3M70A

Crystal structure of tehb from haemophilus influenzae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
286
Chain Sequence
MKNELICYKQMPVWTKDNLPQMFQEKHNTKVGTWGKLTVLKGKLKFYELTENGDVIAEHIFTPESHIPFVEPQAWHRVEALSDDLECTLGFYCKKEDYFSKKYNTTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENLNISTALYDINAANIQENYDFIVSTVVFMFLNRERVPSIIKNMKEHTNVGGYNLIVAAMSTDDVPCPLPFSFTFAENELKEYYKDWEFLEYNENMGELHKTDENGNRIKMKFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of TehB from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
molecule keywords Tellurite resistance protein tehB homolog
total genus 73
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m70A02
5DM4A 3EVBA 4FR0A 1DCTA 4I02A 3GBFA 5LQRA 3LGAA 4RD7A 4PIPA 4AVAA 5JR7B 5DX8A 4I3PA 3DP7A 1XDSA 2IH5A 4POOA 3KR1A 4GF5A 1HW5A 3A26A 4YSFA 5E1DA 4ZU7A 3B89A 4CTJA 4C05A 3SMHA 5HZMA 2O0LA 2IXHA 4IEQA 3LCVB 1R6AA 4YUVA 4BLVA 1KYWA 3HP7A 2ZLBA 5KQSA 3I53A 4E33A 1O3SA 3QACA 3TOSA 4CKEA 5E1OA 3BB6A 3FPGA 1L9KA 2HR1A 3E6CC 2GLUA 3IIAA 5EMKA 3BWCA 1FJXA 5CADA 5EZWA 5C8WA 3KMHA 1DGWA 1RI2A 1J3PA 3DULA 1QAQA 4RVHA 3UKTA 2O07A 1YHFA 2XKPA 3P2IA 2PLWA 1I5ZA 3KSCA 4FBFA 5C0OE 2EA7A 1ZRDA 2PXXA 5GP1A 4EWEA 4M36A 3NW4A 4DCMA 4E32A 5T3NA 2MPFA 2P3LA 1VR3A 1UFKA 3GRVA 2F8LA 5K0LA 1YUBA 5BXXA 1G6Q1 1SEFA 4LA3A 2AN5A 1ZRFA 3G5LA 3KGZA 4A2UA 3KPVA 3H1YA 2CMGA 1EY2A 4E31A 2V09A 2P40A 3P2KA 3D2LA 2ATFA 2WK1A 5FULA 3U11A 2YUIA 1SQFA 2ZW9A 3RODA 5BW5A 3M6UA 1BHJA 2FCAA 3JWIA 4KW7A 4HG2A 2PXCA 3EGEA 4RV9A 4IKPA 5CVRA 3LA3A 1DZTA 1JQ3A 1NYWA 3S7IA 4X63A 3G8BA 2B3TA 5E9JA 1ZZ7A 2QRVB 2XYVA 4QXKA 2KW5A 4C04A 4Q29A 4V0QA 3IYLW 3U10A 4PYKA 4LWOA 5DM2A 2YXLA 3P8ZA 1NW5A 1KXZA 5LQJA 4YRDA 2BGCA 2IH4A 1Q0SA 1ZKDA 2OYRA 2UYQA 3HCCA 3KQOA 3EMBA 2ZTHA 4RTMA 3FTFA 2ETEA 2YXEA 1NV8A 1X82A 3G7UA 3QOPA 3LZZA 3LCCA 3GJYA 4MWZA 3NVCA 4BIFA 3HCBA 3IDBB 5JR3A 1PM7A 4D7TA 1V70A 4YUWA 3H8UA 5CUQA 3QV2A 4KWKA 2UY9A 3H7JA 3C3YA 1UIJA 2ZIEA 5EZSA 1NE6A 2QM3A 3TM5A 2DPMA 2H6BA 2Q41A 3C3PA 4PIMA 1U2ZA 4LECA 3FUWA 3PB3A 4HMZA 3PLQA 1UIKA 2BR4A 3KQTA 4ORFA 4XFCA 2OA2A 3UJ6A 5FPXA 2PXAA 3FHIB 4Z82A 5KHGA 5LSAA 4YV1A 4RTPA 5E8JA 1WG8A 2D5HA 2NXCA 4IEOA 5K0EA 2CL5A 1O4TA 3E5QA 2OY0A 5P8WA 3UZUA 3LECA 4NECA 5I8YA 4ZU5A 3GXOA 2Q0AA 3SHRA 2P1DA 3WW2A 4GQBA 4GEKA 5HFJA 5HEKA 2PAEA 1O54A 1FBNA 1O5LA 1R74A 3DLIA 3UJ9A 3TMAA 4IEZA 1SKMA 4XUDA 1L3IA 3RNSA 4YMHA 3QOXA 3UKVA 4LUKA 1X8MA 3BT7A 3DMFA 4F8AA 1LR5A 4LA2A 1OFNA 1JG4A 3G2OA 4N9IA 4XCXA 3MGGA 4KIGA 3JWGA 2IXCA 3FTCA 4HTFB 2YVLA 3GO4A 4WVZA 4XF9A 2PHLA 3TR6A 2FYTA 3MDPA 1Y3TA 3HT2A 3LHDA 5J3UA 3MAGA 1CX4A 3H50A 4RTQA 1CAXA 1XDZA 3CJXA 1QXJA 4HTFA 1WA4A 1VLMA 4PYOA 4MQ4A 5JSPA 3HTXA 3UA4A 2PX5A 3I54A 3DMHA 2VDVE 4ER6A 4PJYA 1Q3EA 1O3QA 3SX0A 3EEYA 1VE3A 1SG9A 2AOVA 1O5UA 3M6VA 5KHHA 3M4XA 2C0ZA 2OPBA 5BY5A 5FHQA 3GRUA 1J3RA 4I0BA 2JG3A 4QM9A 3EO6A 3LAGA 1XCJA 3HQXA 3R9XB 5FCDA 2B2CA 3FUXA 5CCBA 4QQNA 1XVAA 3ME5A 4WBBA 1VJ2A 4XFFA 3DV8A 1YFLA 1RJFA 5EMLA 4FT4A 1RJEA 2NXEA 4I09A 2P3QA 2Z6UA 2G70A 1FXZA 2ZZKA 4RTKA 3CJTA 3BXOA 4QGMA 5EQJB 3FZGA 2P3OA 3ANXA 3T7RA 4AZWA 5ICGA 4MTLA 4X6QB 3HNRA 3JWJA 2QCSB 3FPJA 4LEJA 4M38A 5I8SA 2N47A 4RTNA 4XUEA 3HT1A 5LQKA 3R3HA 4L7VA 1XCLA 2JHPA 4HVRA 3DR5A 3O4FA 2A14A 3N4MA 1ZVFA 5EFUA 2OBFA 2BR5A 4PIZA 3ETQA 4CWAA 2JJQA 4R05A 5G02A 3THSA 5JAXA 2ZWVA 1Q43A 3E5XA 1Q0TA 3IBMA 3DKWA 2XGXA 3VC2A 4A6DA 2EFJA 5FLIA 5I0TA 2Q30A 1XE8A 2EG5A 1ZHFA 5I91A 4XF1A 3RYKA 1H1DA 3HIFA 2ET1A 4YNIA 2PWPA 2UYCA 1KHHA 1D2GA 1NE2A 3P9KA 3ELDA 4XFBA 4R6XA 3OFJA 3LBFA 3MTIA 3OGJA 3VYWA 3PLAE 2F4PA 3CO2A 1BOOA 3NL1A 3OD0A 3DOUA 1NW6A 4IEPA 1QZZA 3E8SA 3FTDA 1EP0A 1QWRA 2AN4A 3RDIA 4M7RA 3NTVA 3BPZA 1RTVA 3FPFA 4FAHA 5BXYA 3MYXA 2PT6A 5I0UA 2I62A 3MZHA 3PTAA 1MHTA 3F4KA 5DTQA 4I2OA 4Q0VA 4H7LA 1YWKA 2PGXA 5C1IA 4PCLA 4EROA 4IERA 2C7QA 1IM8A 3RPQA 3L8DA 3FX3A 2ZBPA 7MHTA 4HBNA 4OX9Y 4GC5A 3PS9A 3PT9A 5FQNA 2ZKLA 3AWIA 3AXSA 1VBFA 1ZREA 4R8RA 5I8TA 3D0SA 1MJFA 3CEWA 1O9GA 5LEKA 3LBYA 4PINA 3CVOA 3BGDA 1INLA 2IH2A 3LWCA 2Z2SB 3DL3A 4PGGA 2VECA 2ORED 3EBRA 2ZULA 4OBXA 2G1PA 5D1HA 3OU2A 2GH2A 3OPNA 4HSJA 1X1BA 4AUKA 3I7DA 2CGPA 2XBMA 3BU7A 4ZU4A 4XF3A 3ER9A 3HVHA 2HTEA 3CL1A 2VPVA 5GIOE 5CD1A 1CAWA 3E05A 3EGVA 1J59A 3RYPA 4E70A 4OA5A 1M0EA 3GDHA 3FPHA 2HMYB 3A7DA 3OCJA 3UKNA 4OBWA 4BH9A 1R18A 2P7IA 5E1BA 1DUSA 5I93A 1HMYA 2ZVJA 2QVSB 2P7HA 2ZIFA 2AVDA 2QY6A 3UJDA 3O7WA 1OI6A 3LA7A 3JWHA 2PFWA 2PAMA 3KQPA 4PYQA 5FDBA 3SCFA 1YZHA 1ZZBA 4CKBA 3BGIA 2GPYA 4UBGA 4GOLD 3BKWA 4JVAA 3DUWA 5K03A 4XFAA 4QM8A 3R6SA 2PWYA 5EZQA 2ET7A 1I4WA 5EEGA 3IV6A 5F2KA 5J7MA 4HN0A 2GU9A 2O8QA 4OA8A 3HA5A 4Y2HA 3CCFA 2PSSA 3HVIA 2CV6A 3G7DA 1CAVB 4ER0A 1CAUB 2VS1A 1XDUA 4QVKA 2GC3A 1L3CA 1NW3A 4V0RA 4B17A 1CAUA 2EVXA 3LL7A 4IEXA 1GQGA 2BM9A 4E2SA 4MV2A 3FPEA 4OQEA 3PVCA 1XRUA 3DXYA 4JV4A 1NKVA 4HSGA 1SVUA 1EAMA 4G56A 1L1EA 2NP6A 2XYRA 3DXZA 2QJVA 5KHJA 5FWAA 4EWDA 5EMJA 2H11A 3DXXA 2ZFUA 1O3TA 3SSMA 1QANA 3ER8A 3BCWA 4YUZA 2QDRA 1X1AA 5DX0A 4AX8A 3ERCA 3C6KA 4JXJA 4RTJA 3IDCB 5EC8A 1ZZ9A 4HZFA 5U4XA 3KCCA 1YUDA 4YUXA 4EMSA 1TQ5A 4GOND 2IBSA 2FK8A 3TLJA 1H1IA 2YXDA 2YX1A 3X0DA 5K01A 2JH9A 4O9GA 3IWZA 3EJKA 3A7EA 2D40A 2EJUA 3U81A 3R24A 1D2HA 3WSTA 2C7OA 4X61A 4MHTA 2PBFA 4B29A 3ROUA 5E8RA 4Q0SA 5IKMA 1SQ4A 5CVVA 1RC6A 5K8SA 4MX3A 3FUUA 2FRXA 4YV2A 4BP3A 4K6MA 2HJIA 2WA1A 2ONYA 3LA2A 3E23A 1SQGA 4F85A 4C06A 2GS9A 1PRYA 4QGNA 3NKTA 3R0QA 5FQOA 2Z6QA 4AZSA 3MQ2A 3G89A 3K6RA 3KQMA 4KWJA 2YQZA 3LKZA 5FQ0A 2P8JA 5ICEA 5F2OA 4F7ZA 4P9GA 4OQDA 1FI2A 1WLTA 5EHIA 5DM1A 5FTWA 5LQCA 1N7JA 4AZTA 4HVQA 3USSA 3BWYA 2GZWA 4DA4A 4MIKA 2ERCA 4C03A 5FLJA 2JHCA 3R6TA 5BP7A 5KYGA 1YLLA 2GH1A 2Y1WA 1XXLA 2AOWA 3SM3A 3B02A 4DQ0A 5E9QA 1JG1A 1ZRRA 3G2PA 3OZSA 4E2ZA 3GRZA 1P1BA 3L2HA 1JUHA 5KHKA 1KIAA 3KGLA 5GOZA 5DPMA 4M37A 3CJRA 4HN1A 1I9GA 1TW2A 3MERA 3EVZA 4J1WA 4QDJA 2VZ9A 3CF6E 4IEUA 3I59A 2AVNA 1X7NA 1JG3A 3E7PA 3U0ZA 1CAXB 2AOUB 3KR0A 3VC1A 2PT9A 3B3FA 5HIMA 2AOUA 3UJ8A 4FT8A 1UD1A 4PONA 4BP1A 3ORHA 5HIJA 4ONUA 3B3JA 3M6WA 3UJAA 3OCPA 4C07A 1GQHA 5DLYA 4RSRA 2Q1ZB 3IHTA 2K0GA 1NV9A 5GINE 1Y9QA 4X1OA 3H1MA 3MPBA 2BZGA 3UJBA 3PFHA 2QRVA 2P35A 4E2GA 4HVOA 2NXJA 3GCZA 1BC5A 5DSXA 1RJDA 1RUNA 1ZGAA 1JQEA 3NDIA 2NNWB 3GGDA 1ZGJA 1DL5A 1L3JA 1UIRA 3QOWA 4KRGA 2Y1XA 2ZBRA 2AOXA 3FUTA 3HVJA 1QY4A 3K0BA 1FT9A 4KU8A 3THRA 2OZVA 2ZZMA 4QPPA 1CAWB 5EGSA 1CGPA 3OZRA 4P58A 3A25A 1L3BA 4CXMA 2OZJA 5EHGA 4RTSA 4TLFA 2HV9A 1YFYA 3FZ3A 3E97A 5GM1A 2Y0OA 4MGYE 1YFJA 1F3LA 2XLFA 2IGTA 4XEZA 4DF3A 4X41A 5D1NA 5B1SA 5EIWA 2O05A 2PX4A 5FHRA 2EAAA 3CC8A 3FYDA 4IETA 3EGIA 5FPZA 5CVUA 2IDKA 3TKAA 5F1RA 5CU1A 2N7GA 4UOEA 5CIYA 4QQKA 1AQIA 3C6MA 5KBFA 2AR0A 2G72A 5FA5A 1UWVA 3GYDA 1XE7A 4XFHA 3LDGA 1O3RA 4P7JA 4AXOA 1SUSA 1N2XA 3ES4A 3WW3A 3LCUA 1RL3A 4MGIE 5HIIA 5EKXA 4FZVA 2CKDA 5EKUA 1WGPA 4WXHA 5DTMA 5FUBA 4O29A 4LLOA 1P39A 3UWPA 2JHAA 3SCHA 4UXAA 4XUCA 5KVAA 5BW4A 4MGKE 5LEJA 1JR4A 2GB4A 4KL1A 2K4MA 3SMQA 2GC1A 2OB2A 1VP6A 4XFGA 1NT2A 4D7SA 3PX3A 2WFPA 3P2EA 2VQAA 5I0RA 3KR2A 5DRTA 4YUYA 3BZBA 3EVDA 2NYUA 1NW7A 3CJQA 5ICCA 3UA3A 4HC4A 3P9NA 2JH8A 3PNAA 3WW4A 5JUWA 1X1DA 4WVLA 2K9ZA 3EVFA 5C9ZA 1TW3A 3I64A 3O31A 5FCCA 5K0JA 4QDKA 2CWWA 3AJDA 4IWNA 5T64A 3HCEA 1ZG3A 4KU7A 4GC9A 4PYNA 1AQJA 2IDJA 5LRSA 2ZCWA 5BUVA 5DSTA 1XTPA 5C6CA 1JSZA 2AOTB 1YFWA 4RTRA 2FK7A 4DM3A 1RUOA 1EJ0A 4X60A 1IPJA 3B7PA 4DINB 4XFIA 2IIPA 1PMIA 5EEHA 3BKXA 2B5HA 3SGLA 2OKCA 1OR8A 1QAOA 1Q5OA 5K09A 4CTKA 2AS0A 2B9UA 4ER7A 3LDFA 4P7FA 3KPUA 2UY8A 2OYZA 5KHIA 4U7TB 4DKJA 2BNMA 3D82A 2VP3A 3SCGA 4P7KA 2HKXA 1ORIA 4E2QA 1G8SA 3EQEA 1RI1A 1JQDA 1LRHA 5H02A 5M5BA 1RJGA 3V97A 3KR9A 2BH2A 3PVBB 4E2YA 4R6WA 4HGZA 3DH0A 2ONZA 4IV8A 5DTRA 1NZCA 4LULA 3LOIA 2UZ4A 5EG5A 5IH3A 2YR0A 3RZZA 4YV0A 2ZZNA 1RI5A 4AVCA 4H0NA 2XKOA 2Z69A 3SXWA 5E1RA 2PTMA 2ZCJA 1Z3CA 5K0GA 9MHTA 3NWBA 5KQRA 4XETA 4HH4A 2PV0A 3CBGA 5K0CA 2PX2A 4L11A 1QAMA 3LSTA 3E6DA 3BALA 1UPIA 2WA2A 3H2BA 2BYVE 3SVZA 1G8AA 2HWKA 3MHTA 4PIYA 4BHPA 3FYCA 2I9KA 3OF1A 3DN7A 5LR6A 4PGHA 2Z6AA 4LUMA 2ZBQA 1O7FA 3ELNA 4RTOA 2BR3A 3MTEA 3NSTA 5CCXA 2B8MA 4F86A 1J1LA 5K8VA 1ZZCA 3MCZA 4KDRA 2MNGA 2C7RA 5F2NA 3FJSA 3EVGA 3KU1A 3UFBA 3EVEA 4BLWA 2OB1A 3BWMA 1X19A 4DZRA 4META 1VP9A 5GWXA 2YTZA 4QVGA 1P1CA 4OFGA 3PX2A 1EG2A 4GBED 4AQ6A 3M6XA 1R00A 4RX1A 2C7PA 3M3IA 1M6YA 3TRKA 3EVCA 1JTEA 5K0FA 2IFTA 3EMDA 3EPPA 2P17A 2XVMA 5E16A 5EIFA 3UBTA 4MZUA 1N7IA 4RVDA 4XF0A 4ATNA 3EVAA 4AVBA 4EV0A 4R52A 1EYBA 4F84A 3I58A 5DM0A 3REOA 2IPXA 4HSLA 4Q0UA 2BNNA 5JCTA 3ELYA 4RYLA 2PHDA 2UYBA 3GWZA 2XYQA 4EK9A 1YFUA 4OLLA 2ZWAA 2DCTA 3KPWA 2PKWA 4LG1A 4MUVA 5EMMA 3LPMA 4RVGA 3BUSA 2G71A 1YFXA 2XLGA 1IXKA 4X6RB 3TNPB 1JSXA 3GNLA 5K0NA 1KP9A 3I59B 3G5TA 2FPOA 4FP9A 3P9CA 1KPGA 4EQZA 2QYOA 1AV6A 4LTAA 3GIWA 3KQWA 3B3GA 2VDUE 3HEMA 4PYIA 3LX6A 1OMIA 5BPXA 3ID6C 1J58A 2IXJA 4ER5A 3OFKA 4DCGA 3M33A 3KQYA 5ERGB 3NDJA 3NVKI 3SSNA 5D1IA 1EIZA 3C0KA 5E2BA 4PYLA 3TM4A 2UYAA 1XJ5A 1LB2A 1T43A 2CAVA 5FLHA 4PCAA 4KDCA 3H3UA 4Y30A 5DX1A 1VIDA 3D0JA 1B42A 4KVZA 2FMYA 2QE6A 4AZVA 3ELWA 2O06A 2B9EA 3TPZA 2ESRA 1YZ3A 3E5UA 4E30A 2PAKA 5KS2A 3BGVA 3CGGA 1SFNA 4I0AA 4PIXA 2PY6A 4U7PB 5FA8A 1X1CA 4Z2YA 2V74B 5HI0A 1O9HA 3KPYA 4FSXA 4ZTBA 2B25A 3JZVA 3DTNA 2OO3A 1RI4A 3AY0A 3GRYA 1RI3A 1VQ1A 5MHTA 4YARA 1FPQA 4QGLA 3HA7A 3I5UA 2H0VA 1R8YA 5JSRA 3GU3A 3KHKA 3DMGA 3OE5A 1ZQ9A 2IBTA 4EKGA 3SXJA 4KWCA 2GC0A 5EVJA 5ICFA 3RW9A 3M70A 1IPKA 3OTFA 4UBHA 2B78A 5GIPE 4I01A 3RYRA 3O14A 2CMHA 3NW9A 3KKZA 2O1QA 5HOQA 3TKYA 3FRHA 3NJRA 2OZ6A 3MB5A 4HGYA 2PJDA 1G6NA 3FRIA 5DXAA 3NVMB 1PJZA 2R3SA 4Q0QA 4Q0PA 4LWPA 4GOMD 5BV6A 5CM2Z 1NBIA 4YYOA 1CAVA 3VSEA 1FP2A 4PYMA 4FGZA 2MHFA 3KQSA 2AZTA 1WXWA 4FAGA 2IP2A 3G8AA 3A4TA 10MHA 5E9WA 4JTOA 3UJCA 5FQ0B 2PA7A 2GA9A 4BLUA 5EOVA 2E5WA 3RIEA 1ZNPA 2DULA 1QYRA 1QXRA 2GAFA 3C3VA 5HIKA 3H7YA 1ZZ6A 2IXKA 1TPYA 3LDUA 4O9EA 1WZNA 3Q7EA 4E2WA 2IC1A 3FTEA 2V7EA 5LQNA 1LKNA 2EX4A 4AQ2A 1G38A 1I6XA 1ZRCA 3OU6A 1I1NA 4GULA 3H1WA 2ZSUA 2GAUA 4QX5A 3ELUA 1SUIA 5E2AA 3P9IA 2BM8A 5GM2A 2OXTA 4C4AA 1UW8A 2KXLA 5T67A 4RTLA 1DGRA 4IEWA 1F38A 3H3ZA 4A6EA 1NE4A 3GRRA 4C08A 4QTUB 3PFGA 2I7CA 3Q87B 4PNEA 1G60A 1G55A 1V39A 5CVEA 3SR4A 3EHKA 1J3QA 4MH0E 2H00A 4IEVA 4IEYA 3T7SA 3P97A 1KYZA 2H6CA 5DT2A 3LKDA 3E6BA 2Q4SA 3H9AA 2ZIGA 1P91A 5EPEA 3MCTA 3HCAA 4KWLA 2XLAA 3IEIA 1EQAA 4PWYA 1AF7A 4IESA 2D93A 4JTNA 4HRAA 2XVAA 5LRRA 3OU7A 3CLPA 2P41A 4J1XA 5E1MA 3EEOA 4QMAA 2NP7A 5AVPA 4IV0A 2WC2A 2AN3A 2LD4A 5I0SA 3DLCA 3G2MA 4GUAA 5K05A 1X8EA 2UYOA 3ZDSA 4ER3A 3TNQA 2IXLA 4HLTA 1ORHA 3OE4A 4KIFA 4NVPA 3CKKA 3FE5A 2OPKA 1WXXA 2AOTA 1M6EX 1DZRA 1OD5A 1U12A 8MHTA 3ACLA 4R8HA 4K8FA 1KPHA 2ADMA 4BY9E 4Z07A 1NBHA 4RVFA 4EKIA 3T0IA 1BKYA 2BEOA 5LQAA 3P71T 5LQUA 3OZTA 5DXJA 4P7GA 1HNNA 5K0BA 3ES1A 2XL7A 3KPJA 5J48A 1JTFA 2E9QA 4WZCA 1WY7A 2BNOA 2XHKA 3SSOA 3UJ7A 3S0MA 1RGSA 4XF4A 2O57A 5FADA 4GOOD 3T7TA 2HNKA 4E2XA 4L2NA 3HVKA 4QPNA 4MGZE 2GC2A 3G88A 3AXTA 1EJ6A 1ZZ8A 4EVIA 2QNKA 2PQQA 3FWEA 1ZX5A 5HILA 3NMUF 2I6GA 3KQQA 1FP1D 1WS6A 2NXNA 3S68A 4FS8A 3NWEA 3TQSA 4EWAA 1NXMA 1IY9A 4BYYA 1R8XA 3S7EA 1UCXA 1KR5A 3HCFA 1JG2A 3HCDA 4ISCA 4FSDA 4R8SA 1VPTA 3FFQA 5JSOA 1KPIA 2VDWA 4PYJA 4RWZA 1Y8CA 3G2QA 2CAUA 4QTTB 3FUVA 2G8NA 3B5IA 2FHPA 2H1RA 5DRYA 1VL5A 2D5FA 3A27A 5CVDA 3ST7A 2PX8A 5CVJA 2EJTA 3I9FA 1H1MA 4FT2A 2I45A 2XL9A 1YB2A 3WW1A 3TFWA 1D2CA 2R6ZA 3V8VA 3VHRA 4DMGA 5T6BA 4YMGA 2PVCA 3BWBA 3HA3A 4N9HA 1EPZA 1YF3A 5FWDA 4CYDA 3HM2A 2FQPA 5DWQA 1VP3A 3NJZA 1NW8A 2IXIA 4CKCA 2PYTA 2UYHA 3KQVA
chains in the Genus database with same CATH superfamily
1DIAA 2JFFA 3MUFA 3KJGA 4FR0A 1DCTA 1Z7S2 2PRSA 2E7TA 2ECFA 1ZBE1 4PIPA 4AVAA 3Q40A 2RJ3A 2WZBA 1GYPA 4UBMA 4CM4A 1F0YA 4IQ0A 1FX5A 3E9NA 3LC1O 1G7RA 2GEJA 2K2WA 4YSFA 5E1DA 3QITA 1YUNA 1HQCA 4QB1A 1ZD4A 4C14A 3T2PA 2BGPA 1UPBA 2H5EA 4B40A 2IXGA 4E33A 4KUEA 3TOSA 2O8CB 5G1PA 2IYFA 1LA2A 3RARA 1HKUA 1XNCA 1RI2A 3DWGA 2CY6A 4S1WA 3TTSA 4RA6A 4Z8XA 4CM6A 3UKTA 4I1YA 2OAP1 4XIYA 4NCBA 2PLWA 2KWIA 3COJA 2EFCB 1W46A 2NSDA 1RUD1 3F67A 1KEVA 4ZJUA 4DCMA 2ARXA 2R6R1 4B4RA 4OG2A 4O5AA 5F73A 2G76A 3RSLA 1MRNA 2VJOA 4AJ4A 1ZRFA 1W8NA 4AXBA 1UC9A 2IT1A 2VAUA 2JH3A 2WK1A 3ALQA 1A7KA 2F62A 3FPCA 1QJZA 3ORYA 2PXCA 5EE1A 1ZUWA 3U6BA 2VOKA 3QVTA 4X63A 3G8BA 3ZNOA 2JKBA 1BBT3 1QB8A 2WTXA 2CLIB 2KW5A 4WUTA 1B0PA 1TZMA 3MAJA 4LWOA 5LQJA 1D9XA 1G5QA 2IH4A 4LHVA 4FPCA 1JB1A 1B2LA 5ALYA 1VPVA 1JXAA 4CQMA 4AVSA 2X4IA 3PPXA 2R2GA 1X82A 3G7UA 4Q47A 1WMBA 1ZICA 2QZ3A 3VU0A 1KEXA 3LCCA 3DHYA 5LA9A 2QAJA 2W95A 1V70A 4IXTA 3QV2A 1PKEA 1WHSB 5FZCA 1JEEA 4Q3LA 3H7JA 4JP1A 3EQ8A 2D5LA 1F2UA 1ZR2A 1WUTA 1MVQA 3C3PA 4CTEA 1TK9A 3IEXA 5K3FB 5CA0F 5HKOA 5C4GB 4N6NA 4C21A 4EG5A 2OA2A 1FOD2 5JQGB 2I65A 4MRAA 1UF9A 4AI8A 4EB8A 5FEUA 4QQLA 5M0TA 1WG8A 4YI5A 1TU3A 2GPNA 4RGKA 1XFDA 3GGCA 2JFWA 4ENVA 1XMPA 5B4VA 4N43C 1J6UA 2RHOA 4TLAA 3FY4A 1CY8A 3VNVA 5GJVC 1I9RA 1N5IA 5HQTA 5IAVA 2FGKA 3NG1A 3SYLA 3GC6A 1O54A 2DF7A 4FFIA 3UN1A 3TOZA 3OF2A 1AF4A 1OREA 4QGBA 4WESA 3QF4B 2XIQA 2PZAA 1M33A 2C5GA 2Y1KA 1W19A 1SBCA 3H84A 2AIRA 5BSKA 1X8MA 2I03A 3L8EA 4YZ5A 2FMHA 2ZGOA 1PJ4A 2IXCA 2VVEA 1ZI9A 3TR6A 1S0JA 4LHKA 4ZCQA 3TTXA 3H1FA 1DAHA 1OSGA 3H50A 3PNQA 3LIHA 3EF0A 4NMLA 5L4SA 3SYNA 5K6RA 3R3ZA 1C3OB 4KK3A 1YVRA 1E7RA 4JFRA 1CJKC 1I33A 1A2BA 3WRXC 5E2IA 1H94A 5KHHA 4L0QA 5IPFA 4RSHA 3FG9A 1N78A 3F6SA 5T4EA 3TO5A 2F6BA 2BH9A 2Y4OA 1PUIA 4QOFA 1N36B 2VPQA 3D5EA 2PHTA 2X5NA 2H8KA 3ME5A 4WBBA 2WU4A 5EMLA 3SZUA 4QU9A 3C39A 3J9SA 4IG4A 2WTBA 4R84A 1JBQA 1GA4A 5EQJB 2F90A 4DBLC 3M9LA 4KG7A 3ZS8A 3ZD8A 3VBFB 4TQGA 4AZWA 2PGLA 1O4VA 3QQPA 3HNRA 3HGMA 2GHQA 3LUBA 5KYUB 1SBIA 3GFFA 6REQA 3R3HA 1FMTA 5G3ZA 3AR3A 1D8TA 1BWQA 3O4FA 3BSFA 3MPOA 4BO4A 2VHCA 3ZWAA 1Q14A 1E3LA 4XQ4A 1WW3A 1UBKS 2XJ4A 3L9WA 3DVRX 1MNAA 4EN8B 1ECCA 2NAPA 4WMLA 5BYBA 2VHJA 5IT4A 3IXLA 1Q0TA 3GH1A 1F4PA 3KVVA 5I91A 1AS0A 1YRWA 3O2SB 2ABWA 5BR4A 4C7OB 2RHLA 1WOYA 2HQBA 4WZAB 3FAZA 3H75A 3GAMA 1E4YA 3HCNA 4Y2VA 2Z8XA 5AVYA 3OIGA 3UAVA 2BP7B 1Z3IX 2C82A 1OF3A 1GPNA 4N41A 1XTRA 2XUIA 3BUCA 4O2AF 3HJCA 1Z0IA 4M9UA 3JD4A 1U0HC 4PQRA 2VL4A 2FAXA 3SC6A 4CI0B 1GJRA 2WT9A 1CIVA 3G9QA 5FBWB 2NPFA 1JYNA 2RK4A 4G07A 3WG4A 1A82A 4F46A 7AT1A 1GZ5A 1Z4PX 1GL7A 3SEPA 1SIBE 2GDJA 4NAUA 5LP6B 4MQBA 1MEJA 5FPLA 4GXRA 1RQRA 1XUOA 3QE3A 3ZYGA 2CLEB 2BTEA 4BNMA 2JIRA 5I9SA 1V45E 2RHJA 5AKXA 3DWEX 1RUF2 1N0HA 3AEUB 4JGGA 2GZ2A 2ZGMA 4OB7A 1NCQA 2ORED 1P45A 2AD1A 2YNMD 2GH2A 2ZVDA 1UJMA 1X1BA 1CETA 4I6GA 1FS5A 1LPNA 1HA3A 4JJZA 4XB2A 1V0AA 4DNOA 1CUUA 1PNVA 2R073 1IAQA 4ZONA 3U60B 4G8DA 1B1CA 3R9WA 5DYGA 4OIFA 3SC2B 3V32A 1CY2A 3T1LA 2XY4A 4CEYB 1XVIA 1XD8A 4US1R 4DZTA 1C80A 2DH5A 2P3JA 3RWNA 1LZKA 2ZIFA 2GHRA 3JWHA 1OJLA 4NBSA 2RGAA 3VHXB 1NI3A 3IKWA 3QBDA 1QQP3 2VDQB 1TNRA 4OSOA 1Z2EA 4YJHB 2GD1O 1PF7E 3FYSA 5K3SA 5K03A 3KOUA 1MO6A 1OD3A 4CLOA 1MB4A 2R042 2V7QA 3H7IA 1BCRA 3R6SA 3SOPA 1GPUA 5EZQA 1FDVA 2QGZA 3NEYA 4UZSA 5EEGA 5FYSA 1EBUA 1E3WA 4MYCA 1E3QA 2ZBFA 1WLDA 4Y2HA 4LK6A 2GCOB 4ZAYA 2WJGA 2IYXA 3IBGA 1BFKA 4LGYA 4LLFA 4IE5A 3FIUA 3H8OA 1ZOSA 3W21A 3DDWA 3V4SA 1IXSB 1WB4A 3M3CA 4ZYXA 2YBEA 3WE7A 2WICA 2IKSA 4ZC8A 3NHBA 3ESDA 1T2EA 4MV2A 4FHCA 1RP1A 1COZA 1Q21A 3VDXA 1O9BA 5JJCA 4A41A 4KNWA 2GD0A 2XYRA 3B52X 1LS6A 2QJVA 2EATA 4W4ZA 4YO7A 3CIHA 5AVQA 1ZW6A 3HY3A 1L2TA 5EFZA 4G3XA 2SKCA 2NO7A 5IJ9A 4A3XA 1E1QD 4BU1A 4WOKA 3HCOA 2XV1A 1T0IA 3SS8A 1C4KA 4NHYA 3PUJA 2ZGNA 3GBVA 4XOIA 5C4MA 4QX2A 2QDRA 1DV1A 4AX8A 5AC92 3EFBA 4MJ7A 2CLMB 5AJXA 3USUB 3IDCB 1ZZ9A 1P3DA 3H1EA 2W5UA 1AR71 2FK8A 4FYWA 2YX1A 2WYVA 2SLIA 4B81A 4O9GA 3FVRA 2VZ3A 1U8UA 4YR7A 2XPCA 1G4AE 3ZGVA 3AUKA 3D5OA 5T4HA 1A9PA 1J5XA 2J85A 4KG8A 4YAWA 4Y7CA 3VBSA 2ERXA 4F85A 2BFDA 5LD2C 5DH9A 4IHAA 5KWEA 2ODWA 3SZLA 3EDYA 4U9UA 4QVIA 1PN3A 4L73A 4X7BA 4AYWA 1L4HA 4N12A 4TV9B 4EBFA 2V4AA 4YQYA 4A6OA 5FTWA 2CVQA 2AUMA 4CEIB 3USSA 4BVFA 1XF9A 4ZHSA 4S05A 1GM5A 2E7QA 4QNMA 4BLQA 1Z06A 5L3QA 3HWWA 1UBOS 5CYFA 1PS9A 4HEA1 5F7ZA 2XRFA 5FAKA 4IH4A 3G2PA 1NVEA 5JW6A 2CDOA 4F3KA 2QLTA 1COV3 2GDFA 4HLNA 3GDGA 5EUBA 3GXUA 4PPYA 3KGLA 3ASUA 3RS6A 2WD9A 2HYDA 3HDHA 4M37A 4IM7A 4YR9A 2DECA 4J1WA 4RL7A 1OA0A 2FRDA 1WRBA 2DQKA 3I2OA 4MW6A 4TVBA 4QYXA 4EQ6B 4JQRA 3AOGA 4Q9KA 2Q49A 4G85A 3BCUA 2XMQA 1OHFA 2C3YA 1ANKA 4BP1A 4PG7A 5HIJA 4BLOA 3ZD9A 5FPPA 1XV5A 1KZ6A 1LC0A 4S2FA 3PIGA 1H0RA 3O4IA 3PPYA 4YRCA 1YL7A 1HUQA 3TSOA 4XXAA 1H5NA 1I0ZA 1Y5MA 1S0IA 4DPLA 1RJDA 4P4SA 3Q3JB 2J1UA 2I66A 3EX7C 4JC1A 2QTHA 2WIDA 4Q9LA 3ADDA 1JIVA 2Z2XA 3PNKA 2HTFA 4KDEA 5FTNA 3T0AA 4G5XA 3EQ9A 3HEBA 5TDHA 4Y24A 3ZY3A 1CAWB 1CGPA 2A6WA 3KSRA 2P4EA 4I5EA 2HV9A 4QEDA 3R9IA 1ENRA 3QJYA 3E97A 4ZMBA 2VSNA 1RUD2 2L19A 3O94A 2WYHA 4DF3A 2OILA 3SVLA 3W3AH 2VHUA 3FLEA 3C7FA 1YQ5A 2J30A 3ISJA 4RIHA 1PJQA 3AFOA 3W5MA 4KMOA 5G04L 3UAXA 2G6TA 1ZCFA 2IOYA 5I3CA 4DLKA 4Y1RB 4ZXKA 2AJCA 3HACA 4Y2SA 2WF7A 1YMUA 3AL6A 3N05A 3W90A 3DLTA 4ZGWA 3EC2A 2CWMA 3ES4A 2YBPA 4QASA 1OSNA 5FO1A 3NX4A 3G9UA 3KC2A 1ODNA 1J2TA 4ND5A 4LO7A 2B83A 4JWTA 4YH1A 1MS5A 5KCMA 2R96A 4ZJPA 5BW4A 1X7XA 3L7LA 2K4MA 1Z08A 1O03A 1NXQA 4IDEA 1NG1A 3U4XA 3TR0A 5GJBA 3R0JA 1PVC2 4YUYA 3BOSA 2WWVD 1KYIA 1QRDA 4Z99A 5A3OA 3QVOA 3D6UA 1I3NA 4WVLA 2R9VA 1QWSA 4FW8A 1N1SA 3HJFA 3THYB 4MUEA 1QIEA 4JQSA 2ZOSA 1SIOA 1XL0A 1C0IA 4HDNA 5ICSA 4CCAA 2A0KA 5JZVA 5T64A 1A9YA 4IWYA 4GM1A 3RHFA 1SCNE 2W93A 2IDJA 3U0BA 2Q8NA 3MJ4A 4A92A 1X9GA 5E3JA 5DSTA 5BXQC 1V6JA 1JSZA 4HZIA 1DBVO 2MT9A 2OHOA 3B6IA 4DM3A 4RQPA 2HCRA 1ZFNA 1YEWA 1XB9A 2VP4A 4EAQA 5CIWA 1REFA 2VZRA 2QN3A 2BUBA 1P60A 4YDHB 4Z4FA 2XH6A 3T0BA 3WQ7A 3PC6A 5JQGA 4UEWA 3D0QA 5FEMA 3VKOA 2QEQA 4U2CA 4GMP3 4FCAA 3FLAA 2HRDA 5LY2A 5C70A 1MS1A 1ZM4A 3LFUA 5M5BA 2ON6A 1LHOA 2DY0A 4OB6A 1PZ8A 4JZYA 4ONEA 1NF2A 4UQPA 3R9KA 2VYCA 1L5VA 4F4UA 3SEZA 5FZEA 1S01A 2QUBA 1JS1X 1ZI8A 1GXSA 2HWE3 5HA5A 3P52A 1C1XA 3FFWA 3LOIA 3ZIXA 3DOEA 4EG8A 3BQ9A 3I3MA 3CZ4A 1LJ7A 3CO0S 3EZGA 5E1RA 4IV3B 1M1YB 2V5YA 2PTMA 3PIDA 2J6HA 3QQ5A 1DTSA 3POWA 5AM2A 4XCAA 2AG8A 1WDWB 1PFQA 4CDWA 1EEHA 5F23A 3NLLA 3BALA 4DY4A 2BD0A 3ZQUA 3VKLA 4MW7A 2HWF3 5DNAA 1C14A 1MTZA 1USVA 4NZZA 4LBLA 1HORA 2QORA 4AR2A 2XBLA 3I73A 4TV9A 4GPAA 4MGSA 2BFCB 4UD6A 1J1LA 2H3EA 3ZKWB 2QNIA 3UFBA 4D9MA 1D0IA 2I8AA 1N33B 3GBGA 3LY8A 2OKGA 1WWYA 3D0OA 3CRRA 4H55A 5GWXA 5ILOA 4ZMRA 2CSUA 2FX5A 4HK4A 1N5JA 1QXSA 1YNSA 4LBOA 2KBEA 4L5YA 3TS1A 2DYKA 2JLCA 1OD6A 1RJ9B 4U02A 2HYXA 3TFOA 3L0SA 1PO12 2CLKB 1BEV3 1I14A 4UUBA 4PRKA 5GJWC 2XVMA 5K9ZA 3OZEA 4UMDA 3UBTA 2FLVA 4BIMA 3D8NA 1P2TA 2H6EA 2OHGA 3ENNA 3TOXA 4ZOLA 1PGW2 1T8WA 4H3WA 4L2IB 5J1XA 3R05A 1IM5A 3CF6R 1UAGA 5FUQA 4AEKA 3GLIE 3WF4A 4MR9B 4LDJA 4EUEA 3THDA 3T9FA 4IIBA 3GOQA 3DEJA 3WGQA 3CM0A 1U5XA 3NANA 1SB9A 1GNRA 3NBFA 1CIWA 5JPNB 5K8LA 4Q4W2 5J2UF 4EW6A 4ABYA 1ULAA 4GFDA 4RV4A 4XUNA 2QYOA 2NVUA 5FP4A 3DECA 4JITA 5J2UA 4KI5M 3D8UA 5DT9A 5FZHA 4MA0A 4FYMA 3MWEB 1R9GA 4DCGA 4KVAA 3M33A 2PZMA 4RXUA 1QNWA 3BD9A 5DHFA 3O8OB 1IRXA 1AR73 5E2BA 1J42A 1H4SA 5JATA 1EUYA 4AZVA 1N1EA 1AYN2 5KAMA 4IDQA 1OAOC 2DZDA 3JCIA 4BECA 3COYA 3CGGA 4CDXB 4RD4A 1XZNA 3EIHA 4FPYA 1BVUA 3CS3A 4PZEA 5LD2B 4FSXA 1SK8A 1DVRA 3AYAA 2QT0A 1UPAA 3MILA 5DJ5A 3ACCA 5GONA 1HNXB 3FGPA 3QWHA 2XD9A 4FI9A 1XQ1A 4BB0A 5HW0A 2XWJI 1K4KA 2IBTA 4DCNA 1TQ8A 2WBKA 3RW9A 2A0XA 3CMMA 2VT7A 3WAGA 1KEEA 5KR7A 3PC2A 3OGGA 2W2KB 2O1QA 4L0PA 5G41A 5A1JA 3O3OB 3CTPA 3VU3A 3A8TA 5CX1B 3I92A 3P9YA 1WUVA 4GOMD 1PIV3 5BV6A 1GGFA 3AVUA 3TLCA 2JJYA 4MLPA 1P4RA 2WHPB 1Z2DA 2DU1A 2JD0A 2QSZA 4GW3A 2BEWB 2V9PA 1LBSA 3WBBA 4QNNA 4QBFA 2WG1A 2XRYA 4TYWA 2UVPB 4G84A 3IIMA 5ESDA 3ZWCA 2H0QA 4NJEA 5HKAA 2X5OA 5JYBA 1UU6A 3O26A 4CM8B 1X13A 5LZ9A 4IOKA 2L69A 4C4OA 4TZ6A 2ROQA 5ADUS 1E2LA 4H18A 5F4ZA 2GAUA 2GFIA 1PR5A 3S2EA 5E2AA 5FR2A 2WKPA 4WK4B 1J2UA 5DHTA 2E26A 1F38A 2P11A 1THZA 3LUKA 4EBBA 1HXS1 1E98A 1XXHE 1SOVA 3SYRA 3I49A 4D43A 3P97A 2OZEA 4M98A 2O19A 1NVGA 2EZUA 1JDSA 1W8UA 2VNRA 1FPMA 4EMUA 1D6MA 1TAQA 5DMYA 2JFHA 2BVBA 3KJHA 3BRSA 2WR8A 5BW8A 1PJRA 1R081 1FJ2A 1EQAA 5JEEA 5JJ5A 3V8NA 1IQ0A 1H2MA 4QD2A 1LQTA 1QQP1 4TTRA 3JVUA 1EXMA 3VXKA 3VD9A 3DBLA 4YAJA 2YJZA 5KXBA 1PVXA 1S0FA 5CG9A 1GV1A 4JXZA 3QU7A 1GP2A 3WTCA 2PU5A 2VK4A 3K0CC 5E9AA 1PR1A 4BO3A 4IJ5A 2RGEA 4YRIA 4LRXA 4QDTA 4LK7A 1VI6A 4W5JA 1KJ9A 5KWVA 3K6JA 4YP9A 4EECA 3D3EA 5CNMA 3MTAA 5T5JA 1M8FA 5AW3A 1T6BX 3V56A 5AI9A 3MHPA 4W5RA 1FAYA 5DBEX 3ETCA 4JUFA 1ZO8A 4IX9A 5KZMB 5I48A 4N7JA 2E9QA 3DVQX 2G7MC 2QVZX 4Y1VA 3VAYA 5IBQA 4XF4A 5FADA 2ATVA 2Q5TA 2JAPA 4L9RA 4F97A 4NLLA 3R1IA 3HVKA 1V6AA 2MEV3 1GFZA 2J4CA 5DXDA 2PQQA 2CYAA 4AXXA 1NOKA 3SLIA 3D31A 3W5IA 4QPYA 1F60A 1MMFB 4LEIA 4EA6A 1EK0A 2NXNA 1B3BA 5F9MA 5JSKA 1YJCA 5IABA 1H2KA 5EJIA 4K6GA 1VI2A 4PLFA 1VRWA 2JGFA 1JG2A 4X20B 2XZLA 4ZOBA 4A2CA 5FWXB 5L3QB 1IC6A 1ISSA 4QTTB 1W25A 1IHPA 1Z6TA 1X1QA 3MOSA 1VL5A 1BMTA 1F8VA 2E32A 5B2GB 1GTL1 3VKNA 4LSWA 4LSGA 2Z5WA 1AV7A 4ABTA 2PHRA 4P0QB 2R0HA 1LX6A 2PVCA 5J4VA 4TGLA 1A9RA 2QXYA 2NUAB 4ZHQF 2J6CA 2OLKA 4RR3A 3DEZA 1W94A 4QT4A 3SS7X 3QXGA 4LHZA 4CQNA 3BMNA 3MQ4A 3B8HA 2GJ8A 2WWIA 5ED4A 4G63A 1CR4A 1W9SA 5DOZA 4IE7A 4LGVA 5EP9A 4J3FA 1S96A 4BIIA 2L0XA 1MXFA 1TMKA 2DDUA 1OAAA 4CDXA 3C3WA 4NARA 4JGIA 3LCVB 2VTKA 2IYPA 2IDZA 4NNPA 3I53A 5MFZA 3FLBA 1QZTA 4AK3A 4O3MA 4TUYA 1G1AA 1PMJX 2ECQA 2GLUA 4W8OA 2A5ZA 4YMSA 1OZAA 1HFEL 3NTOA 4MPDA 4UOZA 1BKDR 4RE6A 1LD3A 2EWVA 3A7QA 3RANA 5IJ0A 5C0OE 2EA7A 4MMZB 1EM6A 3EUAA 3I61A 2BFNA 5EHNA 4QBKA 1TZJA 2CE2X 2MPFA 4XWGA 4QODA 2ODQA 3DZBA 1NNLA 2A5GA 2XGMA 4KXYA 4W5OA 1C30A 2PVSA 3DM9B 2C4UA 4ZK6A 2PAAA 4C8DA 4TXJA 1V7ZA 4GVPA 5EXEA 2WEKA 5JSUA 2ATFA 1TEZA 4Q03A 1SQFA 2Y8EA 2BHSA 2I3BA 3ZWWA 2ZJ8A 2JL1A 2Z4SA 4MMYB 1DB3A 4NH4A 1I5OA 1QDOA 4GH4C 2VXOA 1X7XB 4DA9A 4GEGA 3Q1KA 2A9OA 2PXJA 2XNDD 1PO22 5KC9A 3CCBA 4JCOA 3CU5A 1KHTA 3H5AA 1TJ5A 1XRSB 5FFFA 2IHVA 2WWYA 3EMBA 3QVLA 3NRJA 1IZ3A 4UTVA 2RV9A 3GARA 1AN0A 1Q7CA 3K6SA 3GJYA 1QOOA 1T2UA 2NZ8A 3C7KA 4V1CB 4IIDA 3M6MD 3U3ZA 5JY1A 3SIPA 2FB9A 2GJAA 2DVGA 1EP9A 3AKSA 3N28A 3GCGA 3KIPA 5HXAA 4FCCA 1WHTA 1MVNA 1W88B 6GPBA 3C43A 1V4VA 4EJ6A 3ILNA 1L4NA 1W88A 2X6TA 3U4QA 5HOEA 4RZ3A 3VZJA 2WLQA 4UBJA 2OM6A 4YJFA 3W78A 4MKFA 4XYLA 1PTKA 1IHOA 1IJFA 1V3TA 1PFKA 3WI7A 4GEKA 4ASUA 2IX9A 3K8QA 2AREA 2BTQA 2BZSA 4P1ZA 4BQYA 3AOEC 1U2EA 2NPIA 3RVHA 4AJ1A 1P1KA 4WVWA 4I55F 1PVDA 3D3WB 3LMKA 1MKYA 5FIUA 2HYKA 3DVSX 3DMFA 2H0BA 4UUQA 1OLSB 3HCWA 2NSJA 1OFNA 5FPSA 2HUPA 4IKEA 1JODA 1FSPA 4N9IA 3CVWA 2W2NA 1TEXA 3JR7A 4QREA 2VH1A 5FNZA 4FTWA 4C76A 3LHDA 3AP7A 1NYQA 1ZNQO 1QH9A 4A10A 4XX0A 4AN4A 3T1NA 4EUKA 1GPJA 3S1AB 3RADC 1ZGGA 3M1HA 4IYJA 2RJLA 3DBVO 2A3WA 4X95A 2Q3HA 5DBHX 2WUVA 2AFIA 3ZWMA 2D6MA 4PYRA 1Y4ZA 1HN1A 3N2GA 2IHUA 4UJ3A 1ZCBA 2L17A 2BKUA 4A6SA 3LCMA 2HGSA 4J7XA 5FCDA 2B2CA 3CEPB 2R62A 3K15A 2UUOA 3N7KA 1Y4UA 1RJEA 2NXEA 2XVZA 3I1IA 1JEYB 5IHRA 4AJ9A 4ZU6X 1Y9JA 1NBMA 1X1EA 5BNQA 5A6SA 1W8HA 1U04A 1CF4A 4JLNA 1W3VA 4YFVA 3ZZ1A 1RRPA 3P0JA 3OLVA 2QZ4A 4L95C 4QOIA 3ACBA 3EIWA 2X9GA 3PIJA 1BEZA 3V4LA 5BV7A 1QQTA 2VDJA 3I2DA 2E53A 4XUEA 1YS2X 1XYOA 2WF8A 4K28A 3RSJA 1IG0A 2D54A 5JXJA 1FVOA 4W1PA 1U4OA 1ZNXA 3K4ZA 4PG6A 4BNXA 3AVQA 2D7DA 2R60A 4OYLA 3SS9X 4R3NA 2J3QA 4NHOA 4A73A 4MX8A 3UJ3X 2HT6A 4Z0TA 2QTMA 3U49A 5E6HA 3EAFA 3ZU4A 3OLQA 2JLBA 1IPHA 4S2HA 4TTPA 2Z43A 2BEWA 2ZREA 4I5DA 1Z74A 2BBOA 1OVGA 4KFTA 2M1ZA 4M4SA 1Z07A 4U6NA 3AVSA 2KLBA 1FCJA 4HK8A 3O8RA 1MQ9A 3CO2A 1PFWA 4UMFA 2HMWA 2JFVA 1CONA 4CIBA 1FQWA 3TZCA 1WW8A 5KOYA 3GMTA 5I0UA 4CMCA 3W8NA 4WXEA 4LMRA 1ESCA 3ONNA 3IN9A 2DR3A 4PU0A 2QZPA 2I2WA 4IERA 1QK5A 1JJAA 4P08A 4O4IB 3RQSA 3K7EA 3SLKA 2WTNA 3SH3A 2G9UA 1OY1A 1JLLB 1Z8NA 1B0AA 3NBZC 2OQ6A 1BEUB 3HYSA 4YJ2F 5CLIA 4M8IA 4KLNA 1MB2A 1JWBB 3OPZA 1GSAA 4FDAA 3TGWA 3A2LA 1YO6A 2ZMNA 1A5BB 3Q0TA 2VWGA 1VBD1 2YWEA 3WV5A 1Q95A 4GPIB 4Q7QA 2D6PA 1NA1A 5E4TA 4BZZA 1HYEA 4NVRA 4UHKA 4B3HA 4I2VA 2E5LB 2WV9A 4EGAA 4IYRA 1S2IA 3VBSC 5I93A 1MJHA 4WRRA 3T5CA 4RK0A 3INYA 1Z68A 2XGGA 1Y81A 1GQSA 1Q8SA 1GYKA 3OO0A 3OT1B 4M3CE 3TTVA 3NAPA 2FSPA 4UHFA 5T6MA 3MD9A 1CY0A 4AZ0B 5JNSA 1RQGA 1O97D 2PT7A 4LWQA 3MT0A 3CVXA 4S2DA 3EIOA 3QH6A 1G4HA 2XBO1 3NZEA 2GU9A 4TYNA 3GLFA 5IAKA 4FGSA 5JMPA 2EKPA 4XJVA 4K26A 2XB9A 4OK6A 3DVLA 3HVIA 2ZRJA 3H19A 1M1XB 4M0UA 2A33A 1N3LA 2RHPA 5HZHA 5CYOA 3J81A 5AW7A 1FMD2 4BCCA 1R091 2HHAA 3PZBA 3O7OA 4LE1A 2FWRA 3K9WA 4L5BA 5F1KA 3KE9A 4OHPA 4UMEA 4GMDA 3BDVA 3ABZA 4KB5A 3TE7A 4CKCB 4G56A 4HYQA 1UJ6A 4QT0A 3VVBA 3ZHRA 1ULOA 3VKFC 5KHJA 1EXDA 2AE2A 2TS1A 2R7KA 4IGEA 5T3UA 4FOQA 1KFBB 3G2NA 1RTTA 2BVNA 1M73E 3ILXA 4V0KA 2A30A 4OUDB 2WNVB 4P80A 1H3EA 5DX0A 5ALUA 1TIKA 2H18A 2VVDA 2PG3A 1TCVA 4WN3A 2BGWA 2DCYA 2X42A 1XQVA 4JJKA 2C20A 2C1FA 5BWCA 1JH9A 3JQAB 4TWBA 2A7AA 2JI6A 4LX8A 3NFYA 3X0DA 5K01A 3NNNA 1NTOA 4EKEA 4YRSA 2CD7A 5C4WA 4RQPB 4CCWA 2PSHA 4S24A 4K9OA 5D3MA 3GMDA 4Y6RA 4C6TB 4AMUA 4D42A 5FTLA 5JXIA 3FUUA 1BCRB 2X5KO 4E4YA 1NY72 4ERXA 4B8ZA 3ZX4A 1W0KA 5BMVF 3E23A 1GFF2 2I87A 2VMHA 4IMJB 1PRYA 4RLFA 4LKDA 2JRLA 5KSWB 4CEIA 2RK3A 4K9RA 1L7NA 1HF3A 4GX5A 3HB5X 5C8VA 3TJMA 1H4TA 1KZ1A 1NULA 2GZWA 4POAA 1KVSA 6NULA 1JHYA 1PIWA 3E8XA 2DPXA 5AIBA 4N53C 4LF6B 1W6NB 3WAJA 1QKJA 1E7YA 5NLLA 3GJBA 1V2HE 3RYHA 3QMPA 3AL0C 4GH4B 3I6MA 3CJRA 4DHEA 4HN1A 5HVNA 2HJRA 4QDJA 2DBNA 3PE4A 3S7ZA 4S2UA 4Y2JA 5CCDA 1GARA 9ABPA 1C9DB 3VC1A 4N8EA 3SK0A 4B7EA 2JF0A 3LVFO 1JHZA 3O0DA 3PE6A 1FPN1 3AUUA 1PR4A 4YRLA 5L3ZA 2GYVA 2D06A 4LVNA 4NC9A 3TAUA 4UM8B 1YONA 2ZRHA 1W6PB 3NYQA 1N2CB 1JN0A 3BULA 5H16A 3LX5A 2GUGA 4A03A 1FRNA 4BNWA 1R8SA 1RUNA 1ZGAA 2NNWB 4R1LA 3RVOA 4YZ4A 1MB9A 4QELA 3GDFA 3UQYS 1BCXA 3WDYA 1K7XB 3HLKA 3J80A 1VBA1 1HFWA 2FWMX 4CXMA 2JC3A 4HNVA 1WQ1R 4KIWA 2OZJA 4OP2A 1RZ3A 1DJOA 4OULA 4HWSA 5KQPA 4LHLA 4YCAA 3MV11 2A2ZA 5GM1A 4IVQA 4MGYE 1F3LA 3TCXB 1W76A 2BUKA 4BFXA 2R86A 5A2GA 2JXAA 5B1SA 3MGAA 4JBHA 3IT2A 4CCDA 3GHHA 4RR3C 4DSUA 3NDRA 1BWRA 1I8TA 3TKAA 3CNLA 2H0AA 4UNQA 3L2YA 2PM8A 3AONB 3OE1A 3GFVA 5DBIA 1DTEA 4QRHA 3MTJA 4LHWA 2V73A 1SUSA 3QKRA 3LCUA 1P5HA 3OP4A 1CDEA 1RAIA 4KYVA 1Q7BA 4FOTA 5HBGA 4RHXA 1BKZA 3OM9A 3JALB 3EXIA 5CKQA 4AM8A 5JIBA 3P96A 1YHZA 4ZVLA 3LKBA 4HZUA 1OFSA 2C4VA 2OB2A 2CK3D 5F5NA 4L4UA 4HDOB 4CIYA 1NJ2A 1WPRA 5A7GA 4D7SA 4OMDA 1MB0A 1KOJA 4UDOA 1CG6A 2QB5A 3SCZA 3VKWA 2JAQA 3UO8B 2JGNA 2BPOA 4NYJQ 1RDFA 5ALSA 1E5HA 1PNOA 4F6LA 3AHFA 4P2GA 2EJVA 2DCJA 3C48A 2OENG 3DBIA 4CUZA 3I64A 1SLIA 2HWB3 3N87A 2ZEYA 1ORRA 4XJXA 4F96A 4D3YA 5H9PA 3GNTA 5C1PA 2O8VA 2XNKA 5ACA3 3PD1A 2OUJA 5KSZA 4P5PA 4ZFNA 4NNJA 2JFXA 2YJNA 1W2GA 4PLHA 1YFWA 1ZGBA 2G3YA 3UJNA 1IPJA 2OBMA 4KFUA 5P21A 1AHHA 4W5QA 4RGVA 4DXSA 2Z98A 3PKJA 3QI7A 4QSMA 2PH3A 4NOMA 1J84A 3QLJA 3B36A 4EI2A 3GZEA 4XQWA 1GFWA 1P5JA 3UWSA 2E37A 2POCA 4EARA 3EYAA 4J0HA 4ND7A 4DY6A 4GGOA 3AVVA 1ESZA 2QX9A 3Q7SA 1NMXA 1YOVB 3K0CA 4JB8A 3TL3A 1OH6A 5AWFC 2AW3A 1QF7A 1LK0A 1DBIA 4L57A 4N3CA 5KOIA 4HFNA 3CE6A 1Y1TA 2CYFA 1U1FA 4YMUA 2WBLC 3U7RA 1NWHA 2VQ3A 5DZSA 5KAPA 3JQ7A 3R8FA 5IH3A 4ZV9A 1F4AA 3K53A 1LEDA 4CP2A 4TMXA 2Z69A 1KS5A 4F5YA 2ACEA 1I94B 4IL7A 3A06A 3GAFA 5K0CA 4TWZA 1XYPA 3ZBPA 4EA9A 3G0OA 4I8XA 3UFXB 4OYYA 2GBLC 1G8AA 2B39A 4BHPA 2Q9AA 5JWRA 2HRQA 4TRNA 4RKEA 3GN2A 4YCJA 2Z6AA 4YQZA 2B4QA 1QPZA 1NLYA 1YJQA 2ZEWA 2BJWA 2Z42A 4BFWA 3K1JA 4TQAA 4JASB 4CTNA 1JEJA 1U0SY 1KORA 4NHLA 3HMKA 2WE7A 3AHCA 1C4WA 2CHUA 1DP0A 4QVGA 2QPAA 2Q9UA 2XA2A 3F49S 4E4ZA 3PPVA 2O6LA 1R00A 4BO1A 2NLOA 1T6ZA 4FK8A 3GA0A 3R0IA 3TVDA 2QQNA 2NYYA 1QHGA 3EDCA 5DN9A 4H1WA 5AOAA 2D1RA 1TKRA 2W2MA 1YCIA 4RF4A 1V5WA 1ZH4A 1EYBA 1SA0A 5DM0A 2DBQA 5GOTA 2D00A 2PHDA 3GWZA 4G67A 2FPLA 2ZWAA 2DCTA 3A11A 5FPTA 1D07A 1VG1A 4XTPA 2CK3A 2GX6A 5T50A 1K5MB 4IV3A 3G5TA 4ZZ0A 3J7MA 3ORRA 4JBGA 3I1JA 4UEOA 4LZNA 2D2IA 3IUMA 2GF2A 3CZQA 2VHXA 2BMEA 1O94D 3NOOA 4LBMA 1EM8A 1UZMA 3ROZA 3SR0A 4HNHA 3MJHA 2LE0A 1TLTA 5LVAA 3EDMA 4NU6A 4QU1A 1J00A 4TQUS 2P5YA 4R9NA 1XJ5A 4KQKA 3T12A 2JEMA 4Y30A 1L5HA 2Q9BA 2O9JA 4MKRA 3RC3A 3WK5A 4X6YA 1T5TA 3QVMA 4XEHA 4B7UA 1YBVA 5I9TA 3U9TA 1E1MA 1UODA 4I1OA 2EX0A 1RMTA 5LCXA 4LYGA 2QUAA 1SFNA 2QRKA 2AEMA 4I0AA 2PY6A 4WAUA 2Y34A 4C3UA 2BTVC 4XDZA 4GX0A 2IYYA 1MRZA 3PHBE 2Y4NA 5DBGA 2P3YA 2Q45A 4DR3B 2QTNA 1FRFS 3IKVA 2O8FB 5C7OO 1G8KA 1DHTA 1EB9A 2NOAA 2VDLB 2V7QD 5EJ4A 3DEMA 4M0FA 4FPOB 4X64B 2GN4A 1NKTA 2PKYX 4DDUA 1GCAA 1Z34A 4NIMA 3FFXA 4CIDA 1N2CE 4U2KA 1BS9A 1ACLA 5LOVA 4RANA 4IIXA 3P3NA 3AMMA 3V34A 1J49A 2HQ1A 1PWXA 1Z0UA 5DXAA 4Q0PA 4Q4AA 4YYOA 1CAVA 4BL5A 4CDUA 4UAGA 2DPLA 1C5IA 1FYXA 3A4TA 1ZRIA 5IU6A 4LMFA 1KMNA 1TQ6A 4U6QA 2HEVF 3QLVC 1SXPA 1NQUA 1RXVA 3NOXA 4QPGB 1E1QA 2A35A 1PGL2 1N9GA 2IHYA 2RI0A 4QKFA 1SVWA 1JPVA 1SHLA 3D3AA 2WJIA 4WY8A 3LRPA 2P9CA 3HGQA 1FSSA 2OG2A 1NQWA 1V43A 1Z5UA 2OGWA 2H7XA 3QLEA 4B3IA 1G8PA 3P9IA 3J7NA 3UXMA 3OUIA 3UGGA 3OWXA 1AR82 1A8SA 1LV7A 1AL23 1NE4A 1OB5A 1O5IA 1E2PA 2HW8A 4QKDA 1T1RA 1V39A 5CVEA 3SR4A 2IYWA 4NYIQ 3THOA 3PLNA 3OG2A 1M10A 3FNFA 1UEJA 4IEYA 1P91A 5A1TA 4ZGGA 2CZQA 4MWGA 2XLAA 4ZO6A 5BWOA 2XMGA 1FNYA 1U31A 1E1RA 1POV1 4WX2B 2GAIA 1NTRA 2DPGA 4D4MA 4EENA 2W4IA 4LIUA 4GWMA 2Y6HA 5E1MA 4TTJA 2Q5OA 2WC2A 2NYRA 4JY7A 4XA8A 2ZUBA 4NJ4A 2MYNA 4L9WA 4MB6A 2XBO3 1U1GA 3OE4A 1T4GA 5ANRB 1W5FA 1GZDA 4U2DA 3GDBA 1YKFA 3TLAA 5FNVA 4XSHA 3UK2A 3AJZA 2K87A 3MN1A 3MFCA 3P71T 3PFWO 5GZ1A 2Y71A 4XVQA 1CZNA 3NUGA 4TT3A 5K0BA 4INAA 1KRWA 4EKYA 1DKPA 3AFNA 4BLRA 1DCKA 5E6SA 3RSOA 2BNOA 4DS0A 2RGBA 1RGSA 1SVIA 4GOOD 3QXXA 5G0WA 1N5DA 4Z1MD 4IXLA 2QX7A 3AEZA 1ZSNA 3GLRA 3FNIA 2HIMA 4F5ZA 1V5GA 1TI7A 4M4PA 4RJ2A 5B4UA 2HEWF 3BTSA 3BXXA 2C1ZA 3DZKA 1HRI1 2EIDA 4JKKA 1UWLA 1QQP2 4LJAA 1GDTA 2JEOA 2J1LA 3BDIA 2VC9A 3MGUA 3V3KA 1WOMA 2A1TS 3R7FA 5ANNA 5C52B 4H0FA 3VV2A 4RQAA 4L9AA 2ZGQA 4UOJA 1K86A 3G5AA 1IS5A 4XJUA 3ANTA 3LJKA 5LUBA 1DOHA 3SH5A 5MGBA 2HWWA 4M0PA 3ZJ4A 1DC6A 1YQEA 1FYUA 3IOMA 4NBUA 3LPFA 2GTIA 4AFMA 1C0PA 3U6KA 4B73A 1GLGA 3VBEA 1VKHA 2FOIA 4JV5B 4D9NA 3CO5A 1V1RA 3EEBA 3KFLA 4ROTA 1QGAA 2YYZA 4JAVC 4QOHA 4XTMA 3GGGA 4P7BA 1NW8A 1KSJA 1SVNA 8ABPA 2MOKA 2WM2A 3CEAA 2HXYA 1CRQA 2ZIWB 5DM4A 1L8AA 4BWFB 3NKVA 3SC3A 4JJ4A 4A2WA 1KAEA 3CF2A 5FUXA 2H1CA 3TCNA 3GZNA 1G5TA 1P1IA 2XX3A 4G89A 4KBGA 5KKNB 1FZTA 4CEWA 3QMWA 2IE0A 1UWWA 4WZBA 1EWVA 2B7LA 1QRUA 4CTJA 1B1AA 2G80A 1P73A 5KTNA 5GLUA 3VBOA 4GP7A 3FHCB 1MP0A 4NF2A 4YG0A 4HWTA 2GUWA 1NMYA 3ME2A 4TVOA 2WNEA 3OIWA 3VNBA 4TKMA 3ZY2A 4PBTA 4HNAB 4ATFA 3H1TA 4P4LA 3NBKA 1YQTA 4A27A 3RU9A 3OT5A 5E3HA 2VNIA 2BOIA 4MO9A 1RHI2 4F4IA 5CAEB 1J3PA 1DJLA 4YMIA 1QAQA 4YQFA 2GMPA 1RWPA 3MTBA 2DG2A 3VZRA 5GLTA 5CNKA 4KYIB 4WM7C 2Q99A 5K0LA 1R4MA 2UUBB 1R5NA 1PQWA 4F9TA 2Z56A 1DAIA 3DO8A 2NT4A 4Z6KA 4G1BA 3O93A 3A1VA 3D64A 2VJBA 1T9CA 2YZ2A 5FZAA 2HHCA 1NA1C 5F9HA 2ZIXA 1ZH8A 1UMBA 4DDMA 4FPXA 2HFJA 1VSUA 4RPHA 3C5WP 4ITRC 4XKJA 2XOKA 2WHEA 1SXJA 2Y9MB 4OVEA 1R0SA 1M5RA 1HTBA 3UG7A 1R0YA 1P3JA 1VL2A 3KB6A 1Q0SA 1BO6A 4FFRA 4J1TC 5ANQA 4DG8A 3H86A 4HDMB 4K8RB 2YXEA 4JU8A 1QJU3 3Q7PA 3UOAB 1MEOA 3NVCA 4ZODA 4B8EA 2O8EA 4P81A 1KO5A 4B3XA 4Z1MA 5CB7A 4KR2A 4HQKA 2QM3A 5A6QA 1VE9A 3D59A 4YFWA 2WUEA 2XQIA 3NBXX 1W0OA 4JBIA 2BP6A 4JLKA 3RAJA 2KBFA 3GQBA 2IYAA 4UU7A 2QQVA 4Y22A 4HLDA 2RAPA 3KT4A 3IQDB 4UTRA 2RJKA 4IEOA 3LC7O 2ZE6A 1DRJA 4UFKA 3D6MA 1GOTA 3LECA 4D9GA 2CWSA 4LJ6A 4BB3A 3MV01 3BSYA 1AQYA 4HT1T 4U0JA 4AZ3A 1CZRA 3PD7A 1PO21 1EVIA 3RIGA 1GZSA 1VYUA 4IEZA 2GH8A 1RZRD 2DVFA 4YCLA 4CPBA 3GK3A 1X39A 4IJKA 3QOXA 4TL6A 1F7UA 2ZA9A 1LR5A 4GZ9A 1MN6A 5LYJA 3JRWA 2QYSA 1E6WA 3GRPA 5HXVA 3BTVA 4LJHA 4WVZA 1JZ5A 5BSHA 3ZDYB 4AZ0A 2QXUA 3AHJA 3TB0A 3N9OA 2SNIE 2AG0A 3C6XA 2P65A 4F1KA 5FZ6A 2R7AA 3H6KA 1SCQA 4JLPA 5K0UA 3B94A 4GSLA 2XCQA 3LHIA 3DPUA 1CK4A 4RCYA 2O3RA 2ZYSA 2GR9A 2ZYTX 1MG0A 3MFQA 1JBEA 2PTHA 4RJJA 2I1WA 2FMUA 3SHWA 3VBFC 4RV5A 4N5LA 1FTQA 3H0KA 1IDN1 2VZ8A 2OSBA 4ZVQA 1P18A 5EPOA 5T5QA 3HBMA 1T5SA 3H11A 2TMYA 4F6CA 4P38A 1PUJA 4KQ6A 2E89A 4UHHA 4LKSA 3OH8A 3EFEA 3G8DA 4R4XA 5GAJA 4M1KA 1JDUA 4LIVA 1B16A 1Q7RA 2DFBA 3KT7A 3BXOA 1XA4A 1OXVA 3L05A 4QAWA 4GO1A 4ZCTA 1ZIPA 2HYIC 4AKEA 2VDOB 4XAEA 4ZZ2A 3UW3A 1EDEA 4LOLA 3KS9A 2Q2VA 1K7YA 2M32A 4LEJA 2N47A 5LZ4A 3OETA 2ZXEA 3DR5A 3AHEA 5EQUA 5C4WB 4IINA 4G4IA 2BUAA 1VE0A 4PR3A 2OBFA 2YICA 2R071 1K42A 4A0SA 2XJTA 3GEIA 3BK2A 5JH7A 3OTQA 3T41A 5LDDC 5F7XA 3RWBA 3OCXA 1H2NA 3ILFA 3CEMA 1V1MA 2R5FA 3AOEA 2CW5A 5B58C 4GNKA 2W6NA 3LSEA 4R71A 5CT9A 3RYKA 3TE6A 4OZXA 4A5SA 5AVJA 4ZI7B 3HA2A 4JI4B 4B3DA 4N47A 1XX6A 1FLDA 2COEA 2C97A 3RJ5A 2WRAA 3O4VA 1BMV2 1E8MA 3HWRA 2H29A 2QSUA 1O5OA 1CJCA 5BYNA 1IRIA 1V96A 2Q3FA 3LT5A 4J1SA 2FDJA 3JY6A 1LOFC 1EVQA 3ZLUA 3JVDA 3Q5GA 3DOUA 3R5KA 4UTXA 2EZ4A 1FXWF 3MBKA 5HE9A 4C5CA 3KZ4C 1CQZA 5KNCA 3ZGOA 4B6GA 3P94A 2JJ2A 1A8UA 2H08A 2XECA 3ENWA 5A3PA 5BNTA 1YWKA 3BHIA 4B75A 5C1IA 5EKSA 3IH5A 1RHI3 2V6IA 1TCBA 2IZOA 4HDKB 3H9GA 3DBOB 1TD9A 3S44A 4MR8A 3SE7A 2WJ4A 2JBAA 1LGYA 1QG6A 1WB6A 3IQXA 2Q5JA 3COPA 1URXA 1E77A 1QO0A 1UKGA 3D0SA 2AI3A 7REQA 3L41A 3RQIA 1VSQA 4DEYA 3ITEA 2B45X 3WDLA 5C5TA 3UH0A 5KX5B 3C7DB 3O38A 2WD7B 5CVCA 1RQXA 2IH2A 2VECA 5KOJA 1LDMA 4CDQA 3LKVA 3SZ3A 5I4IA 4BGUA 1M1YA 4HT3B 3FHQA 4L8VA 3Q8KA 3VYSB 4F4JA 1N0VC 2O2SA 3BRWA 4X1IB 3U2QA 4DARA 2Y33A 2VAXA 5HDQA 2CMKA 3GFSA 1FQJA 2HH9A 2VPVA 4LOJA 5GIOE 2Q9CA 3E05A 1U9YA 1HQLA 2H4HA 1T13A 5KNDH 5BQXA 1J25A 4PI0A 4IO1A 4EPWA 4IW3B 1SD1A 3IO3A 2A3NA 3CNOA 3X1XA 1WXIA 3WGOA 3PF9A 4P3NA 4MDFA 4B85A 2GN0A 1I5EA 2C4XA 4JWKA 2J59A 4NAVA 1ZYBA 3KQPA 1GFSA 3DEHA 4DPMA 3PYXA 3W1EA 4W1QA 3GVCA 2Y60A 1FATA 2D0PB 1QKKA 4V0MA 3DUWA 2ZR0A 3DAFA 3ZE1B 2DBVO 2QT1A 4G0YA 4KXVA 3HDJA 3KG2A 4JR1A 3UKOA 2DSNA 3KV6A 4IQ4A 3F6EX 2DWQA 2X0JA 1XNGA 3T1HB 3K94A 3DOJA 1MDBA 2XH8A 3FJ1A 1XRQA 2NU9B 1REQA 3A2MA 2B36A 1TECE 1YMVA 5EKDA 4V0RA 4S2EA 3L8GA 4OAPA 3CXRA 4OLBA 3WLFA 4R0MA 4G3YC 2XXZA 4MPTA 3SM9A 3AMQA 3FDJA 3NHYA 3PKIA 5TVKA 3AP3A 1QQ7A 1EAMA 1BS2A 5ADHA 3QFCA 2FMXA 3P0HA 1ZMXA 5DISB 3QPDA 2J1SA 1TD1A 2OO5A 3ELBA 1IHDA 1RM0A 5EMJA 1WLWA 1L6IA 1Z7WA 2K7FA 1XTKA 3SSMA 3HB4X 3C8XA 2IZWA 1VMKA 2X1LA 4JXJA 3SSAA 3IT3A 1XI2A 3KCCA 3DBRA 1JR2A 3NXKA 5IAJA 1ZMRA 5FIXA 3TLJA 2QG4A 2H17A 4CR6A 5JIUA 4MUJA 4W5HA 4BJ5A 4Z86A 4DLSA 2OCGA 1P44A 3MCUA 3OT1A 1UN1A 4B29A 4OQXA 3HKCA 3GFOA 3AI7A 4G01B 1E99A 4X62B 5FYYA 2R85A 3BMXA 3NXSA 1UQTA 2XWPA 5JZBA 5FQOA 1Z5NA 4R1SA 2P27A 4XVRA 2EF6A 1PS8A 1BLZA 2N1MA 2VO1A 2PQSA 3K6RA 5CZKA 1IN4A 5EJ1B 1TF2A 4NZOA 3L4KA 3OOHA 4MS4B 3SXUB 5F2OA 4F7ZA 5DEIA 2VQUA 3WINE 5JY6A 3M6FA 5JI2E 3BWYA 3PCTA 1E9FA 4RY0A 3R7SA 4KQ2A 1LLDA 3DHEA 3ZXJA 2Y1CA 4TKUA 3WISA 3RFUA 4B8WA 1L7XA 4FDTA 2V7BA 4QYMA 4NEHB 1DKUA 2HOQA 2B6NA 1FYVA 1SBQA 3M6AA 2R97A 5C3QA 3VO9A 5F1PA 4IFEA 3OAAA 4O4HF 1IHXA 4M01A 1BRMA 1O96B 1CD3G 3RSQA 4ZCPA 3U0ZA 4C4SA 2WJYA 3D4BA 5ALDA 1OT3A 2ZI6A 3K1TA 3L7BA 5AK3A 3RRBA 2W2IA 4DSTA 1ONSA 3NH6A 4MQ6A 1P6QA 3OCPA 2BSQA 3EPRA 2WWWA 1E9BA 3TR5A 4CA9A 4FQ7A 2OUKA 1CJMA 2TRSB 1UPXA 4HEQA 4QPIC 4V0ME 3QFFA 4YRPA 3B1KA 3KFVA 2HWE2 5GVSA 2QBYB 4XPVA 3DDSA 4D9FA 4NZYA 5JCJA 5TRTA 1RC1A 3T9AA 2DYCA 2QQFA 2FPIB 5KYXB 3POSA 4MRVA 4FMDF 4CCYA 1VLJA 1ODCA 3Q9NA 1DL5A 5LNK6 4C6TA 4DIFA 1WCYA 1UIRA 4M1EA 1U81A 4MR7B 3FPBA 2BFAA 3WP5A 1K9VF 1SURA 4NYMR 4OXIA 2ZTLA 3FOZA 2P6HA 4JGZA 1RHI1 3CUEF 3KXPA 2XI4A 2YWHA 3K09C 2DKFA 1C7JA 5CXSA 2H4FA 5CIQA 3W5SA 2H7VA 1XAGA 1MORA 3AZWA 4FFDA 1QM5A 5EIAA 1YRBA 1N5KA 4FKBA 1F31A 1KEUA 3HFJA 3EMKA 4NE7A 5KX5A 4F4FA 1WTCA 4YM0A 5JZMA 3K0SA 5FY5A 2ALJA 1U0FA 3FWKA 1DLLA 4IV5A 1IOZA 1VHTA 1XQWA 4OQPA 3ZX7A 5IYZF 4NULA 2YS7A 1USUA 2D0IA 1WBJB 2XODA 1ESDA 4GLFA 1PK6B 1FV3A 1E1DA 4KGGA 4B71A 2O7SA 1XRLA 3S55A 3UWPA 5GZ6A 1MAHA 3WGNA 2W2QA 5LMUB 4KR6A 1YQWA 5EXOA 2GB4A 4KL1A 1RW4A 2VJYA 3SMQA 3ULKA 3KUUA 1R6BX 1G9SA 1G21A 1CP3A 5AJYA 4UTPA 4K1YA 2FQ1A 5CBKA 1PHPA 4YFZA 1EUDB 1KFKB 1BBT1 3R7NA 4DLLA 2RIPA 5AHKA 2QLNA 4M0MA 1YBFA 3O31A 4QTXA 1Y8AA 1VIAA 3LRTA 1F14A 4KU7A 4J6FA 4GC9A 1J2RA 4R9CA 4AJKA 3K0FB 3QVUA 4WV3A 1LKZA 1OH5A 3W9UA 2WJWA 4FDMA 4D6QA 1JBCA 2PKXA 1R5JA 4D5GA 4X85A 3GYGA 3NV2A 5C3SA 2X8LA 3SGLA 3M5CA 3SE0A 1Q5OA 4J6EA 1HT2E 2BERA 5EWLB 4HXGA 5C4WC 1XKLA 3S40A 2QUHA 4P4GA 5H70A 2WZR1 3U7GA 2R7LA 2OAQ1 3CLTD 4DKJA 1YD7A 3STHA 3SCGA 1N2EA 1I36A 2O1SA 2GBIA 4CV2A 4KXNA 3FNGA 4BQFA 3O4RA 4IZ6A 1JJ7A 4R6WA 1GLHA 4YZ2A 3A4MA 2L9LA 3VD5A 1MNQA 4L99A 5TQJA 2JFYA 4C7BA 2Y68A 5G1NA 1G6HA 1NSTA 2J7MA 5I5GA 2WA3A 5FAXA 5HSGA 2A1XA 4L8LA 3LEGA 4BEVA 8ATCA 2BCJQ 2RH4A 1N5RA 1GA6A 4OHFA 2RGNA 2CNKA 1JDPA 3NWBA 3NYWA 3T1QA 1N6OA 2W3JA 4XETA 4HH4A 4IDOA 2WQ7A 4EY3A 4R0VA 3ICQB 4HR7A 1ONBA 2D2FA 1AZLA 3WXMA 4IGIA 4M1OA 3S99A 4FFLA 5JVVA 4BBZA 4J0GA 3DHWC 3EXFA 2I9KA 1QMJA 3COZA 2PHZA 2KD7A 4LUMA 2XTAA 3NNDA 3STYA 1S0UA 2AMJA 5DV9A 4WESB 3RGWS 4CIVA 5K8VA 4HDAA 1ZGHA 3G0DA 3N2GB 3W6NA 1VXOA 1S2LA 3EVGA 2XMSA 1ADYA 1X19A 4COVA 2ZAOA 4ZU1X 1Z4KA 3U1XA 3HMYA 4D4KA 5SZKB 3HXLA 1T29A 3CW2A 3C3BA 4JI3B 3PK0A 2ORYA 4YT8A 4KMQA 2TEPA 5TGDA 4FPHA 4AVBA 3CEJA 4PPNA 3SBOA 1NRXA 4C1XA 4WBNF 3LLMA 4LQ4A 4FGKA 1GKKA 4UBKA 1W0NA 5EUMA 1WCSA 1OKKD 3UPTA 2XHZA 4ZYLA 1WB9A 1IY0A 2D3PA 2ZP1A 3BMOB 1E62A 5MGNA 2XONA 4OLLA 3H9EO 4TTGA 1K12A 1MLDA 4Q1CA 4UBNA 2PKWA 4LG1A 4RGBA 4Z4QA 2G1UA 4LXUA 3LPMA 1SZPA 1NMSA 3ESQA 2ODPA 3V8RA 4E46A 4Y2TA 1BMV1 1PD0A 5K0NA 1BDMA 3EXAA 1Z5GA 2GCIA 5AHWA 2PGAA 1CB7A 5T5LA 4HGQA 1E7MA 1M1NA 4LTAA 2ZAIA 4HEHA 3B3GA 1KYXA 3HFGA 2A5FA 5EAIA 3ZKWA 2AYXA 1GU1A 4I4TF 3TINA 5CYPA 1UC5B 1KARA 5GALA 2IXJA 4ER5A 1JW9B 1LFDB 2Q50A 2C99A 2OCDA 2ZE8A 4EZBA 2C9YA 2H92A 8LDHA 3ZE8A 3SHQA 2IUYA 4JX8A 1VCIA 2AEJA 5A4DA 4P00B 1LC3A 4QG3A 1GSIA 2X13A 4AWBA 5CB4B 1E5TA 2ESRA 2H9IA 2BFMA 1XOIA 1MIOA 2A78A 5GMOA 1PBNA 3QXJA 1W2TA 2HLDA 1NUKA 3WF2A 3A9CA 3CINA 1O95A 2OBYA 3GFPA 3U39A 1YU9A 2PHWA 4NZMA 3WNDA 4DNFA 5JCOC 1DAKA 2IEAA 3QLTA 3VZPA 4MV7A 4M1QA 2DVBA 1IULA 3C7CB 2QX6A 4YARA 2C88A 5TQ2B 2Q1WA 5JZGB 1H2XA 4F83A 2ZUEA 1XNBA 1XHFA 3OC0A 3ORQA 2FP4A 4BQXA 4BV8A 1EEXB 1MOSA 5GIPE 4C0WA 3B85A 3WBJA 2IZZA 2QQKA 1CWUA 1O91A 4XWYA 1IJBA 2UZ1B 4K21A 3GBSA 5J96B 2FBEA 1WJGA 1MVEA 1MXHA 4COWA 1OI7A 4REQB 1R0CA 4FGZA 1T0JB 3D1JA 1NJ8A 4WZZA 2FSUA 4C1WA 3FOWA 2JLYA 1QDUA 3ICEA 5EOVA 2E5WA 2VAWA 4NOKA 4RSGA 2JGDA 2PS1A 4DCUA 5KB3A 3EF1A 2YW9A 4X9XA 4KXMA 1ZOPA 2UV8A 3X2SA 4XGKA 4RIEA 1SXQA 5DHPA 2HLNA 3KDPA 4FYJA 2XXBA 4A26A 4TXWA 2R6AA 2PUTA 3W4JA 3SBDA 1OHHA 2EW8A 4A6EA 3NBYC 4BQ4A 2J9XB 4OU5A 4N7UA 1HQNA 3W5VA 5KVCA 1WEHA 4M6WA 2OORC 1N1VA 1ESMA 3T7SA 4XYGA 3H9AA 1D0GA 1AVBA 4GB32 4L08A 4A91A 1R6UA 1DCMA 2HDNB 4AB1A 3G8CA 3HCAA 3VDBA 5DTEA 1AF7A 1S2OA 4RELA 1DC8A 1NW4A 3Q3IA 2YZMA 4C0JA 2NTEA 2DQYA 2RKBA 1JKMA 2V3VA 4PNPA 1GG5A 3KAQA 2XWJB 3EPLA 4OQMA 3VN4A 2C8JA 2IRWA 4B6PA 5BQFA 3RUFA 1NGSA 5I9BA 2JE8A 1XLVA 1H9AA 3I9V1 1GA1A 4MB0A 1MB3A 3MRXA 3OVMA 4YAFA 3IJRA 4JYBA 1GTMA 5A5DA 1GUFA 3NV9A 3IVMA 2Q4RA 2HO5A 2BEOA 2PN1A 1XQNA 4BQSA 4HFMA 3WD5A 3LT0A 3EYWA 4L75A 5H59A 3ES1A 1X70A 1SC1A 4CLOB 1TTQB 3G59A 3ZDXB 1L8XA 4AX4A 1QJCA 1KK2A 4QKQA 2PFKA 4FOLA 4E6PA 1XK6A 5C32A 4Q4JB 2IGBA 4UCXA 3ZU6A 2BFUL 2MYUA 2CVOA 4XZ3A 4QPNA 4DCVA 2CD9A 1HNWB 1EFTA 3G88A 1ND3B 5E7MA 4RABA 2HBZA 2RAVA 4UKDA 3KB1A 4OGWA 3JD1A 1G0OA 4R8KA 4GS5A 3V3TA 3S68A 4L9BA 4EWAA 3U09A 1E1LA 4BNGA 4GJZA 2VZLA 3EUEA 1MO2A 4CQLA 2Y0DA 1KR5A 1RCFA 2HV8A 4LYFA 4ISCA 5FXVA 3F6BX 1E60A 2NU7B 5I8WA 1Y8CA 2OHXA 4BE4A 1WEKA 1EESA 2H1RA 3H6GA 3A27A 4OP1A 2WDZA 5FI3A 2VQDA 5CVJA 2C3PA 2W47A 1H1MA 2BE7A 1PVVA 3MPUA 1KZ7B 1D2CA 3EA0A 3BOWA 1QJU2 4IDZA 3R74A 1UBCA 5HGXA 3C5HA 2PH1A 3CYFA 1MQTC 2G88A 2VF5X 4IICA 2YL2A 2YVUA 4QXAA 1J83A 5AVZA 4IEFB 3VR6H 1IZYA 4F5DA 1UPFA 3EGXA 3C8ZA 3EXHB 2GN9A 3LHKA 1POWA 3IAS1 3DUFA 4P9LA 4EJSC 4RD7A 1WW5A 3C3MA 2QROA 3HQUA 3N9QA 3NPAA 5U9CA 3LWZA 1UBRS 4MJXA 1ZCJA 4BMEA 3VBOB 1AJKA 4XJTA 5MF6A 4PCVA 1JVSA 3NS7A 3JZFA 4ZCLA 1CR0A 1DKOA 3KQNA 5LJIA 4MULA 4HQNA 2J4DA 2ID9A 1TMYA 4WACA 2JCYA 1LOGA 1NVXQ 1DQ4A 2XDVA 5EJZB 3FPGA 4QQFA 1ALYA 3OCVA 3DBHB 2HR1A 1PSWA 2FSHA 1R66A 3C98A 3PU6A 3KMHA 1BFUA 1ZK0A 3DULA 2PSJA 4PSUA 2BSAA 4RHTA 5CPFA 3U1BA 5HM8A 1XZHA 4D94A 1ZRDA 1NLZA 3O8LA 3H0EA 1UBLS 4R8LA 3WGYA 2JLVA 1DSSG 3AUFA 3FWYA 2PIAA 5BXXA 1UT6A 1XPUA 1ND2B 1PDWA 1CFZA 3N6VA 2CMGA 3QKSA 4PSCA 3UTCA 1EY2A 1YK1A 2WNSA 4U9IS 2V4UA 1OGYA 4Q3BA 2WF6A 1W48A 4GP9A 4AJEA 3S29A 2V4VA 2QN6A 4MUBA 4BQPA 2W6ID 1BBT2 5K3OA 3O1PA 3WNXA 3VOSA 2J0QA 2W2OA 3PJYA 4O4IF 3AYDA 4Z9BA 4C04A 4PYKA 2CJXA 2C42A 2J6IA 3LSDA 4LRWA 3CUSA 1W1UA 4O4IA 1ZKDA 4ZI3A 1W6QA 2D4HA 2GYWA 4G8BA 1HJGA 5KYKA 2IPLA 5CKMA 1I2DA 4HDKA 1PFGA 3OCCA 3LZZA 2OXEA 3OJOA 2XUJA 1M8KA 1VB4A 5JR3A 3SIRA 1MZEA 5EYPB 4KWKA 3WR5A 3AZPA 3PSHA 2XB8A 5FPVA 2OVFA 1W0JD 2XB6A 2V55B 2R87A 3ZU2A 5I7RA 4SBVA 3DHNA 3UJ6A 1DT5A 5L7TA 4IJQA 1VAKA 1ZHOA 3HWJA 2GPBA 2YB7A 1F9AA 4NYJR 1GZHB 4RQUA 5G0VA 1C3VA 2YYSA 4YYEA 5JAMA 2JS7A 3OPWA 3ILYA 3AESB 1O0BA 4L4ZA 3UZUA 5EIOA 4MVYA 3V5NA 5BSWA 4C7OA 4XQCA 1J5EB 3PXEA 1YJ5A