3M70A

Crystal structure of tehb from haemophilus influenzae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
286
Chain Sequence
MKNELICYKQMPVWTKDNLPQMFQEKHNTKVGTWGKLTVLKGKLKFYELTENGDVIAEHIFTPESHIPFVEPQAWHRVEALSDDLECTLGFYCKKEDYFSKKYNTTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENLNISTALYDINAANIQENYDFIVSTVVFMFLNRERVPSIIKNMKEHTNVGGYNLIVAAMSTDDVPCPLPFSFTFAENELKEYYKDWEFLEYNENMGELHKTDENGNRIKMKFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of TehB from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
molecule keywords Tellurite resistance protein tehB homolog
total genus 73
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m70A02
1O3QA 1O7FA 2ONZA 1VIDA 2VZ9A 4X60A 3ER8A 5LEJA 2PV0A 5BXXA 3ES1A 1H1IA 4HVRA 2KXLA 3LL7A 5LQJA 3HCBA 2AOWA 3MCZA 3K0BA 3M6VA 3BGIA 3M33A 2LD4A 4M37A 2O06A 5EHGA 2VDVE 3LDGA 4LA2A 2EVXA 5FWAA 2CAUA 3UJCA 1ZVFA 2FK8A 5CVDA 4Q0PA 3SSMA 2GC2A 2R3SA 5KHKA 3Q87B 5IKMA 3HVIA 3KQOA 2OXTA 5T3NA 3UJ8A 1LB2A 1X7NA 2JJQA 4GEKA 3K6RA 3KPWA 1YZHA 5E9JA 4YMGA 3LCUA 5KBFA 3DMGA 3KPUA 2R6ZA 3GRYA 3KPYA 3GO4A 2ERCA 5DRYA 4XFIA 2V7EA 2BYVE 2P8JA 3UBTA 1O3RA 4A6DA 3UKNA 3EVCA 2ORED 4DKJA 4CYDA 2H6CA 3LOIA 3P9IA 4YUYA 3EBRA 2PT6A 2H1RA 3R0QA 1L9KA 2HWKA 3KGLA 1ZQ9A 5HIJA 3ROUA 2IPXA 2ZTHA 4F86A 2HNKA 3LBYA 1TW3A 3MPBA 1UIRA 1PRYA 5H02A 4X6RB 4IEQA 4X1OA 4RVHA 3P9NA 4BIFA 4N9HA 3RZZA 5FCCA 3UJ6A 2YUIA 3UJDA 2FHPA 3SMHA 2IH2A 4I01A 4CKEA 5KQSA 3MCTA 5JR3A 2ZWAA 4HSJA 2ATFA 2C7PA 3OCPA 2JH9A 5HIKA 3PNAA 3G7DA 1FP1D 1JSZA 4D7SA 1NE4A 5EC8A 5K01A 3AXTA 2E5WA 2PHLA 2EJTA 3B5IA 2OB1A 4C06A 3NDIA 3BT7A 3CJXA 2PGXA 1JTEA 1QYRA 3GIWA 2E9QA 3LKDA 5E16A 2VP3A 4E32A 1P1CA 3LX6A 5C1IA 4MZUA 2VPVA 1RI2A 2BEOA 4RTRA 4DF3A 3FUUA 1XE8A 4KWJA 2IXJA 3TR6A 2VDUE 5DTMA 2IXHA 5FUBA 2VECA 1O4TA 3OGJA 2OYZA 3G7UA 1KYZA 2XL9A 1NBHA 1R8YA 1SQFA 1MHTA 2UY9A 4I09A 2BR3A 5FTWA 3EVBA 3LDUA 2PAKA 3H8UA 1WXXA 5ICEA 5FLIA 5J7MA 1VQ1A 4U7TB 3UKTA 3DXYA 1G60A 3E7PA 5I0UA 3JWGA 2BM9A 4RTNA 3FJSA 1RUNA 4XFAA 5JCTA 1O54A 2B9EA 1X8MA 4X61A 2ZZKA 2D93A 4DCGA 4HBNA 4JTNA 4I0AA 4HH4A 3P2IA 2IP2A 3I59B 2Z69A 4AVCA 3I58A 3RYPA 3JZVA 3LECA 1RI3A 1GQHA 3OZTA 5LEKA 3LCCA 4DINB 3ELNA 3UJ7A 4HVOA 3LKZA 2XGXA 2IBSA 5JR7B 3V97A 4C03A 3LZZA 1YB2A 3FRHA 3M6UA 2YQZA 5EEGA 5ICGA 2EFJA 2MHFA 3OU2A 2Q4SA 2N7GA 5LQUA 1EY2A 3DP7A 3L2HA 1WXWA 3SSNA 4PYIA 3SCHA 4IEPA 1P91A 1ZRCA 2CKDA 3UA4A 4GOLD 2ET7A 4FT2A 3MZHA 3OFJA 1WLTA 3ELUA 2WFPA 4ER6A 5D1NA 3ST7A 2PX5A 4QVKA 2B25A 4FSDA 5JSPA 2O57A 4HVQA 2FQPA 1F38A 5DPMA 4KDCA 3M4XA 5DT2A 2UYAA 3KMHA 1KPIA 4NECA 3TMAA 2PAEA 3HIFA 3FZ3A 2IIPA 2UY8A 2IXCA 2PWYA 4V0RA 1M6YA 3FTDA 4RVFA 5DX0A 5J3UA 3NVMB 1ZGAA 2DULA 4XFHA 4IKPA 2CAVA 3R9XB 3C3VA 5EMJA 1O5LA 4BLVA 3EJKA 4I2OA 4FSXA 2Q30A 2GB4A 1H1MA 3HCFA 4Y2HA 4P7GA 4HC4A 2IXIA 3E5XA 2F4PA 3BGVA 4JXJA 2KW5A 4OX9Y 3E5UA 4QGNA 3HVJA 1HW5A 1NT2A 2IGTA 3CCFA 2OYRA 5BY5A 1L1EA 4IEZA 3MYXA 4ZU7A 3BKXA 1X1BA 3CBGA 2G8NA 2GH2A 4IEOA 4MH0E 3RIEA 2QE6A 4YV0A 4ER3A 3OF1A 4RTSA 2P1DA 4XUCA 1ZX5A 3EEYA 4GULA 2K9ZA 3BALA 1YFYA 3TM4A 2VQAA 1X1DA 4HTFB 4PYMA 3FHIB 2H00A 4EKGA 2P35A 5CD1A 1Q3EA 4GC9A 5CVJA 4RTMA 3U10A 4X6QB 1HMYA 3OU6A 1R00A 4KIGA 3P9CA 2XLAA 3GRUA 3C3YA 5KHIA 2OB2A 1KYWA 4M36A 1G55A 1NW8A 1YWKA 2Z6AA 3TNPB 4KIFA 1IXKA 2NXJA 5MHTA 4E2WA 2PTMA 3FE5A 5DM2A 4QDKA 4PINA 4LECA 3WW1A 5HZMA 1KHHA 4IETA 1JSXA 3NVCA 1RI4A 1NE6A 4F8AA 3GRVA 4P7KA 4AVAA 1YFUA 4BLUA 2BNNA 4XF4A 4IEXA 3RYKA 3DXZA 2I7CA 2ZFUA 3UFBA 1X82A 1V70A 1L3CA 2NXNA 2B9UA 2OO3A 1KPGA 4PWYA 2PJDA 1EG2A 2P40A 1CAXA 3ORHA 3B89A 1RUOA 4EK9A 1TW2A 5HILA 3D82A 3D2LA 2EG5A 1O3TA 2QCSB 4R6XA 1L3BA 1VL5A 3KU1A 5GM2A 5E1RA 3GRZA 2PXCA 2O0LA 5E1DA 1J3QA 2A14A 4QGMA 3P71T 2UYHA 5EFUA 1G8AA 4GOOD 3S7EA 1NE2A 4IESA 5LQRA 1TQ5A 2IH4A 5LR6A 1VJ2A 4EV0A 3B3GA 2PSSA 4F85A 1NYWA 1ZZ9A 1WG8A 1D2HA 4AXOA 4XFGA 5K0GA 3M3IA 5BPXA 3NW9A 2YXLA 3FZGA 3IBMA 1RL3A 2CGPA 5ICFA 3D0JA 4QX5A 2GZWA 3FPGA 3WSTA 4EMSA 1ZZCA 5FHRA 4AZWA 3EGIA 1DUSA 5GM1A 4LLOA 3I7DA 1O5UA 1ZNPA 1TPYA 1AQJA 5I8TA 3TOSA 1OR8A 2YX1A 2H11A 2OA2A 2Q41A 4PYKA 1XDUA 2GC1A 3KPJA 3I9FA 5P8WA 4RX1A 5EMMA 1U12A 1VLMA 4QTUB 3HA3A 3FUTA 1KPHA 3EMBA 4FP9A 3MTIA 5EKUA 4QM9A 5F2KA 1UIKA 3H1YA 4AZVA 4ER0A 3UZUA 4PYOA 3KQTA 4I02A 4RTJA 3BU7A 2GLUA 3NVKI 5EIFA 2AR0A 5DX1A 2AOVA 3B3JA 2K0GA 3MTEA 4Q0VA 4Q0UA 1PJZA 3O31A 1NW6A 5CU1A 4KWLA 3P2KA 4E31A 3NL1A 1WZNA 4KDRA 5JSOA 2P7IA 2C7RA 3CVOA 4XF0A 3UJ9A 3B7PA 3EVFA 1JTFA 4LA3A 2BM8A 4P7FA 2YR0A 2PAMA 3BB6A 4AQ6A 5K0EA 1J3PA 1EP0A 1QZZA 3BWMA 1CAUB 5D1IA 3HCAA 2OKCA 3OE4A 4JTOA 1ZZBA 5FA5A 4E2YA 5T6BA 2D40A 4E33A 1DZRA 1PMIA 3GDHA 3O14A 1LR5A 1GQGA 2H0VA 4JV4A 5K09A 5T64A 1OD5A 4K8FA 4HZFA 3KQWA 1FJXA 3JWHA 2C7QA 2PX2A 4LG1A 1F3LA 1NV8A 5CVUA 5E1OA 4IEWA 1BOOA 3G2MA 1YLLA 5EHIA 1RJDA 2I62A 3S7IA 3P8ZA 3ES4A 3H3UA 2XVAA 3OCJA 3BZBA 2QRVA 2ZKLA 3SSOA 3G8BA 4BYYA 4UBGA 1QAOA 1INLA 4KWCA 4XF9A 3EO6A 4Z07A 5EOVA 4UOEA 3H9AA 2MNGA 5C8WA 2NP7A 9MHTA 2PHDA 1UD1A 2PA7A 5EGSA 4FR0A 1QXJA 3G5TA 1JQEA 2IFTA 3H50A 1ZZ8A 2PYTA 4XCXA 1PM7A 1KR5A 3UJBA 1VPTA 3PLAE 5DSXA 3GGDA 3CO2A 3SX0A 2K4MA 3R6SA 3RNSA 3I59A 4RVGA 3REOA 2IC1A 2OBFA 4YUWA 2QM3A 3MB5A 2AOTA 2PBFA 3MDPA 3BWBA 4GUAA 4GOMD 3N4MA 3OE5A 3E23A 2C7OA 3FRIA 3Q7EA 3IDCB 5FLHA 1XVAA 1DGWA 2G71A 1JR4A 2IDJA 4EWAA 5K0BA 2ZBQA 3DR5A 1Y8CA 3I54A 2ZBRA 3FUVA 3VYWA 2V09A 1I9GA 3M6WA 4XEZA 1NKVA 2PVCA 4P58A 2XLFA 4C05A 3TFWA 1NXMA 1QAQA 3TRKA 2OZVA 1ZRRA 3DMFA 3G2QA 4QVGA 3PB3A 5F2NA 1OI6A 4E2GA 4QGLA 3BCWA 3EVAA 3M70A 3SM3A 4E70A 3ELYA 3R3HA 1UCXA 2ZIEA 1SQGA 3MGGA 4CKBA 3SMQA 3EHKA 4XFCA 4LULA 1J3RA 3FPEA 4IV0A 3KHKA 3LA3A 4META 3SGLA 1EQAA 4FBFA 1B42A 2NYUA 2JHPA 4B29A 4QTTB 2FCAA 3HEMA 4WXHA 2AOUA 4RTLA 5DLYA 4CKCA 3KQSA 3LCVB 1SFNA 3DN7A 4IEYA 1AQIA 2DPMA 1FT9A 2B78A 3A4TA 4DCMA 4Q29A 3QOWA 4EWEA 3CC8A 3BPZA 3EVZA 4MV2A 4AX8A 1KIAA 3WW3A 3BKWA 3EPPA 3IDBB 5F2OA 4FGZA 2BR5A 3PFHA 1YFLA 1DL5A 1M0EA 2ZLBA 5FWDA 4HN0A 2P3LA 1P39A 5BW4A 3E6DA 3HQXA 2AN3A 4EQZA 4M38A 3CJQA 1DCTA 3KQQA 4PYNA 4QMAA 1RJGA 3PVBB 3PVCA 4WBBA 1EJ0A 3DMHA 1SG9A 3KR2A 4CTKA 3EVGA 4YV2A 3E6BA 3R24A 5I0TA 3NW4A 1AV6A 5HOQA 3FPJA 3H7YA 3GCZA 5I93A 1ORIA 1WA4A 2IBTA 3TM5A 3HVKA 3DL3A 3F4KA 4OBWA 4Q0SA 2JG3A 2ZBPA 4PGGA 2ZULA 3LAGA 2FYTA 5EZWA 2AVNA 3LSTA 4ER7A 3QOPA 3NDJA 1NW5A 4PYQA 4M7RA 2HR1A 3ER9A 4PONA 1D2CA 4LTAA 3KQMA 1XCLA 5DTQA 2GC0A 4XFBA 3HM2A 4Z2YA 1O3SA 4FZVA 4QPNA 1XE7A 2XLGA 1ZG3A 1LKNA 3PX3A 4PIZA 1Y3TA 3ERCA 4KU7A 2AOXA 3EVEA 4LEJA 3OD0A 1N2XA 3AY0A 3E6CC 5K03A 2NXCA 3NWEA 5EVJA 2WC2A 2ZZNA 2O1QA 5EMKA 4V0QA 2GH1A 2PXXA 5K0LA 4C04A 4RTOA 2Q1ZB 1RC6A 4H7LA 5BXYA 3I5UA 5E2BA 3S0MA 4XFFA 2CMHA 5FQ0B 4MQ4A 1I1NA 4RVDA 3H7JA 3MHTA 1FPQA 4MGZE 4PYJA 4YSFA 3CJRA 2XHKA 4ZTBA 5KHJA 4ZU4A 1Q0SA 3LWCA 3O7WA 3WW4A 1JUHA 4JVAA 5BW5A 2HV9A 3BGDA 2PX4A 5K0FA 2NXEA 4U7PB 3CGGA 2O05A 5T67A 2PT9A 1RGSA 3FUWA 2AN5A 4Q0QA 1SEFA 3C3PA 5CCBA 1RJFA 1YUBA 2PFWA 2PXAA 3PT9A 4X63A 3FTFA 4D7TA 1XTPA 4LWOA 5EZSA 4POOA 4GQBA 1DGRA 2CWWA 1RTVA 10MHA 5BV6A 2XL7A 4TLFA 3TNQA 4YV1A 3BWYA 3BUSA 5DM1A 3KSCA 3OFKA 2GU9A 4E2XA 3GU3A 2P17A 1I5ZA 2P41A 1IM8A 2WA1A 3C6KA 4EWDA 5GINE 4EROA 5GWXA 2QDRA 4OA8A 2B2CA 1U2ZA 3DLCA 5BP7A 4HMZA 4XETA 2HTEA 5GP1A 2XKPA 4LWPA 3U81A 3DTNA 4QPPA 1OMIA 1XDSA 4PCAA 5JUWA 3GRRA 3ID6C 2IDKA 5EIWA 3LBFA 5LQNA 1FP2A 2JH8A 3S68A 1ZZ6A 3DOUA 3UWPA 5FLJA 5C9ZA 4CWAA 4O29A 4ZU5A 3RW9A 5AVPA 1I4WA 4L7VA 5IH3A 2P3OA 3GNLA 3FYDA 5I0RA 3HT1A 3G2PA 5LQAA 4KVZA 4AUKA 2CMGA 3I53A 3RODA 5DM0A 2Y1WA 5C6CA 4O9GA 1Y9QA 4KW7A 3FPHA 4DZRA 1VE3A 1SUIA 3A27A 1RJEA 2OZJA 3C6MA 1T43A 3HCCA 1FI2A 4ER5A 4F84A 5CIYA 2DCTA 3KCCA 4WVZA 1CAXB 2FRXA 1YZ3A 4XUDA 8MHTA 2GA9A 5FQ0A 4AZSA 1YFJA 3ELWA 4HGYA 2Y1XA 3PS9A 5HFJA 1L3JA 3HA5A 1ZKDA 2YVLA 2XKOA 1WY7A 3KR9A 5FA8A 1X1AA 1CGPA 2CL5A 2ZIFA 5CVVA 4GC5A 4IEVA 2B8MA 3QACA 3EMDA 2PWPA 3OPNA 4BP1A 1R74A 3UA3A 3IIAA 4YARA 2UYOA 1OFNA 3UJAA 2UYBA 2O8QA 1N7JA 4HGZA 3H3ZA 3O4FA 3T7RA 1QANA 3HP7A 4P9GA 2QJVA 2PQQA 5LRRA 5HIMA 1QAMA 4GBED 3AWIA 1SVUA 4I0BA 3BXOA 5EEHA 4UXAA 3LPMA 3THSA 1VP9A 2VS1A 1YFWA 4GOND 2PY6A 1EYBA 4QQNA 1JQ3A 5FPZA 3IWZA 2GAUA 1ZGJA 4E30A 3DKWA 2V74B 5CM2Z 3TQSA 2GS9A 5DXAA 4I3PA 5I8SA 5CVRA 4RD7A 1QXRA 4KU8A 2Z2SB 2BGCA 1XXLA 4L2NA 5ERGB 2PX8A 2ZVJA 2IH5A 4YMHA 3JWIA 4RYLA 1BHJA 4RTPA 2Z6QA 5E2AA 1CAWB 3SCGA 3HTXA 5KHGA 4FAHA 1EJ6A 5G02A 1I6XA 4ISCA 5EQJB 3TKYA 1N7IA 4Z82A 4N9IA 1WS6A 1JG2A 3DH0A 2I45A 4DQ0A 5CADA 2B5HA 1IY9A 1WGPA 2D5FA 2AOTB 3TPZA 1SQ4A 4NVPA 5LQCA 4BY9E 5DRTA 2PKWA 4PNEA 3G5LA 3T7TA 4HLTA 3LHDA 3HT2A 4BH9A 4CTJA 3CEWA 5FDBA 2P7HA 2XYVA 3NWBA 5FHQA 1YHFA 3IV6A 3NJRA 3PLQA 1ZREA 3NTVA 1X19A 4OQDA 3PTAA 3UKVA 3GJYA 2NNWB 4QQKA 1R18A 3P2EA 2GC3A 4C4AA 1R8XA 2I6GA 5EKXA 1J59A 3U0ZA 1XCJA 3KKZA 3AJDA 2G72A 2YTZA 1JQDA 5E1BA 1Q0TA 1O9HA 3OTFA 4MX3A 2BZGA 4XF3A 1XRUA 3KQPA 5JAXA 4GF5A 4OA5A 1DZTA 3CL1A 4XF1A 2GAFA 3P97A 5DTRA 2BH2A 5DSTA 1RI5A 3IHTA 5GIPE 2ZCJA 1VP6A 5HEKA 5K0NA 5HIIA 3LA7A 4X41A 4CXMA 3HNRA 2ZWVA 5E9WA 4H0NA 3VHRA 5K0CA 3ACLA 2PLWA 3CKKA 3ANXA 5C0OE 2G70A 4PGHA 5DM4A 1H1DA 3LDFA 2ESRA 2XYQA 3A7EA 4PCLA 1NZCA 2ONYA 2YXEA 3HVHA 4HSLA 3HCDA 5GIOE 3H2BA 4WVLA 4PIPA 1ZRFA 3M6XA 1NW7A 5K0JA 3OZRA 3SXJA 4EVIA 5KYGA 3CF6E 3QOXA 5FCDA 5DWQA 3CLPA 4IV8A 3ZDSA 1JG4A 3FFQA 3EGVA 2QY6A 4HRAA 4RWZA 4RV9A 5LRSA 3G2OA 2FPOA 4DM3A 3THRA 1HNNA 4FS8A 1Z3CA 3FX3A 4MGKE 1CAVA 1VBFA 3B3FA 4MHTA 2HMYB 3KR0A 4RTQA 3T0IA 4R8RA 2EAAA 1VP3A 4YUZA 1XDZA 1YF3A 4IERA 3SHRA 1M6EX 4MUVA 5FULA 5D1HA 3H1WA 2HJIA 4R6WA 3QV2A 4QDJA 2B3TA 1CAUA 1O9GA 1J1LA 1ORHA 7MHTA 3TLJA 3SCFA 4A2UA 3HCEA 1G38A 3PX2A 4B17A 1UIJA 1P1BA 1NW3A 2IXKA 4C08A 3EVDA 5K8SA 1UFKA 4HSGA 5KVAA 1J58A 3RPQA 3OZSA 5FQNA 3LA2A 3GWZA 5KS2A 5I8YA 3VSEA 1KXZA 4YUXA 5KHHA 3FUXA 2AVDA 4KRGA 4PYLA 4WZCA 2EX4A 1CAVB 3A25A 3DV8A 5CUQA 4E2QA 5F1RA 1X8EA 2XVMA 2OY0A 3FYCA 2D5HA 1ZZ7A 3E05A 2ZZMA 1EPZA 1D2GA 3MAGA 5LSAA 3U11A 1BC5A 3SR4A 3GYDA 3RDIA 5FADA 4DA4A 5FQOA 4BP3A 5I0SA 3L8DA 3NJZA 2ZCWA 5GOZA 4FAGA 4YRDA 3HA7A 4L11A 4ATNA 3FTEA 4Y30A 3A26A 2YXDA 4E2ZA 4IEUA 2BNOA 3R6TA 4K6MA 1R6AA 2Q0AA 3NSTA 3WW2A 1NBIA 2F8LA 2JHCA 4FT4A 3DLIA 4HG2A 2XBMA 1JG3A 3X0DA 3JWJA 2OZ6A 4MGIE 2WA2A 4A6EA 5EG5A 3G8AA 1G6NA 2C0ZA 5CCXA 2UYCA 4OFGA 5JSRA 5DX8A 3KPVA 1MJFA 4AQ2A 3USSA 3MQ2A 3DUWA 2FK7A 2EA7A 3GXOA 2EJUA 5U4XA 4LUKA 4R52A 3GBFA 3EEOA 4BLWA 3AXSA 5E8JA 3IEIA 4QXKA 5M5BA 1G6Q1 4YUVA 1V39A 1L3IA 2VDWA 3C0KA 4LUMA 1QY4A 2BR4A 4QM8A 3SVZA 3KQYA 4PJYA 3EGEA 3ME5A 1FBNA 3FPFA 2CV6A 4HN1A 2WK1A 1VR3A 2MPFA 5K8VA 4RTKA 5DXJA 5J48A 4MIKA 5EPEA 3ELDA 5E8RA 4XUEA 3G89A 2ZSUA 4R8HA 2UZ4A 2OPBA 3VC2A 1SUSA 4YNIA 2AS0A 2O07A 2I9KA 4R8SA 5ICCA 5K05A 4KWKA 3E8SA 4J1XA 1IPKA 4YYOA 4P7JA 4MWZA 3A7DA 2HKXA 1YFXA 4PIYA 3TKAA 1SKMA 1AF7A 1XJ5A 1FXZA 1BKYA 3SXWA 3DXXA 5EZQA 4AZTA 3T7SA 2UYQA 2GPYA 1LRHA 4ORFA 4E2SA 3FTCA 2AOUB 5LQKA 4MGYE 3LGAA 1NV9A 2AN4A 4HTFA 4R05A 1IPJA 5HI0A 1UW8A 3KQVA 4C07A 2IXLA 2Z6UA 4KL1A 2P3QA 3MERA 3FWEA 2N47A 5KQRA 3VC1A 4ONUA 5FPXA 1CX4A 3NMUF 3B02A 4FT8A 1ZHFA 4O9EA 1JG1A 2FMYA 2G1PA 4DMGA 1YUDA 4J1WA 1G8SA 3ETQA 1EAMA 5BUVA 2ET1A 2QVSB 3PFGA 4OBXA 2JHAA 5CVEA 3H1MA 2OPKA 4UBHA 2QYOA 5I91A 3CJTA 3D0SA 3I64A 1RI1A 2ETEA 2ZW9A 2ADMA 1CAWA 1UWVA 1KP9A 4RSRA 1Q43A 4PIMA 1QWRA 3NKTA 2BNMA 1UPIA 2AZTA 3OU7A 4PIXA 5EMLA 2ZIGA 5E1MA 4OLLA 4G56A 1X1CA 5E9QA 3KGZA 2QRVB 3P9KA 4OQEA 3E97A 3KR1A 4IWNA 2QNKA 1Q5OA 5B1SA 3EQEA 1EIZA 4BHPA 2NP6A 4MTLA 2H6BA 2Y0OA 2XYRA 4EKIA 1ZRDA 3E5QA 3G88A 3IYLW 3RYRA 3V8VA 4F7ZA 4AVBA 3DULA 3BWCA
chains in the Genus database with same CATH superfamily
4GZ5A 4JNCA 4X60A 1B8NA 2CBGA 3NO4A 2JAHA 3D5EA 2VCEA 4IL5A 2R4TA 4IRMA 3FH0A 2BP7B 6LDHA 3S2SA 2LD4A 4TT8A 3N8GA 1A4UA 2EXKA 1HDEA 2JGDA 3GH3A 2REXB 2RMU1 1UJNA 4ZAZA 4GI7A 5J5VA 4EPRA 2ORXA 6ADHA 1T8TA 5FAKA 4C3UA 1HK7A 2JJQA 2JJ2D 2HU5A 4R0MA 3K70C 1RQXA 3ROQA 1Z17A 2CN1A 5LP6F 1T0UA 2BYVE 1VBB3 4E15A 1RINA 2F43B 3EVCA 3QPAA 3E1KA 2WZPP 1NNLA 4DKJA 1QYVA 3LW8A 3STHA 5KNCA 2LKDA 1D03A 3QE0A 3KGLA 1A2BA 4K87A 2VCCA 2QRQA 2W6JD 3ROUA 5JNTA 3ZXDA 1P3JA 1FRNA 2GTIA 1K27A 3WHPA 3VBSC 1PK8A 2ZJFA 4BFCA 4AGRA 4XD2A 4AZ0A 3HS3A 4JITA 4EJ0A 2H85A 1JFTA 3LG2A 2ZRMA 1P7ZA 3AHCA 4ZYTA 2O8BB 4DQKA 3G7DA 4UW6A 1YIAA 4EEZA 1Z74A 1FP1D 1M33A 2PHLA 5KIAA 2PHXA 2CXRA 4FXGB 3F2ZA 5IXJA 2VZOA 3GIWA 4QBHA 2BW0A 3HU3A 1CR7A 4J0HA 4XD7A 4IJ5A 3KVRA 3WG1A 1GIAA 1QQ6A 1HX7A 4KYIB 4LQCA 3WX5A 2B9VA 5AFEA 4JJ7A 3TR6A 2ZX2A 1BA3A 4YAFA 5TNXA 4I9NA 1I0ZA 1DAKA 3FGZA 4XEHA 5GVRA 1OFGA 5CCDA 1TAHA 2VUDA 2CJYA 1ZJWA 2I34A 4CEYC 4HV4A 2GZ1A 2YZMA 1BMQA 3L1UA 3F5FA 1ENSA 4JXXA 4QM6A 4B6RA 4X1KB 2UYYA 4XFAA 4XZPA 2WO2A 3HBZA 5GAJA 3FNIA 4X62B 1BMDA 1YUNA 5FTLA 5IDXA 2TRSB 3K5PA 4IGQA 4YRTA 3I9OA 4CXXA 2BBAA 3VYVA 4H3SA 4PZCA 3SXUA 1PIV1 3HUDA 4DINB 4Q3BA 4ALKA 1ZGZA 4GYJA 3OSUA 5DN9A 3TD9A 1JDUA 4A0QA 1T9BA 1AGPA 4YP7A 1DP4A 1VG1A 2WO3A 2BGWA 1KMHA 3VKMA 4R8LA 1L4FA 2CUNA 2DT5A 4LHSA 2DUOA 3SCHA 2KSQA 4XX1A 1T6YA 2PZMA 3OP4A 5A9SA 1W34A 1SXIA 2GBFA 2IYUA 4RGKA 3DPRC 1BXGA 5D1NA 5TMBA 2GK7A 3ZZMA 4AF6A 3FBMA 3ASYA 3KCYA 4KDCA 5F7JA 2I2CA 3JPWA 1ZZEA 2GN4A 1K7FB 1A82A 1OH5A 4DMMA 4Y1YA 5B4NA 4QB1A 4ODIA 3FTDA 5DU2A 1MV8A 3TFOA 1EA5A 1AZTA 5KU1A 1R4NB 1OHFA 1PQUA 4FE4A 2D2XA 3M2PA 2NO9A 3L5KA 3MIZA 4F8EA 4JI2B 2JLUA 4I2OA 1O4WA 5L3QB 1TQ4A 2BFAA 3X1JA 1Y0BA 4A9AA 4DDHA 4WBXC 1UBHS 3GIDA 1LJUA 2VNRA 4P7GA 1GR3A 3IXQA 1KDPA 4QGNA 2GSWA 5B4VA 4BPZA 4CMAA 1A4IA 4GMFA 1VZ3A 1NASA 5JI9A 3ZDDA 2IZ0A 4NHOA 2WJYA 2OK8A 4UHBA 4JAAA 3ZN6B 4GNRA 3SNHA 1VBE3 1DUVG 1OWNA 3BG5A 3ILNA 3GXBA 3QKIA 5CIQA 5JXGA 2C5AA 4RVOA 3HJHA 3QIAA 1KEWA 1I10A 2E53A 3GT0A 2ZUDA 1SPPA 4XJVA 1SC3A 5F5LA 5KHIA 2C94A 3QLJA 5FOWA 2IXDA 3PVNA 2B61A 3CLRD 5G4KB 1KU0A 3V1TC 1GA4A 1CY8A 3JRXA 1VYUA 2QJFA 3FVRA 1J7JA 4GD3Q 1CP3A 4ZEXA 5K3FB 5FJIA 1NBAA 2Y66A 3FHCB 3GPIA 2D5BA 2GHTA 4RFVA 2J48A 5IN4A 1ZD9A 4DPMA 4R1MA 1U9ZA 2NXNA 3N39C 3B1FA 4ANFA 3V56A 5IC5A 3G7SA 1C9EA 3MOIA 3FJYA 4MZXA 1U3UA 3QVSA 2B1GA 1WEKA 1F6BA 4DV0B 4R6XA 2XXBA 3OZXA 4WMLA 1I3LA 3W5VA 3GRZA 3F90A 4TL8A 5KWRA 4B87A 3K51A 3HZRA 1UKVY 3QSGA 4IESA 4YMWA 3USES 3OEED 1K9VF 2QMOA 4BVBA 3GRCA 1K8ZB 4JLAA 2Y0PA 3SIXA 3B3GA 2H2DA 2WF9A 2PSSA 2F55A 1US8A 1THGA 2FY8A 1JJAA 3NCHA 4M8IA 4F4IA 2IGBA 3GFSA 2OA0A 3RKUA 1T10A 1XI2A 4AT1A 1E4VA 3A1NA 2RH4A 4QLAA 4H6PA 1UJ6A 4F2PA 1VYHA 1XZQA 1Z0IA 1UDBA 4BAUA 1FNSA 1MAVA 1Z4OA 3VR0A 1Q0UA 2MSDB 5ANRB 1ZXBA 1UBSB 3EMBA 1VBE2 4R98A 2YOGA 2BWAA 1RWMA 3H1YA 4Q3OA 3GQVA 1H8TC 1E8DA 3LNTA 3VDNB 4E1BA 2X77A 2BFBA 2Z4SA 2AOVA 2D3PA 2VHXA 2P4QA 4TMXA 2YDXA 4Q0VA 1V3TA 3QEMA 3WGOA 3D0QA 3ZWMA 3HNYM 3KHBA 1QUFA 3EQ2A 1N5LA 3CR8A 1TU4A 3MTDA 4KDRA 3NQ41 3CVOA 1HM5A 2FU5C 2X29A 2IPMA 4J3FA 2CTVA 3ADPA 3K0FA 2E4WA 2PAMA 4CPBA 1QXSA 2ZUTA 4OQXA 3M3EA 4Z54A 2BKUA 3LJKA 1AL22 2CNKA 4BQFA 1UKBA 3INTA 3JAKA 4E33A 2ZSIA 4UW9A 1OHHD 2ZHNA 1RZRA 1XDDA 1E9BA 3CNEA 3BS4A 1XAHA 4MR7B 3KEOA 4H16A 4MI9A 5KYVA 1IRXA 3COZA 5K3FA 1XKTA 3IUBA 2QZ3A 1NQOA 4ZOEA 5EZYF 3AMVA 4OY3A 1QDLB 2C42A 5K6RA 2P1BA 5I4KA 1PGW2 1OPOA 3EO6A 2AYHA 2O3SA 4MA5A 3BORA 3RVOA 1TZOA 5C8WA 1R66A 1NSFA 3RH0A 5CEHA 4G0YA 3FNBA 1GV1A 1T5BA 2XMZA 3L7MA 4N5LA 3UMRA 3VH3A 4LBVA 4OJQA 2O3TA 5I9NA 4Q4Y3 4KDFA 1DCSA 3ZU5A 2J7KA 2JEMA 4C0KA 4TPKA 1JZQA 4NJEB 1W35A 2P3YA 1WHTA 3ROZA 1R1DA 3UKDA 4XTPA 4M60A 2OS2A 4OXYA 5FLHA 4COWA 3FX2A 4X54A 1Q1QA 1J99A 5CFQA 3THPA 2O0JA 3ZR4B 4U36A 4B7ZA 2C4XA 4LYGA 2V55B 5KTPA 1LRKA 3HD8B 3VZLA 2ZREA 1F15A 2C98A 3K9NA 3TAYA 3LWDA 3WNBA 1I80A 4E5MA 1QF6A 1SMVA 3NRUA 1LFAA 1RUE2 2X0RA 4CIVA 2CZGA 3BGOS 3AR5A 1WSAA 1ZHOA 1A7AA 2CDBA 1JHNA 4TSFA 4RJ2A 4CDUA 2Q62A 1HUQA 1NUTA 2PSDA 1V9U1 2NYUA 1DTEA 3MILA 4XBQA 3THTA 3HYTA 3UETA 4KPGA 3EGDA 1U5YA 2WIBA 2SLIA 1PS8A 2FQWA 2NSYA 5JECA 4RKEA 1E3EA 4CTEA 1QTQA 2DF8A 4KVFA 3U17A 5FWDA 4CKWB 1UKZA 2N0SA 3HQXA 1L5RA 1ONNA 1T0JB 1W88B 3A06A 1XDGA 2IXEA 3LY5A 1RJGA 4HGOA 3U7QA 1FLVA 2WDPA 2NMOA 1Y6JA 1VFPA 4QQOA 1CZSA 4KFRA 3I8OA 1AKUA 1HXS2 2JGAA 3T4VA 3NDPA 3CR3C 3CU5A 3GA0A 1ORIA 5A7QA 4Z51A 4P81A 1QJZA 1AO0A 4TN7A 1JZ2A 2FYTA 3B9QA 4LGMA 2PGDA 3TB0A 3LSTA 3GH1A 2IU6A 2ARBA 1F5SA 4G4IA 1Z15A 1JMVA 1S4MA 2QTMA 4DEQA 3N2YA 1YE8A 1W48A 1CPMA 1KNQA 1VPDA 5ALPA 1SM4A 2Q2VA 1N1EA 5JATA 4FZVA 4KAAA 5L9BA 3QA9A 1JHDA 5BSKA 3PE4A 3NFRA 4PIZA 2PFKA 1C3OA 2J9FB 1PFQA 3EB9A 4PFKA 4YAIA 2C7BA 5CAEB 4IIJF 2YC4A 2CXQA 2GXUA 5EMKA 2O2GA 3HGTA 2VH9A 3ZV3A 1HOXA 1U0FA 1XQNA 2AJDA 4QOSA 5AM3A 2BEVB 3KK0A 4Q1PA 4M0CA 1I1NA 3GT7A 4QXBA 3U4HA 1AOXA 2COEA 5DK4A 1UADA 3GM8A 5L9VA 4ZTBA 3MJDA 4HFRA 2RS32 5KKNB 2VZPA 2PMCA 1E5RA 3TCKA 3H8RA 1CZHA 3PC8A 3MMPA 4XYMA 5KAMA 3GFBA 4KJZA 4N1AA 1SK9A 1EV12 3ZWQA 4CLRA 1NY6A 5FPLA 4ZPJA 3DFKA 1CZLA 3DBIA 4D7TA 3DAPA 1OV4A 1Y8QB 3U6KA 1Z3IX 3OWOA 4IL7A 4FR2A 4CQLB 1MQTA 2JB9A 1KEEB 3F6BX 5CDUA 1HPLA 5LZ2A 2W6JA 1TZCA 2HWE1 5KYUA 1Y5IA 4HPKB 1SBYA 3IJRA 4PLGA 2DVMA 4EROA 3ZY3A 5GWXA 5DEIA 4PGMA 4MRRA 2QLBA 4HP8A 4ZZ0A 4FCWA 3OGVA 5FOTA 1PIWA 5K6AC 1UPCA 3AP3A 1N6PA 1SVOA 4I3FA 3BJEA 2JXAA 4EGJA 4L16A 4AK9A 4EGSA 1Q22A 2VTFA 2FPPA 2JA2A 1EG7A 1YGPA 2CFOA 2JB8A 4DMIA 4UFHA 4D3SA 4JP5A 5EWJB 4N76A 4HD8A 2PL5A 2GILA 5C9ZA 3WL3A 1ZOIA 3DSRA 2J0QA 1VGRA 4KL8S 1XQWA 1I33A 3N86A 1PX2A 5I0RA 5LQAA 4LC9A 1I5RA 4EGFA 3JD71 1VLNA 4O9GA 5DABA 4QTXA 1G8YA 4XASA 5L3ZA 1NRJB 2GVDC 4N54A 5LOVA 3MCVA 1R6BX 4U7WA 4MWSA 3V1YA 3BQMB 3K3NA 5BPHA 2FZVA 2E7ZA 5AW4A 1XG5A 4LO5B 5KYYB 1P73A 1RQNA 1MVLA 2HJRA 3ZYRA 4R9DA 4D80A 5K3BA 3ACDA 4O4HF 4WUVA 5FUMA 1Q7TA 1JZ8A 3EY9A 4HNGA 4AKGA 3SYKA 4XJZA 2XYPA 5CNJA 4PXSA 1UYYA 3HJCA 4TTIA 3I3BA 1QFZA 3PUHA 2O6HA 4CJXA 2KMLA 4V1CI 5KSZA 1QV9A 2AFHE 3L8MA 4Q4HB 3TXXA 3DBVO 3KOMA 4G1MB 5BQFA 3QMMA 5FL7A 2V3VA 5L7WA 1Z4QA 4LK7A 1VP9A 2QQ0A 1OLSA 3IWZA 4E30A 5IEJA 1RLOA 4IO1A 1KS9A 2J9YB 1VKHA 2AX4A 2WKWA 4I3PA 1KK2A 1O5TA 3ZMNA 4ALJA 4ZVKA 2IF0A 3RRZA 2BGCA 5IK7A 3DLAA 3AF6A 2II6A 1HRI1 2RHTA 4UM9D 3UB2A 1G41A 4KXLA 1JTVA 2W2XA 3Q3GE 3MFYA 3U37A 1L4NA 5DN6D 1JFFB 4FEAA 3KJQA 4PAWA 5G3YA 3GUVA 2HAEA 4YW3A 3WISA 3O3CA 1N7IA 4Z82A 4FOQA 3JQ8A 2HBYA 2Q27A 1HQLA 2Q0HA 3BM5A 4FTEA 4B1MA 2KLBA 5IFPA 1P5HA 2WZR1 2AOTB 4OM7A 1JHXA 1USWA 2C24A 1P3DA 3POIA 2F6BA 4MYTA 3U39A 4D94A 4REOA 2NMVA 2R1VB 4OQPA 2WNIA 5AYVA 3UAZA 4NBWA 3T30A 4CM8B 5JDBA 2QRKA 1SUPA 1SVKA 3T3HA 3DPUA 1KZ4A 3ZHXA 1JR3A 1AV7A 3P2MA 3VNSA 3X1YA 4A1FA 3P2EA 4C14A 2GC3A 3ANTA 4P00B 3DB1A 3HN3A 2GGSA 1Y3IA 3AQ4A 3E22A 4XI9A 4UNIA 1HZJA 3IDAA 3CUVA 4B7EA 4MX3A 1KMIY 2VNVA 3PHJA 2IXAA 5DNWA 1T2UA 3PUJA 1DZTA 2BFMA 1X94A 5F3RA 3B8HA 3LD9A 4OZOA 2Q1MA 3HBLA 5IVCA 4YWJA 4XLZA 5HIIA 4P83A 2FPLA 2QAIA 1UN1A 2ZWVA 4CL0A 4IDNA 5KHOC 2J5RA 5C0OE 2NUTB 4KE8A 3ROFA 1KZ9A 5IJ9B 1PIV2 1A5SB 3ZK7A 3MI8A 1FBTA 1K7CA 1EDDA 6REQB 1OWOA 5E88A 5AC91 3OQIA 4JKYA 2NQ8A 1V8ZA 4G85A 1R6XA 4RLSA 4JRLA 4N5MA 1UZMA 2WE7A 4DIOA 1U0OC 4M54A 2PTGA 1ATZA 5MN6A 5GADl 4RVCA 4MHTA 3G82C 4RGYA 2BMEA 3VH1A 2V96A 4RTQA 4R8RA 1NURA 1BRMA 4FFBA 2W52A 1Z7WA 1YF3A 2JF0A 1IY8A 4MMXB 3AZWA 5KWSA 1Z82A 4EUKA 1TI7A 4ZT3A 3KV9A 1J1LA 2RAPA 2C1EA 2HA5A 3QYPA 2WJ4A 4LJ5A 4ZVLA 1KOFA 4ZRDA 3UWDA 1UIJA 1KZGB 1K7YA 1AR82 4MDFA 4DLYA 5I7RA 5KVAA 2VHVA 3NHAA 3REGA 1EVKA 2BI7A 4GAEA 3RPQA 5FQNA 1IVSA 3UT0A 1ZOPA 4ARSA 2D6KA 1I24A 3QVJA 3RPEA 5A3VA 3Q6IA 4LTMA 4QT4A 3IKWA 2VZ0A 4YJ3A 3EQ7A 4AJOA 1CAVB 2X41A 1QIDA 4I46A 4A8JA 1HDZA 4FMPA 3DHEA 1EPZA 1E5SA 4FPJA 4KG8A 3W2GA 3GYDA 3OCUA 1NAEA 4MYUA 2HK8A 1UJBA 1VBE1 3P1JA 1U02A 3M1YA 1RZ3A 2C61A 4FFLA 3ETDA 1NATA 2RHLA 4URVR 4CEWB 4FQZA 3FMIA 3VPAA 1VLHA 4JI0B 2CYBA 3MXTA 2FZKA 5AM0A 1YVRA 2PQSA 2WA2A 4M3CB 5FUYA 1T36A 1LGNA 1MJFA 2CLEB 3CRVA 1E2GA 3PITA 2LTAA 1AGRA 1PYGA 3EZNA 3R9WA 1FQKA 4GMXA 1OILA 3WK8A 3LO8A 5LXTB 3FUOA 3NNNA 5KTYA 4QXKA 1NI4B 1FDRA 3HFRA 3JQBC 4O7XA 1XSRA 3VDMA 3IAM6 2BR4A 5HUJA 4Z8XA 2PBLA 5I01A 4O59O 4P3XA 4EW1A 4GUDA 3OE7A 4HETA 2VNGA 1RWKA 4EY6A 3Q1LA 4AM8A 1V8OA 3ZZ0A 3JBG2 4C6TB 2UZ4A 4LZPA 5C1BA 1TD1A 4BJHB 2VDJA 1CVLA 4KWKA 5TMEA 2OWDA 1M34A 3TLBA 3V33A 2X15A 5FY8A 1FYUA 3LT2A 2I74A 5AICA 1K86A 2B7CA 2ZB4A 3P2OA 3OT1A 3I9JA 3FPLA 4DV5B 4RENA 1HXS1 3T4PA 3I9V1 1RPJA 1U0SY 3RJZA 2HO4A 3MG9A 2ZEWA 4LXGA 2R043 3C39A 3BD8A 5F5NA 3WGKA 3MERA 2N47A 2WKRA 4TS3A 4OUKX 3NXKA 5EN4A 4U8GA 5L73A 3L0PA 1HIXA 3VPBA 2VJMB 1PJTA 3Q12A 5I9BA 3EFBA 2ET1A 2C4MA 1MKYA 2Q2OA 3KB6A 4QO7A 3R8CA 2IIBA 2VJLA 5I91A 2B8WA 4FGLA 1AU9A 2XVKA 5G0WA 3M3OA 3OLVA 2D98A 3UUGA 2QTNA 1Z2DA 3B5EA 1R15A 1WCV1 2BSXA 1WAMA 1OA1A 4EI9A 2EWMA 3MUNA 5ALFA 4DMKA 1M2VA 4B31A 3ND8A 1ZM4A 4NRPA 3P9KA 4OQEA 2GYWA 4R9RA 5FMCA 2QNKA 4BWFB 2ZCUA 5K9YA 2EZUA 4MSUA 3RU2A 1G6HA 4DAEA 2MR6A 1E5IA 2IUWA 4AGVA 3VBUB 5AKKA 2ONZA 4Y6OA 3WNLA 3ER8A 1L5SA 1C3OB 1G63A 1HG1A 5KMGA 3OGRA 2H4HA 2V59A 3ES1A 4KBYA 1WOMA 5CGZA 4WD3A 2IY7A 1V2GA 2B1QA 1WO8A 3KCNA 1ZRHA 2VZSA 3Q41A 3M89A 4I5EA 2B4KA 4MYRA 3GJ3A 2ST1A 4MSVA 4QX6A 3BSSA 1LRJA 1QJFA 5JSZB 4ITVA 3H04A 5J43A 3AR8A 2GEFA 1W49A 4XIFA 4R69A 2D4AA 2VJPA 4LT5A 5A3MA 5CVDA 4Z4GA 2NQYA 2VRWA 1LLDA 2B7LA 5KX5F 2NN3C 4PLCA 4DC1A 2GC2A 4PLTA 1IL0A 4URXR 4LV6A 3JBG3 4ATEA 4MLPA 1IIBA 5FBWB 5T3NA 4XLLA 3UJ8A 4URTA 4HKTA 4JKLA 1T91A 3W79A 5KBFA 1OW3B 4LC1A 2IEAA 4CDXA 4B3BA 3KE9A 5LMZA 4NDZA 4DGQA 5BR7A 3GCXA 4B2PA 1V35A 1O3RA 1AKYA 2SBAA 2CB9A 4HWOA 4N7RA 2HLEA 1UFRA 3KM0A 4FZRA 1AHNA 1BDBA 1YR1A 1K5MC 1E1RA 3NOOA 4AMBA 4KXVA 3Q3VA 2HNKA 5FYCA 2OBLA 4MWCA 4L9BA 2VQ3A 3WGTA 1DKMA 2JS7A 3MTJA 1FOD3 4TQAA 4E1AA 1RAEA 4QPGB 3O7MA 1YVPA 4LLFA 2BOIA 3ENKA 4MAMA 1V8PA 3L1HA 2QLNA 2FP3A 2GM4A 5BURA 1QO0D 3NFYA 3IIIA 4R1QA 1FOEB 4RACA 3ZDVA 4NABA 1JDJA 3H11B 3IVXA 3DAFA 5CB0A 4LHYA 1N5JA 1GG8A 1Q3HA 1JTEA 4JBHA 1ENOA 1UWWA 1IQRA 1I7PA 2J0EA 2A9OA 1VMJA 3O1VA 2FE4A 1N1VA 4RHV3 3EUAA 3PRKE 5G05L 3C7TA 3OYWB 1DQRA 1VJ0A 3H1GA 4HYYA 4OJNA 3DJFA 4GWLA 1QRUA 1PV1A 4EKEA 4YQEA 2XCOA 2FPKA 2OD2A 1GPNA 5ICEA 1S55A 3TN92 2AEJA 4M0MA 2P78A 3W21A 1XX6A 4PLFA 4NK4A 5H81A 1EJBA 1ULOA 1CUJA 2HUNA 2JCVA 3OPQA 1RUNA 2ZRIA 3GNQA 3FI0A 3RSFA 3P32A 1X8MA 4FN5A 4DLAA 4RETA 3HG7A 4DV1B 2C58A 3JCIA 3BH6A 2WF5A 5LEKA 2Z83A 3BFXA 4HVOA 1VOTA 5IFKA 2EKBA 4E7OA 2FF7A 2W98A 5KTMA 3RABA 3EWAA 3RUDA 1B8PA 1XKXA 3T4EA 4X0EA 3K5WA 1GLNA 1W36B 5ABJB 1GA6A 2VAMA 2N7GA 1ZNXA 4C4XA 1EXNA 1EGQA 1TT5B 4AFDA 2E4ZA 2G5CA 4YGXB 2WWSA 3TSOA 3B6ZA 1P31A 3M4ZA 3H87A 4E9KA 2CL2A 3OETA 3LC7O 2VKTA 3TJMA 1YQWA 2OP1A 2RMU2 2XCQA 4AIRA 3HWJA 2OCYC 3SLRA 3CW8X 3VR4H 4Z5XA 4CM9A 3AONB 3K1AA 1PYOA 1OC2A 5DX0A 3QWBA 4BE4A 3M2MA 2RS13 3U4DA 2YY1A 2C2MA 4Q9JA 1XTJA 4HKWA 4DPNA 1D4FA 3U4QB 5LOVF 2VLIA 5FXMA 2QZJA 3IQGX 1OTHA 1G2OA 3E5HA 3ITKA 2BBWA 4NZ9A 4F6RB 2ZKIA 3HCFA 2Y0CA 2GH8A 3ZJVA 4HC4A 2P0YA 4CU6A 2XTZA 1PJAA 2JGEA 4AP6A 1KJ8A 1TDJA 1WMAA 3NPMA 3IPRA 3ZNPA 1X1BA 2PJUA 4CCNA 3AY3A 2CL0X 1GG9A 3L2YA 4IGPA 2W2LA 4JJZA 1JBKA 4D9JA 4P53A 1HE5A 3G1UA 4WZAE 3QEAZ 3TM4A 2XVXA 2JFBA 4J1TA 3SVLA 5CG1A 3ZE6A 4QRHA 1JOPA 2IY8A 2ILMA 4E5SA 4AGGA 4DDTA 1WDWB 3KHUA 3VR4A 1YWKA 1W73A 1GL9B 5DV9A 4C2AA 2NXJA 1HBJA 3POSA 4MRMB 2PTMA 4UFMA 1OF3A 5DM2A 1EFTA 1PFGA 3NC0C 4L9SA 4KX3A 3R9IA 4KE9A 4IE5A 2FWPA 3JR7A 3UG6A 1FMD1 3GCDA 4LJHA 1DDLA 3FLBA 4J91A 3ORHA 3OVMA 1BU8A 1RWOA 3L0ZA 1DCKA 1TW2A 1SBZA 5CNAA 4RH0A 1P4GA 2HK9A 4MEBA 1ZVKA 1H8HD 5B64A 4QYTA 2FHSA 3PDWA 3RTAA 5CPFA 3ZOZA 2R6QA 2JATA 4Q6WA 1ISRA 3BAFA 1AH2A 2W90A 5AVSA 3G9UA 3H2HA 1QYCA 2XWBF 2IH4A 5KC6A 2ZB8A 3IBCA 5EQTA 4I4CA 4H7PA 2W4QA 1WG8A 3LOUA 3PXDA 1OROA 4TUYF 5BPXA 1NDUA 1T1EA 1QGED 3NUGA 5T4BA 5FZOA 3AUXA 1HYEA 1E7WA 2YCBA 5J58A 5IJRA 2IE8A 2D6MA 2PX0A 1XJAA 1V43A 4LAFA 1GQQA 4BLPA 3I7DA 1K63A 3H11A 4I5IA 5CBKA 5CDHA 1CE8B 2Z42A 3P7MA 3ZIUA 4BB3A 3OH8A 2D0OB 4WM8B 4PY2A 1V16A 2QL7A 4BBPA 2QPOA 4M0HA 1D9ZA 5FP4A 4C2BA 2PT7A 1Q56A 3ZOIA 5FBKA 1VA4A 1QJCA 1U5CA 4PYOA 3GJBA 2XCTB 1SBQA 1CF9A 3NAZA 5F4BA 1XZCA 4JODA 2PV7A 1RM5A 4HJRA 4R1NA 5AKXA 5AKGA 1QUEA 1LBEA 2BFUL 1E9SA 4MAAA 4IMRA 1U99A 4JX9A 3LH5A 4CUKA 4Y20B 1IN5A 1D0GA 1GTSA 5IVPA 2P6NA 4PQYA 4LZAA 4BNDA 5TQJA 4E13A 5DNYB 2R061 3VHPA 1K8YB 4E2YA 1DZRA 1PMIA 3IE2A 3B7MA 2WSIA 5FT9A 3WCRA 2DU0A 4IQPA 1E1QD 5JAZA 3K9QO 3R0RA 3N7UA 4KSBA 2WUEA 4LG1A 1T1RA 4OHUA 2GK6A 3NBZC 4W6ZA 3VDDA 4S2DA 4NIAA 1E1NA 2NO7A 1L7QA 4M0PA 3TSCA 2RHJA 2D3RA 3BYZA 3ES4A 1R4MB 4XBNA 1QE5A 2JCYA 3IEVA 4NROA 1NR5A 4UBGA 1TECE 2JVKA 4OKNA 5JH7B 2D6FA 5EOVA 3UGJA 2ZB7A 1AKQA 2GD2A 1D5WA 2VWQA 4QULA 2X9NA 2JCGA 5EGSA 2CNBA 2IXGA 1UKRA 2I2SA 1THMA 2IDMA 1GU0A 4M9UA 5JBQA 4OHOA 3LLCA 2XCSB 2XMQA 4LZJA 1SHWB 3H6KA 2AR7A 1IU9A 4V0NA 1YAJA 2JGIA 3TAUA 2O3UA 2X0FA 3UXMA 3R6SA 2JEOA 3GLGB 3ZGNA 3MIBA 1N2CA 5L4SA 1I8TA 2GARA 3UHPA 2WUWE 1W6PB 4GUAA 3N4MA 1ECGA 5PGMA 5EXDA 1I4OA 4HXEB 1NYTA 1XVAA 3PWZA 1DDIA 1V3VA 3Q7IA 4UU8A 1GV0A 3EYWA 4QQHA 1YXMA 3F97A 2CLFB 4EWAA 4CEJB 3ONDA 4K05A 4TLMB 3E2PA 3FUVA 1POV1 3FROA 3ZBPA 3L77A 3Q3HA 5ALJA 4KFUA 3KBOA 1KXJA 2EXJA 1NXMA 3OGSA 1A95A 1E2DA 3BE4A 3T5BA 3ZHTA 2F1IA 2IZ5A 5GZCA 4WKOA 3CWZA 1BGXT 2E18A 2BKLA 1XN4A 4PEVA 4BLSA 4X8LA 3B20A 1GCAA 2H2FA 5L40A 3MGGA 2H57A 2Y68A 5EWJA 1JLLB 3FPEA 3T1HB 4WY2A 1VE0A 1QFXA 3BXXA 1G4UR 5L53A 4OGLA 1BU5A 1RQ2A 5IKOA 1UBTS 2KPOA 3NDBB 2OENG 3IHLA 1OLOA 4TVKA 3LCVB 4R41A 3BTOA 4QX7A 1J07A 4DCMA 5ETJA 3SYTA 4PTZA 1DEOA 4INAA 2O8DB 4PNHA 2XV1A 1U63A 1KWKA 3RVSA 4UNRA 2ZLBA 4NFHA 5FBLB 3D2BA 2V0CA 1VBD1 4LY9A 2G36A 3RIMA 3KUUA 4QZVA 1VCNA 3W1VA 2F2TA 4AN4A 2MSNA 2DWUA 5TIIA 1A8DA 1JZSA 2VTEA 3DMYA 3R24A 1Q7GA 3AYXB 1FP4A 1JXMA 4Y9DA 3VYRB 1KS4A 1KZ6A 1MDBA 3UMYA 4YVFA 1IK4A 2FUG1 3OFND 4I19A 3LT0A 5ALTA 5E0OA 4Q0SA 4HPKA 5EZWA 3NT2A 4FXPA 1TADA 3F2IA 2E7TA 1XIVA 2H4YA 2H5IA 1NW5A 4PYQA 4JXKA 2HR1A 2VP0A 1P2DA 4XUTA 4PONA 1XCLA 5FI0B 4Z2YA 3QBTA 3K0AA 4TYSA 1UK7A 3TOCA 1XE7A 2WTNA 4CEYB 1YYNA 3UW3A 3K0SA 3RWMB 1S7CA 3E6CC 4KE6A 2OT3B 2UUOA 5IARA 4A5OA 5EVJA 4A26A 1X7YB 2DKFA 3AB7A 1SELA 4MVJF 4BNHA 1MG0A 5HFAA 2NZJA 1JMKC 4WESA 1DBWA 2D7JA 4P35A 2XCUA 3CLTC 1MQTB 1C4RA 3VL9A 2Z9DA 3CKHA 2HX1A 5BWBA 1E1CB 4A73A 5K0FA 1THTA 1W87A 1YE3A 1Z88A 4MMZB 1RGSA 3FUWA 1PJ3A 3OZGA 1XP8A 3GLSA 1W0PA 3E9RA 4U39A 4X63A 2VSYA 2QQGA 1HA3A 4LF8B 1GZ5A 1DGRA 1YTLA 1Z0HA 1PR4A 3KSCA 3V0AA 5KI6A 1N75A 2R7LA 2HF2A 3NB0A 4NBVA 5DYWA 2SCUB 2BMWA 4TV9A 3FMGA 4D0SA 4KITB 1FFWA 3D0RA 5FWXB 3QLUA 3TNFA 1F9KA 5ACA1 3IQIX 3U31A 1JJFA 2PZBA 1E63A 4CXWA 5T5LA 2AUMA 4RQTA 2P3OA 1QMJA 1G8WA 1QJU2 3LDKA 4DRXA 1Y63A 3HXPA 2V4AA 3OPXA 4I6EA 3IX7A 5C6CA 1RUC1 3FSJX 3I9LA 5KWIA 5JFOA 5JZOA 4DUZB 2VO1A 5ALSA 5BNTA 5G41A 3V4PB 4ER5A 2WF7A 3M7IA 4Z2WA 3PFKA 3W4JA 4Y6PA 2BJWA 4F4HA 3JZAA 2VPZA 5IDQA 4WT7A 1VHQA 3S40A 4MW5A 1VJDA 3U5TA 4FOYA 4QU8A 1XB2A 3Q2OA 5E6SB 5IZ4A 1DKNA 4XIIA 1NXWA 4DA0A 2QRHA 4Z4FA 5HFJA 2QE7A 3EDRA 4WJKB 4LBQB 4R71A 5MFZA 4B8WA 5FA8A 1UF2C 3ODGA 4WOPA 3WA7A 4A15A 3FCSB 1OC4A 1DAPA 2J6BA 5H7XA 5I3ZA 1OXVA 3TGPA 3UJAA 2UYBA 3H9QA 3OM8A 2ZSEA 4GI5A 1KRWA 1WULS 3C2UA 5T57A 3GMDA 5DGTA 1ARZA 1X3LA 4YQZA 3I1JA 1B2RA 4MGHA 3O90A 1NA1B 4UXAA 2EAUA 5IJXA 2R4UA 3MGCA 1BIFA 2XVLA 3HJRA 3I3OA 1TME2 2X8LA 2LTNA 4IINA 4OGGA 1IEWA 3VNBA 4E14A 3UMGA 2FX2A 5ERGB 2PX8A 2Y3IA 3TB6A 4YMHA 3WWPA 5GJ6A 2O5RA 4Y1RA 5THXA 1XJ0A 5FL3A 4MROA 1Z78A 3BCRA 3WG3A 5SICE 3W0LB 2FZEA 5A5GA 1IONA 4RJLA 1HJFA 1WMXA 1DT3A 1QONA 1WS6A 3VC7A 2ARAA 3FZYA 2H4ZA 2AGVA 1U1DA 1Z07A 3G17A 5TR9A 2LXNA 4LE3A 3I45A 4HLTA 3IE0A 4IVPA 3W7BA 3PEEA 5DHUA 3GDBA 4LNUB 3H3LA 2A75A 1SBTA 2MMCA 2VEDA 4R9VA 1E92A 3ZXJA 1DMSA 4KXWA 3MW3A 4JBWA 2O9JA 4V38A 4AR2A 1MDFA 1Z16A 4XYXA 2Q21A 3JQGA 1US2A 2GHIA 1BCRB 3ZE2B 4O02B 2Q4OA 1RRCA 3Q3CA 1Y3DE 3MK31 1AZDA 1JQDA 2X5NA 1H23A 2O8BA 2VNKA 1O9HA 3B5JA 2EW8A 2NU8B 5BNOC 4BO9A 2A0XA 2Z5VA 1MD9A 4DRYA 1PX4A 2RHCA 3J80A 3RF7A 4G37A 3CL1A 1KZ1A 2PZ8A 3TN91 4XQWA 1YI0A 4EDFA 1DQ4A 1GKLA 1K7EB 4ADSG 2MEV2 3AEKA 4X41A 1H4SA 4DQXA 3K46A 4HQNA 3OBAA 4W4ZA 2FQYA 4FXOA 4JNKA 4EYOA 3D4BA 4N40A 3JQ7B 5KNDH 3QF4A 5IM4F 3WBBA 4WBNF 4PCLA 1YCHA 3JALB 3KT3A 2PKQO 2ACWA 1UU6A 4B3XA 2OOSA 4GL2A 1RMU3 3T1OA 3AINA 4GSKA 3HCWA 4PXAA 1DO8A 4YXWD 4EVIA 5FCDA 1K3FA 4Q48A 4N5DA 2PMDA 3FFQA 1NP6A 2LM3A 3IQXA 5H3CA 4TM7A 3L4JA 2FPOA 2N1BA 1EUUA 1OD6A 4FS8A 1Z3CA 5DNUA 3I49A 3EXFB 1CAVA 3IHWA 3R4UA 1A88A 4TVSA 2EIBA 1B0AA 4XH9B 4IQ0A 5K2MA 4MUVA 2F8SA 5FULA 4NFYA 3G2LA 1EESA 3MRTA 5D8AB 2B3TA 3T08A 1OC1A 4I3HA 1E1RD 1PZ9A 1H2LA 1V1MB 1FNCA 1W8IA 3T1VA 4Q21A 1QWSA 3S57A 3JVUA 4OG2A 2P2SA 2UU8A 3UUFA 3PUYA 3EZGA 1HH4A 5JFTA 1J58A 1Y5RA 4AUEA 1H2HA 3OWHA 5ADUS 4CNBA 1LV7A 4IG9A 5F76A 2AVDA 4CUBA 3IO5A 3THWA 3VU0A 1BEZA 4NAUA 2BFUS 1RWQA 1ADJA 1I14A 2DUUA 4M1KA 1V1RB 1YJQA 3AB3A 3SFVA 4HAWA 2BDRA 3EF1A 3NNLA 3RFUA 4KK4A 3RVMA 4H6XA 3S8MA 2RGNA 2JLZA 5I0SA 2JH3A 3NIDB 3NJZA 4PFSA 2H1OA 3IMNA 1QOZA 2WVGA 4JGIA 3AFGA 1X6VA 1L4MA 1X7YA 1W6MB 2C97A 1QS0B 2OV4A 1O94A 5DCWA 4B83A 2OZ6A 2FR8C 4MGIE 5CNIA 3JVVA 1F8FA 2Q6VA 2GO7A 4FK8A 5K0SA 4JLNA 2JE8A 4HDKB 1CY0A 1JS1X 4YRNA 3KOUA 4E4RA 2FMIA 1RVV1 2YICA 4B3NA 1D5CA 3E9NA 1AE1A 5JNSA 2NACA 1I7QB 2LDXA 4PBTA 2A59A 1Y42X 5IK4A 1OZGA 3A2NA 3BTVA 2XONA 1R083 3CZAA 3D3WB 5K4LA 2ZX4A 5K20A 4ROTA 3RAEC 2Z4FA 4G1UC 3POYA 5JRJA 3T4HB 4XYEA 3RRXA 4DUGA 4FB4A 1L7OA 1KFJB 3S1LA 2ETXA 1UIMA 1MPXA 2YBEA 5JSHA 1EZ1A 1RVF3 1JZ4A 3EBOA 3TKAA 3ESZA 1CVNA 3DGEC 2NTNA 3PR1A 2XZDA 3JQAD 5DPNA 2ZITA 3FTCA 2W0XA 4EEXA 1JIQA 4ZVUA 2H2WA 3S27A 1ESDA 2DFCA 2A4MA 2XA2A 2PKRA 3SLKA 1TM2A 2RJNA 4HXFB 3NAPC 2NU7A 3KQVA 2Q5CA 1MORA 2GT1A 4ME6A 1O4VA 4G5GA 4TWRA 2X42A 4PCRA 1M7HA 1QQP1 2WIDA 2XBO2 2X1MA 1E2JA 2Y1DA 1CZKA 4UEOA 3SYRA 2J87A 5KTTA 2X2FA 3F47A 1AK2A 4R54A 1ZSNA 4DBZA 2JFQA 4YAJA 4GWJA 4M55A 3I8XA 4TLLB 1VE1A 5L3RA 3BIOA 4PSDA 2ZX3A 2EFEB 4PZ9A 3I64A 3WF0A 4HOOA 2YGLA 4WZZA 4LNVA 2R0QC 3ILFA 3TJRA 3WBFA 1Y9GA 1YONA 1DKRA 2W4MA 2KQUA 1E2IA 1DXQA 3AGPA 4PO1A 4LXYA 1GILA 4DZGA 2IUYA 2GAAA 3VBHB 3MO4A 4DPKA 1KAMA 3JASB 3N2KB 2Y0OA 3L0OA 1CUAA 4I7EA 5EKTA 1YBHA 4C04A 3J81k 4E8CA 3KKKA 2ZSKA 2X2OA 1PGPA 4ARYA 4ABTA 2BGUA 1WCUA 3VDRA 4NWIA 4HVRA 2QXYA 16PKA 4JDOA 1CFJA 3E9QA 2KXLA 3LZ6A 1LEDA 2FW8A 3F98A 3L7JA 3RREA 2HWUA 4B7UA 3IDEA 1AR62 2PUFA 4MPTA 1UL1X 1V8DA 4PT6A 3W2HA 5EJ4A 1CERA 5JCJD 4A4DA 1LF5A 1R6UA 1BHQ1 2CXSA 3TL3A 1Y8RA 2WQ4A 4DLLA 4O8ZA 4FOOA 5LZ4A 2XUMA 4AL4A 3K6RA 3VOSA 4O4JA 4B6GA 2X1VA 4OFWA 5I7UA 5TVGA 1J5XA 5HF8A 4KWUA 1RE0A 3D54D 1VG0B 2ZG6A 1CUCA 2I0FA 3C5HA 2LIVA 2XUQA 3Q2IA 3GFGA 4BFWA 3IZOA 1PEYA 5EHNA 4JLWA 3LOIA 4YMUA 1KF0A 1G8JA 1N77A 1KYIA 4GX0A 1MVEA 4GR4A 1KITA 1UOEA 5H02A 3B93A 3JU9A 1OV6A 4MVTA 5LFAA 1ESMA 4HMOA 2EICA 1VBA2 2PHFA 1FFXB 1QHXA 3ECQA 4P9XA 1YJBA 3CH6A 1N25A 5KOIA 4YVWA 3WBJA 2YS6A 1WVGA 3GFRA 1KSJA 2QTCA 2ZJ6A 2I3ZA 1Y9JA 1YDMA 4WFQA 3P26A 3ZI7A 1FF9A 1EFKA 1JSZA 1LGCA 3A23A 1UBRS 2VJNA 1KFUL 3BB4A 5C7GA 3NDIA 2GKGA 3AIOA 1ISFA 3LKDA 4RFSB 4X64B 1P2SA 1KI7A 4B3MB 3GD5A 2NX2A 1BQPA 3CBNA 5K3DA 1NBWB 3WGVA 4BB5A 1J0AA 4IW3B 4KAFA 3BFPA 4W1QA 5LBBA 1XA0A 1U11A 1ZH4A 4FMCF 2W39A 4U7HA 3Q98A 4GPZA 1EDBA 1MX5A 2DT8A 1NDQA 2JD2A 2A3YA 2W68A 4ZDIA 1R8YA 2Z57A 4QWMA 2BV3A 1S02A 3H86A 1XLTA 1RLTA 1J09A 3NAMA 3R5FA 1XTZA 4CMCA 4LJ8A 2Q8OA 4TKUA 3NGLA 3VI4B 3H2YA 1O54A 5JC1A 3VBOC 2BKVA 5LWQA 1SXJA 2XB2A 1Q15A 4BNGA 5FKJA 3ZDAA 3ICWA 3UNXA 4BQOA 4GE0A 1JLRA 1GZSA 3LKZA 2O50A 4C03A 4POAA 1AUXA 3FRHA 4GI2A 5B2ZA 3M6UA 4YQYA 4ROSA 3TVDA 3ESDA 4YBZA 3MBWA 1A8IA 4FHFA 1TMKA 3W6OA 3L2HA 1G16A 1M1ZA 2BE9A 1ZK1A 3OEHA 1P91A 4F2WA 3EF0A 2YY6A 1XLWA 4TV8B 3F7TA 4JBIA 2FQPA 3O95A 3PEVA 5FOUA 2C5LA 5JS6A 3OUHA 3V42A 3PNQA 3WI7A 3JATA 1TL7C 1JKJA 4DLKA 1G21A 2UZIR 2CC2A 4JQZA 1FLNA 2C8JA 3ZLIA 4NFLA 3T1QA 4GBMA 2J9FA 3KWJA 3CNOA 3IDFA 3Q9SA 4KGDA 1QFYA 1PSDA 1PL0A 4BQQA 2ZK7A 4MPJA 1BFUA 2V5VA 3VPCA 4RHFA 2B69A 1W2HA 4LDNA 3DDSA 3C8XA 4MGYR 3AEYA 1MH9A 2Q0QA 4HLQB 1DQ0A 4WM7C 1KYQA 1X1SA 2VAPA 4CV1A 1T2FA 1ZVVA 2SHKA 5CRIA 4NE2A 4EIWA 4B7AA 4B8EA 3UFXB 4RTSA 4J2OA 3ZGZA 5BN3B 1XD8A 6PFKA 3PVZA 3WKBA 4PLYA 3A9VA 2P35A 2AZ4A 1OOPB 4HATA 1GSAA 3UKJA 1Y6FA 2QUKA 3QLVC 4OQ4A 5IASA 3C3YA 3PGXA 1DC6A 4J0QA 1FFSA 4PPYA 4HOYA 2BPA2 1RBQA 1GGKA 2DYKA 3CV3A 1N3BA 5DGIA 5FBZA 1CFZA 2CHFA 1E5TA 2JIQA 4GXQA 4K6CA 2RGEA 1OE0A 5EJ5A 2V5AA 2JPDA 4REMA 3I1FA 4PINA 3QKWA 3WDSA 3S28A 8OHMA 3CJIC 5IVEA 5IX8A 2FZ2A 2W6NA 4MARA 4MRVA 1GR1A 1CF4A 4BVEA 3LX8A 3J7NA 4PLVA 2B9UA 4R3WA 4LVOA 4ARAA 2H2AA 4X3OA 4EITA 4QDTA 2PJDA 1ZH6A 2GOYA 4UZSA 2XQJA 4IIHA 4JBLA 4OAOA 1MZFA 1C0PA 2JGMA 4S3MA 1AX0A 1KDOA 1OVMA 1UM9A 4H0FA 4JZKA 4ESEA 1DHTA 3KJNA 1N2OA 4US2R 3IOEA 3GWGA 3O38A 5HCIA 2X09A 1T34A 3S0JA 1V6JA 1IJKA 4RPCA 4CQMA 1EV13 1PLKA 3OPVA 2Q4DA 3C45A 5LZ5A 1F8UA 2AG1A 4YRMA 2GJKA 4G5HA 4ESOA 2BT4A 2NSHA 5DH9A 1MB2A 1L0BA 4JFAA 5P21A 4BNIA 4AZWA 4F11A 2B1IA 2WQ6A 1UINA 4MHSA 1E9EA 4GPBA 4XSHA 3ORSA 1RYFA 4OREX 3IFSA 4PBSA 5CH3A 2QN7A 5LYYA 1F2TA 4BXOA 2G80A 2O1XA 4M1ZA 3BRSA 4JCCA 3QMPA 1RQPA 1LCIA 2IYLD 3BSYA 2WNVC 4WESB 3U62A 3IBFA 3DT6A 4KNVA 5ILQA 1BROA 1LPSA 1OSNA 3IUEA 4RTJA 5IK2D 1RAAA 4K86A 1EDZA 4PX2A 4CFZA 2OUHA 2OVUA 4HX5A 3A4MA 3GBSA 4BHTA 3O8OB 3I23A 4R9BA 3NL1A 3CZ4A 3AEUA 3ZE0B 1OXMA 2DM6A 4DR2B 1I6WA 3R9KA 1JTFA 1JYNA 2C99A 2OHFA 2W0MA 1QZZA 2YC2C 4X7PA 4M1QA 3OE4A 3L6BA 2P77A 3AFIA 5G40A 4B0PA 1UXJA 5A2GA 1JAYA 4QIHA 5K09A 2PL9A 3DZGA 3IHKA 3KD2A 3C41J 4DC0A 3E8XA 4BFSA 4NS4A 1HYHA 1FPN2 2WA3A 1FSZA 3CVYA 1OTYA 2C9CA 1JZTA 1RLJA 4CZ2A 4XURA 2WSLA 2OT7A 4YM0A 1HT0A 1XFAA 2R62A 4AAXA 3TEMA 3OP1A 3EH1A 4F3NA 4FZ3A 2HBQA 4XF9A 4RLFA 2ZRJA 3K70D 2A0FA 3WNPA 1JWAB 1LLFA 2HZBA 2PA7A 2RG4A 3IVRA 1KDTA 1E3TA 3EAFA 1MT0A 4AG4A 4GMP0 3RQIA 4KOAA 1W05A 2XVGA 1RUF2 1TVMA 4PFQA 4RVGA 3NTQA 4IO0A 5AK5A 1V6IA 2OBFA 3MB5A 4MADA 4LF6B 5FUQA 2IPNA 3IDCB 5ALOA 4J0EA 3M3CA 5B2GB 2RJKA 1CUUA 3RYFB 2G71A 1ML4A 2BZDA 5EZYA 3B82A 1WVIA 2FDRA 4G24A 2FFHA 3EAQA 4XEZA 2W9XA 3WMEA 3C3BA 1NFQA 4H7KA 4L5BA 3TFWA 4CLOB 4IX9A 3FR8A 4BMNA 3QNWA 2HDOA 4GE3A 2A71A 1RAFA 5H8WA 3PB3A 4DLZA 1XRNA 1PJRA 3GNTA 3M4NA 2XG3A 2W2TA 3WUDA 3LYUA 2Q99A 4JAVC 3MGKA 4LIVA 5ES4B 3ZY2A 1LY1A 1JLKA 1EQAA 4ZD6A 1B42A 3AR3A 1A8SA 3L8EA 3AUFA 4QODA 3I2IA 1BE6A 3F74A 1C7JA 3L3BA 2WJ6A 4JYZA 2E31A 2J41A 4L5JA 4PHCA 3ZJTA 1FT9A 4ZXPA 2XD4A 3QOWA 1QVAA 3WNVA 4E7PA 4U3JB 5D00A 4KBGA 2ZROA 3URMA 4UTVA 4NP6A 1Q91A 3G8YA 3OB8A 2FQQA 1F12A 3VZQA 5HNKA 1VMHA 1VRH2 4NCBA 1JZ7A 1W39A 3TRHA 4L6IA 1TVGA 4G5RA 3KLPX 4DDMA 1S2NA 3TLGA 1E2HA 5M34A 2H2HA 4FE3A 1T1JA 1XDWA 1H0HA 1G3QA 1VHLA 2V5UA 4I4NA 4QMAA 2O8EA 4LZWA 4WFJA 5GJWC 1CQZA 3ZXUB 1AHHA 2OBMA 2RGUA 3A6EA 1E6LA 2PD4A 3QELA 3SZMA 3Q8EA 3WLEA 2I71A 3A9TA 2P3KA 3EEQA 4IXMA 3K8YA 4FW9A 2EL7A 4NUBA 1VC2A 4O2AA 2RE8A 1IQ0A 3NWKA 1YRLA 2XMSA 5EPUA 3AM2A 2WYHA 3COSA 1VRBA 4EE2A 4JEMA 2OBXA 4QBTA 3V64A 2DFPA 2NTJA 2RHMA 3WO0A 2RVAA 5DAWA 4RABA 5KB3A 4TYQA 1X70A 3HB0A 1SRQA 1D2CA 3NHKA 1KY3A 3VBFA 2LZ0A 3HM2A 1O3SA 4EHFA 1LKNA 3PE6A 1U94A 4BQWA 3JALA 4Z8YA 4H3KB 2FI1A 3OD0A 3H7IA 1H8VA 1ILEA 5IVIA 5C37A 2ZZNA 1K0FA 2XUZA 1RIFA 1RUE3 5IUQA 2Q5JA 2PKYX 4WACA 4HLCA 5F39A 1RYYA 2BUBA 4KLZA 4KYTA 5DT9A 3IOBA 5FUNA 1XA3A 3DDUA 4ZZ2A 5HM8A 3IUJA 2R97A 2X22A 1V6NA 2VUSA 4Y6GB 4IIJB 2VYQA 3OQPA 1G98A 3AHGA 2XDQA 2V7QD 3WW4A 1L6RA 3AF0A 3W3AD 4ZEWA 3Q2KA 1GCIA 3LWBA 4RMHA 4BX8A 1XU7A 1IMJA 2GVNA 4GB31 2QQUA 1RJFA 5IJ0B 4P80A 1NFRA 1JE0A 1G7CA 3DV9A 4N3AA 3QFFA 3QSYA 3BIEA 2V72A 1AXKA 2OBYA 3TQRA 1CY6A 3G5UA 1H9AA 3TNQA 1EK6A 3BWYA 4QJBA 3A4NA 1ZEJA 2IYQA 1JIIA 4WINA 1MB3A 4B6FA 4R2LA 4X1IB 1T6XA 4OA8A 3DLCA 3L6RA 4XETA 2BKXA 2D3WA 1BK1A 3DTNA 1P44A 1OMIA 4FKZA 3PDHA 3BTZA 2ORWA 5FOBB 2IDKA 5CA0A 1RRKA 3NNGA 4D41A 3PFFA 1SOMA 4DQDA 2H63A 4H1WA 4CWAA 4ON9A 1N0IA 4LO6B 1NULA 2HK7A 4YFWA 5IH3A 2FRDC 4EUSA 4W6YA 1BVP1 2CMGA 1ZYUA 2JANA 1HTTA 4A1OA 4RFRB 4O2BB 4ABYA 1TZJA 4FQ4A 1M1YE 5TF4A 4IJ6A 5LU8A 4MV6A 2YNMA 4GT1A 1DKLA 4DLTA 4PQGA 2ILTA 1NSTA 1E6CA 4FM9A 2JZNA 1W5TA 2HL6A 2CVPA 4G63A 2FPUA 3POGA 4GKBA 4E27A 5DMXA 2XKOA 1Z6YA 4EJMA 1J2TA 4B9EA 5EJ7A 3PC3A 4KLCA 5A70A 4KR6A 4GC5A 1XSQA 1PEDA 3HR8A 2R60A 1RMU1 3QP9A 3EFEA 3BEDA 3T0AA 1Z2AA 3P2YA 1SB9A 5I7OA 2V9PA 2OQ7A 4NNPA 4BP1A 3WLPA 1ECBA 1MOPA 1KDVA 1U1FA 1ZVJA 2XGJA 1KI6B 1PFVA 1OKKA 3QJGA 3P45A 1ENZA 4YDSA 4PS1A 4MUHA 3FIUA 3AP1A 4R4JA 3T4UA 1DYPA 1U2DA 3WWYA 1EU1A 2P6CA 4GO1A 4JJ4A 3IJPA 4Z49A 1C1DB 5ABPA 3AYDA 4OHWA 4RMNA 5B55A 1JDTA 2BHRA 3QUTA 1Q0ZA 1KL7A 4DNQA 1J9ZA 4ND7A 1H0BA 2DUPA 5C8YA 5IJWA 4DXAA 2F3TA 2GZ2A 4JJEA 3I6BA 5G0VA 4HUTA 4QHOA 4ZVQA 2IYRA 3FKSD 3ITNA 1QP4A 4TLDA 5IUKC 2IUUA 1APNA 4FTSA 1RYZA 4S12A 4LXHA 2JDZA 2IYFA 1TVKA 4DREA 4N43B 3B1XA 3IR6A 1H2FA 2O8CA 2PUHA 2H06A 3W90A 2R6HA 3AJRA 3GLHE 2BEUA 2BUKA 1ZUNB 4ISBA 1E7SA 2RDNA 4B34A 4TQ9A 2DPXA 2PMWB 2XHNA 4B5KA 2O3RA 5DAQA 1W6MA 1Q16A 3GJYA 4AJ2A 4M1OA 2JJ8A 4NRDA 3OA2A 5CFRA 2HF9A 4LF9B 4Q18A 4L9WA 1KI1A 3SQLA 3D3KA 2MMGA 3GFVA 1XTUA 3H5WA 1F7VA 1UH5A 1JN2P 4EHBA 1RHRA 2QMQA 4U3JA 1AYN2 4D46A 1OWLA 1R6TA 4WE3A 4IEEA 5JAXA 1L5LA 2H3EA 3KTAB 1MP0A 4I6JA 1HXHA 5DTRA 3UV6A 5DSTA 4EKNB 5GIPE 3D4IA 4BKMA 2VZEA 1YR2A 2QSUA 2UXCB 2OPWA 5FYDA 2HCRA 4RFLA 4XE5A 2IYAA 4G0QA 2WM3A 5HCAA 3TD6A 4K28A 4QXHA 4EUEA 3LLVA 2JBAB 2PLWA 4D9BA 3ZX7A 5DM4A 4GOJA 3JQAB 2JD1A 4R83A 2W6CX 3IQHX 4MQFA 4ZQBA 1M6VB 3M6XA 1ZY2A 1UJMA 3G2HA 4YW6A 1MJGM 3DZ8A 4UEWA 5ALMA 1WBLA 3BX1A 3GEPA 5DWQA 1Q77A 4BFYA 3OKAA 4V0SA 1R2QA 1WB5A 1GRNA 5JPCA 3OO0A 1CRLA 4COYA 1U5ZA 2RB5A 2P67A 1W5BA 2JB4A 5IUNC 5F73A 4PO9A 3WV4A 3EZXA 2EQAA 1XDZA 3KJFA 3V55A 2XQFA 4IERA 3N7JA 3ACIA 2O4UX 4ZEOA 1E6KA 2D43A 3QX3A 2YW2A 3SCFA 3BCHA 2XVYA 2D5AA 5DCUA 4WTOA 2GBCA 1KARA 1Q95A 4RE5A 1CEYA 5IYZB 5D8AA 1XYPA 2P6RA 3AUAA 1Z2OX 3MPUA 4OLBA 1SAYA 2B4QA 1Y1QA 4Y67A 3AESA 1Z35A 3DV8A 2DFDA 3A6PC 5CFPA 4W6WA 2D5CA 3DS8A 4UNQA 1MS5A 1RAHA 1FS4A 3LUCA 4N9WA 3OMWA 3JARA 5BN4B 5EJIA 2CLCX 1GMMA 4JCKA 2AQ8A 2R0FA 2Y2UA 3OQOA 1ZR2A 4CU2A 2DQKA 3W5SA 1AKNA 2Z79A 3D8RA 3R6TA 3T2OA 1II8A 4FSJA 4CCOA 3IQWA 1OGIA 1U3TA 4RBNA 2OQ6A 4HR7A 4X1IA 5D3KA 2RS12 2IYVA 3RVPA 4NKRA 4LUKA 1EFLA 1ZS9A 4CUGA 3GBFA 3CZ5A 1C1YA 2YFHA 4K81B 3IEIA 3V80A 3ZS9A 2AEEA 2IELA 5IVJA 1RP7A 3GVIA 1I2AA 4BMOB 1DLLA 1DQYA 5IJ0A 2C3YA 1PSZA 4KR7A 2K7ZA 2OECA 3PU3A 2QZ4A 4UC0A 4MV5A 1MB9A 5ED0A 3ZIWA 2QRZA 1BCRA 3AETB 4K21A 3FYUA 1UZNA 1G5HA 3G89A 4SLIA 3DYMA 4H1VA 5DYIA 4D0RA 3WIBA 4O4IF 3ASUA 821PA 2OPBA 4RGQA 1U90A 1K5HA 4P98A 4WSOA 3WGNA 5K05A 4CU8A 4CCEA 3E8SA 1QJEA 3K8ZA 1ZZGA 4CG2A 2OTCA 5BVHA 4EI7A 3UQZA 1GUDA 3LC1O 4HVCA 4HLUA 2ASVA 5A4AA 3F5SA 4M0UA 5EAIA 1WUJS 1JZ6A 2GPYA 1DS6A 4ORFA 5JAPA 2AOUB 3I8TA 1LRLA 1Y7HA 4XMAA 1ZUWA 3HKEA 4TSRA 5AI9A 1L4UA 2KX7A 5FPKA 4LN1A 3U80A 3WRVA 2P3QA 5FPXA 2C9AA 1CX4A 4D8TA 2FNAA 3I1IA 1Z2PX 4A03A 4J1WA 3EG9A 4NR0A 3CIHA 5BUVA 4AG6A 1IN4A 5EWLA 4O5AA 4BIOA 1S2BA 2N3ZA 5H5JA 4E09A 2OQ2A 3NJYA 4LW8A 2GDZA 1MO2A 4MA0A 4P33A 2ETEA 1L5WA 2JLBA 4JL6A 3N0TA 2HA3A 1HE4A 5BN3A 4OMUA 1KO7A 1XMOB 4IMJB 3TZHA 2WTMA 1UKAA 1DIWA 1SCBA 4OJMX 3D81A 3H99A 2FLVA 4HGPA 1PNFA 3VVLA 3ACFA 4QJ3A 1G20A 3NOQA 1QIMA 3TIXB 4DMUB 3LA6A 3F96A 4O0MA 4MP8A 1SIWA 1LSUA 5EINA 4Y2QA 3FNRA 3D8HA 3UK9A 2ZI6A 5IAAA 5FO8B 2CHVA 5E8AA 5K4HA 1T2AA 1GU7A 3GVHA 3OIWA 1R0LA 3IE1A 1GZDA 2WZBA 3U60B 3GXUA 2R1ZA 3SSMA 3ZTWA 2VT6A 5TE9A 1IHMA 3IA2A 3DO6A 1JR3E 3KQOA 4BJ6A 2IXTA 1W9MA 3MJ4A 1YZHA 1NN5A 1U1IA 2AFVA 2XGOA 5DYTA 2ON6A 4Y6LA 3ZI4A 3KPUA 2P5SA 4RZHA 1G1AA 3R75A 2VM9A 1ZL2A 1G5PA 2QVCA 4L3OA 4RH1A 4WM7A 3F9RA 2QD4A 1TUBA 2YJ3A 1ODMA 1ZLYA 1ZP6A 1K9SA 4N6NA 4J16C 5I51A 3C5EA 1UBCA 3DC2A 3WV6A 3P52A 2Q49A 3CG4A 1KQFA 1W0NA 1XL0A 4OQNA 4MUYA 4TV9F 1M0SA 4PWZA 4P38A 4XM1A 1M72A 4RD3A 1KSHA 3WQ0A 1SLLA 1HDGO 1OLQA 3IMEA 3OHSX 1PJ4A 221PA 2FN4A 3M6FA 1D7OA 4IJVA 4B3SB 2ODAA 3RNLA 4KQ2A 4HSJA 1YH3A 2ZJ8A 5HIKA 2XR1A 2C59A 3PNAA 2LPMA 4TXWA 4HTAA 5EC8A 3RRFA 1S8FA 2YDYA 3AXTA 3WF4A 3M5WA 3PLRA 3ZYIB 4NIDA 1QM5A 1UMHA 4BYMA 2XKAA 3TQOA 4RTRA 3GP3A 2I4LA 1M06G 2FBEA 3K9WA 3WKDA 4EB6A 2WFLB 1EIWA 3AVTA 5DTMA 3AY7A 4NU0A 1PAUA 3CF2A 1ZD4A 4MR8B 3W8EA 3IAPA 1T9GS 2ENUA 4NS1A 4A6SA 2YJ4A 3CB4A 4N53C 3FLTA 5CFCA 3WWDA 1EFVA 4DE5A 4W5RA 2QUBA 2V7GA 4DLWA 2NT4A 4NY1A 4IS3A 5AJTA 5SV2A 2YFZA 4OH7A 5CA6A 1JQLB 1RJWA 1U2GA 4NN0A 1ZAKA 4YT8A 4OI1A 3M3PA 2EGUA 4XB2A 1AMNA 2VG8A 2EU8A 5ER9A 5JR7B 1TKRA 1OKOA 3AG6A 3AM4A 5FYTA 3O7OA 3TCXB 2WP8J 2BFDA 2GTHA 4X6UA 4FR5A 4BAGA 3PHMA 1H4QA 3OU2A 2Q4SA 2BZ0A 1J2RA 1NVFA 5LQUA 1RUD1 4H31A 3IO3A 4YK7A 4IEPA 3GW8A 3DFZA 3W5HA 4FHGA 4UUNA 4AI8A 4Q66C 1SACA 2O57A 3H8VA 3UWOA 4D9EA 4BFTA 2BMDA 2H6EA 2P65A 2WN2A 3GJ4A 5A4FS 1GICA 4C20A 4CUCA 1XZAA 5ENVA 5CLQA 1YULA 2FCRA 4MR9B 2I4IA 1XD2B 1I7LA 1Y6RA 1YASA 2PVPA 4XFHA 4NMWA 3KAKA 3R9XB 1PZHA 4CCWA 4BLVA 2WRAA 3U4IA 2GUWA 5H68A 3SITA 4YR7A 4FPGA 3P9XA 2XB6A 1BVUA 1QRDA 2BDUA 3TI9A 4IXLA 4M88A 5HIAA 5BYJA 4N47A 3E5UA 1N9ZA 1Z0FA 5ALKA 4PPFA 4DJTA 4JRAA 1TUEA 1DYOA 4O4LF 3U7IA 2BL4A 5IF3A 1USVA 2D1SA 4PV7A 2K87A 1F0PA 5LL6P 4IEZA 1R091 1KI2A 3Q8KA 1FEZA 2G8NA 3A1SA 3TW0A 1L4KA 4MQLA 3FOCA 3OF1A