CF6A 2WFLB 1HDOA 5J4KA 1YH3A 2OV6A 5KTYA 2K4MA 4IJVA 4B4PA 4WGGA 1YUDA 1CVNA 1B35C 3IUNA 4DLXA 3WW2A 1J06A 1P45A 4CDWA 1SRQA 4WLOA 2CLEB 4U36A 5GWXA 3DE3X 1YR3A 3NIDB 4L8QA 1KS4A 1SHZA 1MEJA 3FETA 5FYHA 1T0BA 4Q4W1 1XTVA 3L0ZA 3H97A 3LA2A 1T0JB 4EW2A 1RYFA 1AKRA 4QX1A 4IHAA 4BMCA 4LOHA 4UE2A 1CUVA 1V41E 4AZVA 5AKYA 4PYRA 3C14C 2GNMA 1MNAA 3MUOA 5I4IA 1XN4A 1DBQA 1Z56C 3J26N 4DUPA 4DLTA 3TLKA 5JATA 5C3SA 5NULA 2C96A 4HN2A 3F6BX 1AMUA 1RUF2 3LA3A 1SHJA 4EN6B 2RHOA 4UHKA 1XCJA 1SUFA 2PK3A 4DEYA 4M9RA 2I1LA 3N7MA 1UQRA 3SEQA 1KC1A 2HCFA 4J3JA 4RABA 1VYVA 2V0CA 3MAJA 4BLOA 2ORZA 2HO5A 1M2GA 1GPKA 3D2CA 3EQZA 1J5PA 3IDSA 3NWOA 2OX0A 3IOYA 4RVSA 3B1JA 3O9VA 1O77A 3DVQX 1SPPA 1SIWA 4QRHA 1IM5A 1KQGA 2J0UA 3W2HA 1CJKC 1ASJ1 2MNGA 1YQ5A 2PNJA 5CYOA 3WP3A 2NZYA 4XWWA 1DKNA 3ENKA 1YJQA 4ET7A 3A6EA 1H2WA 2VSQA 4YV2A 1S1CA 4C0SA 1FUYB 2QAIA 3O9ZA 5D1NA 3Q7IA 3W8EA 1NY6A 2VK4A 5FFMA 1DHTA 3WGOA 2VNSA 5EPAA 3PHGA 4TUYB 1X1RA 5F78A 4U9UA 5BSEA 4TWTA 3ZN6B 5DHQA 1MA3A 3UNPA 1Y1LA 3DMRA 1ZHHA 1NVTA 3N5KA 4DIBA 5CT4A 5TMDA 3HA3A 2WT2A 2Z83A 3R9KA 2QUAA 1U5BB 3B3JA 3UJQA 3I92A 5L45A 2FSGA 1RMQA 2AF4C 5A7QA 3NVMB 4C87A 2O7SA 4E5UA 1DIRA 3M70A 1ZBA3 4LMPA 4NFHA 1AHSA 3AVWA 1QIJA 4RJLA 2ZK7A 1XWIA 5F39A 1DZIA 1O6FA 1U0LA 3DEAA 3VDCA 2O59A 1RUJ3 5A05A 3L0OA 4M9ZA 4J7XA 2PLV2 3E5HA 1QVZA 3OGSA 4PX5A 1MBZA 5B6IA 4QPCA 1GAQA 4GW3A 1QQP1 5D3MA 2JGKA 5KVSA 4A6XA 1LX6A 4DMIA 1ZIXA 5C4WC 2Q2NA 5J4HA 5AW8A 4WBXC 1C3VA 3X3HA 3PPIA 3WB1A 2XCIA 1OFVA 1ZI8A 3IA7A 2F1HA 1X8EA 3PVOA 1DWPA 3N59A 4EF5A 3OMWA 3GIWA 1XTRA 1AYN3 1E6CA 5D6NA 2I65A 3BFXA 1IH8A 3KQRA 5FZIA 2JGFA 4CP0A 3CPSA 4RJ2A 1C3HA 3LRXA 4QTUB 3HNOA 4UAVA 1RAAA 3K70C 2XDYA 3UHFA 2JECA 2QENA 1IN6A 4MH0R 3M6MD 3JRWA 8GPBA 2CNDA 4KFSA 2C61A 5CW1A 3MT9A 3IEVA 1LGNA 4OB6A 4DSAA 2QX6A 1KZ6A 2GEUA 1VL6A 5HQJA 4K1XA 2RDSA 4QIHA 3IAXA 3IB6A 3L9WA 2RG4A 2V72A 3GVIA 3QEOA 4I9UA 4P6VF 4OK3A 2AFIE 4L5BA 4IG9A 2PU5A 2E3JA 4XIKA 3UWKA 1NX9A 4UTZA 5CLJA 1L4LA 5IUJC 4ZVQA 4YACA 2VW1A 1ABFA 3VA7A 1KKUA 1XTPA 1BA2A 4HVCA 3B9BA 1YRHA 3PZRA 1N6PA 4UZFA 5L7OB 3NAPC 2GXAA 4EELA 3KQOA 3PLAE 3PC8A 5P8WA 1GU1A 3K96A 3PFHA 3WIEA 1JZ2A 2YZGA 4ZVPA 3HSSA 3RS2A 1YACA 4P53A 2D1QA 2QTTA 1CZLA 2HWC2 3C6MA 5LQKA 1NC3A 4BUZA 4QHTA 1G19A 1LDGA 3AUSA 4CKEB 2PSDA 4TQGA 5FMOS 2DFVA 2F8TA 1FX0A 3R5SA 4ABTA 3L8ZA 2NO1A 4AD8A 5KTTA 3GHNA 3AL6A 5JZMA 3GHMA 2XITA 3SF8A 4NHMA 1XDGA 5JDBA 1Q0QA 2HZBA 1CF2O 4DY5A 1J97A 4LIUA 1GDHA 2I1QA 2V4ZA 1NUAA 4IJ6A 1R6BX 1L5WA 4JDNA 1T0UA 3C5CA 3EB9A 2RONA 2F43A 1XA4A 3PKJA 5FA8A 3W6NA 1RUC1 1UODA 2OCAA 2EG9A 3O8CA 3PA6A 1UYZA 4UEOA 2AI3A 1CR4A 2HFJA 4DQAA 4O61A 5KSWB 1CEEA 4JMPA 4D8UA 3D6VA 2P69A 4CCMA 5CEJA 2FK7A 2DH6A 1UPXA 5BR4A 2XVXA 3S2ZA 4YR9A 3WZ2A 2GZMA 4G86A 4Z92B 3SC6A 3UK2A 3UOWA 2VMCA 1FDWA 3TYXA 1N34B 1GP2A 3ZI7A 6GPBA 4PZLA 1IAQA 4D4MA 1N36B 1NUPA 1BEZA 5L4NA 1L7DA 1NW5A 3DP7A 2LCFA 4FOWA 4CKWB 2FH5B 2VDKB 4BK4A 4YDHB 2CZCA 5AW5A 3LCUA 1W5BA 1XZ8A 5HIJA 5AVZA 4HWSA 4BVFA 1R4NA 4WSOA 4KB5A 4I9GA 5EE9A 3IFSA 4MWBA 1KO8A 3S29A 1C7ZA 2ZB7A 2OC4A 1XE8A 1SKAA 1L5MA 1GNPA 5I8PA 1ULDA 1N25A 2Z1NA 4RSMA 1L4UA 3MW4A 2X5KO 4RADA 2ZYGA 3FCAA 4UMDA 2PL5A 3JARA 2VQEB 4A6EA 2F1OA 4FGJA 2OD7A 2UYYA 2W6CX 1M2FA 3VPGA 1E60A 4QTTB 1QIKA 1WNFA 4KL1A 4WA7A 4FDUA 3BGDA 1QXPA 1Z0IA 2DT8A 2YWJA 3MIEA 2BHSA 4DG5A 2B1RA 3GLVA 3QENA 1RLIA 4MGEA 2E7TA 2PZBA 3SX0A 2IDJA 4M7WA 3PB3A 2EHJA 2Z2KA 1IXYA 2QRLA 3MHZA 1L5LA 3J7MA 1NOJA 4PRLA 4ZOQI 4ALKA 4BWOA 4AK9A 2ZJ1A 3K0AB 4RS3A 4MULA 4UOEA 1YWKA 1YZVA 5BXYA 3DUFB 3OIYA 2RGXA 4ZXEA 3MA0A 1B73A 1B6TA 2E26A 9ABPA 1BJQA 4E5YA 3WQ7A 2XIJA 4BNJA 3IO5A 3QYJA 3FUOA 4PO9A 4L27A 2VIIA 1NVFA 2XNHA 2XH8A 4GUDA 2QN7A 2VZOA 4N9QA 1XD8A 4JNKA 3UMGA 3OZXA 4BDVB 2ERYA 3SNHA 1OV6A 2I2DA 1TU4A 2BGIA 3RVNA 2BYTA 4GC9A 4GLBA 3WMXA 1VPVA 1MZEA 3EAQA 3VTFA 2CT8A 3HNMA 4RTOA 1LBTA 3W7AA 2C82A 2YUTA 4TS4A 3ZHXA 3OTFA 4EWDA 1LBSA 4H08A 4CTOA 4Q1RA 2CSXA 3LYHA 4M6WA 1DWQA 1GZSA 5JISA 1KR2A 3E9QA 1E1RA 1A04A 2HWE2 5B4XA 2P65A 2QY6A 4L8WB 2V5UA 1WMDA 1V1RA 3VN4A 5DG1A 3EH1A 1Z0ZA 2WT0A 3M4FA 1A4UA 4X1OA 1H5QA 2Z9DA 4Y1RA 3D7MA 1LESA 1CRPA 4Y1UA 3LV8A 1EHIA 4CM9A 2IOQA 3CKKA 4PNPA 4ZVUA 5J1SB 1NPYA 2NYRA 3NAGA 2INGX 3EF0A 3EGOA 3OLZA 3BDAA 2QMUA 1W6MB 2YRFA 2BDTA 1I51A 1PX3A 2EERA 1FXWF 4L57A 2QZ4A 2VDVE 1NDUA 3WINE 4WY5A 2DSNA 2QJOA 2BCEA 3EA5A 2FG7C 4UEKA 3F3KA 3UHAA 4D7AA 3ICEA 1PMHX 3FVVA 3MWDB 3VU9A 3LFMA 2EFCB 4HZUA 3N7TA 1Y34E 2AQHA 3BK2A 4ZTUB 2GPBA 4YMTA 5LZ9A 4PX2A 1XTJA 2CVPA