3M70A

Crystal structure of tehb from haemophilus influenzae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
286
Chain Sequence
MKNELICYKQMPVWTKDNLPQMFQEKHNTKVGTWGKLTVLKGKLKFYELTENGDVIAEHIFTPESHIPFVEPQAWHRVEALSDDLECTLGFYCKKEDYFSKKYNTTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENLNISTALYDINAANIQENYDFIVSTVVFMFLNRERVPSIIKNMKEHTNVGGYNLIVAAMSTDDVPCPLPFSFTFAENELKEYYKDWEFLEYNENMGELHKTDENGNRIKMKFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tellurite resistance protein tehB homolog
publication title Crystal Structure of TehB from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 73
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3m70A02
1O5LA 2ZWAA 1GQGA 4HVRA 3KR1A 1X1CA 4Q29A 2K4MA 4CXMA 4MUVA 3I59B 1CAUB 5CVRA 2JHAA 4RTNA 4DCMA 2GZWA 4C07A 2QM3A 1J58A 2XLAA 1EYBA 3LAGA 3IWZA 2OZ6A 3GRRA 3ZDSA 1RC6A 3DMHA 3SSNA 5I8YA 2G72A 4FS8A 4P7JA 1EY2A 5EMMA 3IIAA 4GQBA 2ONYA 4K8FA 1EIZA 3HT1A 3OPNA 1J3PA 5DX0A 5LQRA 4WVZA 2XKOA 5E1BA 4EMSA 5T6BA 4QGLA 5FULA 3P9CA 1KPGA 3QOPA 3T0IA 1EPZA 3FPEA 2D93A 1WXXA 1WLTA 4GOMD 3KKZA 3PFGA 2Y0OA 1BC5A 4C05A 2XL7A 3LDFA 3E23A 3EMBA 5DSXA 3PTAA 1FJXA 1FP1D 5AVPA 4HVOA 3TM4A 2PA7A 3A26A 5DWQA 2ZBPA 2ZW9A 5ERGB 3WW2A 3FTDA 3GBFA 3BGVA 3T7SA 3FYCA 5E1RA 4V0QA 2IBSA 9MHTA 4RTRA 1R00A 1SUSA 1X82A 5K0LA 3UJAA 4F84A 4PYNA 1N7IA 1RTVA 4X61A 3R6SA 2N7GA 1RJFA 2P3LA 2R3SA 4PYJA 4FSDA 5DM4A 3THRA 1AQJA 3S7IA 5DTQA 5LQJA 2AN3A 2IBTA 3ROUA 2BR4A 1YFLA 5FDBA 4Q0UA 4A2UA 4I09A 2PTMA 5LQUA 3PFHA 2PXCA 1HMYA 4AZWA 2YVLA 1B42A 4QPPA 1YZ3A 4DQ0A 2FPOA 2ZZMA 1FT9A 5FQNA 4AUKA 4BP1A 2E5WA 5GIPE 4IERA 1ZX5A 2GB4A 1X8EA 4PIZA 5E16A 5E9JA 3DXXA 3B89A 5C9ZA 2PV0A 2QYOA 4YARA 3LOIA 1NBIA 5CD1A 1KP9A 1Y8CA 1XRUA 4OFGA 1UD1A 2DCTA 4GF5A 1L3BA 2I6GA 4LWOA 1EAMA 3BT7A 3FE5A 1DGRA 3Q87B 4FGZA 2Q41A 3NVKI 2VP3A 1JTEA 4PYLA 3EHKA 1KIAA 2XYVA 1PRYA 1R74A 3GNLA 1J59A 2CAVA 3L8DA 2UYBA 4HH4A 2B2CA 3H9AA 3MHTA 4FR0A 5BY5A 2GLUA 3KR2A 3UJ6A 4E2GA 2CL5A 1NE4A 1XVAA 1HNNA 4PIXA 2PJDA 4XF3A 5BV6A 2OPKA 3B3GA 5KBFA 3FTFA 2A14A 2B9UA 2WFPA 2PT6A 1YUDA 4X1OA 2Q30A 2OY0A 1G60A 4CTKA 4ER6A 2GPYA 2O57A 4MV2A 3DMFA 4Z82A 4I0AA 3EVDA 4XCXA 4P9GA 7MHTA 3TPZA 3B5IA 4GC9A 5K8VA 5CIYA 5JR3A 5KVAA 3DN7A 2D40A 5CCXA 2UZ4A 4KWCA 5I8TA 2AZTA 2H1RA 4WXHA 3E8SA 2Z6AA 5K0BA 3UJCA 5KHHA 2ERCA 4E70A 2QY6A 2EJUA 4N9IA 4Z2YA 1U2ZA 2NXJA 2EFJA 3E6DA 1SVUA 3VSEA 4CTJA 3HP7A 1XJ5A 2VECA 3KQVA 5FLHA 1Q0TA 3EEOA 3FUVA 4JTOA 5I8SA 3KPUA 5E1MA 4I02A 3HCDA 3F4KA 3TRKA 1TQ5A 1P39A 4META 3VYWA 1KHHA 1O3SA 3KQSA 3ELWA 3RIEA 2V7EA 2YQZA 3JWHA 4XF0A 1ZVFA 5K0NA 1QAMA 4DKJA 3DL3A 4HN0A 5J3UA 1NE2A 2HJIA 3B3JA 4B17A 2F8LA 5DPMA 4QMAA 1RGSA 4X60A 3THSA 5JSRA 4YUWA 1VBFA 2VDUE 1CX4A 1VR3A 4PINA 3FHIB 1CAWA 1GQHA 3M6UA 3RYRA 5EQJB 2FRXA 4QXKA 1V70A 4RTKA 2AS0A 4OA5A 3TR6A 3BUSA 4PIMA 2D5FA 5F2KA 1INLA 2NNWB 3G8BA 1WGPA 3E7PA 1I4WA 1MHTA 4IEOA 5HIKA 1QYRA 2OZJA 4XUDA 4XETA 4Q0VA 3TFWA 4V0RA 5EIWA 5GINE 1KPHA 3ES1A 5FLIA 2O06A 4QVGA 5FUBA 3BCWA 4KDRA 2G8NA 3FRHA 3KQTA 3CJTA 3OZRA 3NTVA 3LKZA 4P7FA 3CO2A 2H0VA 5KHGA 1ZZ9A 3DH0A 1O3RA 2Q0AA 4ER3A 2CGPA 3P2EA 3R24A 4GOLD 3LA3A 3QOWA 4P7GA 3BB6A 1NKVA 3P8ZA 1ZRCA 4DM3A 5FA8A 4DCGA 3LDUA 4Q0PA 5FCDA 4RSRA 2ATFA 3LA2A 1XE8A 3S0MA 5KQRA 2KXLA 1CAUA 3UA4A 3OE5A 3Q7EA 4RTSA 5C8WA 4I0BA 1EJ0A 1L3IA 3B02A 5BXYA 4RVDA 4DA4A 3EVAA 5HOQA 4QDKA 5F2NA 3MERA 3AJDA 1R8YA 3G7UA 3WW3A 3E5QA 1RUOA 3TMAA 1KXZA 2V09A 4NECA 2IXKA 5HEKA 5I0SA 3DXYA 4YUXA 4HMZA 1J3RA 3KR9A 3BGDA 3QACA 1RI1A 4E2ZA 5EHGA 4CKEA 3LDGA 2VDWA 3HQXA 1JG3A 1ZG3A 1WG8A 5FWAA 2K9ZA 5BUVA 5DTRA 1ZZCA 1YB2A 2PY6A 3G2OA 2ZWVA 2AN4A 5KHIA 4L11A 1QY4A 5HIIA 1UPIA 3C0KA 4C08A 3FWEA 3KMHA 3BWBA 2PX4A 1ZNPA 4MQ4A 4HLTA 5ICCA 3ELYA 4PGGA 3ANXA 4RVHA 1X8MA 2O07A 4HGZA 2YXEA 2NXNA 3AXSA 1LRHA 5BW5A 3LBFA 4PWYA 5JCTA 2VDVE 5DRTA 2XLFA 3S7EA 2O1QA 2ZZNA 3HA7A 4RYLA 3D2LA 3UZUA 4M38A 4HC4A 1VQ1A 5DTMA 1VL5A 4TLFA 3SCFA 3LHDA 1F38A 4LULA 4IEYA 3EO6A 3EVZA 4AZVA 4EROA 2EJTA 1L3JA 5EIFA 4RVFA 4E2XA 5LRRA 3O7WA 5E2BA 4ZTBA 1VPTA 2P41A 3ES4A 5E2AA 1I6XA 1G8AA 2GC3A 1FPQA 2P3OA 4LECA 2HTEA 2PFWA 1X1BA 2Z69A 1IPKA 3OF1A 5D1IA 2IIPA 2XL9A 5LSAA 1OFNA 3PLQA 4IEZA 4CKCA 5FHRA 3A7EA 3LZZA 4C06A 3H3ZA 2CMGA 4JVAA 3SCGA 3TOSA 5DM0A 1L1EA 3M6VA 2BEOA 1ZKDA 1ZREA 2ESRA 2WA2A 2MNGA 3SMQA 4CWAA 4BLWA 1BKYA 3ORHA 2O8QA 4FT4A 3MDPA 3ME5A 1ZZBA 3FPJA 1AV6A 3H1YA 3FUXA 2H6CA 4PYQA 4RD7A 4FAGA 2PX2A 3FPHA 1NV8A 3T7RA 1YFWA 1YZHA 1NT2A 1L3CA 3TKAA 2P1DA 3UWPA 3OZTA 3FYDA 3L2HA 3ETQA 3HCFA 1FXZA 3UJDA 3CL1A 4WBBA 5GP1A 3LCCA 3LPMA 3SSOA 1YUBA 3LKDA 3MGGA 1QXRA 3EEYA 2ZBRA 5ICEA 4D7SA 3KR0A 4IEXA 2QRVA 3VC1A 3DKWA 4XFBA 5HI0A 3HA3A 2OXTA 5LEKA 1RI3A 2GH1A 1ZRDA 1DZTA 4AVCA 2PT9A 2Q1ZB 1CAXB 5CCBA 5EMLA 4YSFA 1FP2A 1WY7A 4QVKA 3HT2A 2ORED 3R6TA 5CM2Z 4IEUA 1YFXA 4PNEA 3NL1A 4A6EA 4KDCA 1PJZA 3EVBA 3IV6A 5CVJA 4Z07A 3OCPA 2CAUA 3BZBA 1NW5A 5KHKA 4XFFA 5P8WA 2UY9A 1WZNA 2H00A 3NJRA 4MHTA 3KPJA 3UBTA 3P2IA 5LR6A 5K01A 4IEPA 3I7DA 2HWKA 2UYHA 4IWNA 2AR0A 4YV0A 5LQCA 4EQZA 2B9EA 3FJSA 3OD0A 3H2BA 2E9QA 4FZVA 2AOVA 4IEQA 5DX8A 4EV0A 4QPNA 3LWCA 5MHTA 2P35A 2BR5A 2ONZA 4E33A 5C1IA 2H6BA 3TKYA 1VP6A 3SX0A 4R05A 4L7VA 5KYGA 2PAMA 3C3YA 2QDRA 4IV0A 2GA9A 1ZRFA 2WK1A 2Y1WA 1PM7A 1Y9QA 1NE6A 5K0JA 1BHJA 3P9IA 1WA4A 4MGZE 5KQSA 4RWZA 1RJDA 1SEFA 4BP3A 3GU3A 4C04A 3M33A 2HV9A 4O9EA 3LCVB 1BOOA 2B3TA 2ZIGA 1R6AA 3OU7A 2QVSB 5JAXA 2B5HA 4YUZA 1ZZ6A 1RJEA 1NW7A 4MWZA 3MQ2A 3KCCA 3LGAA 1O54A 4AQ6A 3FRIA 3O14A 1Q3EA 4E32A 3NVCA 3DLIA 5HIMA 1G38A 2BNMA 4EKIA 1ZHFA 2CV6A 4QTTB 3LA7A 4ISCA 4KWKA 1QANA 4IEWA 3CGGA 5I91A 4H0NA 5LRSA 3NW4A 1NW3A 1EG2A 2OPBA 3NJZA 4IV8A 2ZSUA 1X7NA 3NMUF 3ELNA 2BYVE 4A6DA 4E2SA 3BWCA 1WS6A 2ADMA 3UFBA 4PCLA 3GRYA 1KYWA 5U4XA 4D7TA 2GS9A 2JHPA 1Q5OA 4HN1A 2OB2A 3NKTA 3H50A 3HVKA 1JQDA 4UOEA 1VE3A 2MHFA 3CEWA 2NYUA 4AVBA 2GU9A 2IDKA 3HVJA 2PYTA 2QRVB 3WSTA 2FK7A 3HVIA 1UIJA 1TW2A 2ZVJA 4N9HA 4WVLA 3HNRA 1VLMA 5F1RA 3I53A 1ZZ8A 3EVCA 4GEKA 3K6RA 1OMIA 3G2PA 3A25A 1QXJA 4KU8A 1CAVB 1SQ4A 1SQFA 1KYZA 1EP0A 3FZ3A 4Q0QA 3BGIA 1XXLA 5EPEA 3FFQA 1V39A 3EGVA 3EGEA 3KGLA 3E6CC 3WW4A 2OKCA 2ET7A 5FQOA 1DUSA 4F7ZA 2AOTB 5DLYA 3AY0A 2YX1A 3IBMA 2XGXA 5DXJA 4R8RA 3PNAA 2PHDA 4MX3A 1RL3A 3U81A 4YMGA 1WXWA 3V97A 2Z2SB 4H7LA 3RYPA 3LCUA 5G02A 1AQIA 4DZRA 4XFIA 1I9GA 3ELDA 1KPIA 4R8SA 3T7TA 1JG4A 1XDSA 2I7CA 2IDJA 3G5LA 2DPMA 3NWEA 1VJ2A 4HG2A 4EWAA 4R6XA 3H8UA 2Q4SA 2ZFUA 4FT8A 2XVAA 3DOUA 3PB3A 2XYQA 2BNOA 4RTJA 2QNKA 1RI4A 3RNSA 3C6MA 5JUWA 1O9HA 4PCAA 2PWPA 1I1NA 2OA2A 3P97A 1JG1A 1LKNA 2AN5A 4OX9Y 3MCTA 4RTPA 3BU7A 4L2NA 2AOXA 4J1WA 3OGJA 3HCAA 2UYQA 2YXLA 1ZGJA 2IC1A 3MPBA 1XDZA 3EVGA 5FTWA 1JR4A 3DXZA 1TW3A 2OYZA 3CJQA 4OQDA 4E31A 4ORFA 1NV9A 5DM1A 1F3LA 1X1DA 3I54A 4Y2HA 2OO3A 4I2OA 3G88A 5CVDA 2OYRA 4AZSA 4U7TB 2BNNA 5GWXA 4R6WA 2IXLA 3JWIA 3BWYA 2GC2A 4FBFA 5CU1A 1IY9A 5JSPA 3VHRA 3KQOA 3U10A 3ID6C 4I3PA 1CAXA 3FX3A 3JWJA 3CC8A 3GGDA 4LA2A 3SXWA 3SXJA 4M36A 2DULA 3G2QA 4GOOD 1ZQ9A 1P1BA 1VP3A 4KRGA 4JTNA 3JWGA 1FI2A 2XYRA 1OI6A 2I62A 5E1DA 1D2HA 3N4MA 5K09A 2JG3A 3FTEA 2NXEA 5I0UA 3FPFA 4BLUA 1SKMA 3QOXA 3G5TA 3I64A 5LEJA 4LLOA 4QX5A 3O4FA 5ICFA 2B8MA 2BH2A 5EKUA 4PYIA 2Z6UA 4X6RB 5IKMA 5BW4A 3KQWA 1JSXA 5DXAA 2YXDA 4HSLA 4P58A 2GAFA 3CJXA 5EFUA 3ERCA 2GAUA 2PBFA 3D0SA 3A4TA 3U0ZA 5EZQA 3M70A 1XE7A 5K03A 3UKVA 1Z3CA 2AVDA 4MGIE 4ATNA 5F2OA 4FP9A 3SCHA 2IP2A 2GC1A 3KQQA 1NW8A 2EA7A 3CCFA 2CKDA 3DTNA 4AVAA 3CBGA 2IXHA 1M6YA 5FQ0A 1G6Q1 2JH8A 2PWYA 1DCTA 5BP7A 1JG2A 4PIPA 3GJYA 5K0FA 4RVGA 1TPYA 2IXIA 3EMDA 3C3PA 2NXCA 2JHCA 2BZGA 5KS2A 10MHA 3SVZA 4Y30A 2IH2A 3K0BA 4UBHA 3MTIA 4DF3A 4RTQA 3R9XB 4E30A 1XCJA 1RI2A 3GDHA 1ORHA 4G56A 4BY9E 5CVEA 4HVQA 1UWVA 4IEVA 2GH2A 1JSZA 2QCSB 1M6EX 2G70A 4QTUB 2I45A 4ER0A 2UYAA 1L9KA 2G1PA 5E9QA 2PLWA 4CYDA 3EQEA 4PIYA 2IGTA 3RZZA 2AOUB 4HZFA 5FADA 3QV2A 4GULA 2G71A 4EWDA 3PLAE 3IHTA 5DX1A 1O3TA 2I9KA 3E05A 3TQSA 5D1HA 5FPZA 5HZMA 3G2MA 4IETA 3BPZA 4GBED 1DL5A 4IKPA 5LQKA 2B25A 2FYTA 1RJGA 4BH9A 2O0LA 3ST7A 1N7JA 5GIOE 1UCXA 4MTLA 3NW9A 1O7FA 3UJBA 1G6NA 1VP9A 4HTFA 1N2XA 4M37A 2PAKA 2ZBQA 4UXAA 3DULA 4PYOA 1QAOA 1O4TA 3LX6A 4LG1A 2Z6QA 1CAVA 5GM2A 3FPGA 1QWRA 2IPXA 3R3HA 3EBRA 4AZTA 5EC8A 3EGIA 5EEHA 3SM3A 1Y3TA 2C0ZA 3GYDA 4MGKE 1YFUA 2FQPA 1IPJA 2XKPA 2D5HA 1NW6A 5CUQA 2C7RA 3REOA 1X19A 1VIDA 2AOTA 4KIGA 5K0GA 4F8AA 4LWPA 1UFKA 4OA8A 2K0GA 4X63A 1HW5A 1H1IA 4XFHA 2AOWA 1O9GA 4FSXA 3PX2A 2PGXA 4LEJA 2OBFA 3NDIA 1J1LA 3M4XA 3OU6A 4ER7A 3D0JA 4HGYA 3H3UA 3ER8A 3KPYA 3DP7A 1YHFA 3HM2A 3BALA 5HILA 4B29A 2C7QA 5EMKA 4I01A 3P9NA 4EKGA 3RW9A 2IH5A 4MH0E 3A27A 3CJRA 3MZHA 1Q0SA 5C6CA 4KWJA 3GWZA 4Q0SA 5FQ0B 2WA1A 4LTAA 3NSTA 1RUNA 3G7DA 3SHRA 4OLLA 3USSA 2PQQA 4M7RA 2IH4A 3BWMA 3KHKA 1EQAA 3KU1A 5E8RA 3FUUA 2B78A 5K0CA 3X0DA 4OBXA 3KPWA 1DZRA 3NDJA 4PGHA 1JQ3A 2BM8A 2VQAA 3NWBA 3TNQA 3KQMA 2HKXA 3I5UA 4KU7A 2KW5A 1H1DA 4MZUA 5LQAA 4QM9A 4XF4A 2JJQA 3VC2A 4KW7A 2ZLBA 4FAHA 2IXJA 2PX8A 1U12A 1H1MA 4YMHA 4PONA 2FMYA 3DUWA 3ER9A 4PYMA 4C03A 1P91A 4QQKA 1O3QA 1JUHA 2OZVA 2PSSA 5EHIA 5M5BA 4ZU4A 3JZVA 4UBGA 4QQNA 1Q43A 2NP7A 4E2QA 4AXOA 2P3QA 3OE4A 3TNPB 2YTZA 1R18A 2UYOA 2XHKA 4DMGA 1LB2A 4YYOA 2HNKA 5DRYA 5DSTA 1OR8A 1NZCA 3LECA 3SSMA 1YF3A 5FLJA 2OB1A 3LBYA 3BXOA 4F85A 1NXMA 3D82A 2WC2A 1KR5A 4XFAA 3KQYA 3ELUA 4R8HA 3HVHA 2HR1A 3GRVA 3BKXA 2XLGA 2PX5A 3WW1A 1R8XA 4QDJA 1YFJA 2FK8A 4XEZA 4HTFB 5FCCA 4ER5A 4CKBA 3FUWA 5GM1A 1SG9A 2PXAA 3SGLA 2EX4A 5DT2A 1SFNA 4MIKA 2VPVA 2EAAA 5JR7B 2P17A 3TM5A 1J3QA 5BPXA 2ETEA 4YV1A 4RTLA 3OZSA 2ZTHA 4QM8A 1UW8A 3V8VA 2ZKLA 1FBNA 8MHTA 5FA5A 3E5XA 2HMYB 3UKTA 4PJYA 4XFGA 3HA5A 4KIFA 3I9FA 1OD5A 3HIFA 5I0TA 1JQEA 2ZULA 3KGZA 4XUEA 3FTCA 2PKWA 2QJVA 4KL1A 1X1AA 3BKWA 1AF7A 5E8JA 2XVMA 1D2GA 4E2YA 4P7KA 4R52A 3DV8A 3FUTA 4EVIA 4BHPA 4JV4A 3B7PA 4BIFA 3UJ8A 3H1MA 5EVJA 3G89A 4QGMA 5B1SA 3IYLW 5T3NA 5FHQA 3IDBB 5DM2A 5FWDA 1T43A 5T64A 4MGYE 4YUYA 4ONUA 5J48A 2ET1A 5ICGA 4EK9A 3TLJA 2JH9A 3RODA 3AWIA 3LL7A 4PYKA 3C6KA 3B3FA 3OFKA 4HBNA 2P40A 3PX3A 4KWLA 3MCZA 1LR5A 2XBMA 1XTPA 3RDIA 2YUIA 3HEMA 3C3VA 5K0EA 3HCCA 4RX1A 5EZSA 1CGPA 2PVCA 1ZGAA 4KVZA 1RI5A 3HCEA 3SMHA 2AOUA 1ZRRA 2V74B 4DINB 4LUKA 3OTFA 2ZIFA 4ZU7A 4EWEA 1XCLA 3KSCA 5CVUA 4X6QB 3DR5A 4U7PB 3KQPA 3I59A 4YRDA 2IFTA 4RTOA 2P8JA 1I5ZA 4NVPA 4ZU5A 2VS1A 3R0QA 1MJFA 1SUIA 3AXTA 3PVCA 3H7YA 1DGWA 5CVVA 4HSJA 2BM9A 1UIRA 2ZZKA 4RV9A 5BXXA 5KHJA 3PT9A 1NBHA 5EOVA 3UJ9A 4K6MA 4QGNA 3GO4A 3RPQA 3UA3A 1YFYA 2VZ9A 2EG5A 1QZZA 5GOZA 1YWKA 1O5UA 3U11A 1IM8A 5K05A 2C7PA 2EVXA 3EVEA 2LD4A 4HRAA 1G8SA 3MB5A 2ZCJA 2Y1XA 3PS9A 4J1XA 1IXKA 1NYWA 5EKXA 5E9WA 4LA3A 2YR0A 3HCBA 4XUCA 4GOND 5T67A 1EJ6A 1XDUA 2FHPA 2P7IA 2O05A 3MYXA 3SR4A 2MPFA 2CMHA 4XF9A 2ZIEA 3M6WA 4BYYA 4X41A 5C0OE 2PXXA 1QAQA 4C4AA 5J7MA 3ACLA 5EG5A 5EGSA 3O31A 3KPVA 4XFCA 2N47A 4POOA 2UY8A 5H02A 3S68A 3GCZA 3DLCA 5D1NA 5E1OA 2F4PA 2R6ZA 3P71T 3M3IA 3UKNA 3GXOA 3P9KA 4YUVA 4F86A 3GIWA 3MTEA 4YV2A 3M6XA 1UIKA 3GRUA 2FCAA 5LQNA 4BLVA 4IESA 1G55A 3OFJA 4OBWA 3RYKA 2AVNA 2PHLA 4WZCA 3PVBB 1SQGA 4GUAA 4AQ2A 2UYCA 5IH3A 4GC5A 1CAWB 2H11A 1PMIA 2PAEA 5I0RA 1M0EA 5HFJA 3UJ7A 3CKKA 3HTXA 3NVMB 5JSOA 4FT2A 5K8SA 3G8AA 3DMGA 3P2KA 3CF6E 1ZZ7A 1JTFA 4E2WA 3MAGA 3EPPA 2BR3A 3IDCB 3E97A 1YLLA 4O29A 3E6BA 3GRZA 4AX8A 1ORIA 3FZGA 3EVFA 5EZWA 2ZCWA 2CWWA 5EMJA 3CVOA 2BGCA 2C7OA 5FPXA 3IEIA 3OCJA 4YNIA 5I93A 4HSGA 4RTMA 3EJKA 2NP6A 3H1WA 4JXJA 2QE6A 3H7JA 3LSTA 3E5UA 5HIJA 2P7HA 1P1CA 2GC0A 4LUMA 3I58A 3A7DA 3OU2A 3CLPA 5EEGA 5CADA 4XF1A 4O9GA 2IXCA 1D2CA 4OQEA
chains in the Genus database with same CATH superfamily
1O5LA 2XUGA 5T8KA 3T5PA 1BMQA 1J58A 4GGPA 4EYSA 1GRNA 3LUCA 4YJHA 3RZHA 3P1IA 3WLOA 3KSMA 4BQ1A 5BN1A 2OD7A 3ZD7A 2WZR2 4L72A 5CG9A 2LALA 1W28A 3K53A 5EQUA 4JOCA 2ONYA 1SHWB 4K8FA 1O5IA 3VYRB 1JODA 5AC92 4RORA 1W2UA 1U8FO 3QBEA 4NENB 3SF8B 4V1CB 4EY7A 3SXUB 4WVZA 3OP4A 4NK5A 3NDPA 5C3OA 1VJDA 2C31A 2I2WA 4JU9A 5J4KA 3HWX1 1FFYA 1CESA 2X19A 2Y76A 3EMBA 5DHSA 3TM4A 4TS3A 4KL8S 3E3NA 3NYRA 1XRJA 3BGVA 3GUCA 2I74A 1RUJ3 3LBAA 1R00A 4UXJA 1C7RA 1QX4A 3JB4C 3O92A 1WZCA 2RM23 3VZNA 4KE6A 5IXYA 1MQSA 5DBFA 3CXUA 5FBVB 5AJUA 3SC4A 1HL3A 2EKQA 4OQNA 1U0RA 1VYVA 2N7GA 3LS2A 4RLFA 2H4XA 2NPOA 5DXFA 4CCEA 3THRA 2WN2A 4P38A 5IBRA 2C61A 2IBTA 2AXNA 3OIGA 4XUOA 1SKQA 2PTMA 1O4VA 4Y2TA 1NVBA 3BMNB 3S7ZA 1QVVA 2Q5HA 3DLBA 4TLMB 1RWPA 3DMTC 5G0WA 4ZCMA 1NBIA 2NU7A 4J0CA 4OX9B 1ND3C 1JBCA 2D43A 4NSNA 4QBKA 4IV5A 4GYYA 2ZMKA 4HRVA 3HP4A 4HETA 1CZSA 3MYYA 1PGW2 4CUCA 5HKKA 3JY6A 1K9SA 4IGQA 3N7TA 3AVPA 3WDUA 4X1KB 2W6MA 4DMLA 4ISRA 3R41A 2PT6A 1YUDA 4QQRA 2OY0A 2TS1A 5ETJA 3SHFA 4CTKA 4MV2A 4AMVA 1ZMRA 1MAVA 3OQVA 3T2TA 1FYVA 3L43A 1PNGA 3RYIA 1T6GC 5DYGA 3B5IA 3EQ8A 1HX6A 3GQVA 2E53A 4YCSA 1X92A 5FZ7A 1JSRA 1KQRA 2AZTA 5KNLA 3P0RA 1M1YA 5TDHA 4JCOA 1YJLA 3IJ5A 5HM6A 4XYLA 4XJSA 4RQPB 3OZBA 4N9IA 4DIUA 4RZUA 2RAVA 4AIRA 1VB5A 3GW8A 4WNAA 2AJDA 3ZH9B 1QOZA 5I4IA 4KQMA 5FZBA 4ZI7A 3K31A 3FZYA 2FEPA 5KNBD 2VPYA 1WVIA 3TRKA 4META 1O3SA 1V6OA 5FYDA 1PQWA 1NE2A 3WBKA 3TDNA 5JNLA 1VBD3 4YP6A 3FY4A 2WG2A 3CR7A 3MLEA 2Z8ZA 3ZJTA 3R8CA 4UWDA 4EGQA 5LCWL 4AUNA 4XXAA 3H0CA 5FI0B 3T1VA 2JB8A 4KFRA 3AM1A 1YR7A 1DPGA 1U28A 1GGNA 1Q92A 4JHXA 4M9ZA 2AK3A 2EZ8A 4QOSA 1YMUA 1PV4A 5C8VA 1WGPA 2VY0A 4R2JA 2BL4A 2MHCA 1O77A 4ZT6A 2AFIE 3OJCA 4H77A 3NTXA 4HATA 2GVNA 4BNZA 3VBOA 1JLHA 3RF7A 3BAZA 4LDRA 2HUNA 3SAJA 3PJQA 4MKFA 4YYZA 4W9RA 1IN5A 5DTIA 3PKJA 4PLFA 3B52X 4RD2A 3ENNA 5FCDA 1NATA 2XB6A 5JZBA 3RS7A 2Y1LA 5IU6A 1XALA 3ZHSA 3G5UA 4JXKA 5KQRA 3R3JA 3POFA 4MW6A 4BLOA 2WJAA 4LRSB 3IILA 4Z5XA 4K03A 3WP5A 1W8NA 1GZ5A 1DV2A 3EVAA 4X8OA 5F37A 1XNKA 3HZHA 3OUHA 1GNVA 2H8GA 1OV4A 2GTPA 3K16A 2FUNB 3T41A 4X1YA 3AUSA 3R3XA 5HZGA 1RRVA 2GEDA 3B1KA 2A88A 2EF6A 4EZBA 4XX0A 3F71A 3GEEA 4NCIA 2UUBB 5CPBA 5BUVA 2DT8A 1FP6A 1HN1A 4WFIA 5HIIA 2PPVA 2PRYA 2H29A 3B2EA 5C8DA 4C08A 2J22A 1R082 3FKQA 4COOA 1Y3DE 4C1WA 4MGSA 1CVNA 5B1EA 2H7XA 1OD6A 5K4HA 1QH8A 3U2QA 2ZYSA 4PDWA 5B64A 5F77A 1GFWA 3DLPX 4NOJA 4IEYA 4BUJA 1DWQA 1AB6A 3EEQA 3O7WA 3RSJA 1BDBA 1YL7A 5BW8A 4NFYA 1CONA 1IPKA 3RUHA 3U4QB 2ORWA 2YKGA 2XL9A 1LKZA 2AG5A 3HH8A 2V72A 3LZZA 1WD4A 3FOAA 4OXYA 3NHMA 1YC2A 2FDFA 2CXQA 4XILA 1C7QA 1CS0A 1ULPA 1P2TA 3P0IA 4EITA 4ZZ0A 2UUOA 4KYIB 2RMU2 4NULA 2BBAA 1NT2A 2ORYA 1CB0A 5IP5A 4DV3B 5IDQA 4CLRB 1HE3A 3B48A 3OZTA 2BKEA 3W6UA 4KMMA 1IZ8A 5ITVA 4BDVB 1HXS2 3W3AH 2WYSA 4UVIA 4DTIA 1FZTA 3DTYA 1RS0A 1HLGA 1VL0A 3LPNA 2VO1A 2C4KA 2BFDB 3RTBA 2L2QA 1H9WA 4BBJA 3LVFO 3MRVA 2WJ6A 5CA1B 5LMCA 4MW0A 2ETXA 3CHYA 3ZVNA 3WHTA 5LYYA 3K1JA 2QSJA 3K0SA 3J81A 2ZREA 2DX7A 1URPA 3LO8A 1YEWA 2V7VA 5CLLA 1G7YA 1QHYA 1NJ1A 5C80A 3HT2A 4Q3NA 3HN7A 2RH9B 5IZCA 2M1ZA 4MIYA 1XRSB 4AL9A 1H6AA 1UT5A 3RKRA 4C76A 1K7YA 4YIHA 3N6XA 2E5FA 5I7RA 2REBA 1LF0A 5CA1F 3K4QA 2BFFB 2C2KA 1C8M3 4QODA 4J2OA 2G9ZA 5HCFA 4OQPA 4BQRA 1S1MA 2VZOA 4EFDA 4YPJA 1FNDA 5BORA 2WNSA 4CGZA 2PJRA 1WL8A 3OD0A 5TSDA 3H2KA 1WZ2A 3OIWA 1R9NA 2GXAA 1NLUA 1NBMD 2EAKA 3ZCRA 2HA5A 2P65A 4YFYA 1GARA 3MS7A 4R54A 3VKUA 2YRFA 3DHVA 4FTBA 1PM7A 5FO7B 2RR12 1WMEA 1RMU3 4BGUA 3EDCA 1ABFA 2FF7A 2CYAA 1RJDA 4RWZA 5SYAA 3KB6A 2HNAA 4MXDA 2AFHB 1TYAE 3FG9A 3IEXA 4N7BA 4L8YA 4D9FA 1NY6A 4M6WB 3ZHBA 4L2IB 4A36A 2QQFA 3CVYA 2ZVQX 1RJEA 3WL8A 2X0JA 2XG3A 1XJCA 3KCCA 3NATA 1HT1E 4C20A 4FX5A 2A9OA 4YG0A 5HPYB 3P26A 3RB8A 4EKIA 5AFSA 4XZ3A 3FM9A 4YFVA 5DDIP 4IEWA 1XMXA 4XDQA 5EWJA 3NBZC 1THZA 4NZOA 4RSHA 3U1TA 5IUJC 1VJ1A 3PR1A 1W8WA 2BCGY 4COWA 2FZCA 2ZVDA 4XWYA 4LTMA 2PRSA 1E2IA 2CVQA 3V1KA 3DWEX 3B70A 3HDGA 1GR0A 2JASA 5U4XA 1SK9A 2A1XA 3PVEA 4BO9A 4BJ1A 3P2MA 4B4KA 4HNAA 1JDBB 1CUZA 4AWBA 2MHFA 2GUGA 3DPUA 2EP8A 3N7UA 3AVSA 4ZALA 4G4JA 2YBPA 1J6UA 1SNYA 4QL3A 3PQ4A 1H8TA 1VSTA 1HKHA 4TSFD 2YV2A 3HNRA 2WRAA 4GPTA 1LHUA 4UBMA 2VAVA 1T8WA 4Y67A 4MI9A 3RVLA 1GG5A 2DJ5A 4CTEA 1SHZA 1VBE1 1DJMA 2WVJA 4KX5A 3FYTA 4P6VF 4K5QA 1XXLA 1O95A 2XJQA 2YDEA 2PWAA 3KC2A 4GLJA 3GG9A 3M1HA 3MMXA 4DG9A 3VC3A 4CUZA 3TEJA 4R8MA 1EWKA 4UAPA 5HP4A 3JAKA 3DVRX 5ADUS 1GTG1 4HB3A 2XADA 4CP9A 1HOXA 2OHXA 4R1NA 1LDBA 5B58C 4JBLA 5DP2A 2C2WA 4TRRA 1BCRA 3EWNA 1JG4A 1XDSA 1JA0A 5HTOA 1VIVA 3UMRA 1Y4AE 3EPLA 1ESMA 2Q4SA 2W8ZA 2XVAA 2RKBA 4MYEA 2F1HA 2SBTA 4XJXA 4JR1A 3C6MA 5JUWA 3CR3C 3GG2A 4YX9A 4B7UA 4OX9Y 4K2AA 1S0GA 3VI3B 4UFIA 1FJ2A 3D8CA 1TMKA 4Q5OA 4PF5A 4UQPA 3DV0B 4IIGA 4KYUA 3EDQA 4ERNA 1IRIA 2XBUA 5JSYA 1WEKA 2PPLA 2VW1A 2MJLA 3K0CC 4FGLA 5G1NA 3KV3O 4QQOA 2CMDA 5I9BA 4Y2SA 4A5SA 2B46X 5EI5A 5CU1A 4Z4FA 2PZ8A 1GPNA 3JSXA 3F95A 5JNTA 3ZQ4A 3WK8A 2K7ZA 1D2AA 1ML4A 4B7CA 3ESZA 1QQTA 3F46A 4TROA 3PDIA 2DULA 3R0JA 3ZDRA 3IHLA 1WCDJ 3CBQA 3ITDA 1ZQ9A 1P1BA 3GUYA 5FTKA 5AKYA 4KFUA 1GL9B 1QGZA 2RS12 3E70C 2AL7A 1MC1A 2VQEB 3KV6A 2J1LA 1XTJA 1OQEA 3M9XA 5BSVA 4R8LA 4OJYA 2KMLA 3MCUA 4XUTA 5DK6A 3SYRA 4N7IA 3O4FA 2JKVA 3HCPA 1JE0A 4AI2A 1M10A 2VYVD 4OVKA 3CJXA 4AKTA 3Q85A 3Q5DA 2EIDA 3QVJA 4IGEA 2R11A 3TVYA 5CDTA 3W8NA 1E4OA 3IBSA 2P9HA 4KQJA 1K3TA 4HAWA 4K9MA 5ADWA 2P9BA 3VPHA 2PVPA 1P2SA 1KH3A 4HLUC 3PNPA 3KS7A 3UETA 2CYFA 2FPKA 1X7YB 3LKVA 4UEQA 5FMOL 4QLAA 1EJ2A 2NZUG 2WZBA 3Q8FA 2HA0A 5TGDA 1N2ZA 2MR6A 5EJ4A 5AOBA 1S2LA 1N4AA 3ME2A 4R3UC 1J8DA 1PD0A 3AB7A 3BEDA 3WAKA 1G4UR 4P81A 2G08A 4G56A 1UINA 4TQAA 1GOGA 3PJYA 1H0RA 1A5AB 3S2IA 4V0NA 3KKLA 4RFVA 2IS1A 2ET6A 4H3KB 3TNJA 5ADVA 1NRXA 2ZXQA 1HM5A 1N2IA 5ALPA 3LXMA 2RE8A 2BVNA 4LJ8A 3DYOA 1LWNA 2AOUB 3MM4A 5ALJA 2C3OA 2IX3A 4JIGA 3IHTA 3VYVA 1RYDA 2HZBA 5F5IA 2X22A 4HAIA 5L3ZA 4I50B 3TMYA 5ALVA 5KJEA 2XF8A 4IGOA 5BN4A 3O91A 1FMD1 3VHQA 3NFYA 3FKSD 1LHWA 2R8BA 1ADBA 1SCJA 2VJXA 1PHPA 3FPGA 5IT6A 5ALTA 3ZS9A 4N9QA 2O0JA 4TQGA 4LX8A 3WDXA 3WEZA 1MGOA 3B6IA 2YJZA 4F3JA 1OUSA 2D5HA 4AT1A 1L7LA 3FJ1A 3L4JA 3GR6A 4PPQA 4DW8A 1Y98A 4CQLB 1L5YA 1ZM7A 4AJJA 3T94A 1WDMA 3SITA 3M9WA 4RWEA 2HWC2 1X94A 1E1YA 4TL9A 5KC6A 1Q83A 2FG5A 2CD9A 1O9GA 3QVXA 3HJUA 1B15A 3CSUA 4NQRA 4TS9A 3A6EA 1A9ZA 4MWDA 3D0JA 4MH0R 5J47A 4B29A 3H9CA 4B6FA 1J7KA 1Z0KA 4KPGA 2QQVA 2Y66A 4TLCA 3T0AA 4KWJA 3UFXB 3F3SA 4Z8BA 4OLLA 5DGDA 1J24A 2IH4A 3INNA 4XEUA 4EF6A 3EUWA 3PSHA 3W5DA 2BVVA 3O4GA 4L76A 4OL9A 5JWPA 2DVBA 2HBZA 1U3CA 2D97A 2DCKA 1QP0A 4G01B 4HAZA 2Q8EA 1B2LA 3KE9A 1K42A 5JD6A 2TEPA 1SOVA 3WDKA 1SVMA 2Q45A 2VJYA 4JB8A 3FLBA 2NGRA 2E87A 3WNVA 4IGPA 4LSGA 1Q84A 1CW2B 1VMKA 3LX4A 1XPRA 2HWD1 3CEJA 1GOTA 4YZ4A 1ZNZA 3OYWA 3N1UA 4JL8A 2XNCA 2BELA 3K09C 3VZKA 5IVYA 1J1UA 1PNTA 2PZEA 4C21A 3CEAA 3R9WA 1XTUA 1I24A 1UBHS 2VNGA 3H2ZA 1ABBA 2XMSA 3WJ1A 2YZKA 1NT0A 2QMOA 1E7QA 4KYVA 1NLFA 1NXMA 2W6PA 3JRXA 4ND6A 1MPTA 4I1IA 3SLIA 4XEZA 4QWNA 1ZVKA 3CT6A 3MPOA 1FUUA 3LVQE 3TZ6A 1GAWA 3BMCA 4MIKA 4GI1A 4E21A 2OCGA 2QUZA 1T9CA 4YLEA 3SS7X 5CLJA 1C2YA 3F8SA 1CWPA 1R6BX 2X4DA 1Q56A 4D02A 5J4VA 2ZTHA 2PN5A 2E48A 2CNKA 1ZAYA 4BRWA 2BFNA 4WLNA 1CV2A 2HIGA 4N7MA 3JATA 1SD5A 3EW7A 3KOXA 2FFRA 4B79A 3CVXA 3D7LA 3TSYA 1PR2A 5KI6A 2BT4A 2G0TA 1OD5A 1V1RB 4S1OA 4N5MA 5I0TA 4X85A 2ZULA 5GGXA 2IXGA 1T9AA 1P73A 1IIBA 4KL1A 2FCTA 2OC9A 3B7WA 4ZVVA 4TRJA 2XIQA 1WCV1 4DSUA 2ZYUX 5IYZB 4YGDA 5FYQA 4U7FA 4LS3A 3HJGA 1Z5NA 2BFWA 1EVJA 1UMHA 3BWVA 4C3OB 4F7WA 4BIFA 2IXAA 4XAEA 3DBHA 5BNOB 4D2IA 1SWWA 2OKXA 4AFAA 1RBQA 2BY4A 4LE0A 2ARCA 3C6KA 2VQSA 3EJ6A 2O2DA 4HBNA 2ZYRA 2RHTA 2XCTB 1G20E 2CY0A 3ASYA 3PX3A 4LEIA 4K8RB 4ASUD 3U0VA 2RMKA 5AVOA 3L2OB 1QVRA 3K9NA 1KYYA 4MXWA 3RDIA 1ZIPA 4J6GA 1MZ5A 4RX1A 7YASA 1CGPA 3KYIB 1SVLA 3QSYA 4L95C 2XT9A 4DT1A 4NMLA 2YV4A 4KZKA 1SUCA 4R1QA 4OY3A 4YM1A 3JU3A 2GF2A 4NRMA 1SBYA 4ZU7A 4KXYA 3RJ9A 1DZ3A 2WINB 1SZDA 4IEFB 4JNCA 2JIOA 1YI9A 3DR5A 2IFTA 3AF4A 3D7RA 4CP0A 3R0QA 1PX0A 4FU0A 3A4UA 2QUHA 1J2EA 4CU9A 1BWRA 4BJ6A 2DHDA 4Q1RA 3ORFA 4CCCA 3K46A 4A8TA 1PFGA 3WRYA 2RS51 2AN1A 2FWMX 2BJSA 1L4HA 4PI0A 4EAAA 3DE4X 4HRAA 1JDUA 2YBDA 2Y1XA 2F9LA 1R6XA 1IXKA 4BQQA 2CFTA 1R9JA 1T5IA 5EKXA 2QZJA 1RRGA 3OJ0A 4XCBA 1Y7IA 2FR8C 2HXSA 5A6SB 4BTVA 3HYRA 5J58A 1XWWA 1ECFA 1MB3A 2C5AA 2JH3A 2HU2A 1QJFA 4XF9A 2ZIEA 3O73A 4O1IA 2IODA 2QAGB 3W9YA 4RLSA 5JADA 4EW1A 2V0CA 5JSHA 3UXMA 5J7MA 2FEXA 2XQVA 2QTAA 4RSGA 2UY8A 1NKSA 2H7CA 2I71A 4UNQA 3P71T 4LJ6A 4MRAA 1XXHB 5DTEA 1CUYA 4MV9A 1DAEA 1UIKA 5JFGA 1MS0A 1XDGA 3WYAA 3SEAA 5H9QA 2ZTLA 1T0HB 1UNBA 1MVQA 2CDRA 3OVMA 2X53S 4WZBB 4XJAA 1IPEA 3U13A 3TB0A 4W5JA 2XECA 4BFXA 4FT2A 3WY6A 1QNWA 1PZ8A 2WKRA 5IT0A 3GA7A 3G8AA 2D6OX 2QP3A 4E2WA 2WU1A 4F4UA 3MSCA 4NE7A 3RVKA 3QVKA 1UK8A 1FXWF 3WLIA 3K1YA 2RAFA 4ZQCB 2CL2A 3OUTA 1KJLA 3NNLA 3OPYB 1RLOA 1E0AA 5CIQA 1B35C 3KBOA 5HE9A 3H4MA 3ZWKA 3HAGA 1CR1A 5EEGA 1XU9A 1OREA 2XAAA 4D41A 2O1XA 3BPSA 1O7JA 1D6JA 1X1CA 1VIAA 4MUVA 3CR8A 3AU9A 3DE6X 2O8NA 4C07A 2QM3A 3QTBA 3B85A 5IN4A 4UBJA 4B71A 2X29A 4LQ4A 3OKAA 4FN4A 4X3OA 1EUTA 3HZRA 2PLV2 1EGAA 5DX0A 4L9WA 3WLHA 5KYYB 4KU4A 1US3A 4UTVA 1G6HA 3MTDA 4FIDA 1SCUA 4GMGA 4C05A 4C5BA 1A7KA 4Y98A 3O90A 2G9FA 1WUYA 4BO4A 5FUVA 4HQ6A 3HU5A 4YAOA 2YXNA 2IHBA 2XMZA 3DCNA 2LV8A 5F6KA 2Y9MB 2C4TA 4KPUA 1MO3A 5K8LA 4GEGA 3QU4A 3CX8A 4ENWA 3QJGA 2EALA 1RU3A 1AMUA 2R7NA 3WJ2A 1XEWX 3AEKB 2JLRA 1OKKA 3HYCA 5FP8A 4X6LA 2YY6A 5LQJA 3BHJA 3L0SA 5IMSA 5T5QA 5IMBA 3KIPA 4ZCQA 2W1SA 1BXRB 5AFEA 3RBXA 1N8TA 2QXTA 3AR2A 2FEMA 3JRNA 1OLSA 1VJ0A 3A4MA 1CBUA 4IIEA 3VBRC 2VPIA 2WT0A 2E5WA 1PG0A 5KHAA 4JDOA 3O1IC 4C0AC 1GTVA 2WFF1 5E9JA 3B89A 3TSAA 5C9ZA 4RZSA 2VNHA 1T34A 3UK9A 3TAXA 1NVUQ 2H2FA 3VKLA 3AMVA 3H65A 1UD1A 4ESEA 1PK8A 4BOYA 3SLKA 2VP3A 4P86A 2EJCA 4PGMA 2QVBA 3HPQA 5FLKA 1PRYA 3MB8A 1RHMA 3QENA 3MHTA 1G59A 2ZJBA 2HCTA 4ZEMA 1HNNA 4ZXKA 1WQ4A 2PJDA 3QCWA 1CF2O 1WPXA 3KJGA 2BSAA 4C0JA 1UK9A 4XQGA 5IWAB 3BTVA 5GQSA 5IT9A 1EX9A 1U7WA 2LDBA 2JX9A 5LA1A 3IP8A 2YNMC 2V98A 4LRUA 3VISA 4P5HA 1W88B 5A3WA 1R27A 5DWVA 1BX0A 1Z6ZA 4EIWA 3O7OA 3EZXA 2UZ4A 2GEFA 3T5GA 1GP2A 2YBEA 4JC1A 4ZIRA 4L5AA 4V0MA 2KPOA 1FB5A 4OHVA 1R9GA 5JXGA 3WOGA 1KU0A 4WJLA 3QPAA 3ZN2A 2VRBA 4PXYA 1GLHA 3JQ7B 5JDBA 1LDGA 1U3GA 5EIOA 4BTEA 4MUAA 3SS8A 3O1RA 3RRMA 3GJBA 2G0NA 3V2UA 4MJLA 1O6GA 4GRDA 4XIOA 3BN6A 5JW6A 3ELWA 4LFAB 5C5TA 3U7JA 5UKDA 1JA9A 2PFSA 5CH5A 3VGPA 4GBGA 1QJY2 3INTA 2VPPA 2XB6C 3NASA 3ZU2A 1WAMA 4BP8A 1XELA 1CX4A 2NVOA 3X1YA 4QUKA 3GJ7A 2VZRA 3C4JA 1FV2A 1Z3IX 4UHFA 2FRXA 1BH6A 4QXKA 3BUSA 2GPNA 2VTVA 3GAZA 2EHJA 4KI0A 1R64A 4LBOA 4RE6A 4MEAA 1MP0A 5K8JB 3RVQA 3HP1A 2E18A 4Q4HB 1KAOA 2PXHA 2VTBA 5H59A 3T1OA 2R2GA 1W4AA 3MJVA 3VZQA 2NQ2C 4LJLA 2FPPB 3P2EA 1KI7A 1DWOA 1WW5A 3MELA 2XDQA 1JIQA 4PLMA 1OTXA 4HBZA 1N2CE 4LUCA 3KJXA 2JVIA 3KKEA 3C6QA 4G36A 3OM9A 3EQ9A 5ILQA 2VGDA 3Q7EA 2OWEA 4XZUG 2W0SA 3GUVA 1Y3BE 1VBE3 3B02A 1QO0A 3CUWA 1DJOA 3RS6A 4KHZA 3RM3A 3HBJA 3E5QA 1H8HD 1MVOA 2GH8A 3SS9X 4I5FA 4Z0TA 1WUTA 4BWGA 1PR6A 4UFOA 3BVCA 4HMZA 3CZCA 1QIHA 1JA1A 4UFNA 1J3RA 3Q3VA 1PAUA 4J91A 2WSSD 3EYPA 3UMSA 1ZD1A 1AYN3 3DPSA 2YUEA 3DTVA 2PY6A 4A5OA 4BMPB 2HBQA 3WBJA 2QW1A 1STMA 4FYVA 1M0SA 2HC9A 3GFOA 2OXEA 4UVHA 3OSDA 3BRWA 4B73A 2CWDA 1X8MA 4RVHA 2O07A 5C34B 1EZ1A 4HPKA 3WNPA 1RXCA 4O4JB 3UHFA 5TQ2A 3AKDA 3L18A 4GECA 5HXVA 1WWYA 5CZKA 3IMCA 1J21A 4HH0A 5A71A 1UKRA 3U1VA 5HZKA 2CJXA 4XQCA 5CFLA 2JK0A 3LHDA 5EXTA 4DWOA 1EUQA 4UOZA 4AZVA 1L3JA 1KI9A 2DU1A 4PG4A 4IDFA 4TTPA 3T3YA 1GA6A 2HEIA 4LY3A 3TWIA 2GC3A 2QTFA 1SGWA 2XJRA 4DMHA 2VPTA 5IDYA 3O2JA 2MTBA 4CKCA 4RY0A 2OP0A 2XWJI 4HGPA 3S28A 1NUAA 3VU9A 1FOD1 3A9UA 2IK8A 3H3XA 1UXGA 3WNZA 2XUPA 2O8QA 4HGOA 4KQCA 3ME5A 4G5SA 3H1YA 3HQUA 4CQMB 4FD3A 3DDCA 3VV2A 4E14A 1OBFO 2X0RA 3QIAA 1C4RA 4DS3A 5E2IA 1W5AA 4IJWA 1S3GA 3BFKA 4YRSA 3ADCA 5IKOA 2JG9C 4EHIA 4XGQA 4XD7D 4KR7A 3PC8A 4WJZA 3G9TA 2PBLA 2XVZA 2ZP1A 3C6XA 4MIEA 3A1FA 1TEHA 4DPLA 2QD2A 1MDBA 1D1SA 3GEBA 4MUJA 3ZDBA 4TWBA 3HBKA 1PZGA 1KAMA 1KP2A 4QGAA 3OLXA 5HF8A 1VLQA 1HRV3 4JWTA 1W76A 1F2TB 4EY4A 1N7HA 2X5XA 4MVWA 4DANA 2W8BB 1DFHA 2VKTA 4CNBA 1YFXA 2GM9A 4PNEA 1E0DA 2JEMA 3E0QA 1YR8A 5EE0A 1YTUA 2WMDA 4HWKA 2ZJ4A 5F5XA 4C7JA 1U7XA 1H8ED 2BE9A 1HFJA 1MB0A 1UBJS 2Y60A 5P8WA 4WGGA 4G9GA 2ZSHA 4R2HA 3MOIA 2FTKE 3NJRA 1LA2A 3WICA 4YLZA 5A5VA 2FWRA 2YIMA 4Q0MA 3P2IA 4W6QA 2XUKA 4IEPA 2J1VA 5MN6A 3ZXYA 2AR0A 3VDMA 4K0RA 4H4EA 1OA0A 4KAJA 3U07A 1O0BA 1VBA1 1REQB 1KDTA 3SHVA 4GT1A 5U9CA 5IDWA 1GQPA 3L6UA 3SX0A 4EGAA 1HQKA 3OTGA 3PNKA 1ZIDA 1BJKA 4IV0A 1DX9A 1OKQA 2J4FA 1DOAA 1WKVA 2WQ6A 3DAYA 3A2KA 1WMXA 4GJZA 3PEVA 4UU7A 3T1MA 3P9IA 5AVAA 1PK6C 4NAUA 1VHJA 3OZVA 1R6VA 1WD7A 4QYIA 1G3MA 4CU8A 1TQDA 5K0TA 3T7DA 3MQ2A 4O25A 2BDUA 1Q3EA 4MRMA 1FMD3 3ZHVA 3VR5H 3U19A 3HUTA 3JXSA 3RHTA 3SK0A 4AYWA 2EIHA 3QG5A 4IV8A 1MR5A 3G79A 5DO9A 1CY2A 2AEJA 1AUPA 4E15A 1NSYA 5HCBA 5CT4A 2NV6A 2P27A 4DB4A 1NBME 2JHPA 4PWZA 3NKTA 1Q77A 3PK0A 4A3SA 2J07A 4EQ6B 1PVDA 5F2WA 4CVNA 4NHKA 3VU1A 1Q7TA 1S2BA 1TO6A 4K8OA 1Q7CA 2RE9A 3UPTA 3L0OA 4NRDA 1XD2A 3N76A 2Z4SA 3QPDA 4OI2A 1Z8HA 1YIFA 3GRCA 3FWYA 4WKGA 3VDQA 1L5KA 3I0NA 1OIWA 3WK6A 5F1RA 2A6ZA 4NABA 3S2FA 4GEKA 1KEPA 5H1YA 2V45A 4O0LA 5IEJA 4PZEA 2YMZA 1MZEA 2XUHA 1LHNA 4YDRA 2BE7A 3JYHA 3I30X 3OSUA 2RK4A 1H3FA 3O0WA 4MA5A 4CQMD 5A4FS 3T9AA 4L8VA 4OHUA 2FSVC 4XFDA 3EGEA 3E2PA 4BO1A 4WXMA 3OWOA 3VH3A 2AJ8A 3KQNA 3M82A 3CG0A 1XQNA 3UG7A 2RJOA 4Y6QA 2HRDA 1SB9A 2C57A 5JI2E 2RGDA 1FY2A 3RYPA 4WM8A 4KIJA 2ODQA 2C59A 3Q40A 1W9MA 4UOJA 4RENA 1VMJA 1D0GA 3HMKA 3P6BA 5LZ7A 4U7DA 5B7PA 1ONBA 1YZFA 5TV2A 1VAMA 1HRI1 2HWD3 4F3TA 3GUZA 3VU0A 1GWLA 4Z86A 1SJ9A 3QVGA 2PIAA 4TT3D 3SYKA 4NEQA 3FCCA 3OZ7A 4IICA 4TTJA 4BJHB 3SHOA 5FOQA 4CLOA 2OHJA 3BD6A 2UKDA 1SC4A 5EWMB 1Z0IA 1SUEA 4GXRA 3N75A 1XVLA 3PQ3A 2UYQA 4KQ7A 5KWJA 2A35A 4LNUA 1NMYA 2J9ZB 2GFQA 3EBOA 3V3TA 4OHYA 3DDNA 1S5PA 3NBKA 4JJIA 1U2SA 4Q1PA 4G6ZA 4MRNA 1YB5A 2EXJA 1USKA 3IKJA 1NVXQ 1CQIB 5BV0A 2OYRA 4AZSA 1X1RA 1C3OA 6LDHA 5BRJA 4AQSA 4X7RA 2BGLA 5ED0A 4E27A 5KWRA 1G4AE 5IK2D 2XTMA 4FXOA 3EX7C 5GZ6A 2ZHMA 4MULA 4YRGA 5T6MA 1B09A 3L0PA 3SXJA 5CVCA 2F67A 1DBQA 4UOQA 2YY1A 1QMJA 3FVQA 4RPGA 2GZ3A 2B30A 1Q0RA 2G9RA 3M5CA 3EXHB 3PQEA 1Q0QA 1GAEO 1WCUA 4FHGA 2NX2A 2YV8A 1BE6A 3O4IA 2GYWA 3A58B 1H6BA 3EXUA 3GZNB 1KNQA 1EZ4A 2QGFA 2F3SA 3FAKA 3F2IA 4QX5A 5B53A 5I8ZA 3ELBA 1JJAA 1QZXA 5AW6A 2ZJ1A 5KTMA 2ZT8A 4V1PA 4PANA 2HJRA 2Y8KA 1J22A 4XFKA 1ZINA 4JGZB 2WSMA 4MKRA 3T1HB 3ND7A 3M3EA 3C74A 2B7LA 1DEKA 5JU6A 4J1SA 4Q4JA 3KYDA 3F6SA 2YYSA 2EA7A 5J98B 3WCRA 1CDDA 5L4SA 4YT5A 5KYKA 5DW3A 4RQUA 1JDZA 2IU0A 2QRUA 3WWZA 1Q1BA 1XMSA 2X14A 3FWPA 2H1IA 4OM8A 1LLDA 3ZCVA 1PHRA 3EMDA 1JILA 1EP9A 3L1HA 1MXHA 2P4HX 2QYHA 1AT1A 3OURA 2RS53 1I4EB 3DOCA 1Z8FA 1OWPA 2Y1OA 2WWVD 4LYJA 2ZGTA 1PLLA 1QIMA 1VBKA 4LO7A 1L7MA 1PWZA 2GBLA 2VUJA 1SEPA 1JSZA 3OOWA 2XKBA 3ZV7A 3JD1A 4RHEA 4GMP1 1JB1A 4O2BA 1HNZB 3EEIA 5CTAA 5JROA 1TYZA 1JU4A 1JS1X 3BOWA 2JGJA 4B4VA 4W6ZA 2HF9A 3FR7A 3EIFA 3CX4A 1YD7A 3E05A 5DNVA 1Z74A 4XIFA 2X8AA 1WKYA 5KNDA 2KR2A 4EOGA 4LI0A 1DRKA 1QIKA 5F6LB 3VGIA 3T61A 2OZPA 4DXAA 3ZIDA 3NT2A 4OATA 3JCIA 3DNMA 3QH6A 5FYUA 3I3MA 2ZPXA 4Z4IA 1Q95A 2DQKA 3U4XA 4JLOA 3G9ZA 4R71A 3HNMA 1G41A 1YRHA 3UG6A 2VJCA 3I5AA 4TVKA 3HDVA 3M34A 1TK3A 4YACA 1A9YA 4EG5A 4KIGA 1ZOPA 4WW0A 1BO6A 5IVVA 4OA8A 2K0GA 1R3DA 1LJUA 1AJEA 3VTAA 1N1YA 2D44A 3AY3A 3H8RA 3F1LA 1MTZA 3O93A 2OCKA 2P9FA 2HWB1 3CBNA 4KB5A 2AE2A 3GA5A 3EFBA 4NRPA 3P9NA 3I52A 2J9FB 4NAOA 1MENA 4F3CA 3BCRA 4FWTA 1E98A 2WTNA 2CCGA 4IGFA 2A0UA 5HF6A 4W6WA 1KJRA 1M6VB 4YVWA 1IEQA 3USSA 4LGCA 4TXHA 2UVPA 3RSFA 4M88A 1WUHS 3DHNA 1PZNA 5E8RA 3X0DA 1I2BA 1IQPA 5ITZB 4KU7A 2NOAA 1BEEA 4ITVA 1M76A 3ZMOA 5CBKA 4QXAA 1A9PA 5CB4A 1PL7A 1U8YA 3DUWA 1X8KA 1ZH8A 4PLPA 1O91A 4H16A 2GT1A 4UDOA 5IABA 3O0TA 2Z3WA 1ACMA 4IJ5A 4D4LA 3HSSA 4PYMA 4Z8XA 2CXPA 3D3WA 1K5MC 4TVOA 5K3CA 4NEHB 1T4GA 3KZ4C 4M60A 4E2QA 4P2BA 4EJMA 1TNFA 2CUKA 3X2EA 1VHLA 4H9GA 5FD8A 2P2LA 1ONPA 1R66A 1IFXA 1DO0A 2PQSA 1UPTA 4H3WA 3E61A 1Q1GA 1YR9A 3SSMA 3TTSA 4Q1FA 5JBQA 5FBRB 3BXOA 3OFND 4Z7QB 2VAMA 1EUCB 1KR5A 3OQBA 2QX7A 1AYM1 4TM7A 5CFZA 4CHGA 4NCHA 4RZ2A 5F1KA 5C53B 3SG0A 2E7AA 4R0VA 5FCCA 3OZDA 1F2UA 2OSVA 3I9V6 3L0CA 5JI7A 3SGLA 1V8FA 5E6RA 3WNKA 4NCNA 5I9MA 2VMEA 2HYDA 4CN8A 2JDUA 2FW6A 4QXBA 1YQ9A 1L1RA 3G2NA 2OZKA 4BXOB 4XXHA 1Y9JA 4EVRA 4N43B 3F1KA 2WFF3 3X43A 3IQEA 5FA5A 1RP7A 1QFSA 2V7PA 3OOYA 4XFGA 4I99A 2X5JO 5B2GB 1FDSA 4C78A 3LUPA 3H18A 4NH4A 2PD4A 1RINA 2OK8A 3C1TA 2DFVA 4G0OA 2CLKB 4UW3A 3EC1A 2D0DA 1OW3B 4ESVA 1BXGB 1CZOA 2EEZA 1ZXLA 1HR0B 3Q10A 5BUZA 1PL6A 4QXRA 4B4PA 4ONUA 5ICGA 2WJJA 4Q66C 3RRNA 4H7FA 2XB8A 5JH7F 2R071 1HLPA 2CXOA 2FWNA 2F3PA 4W9NA 2XLCA 3MUNA 3NC0C 2Z8YA 4BCBA 4RCVA 4Q6BA 5HCNA 1RRKA 2RH5A 3WGQA 2YUTA 3LAWA 1A82A 1EYZA 4AURA 1S9DA 4FYKA 3HCEA 1AKNA 2QLJA 2Y26A 2OUIA 1ZO8A 2IYYA 4WERA 3F6CA 2AKYA 4DINB 2NW6A 4BQNA 1WSWA 4CDQB 4AJ9A 3PHHA 4I36A 3RHZA 4YRDA 1W05A 4LCJA 4R81A 4H35A 3T8YA 4OUDB 4MROA 2B6NA 2DQZA 3L7IA 4K81B 4EPVA 1XLTA 2A6XA 3I9V1 4X97A 1OA1A 3E9RA 1CQJB 3BTOA 4ILEA 2GZSA 5A2QA 1F3OA 2SECE 1MNAA 4A8JB 4ENSA 1OA4A 1ILWA 3UHPA 3AIKA 3NO8A 5IANA 1OC4A 4TTTS 1D4M2 2E1RA 2H1SA 4DQAA 3BMQB 3PCTA 4L07A 3IXLA 3JD0A 5A9TA 2YWGA 3ZWWA 3KYBA 1QZUA 1V25A 1XTTA 2WWJA 1M9NA 1COZA 1R16A 3A6ZA 4BYYA 3R75A 2OAQ1 3RE1A 4CM5A 1R4NA 3WKAA 4XFCA 4I1UA 3RRBA 5FB3A 2V6BA 3K96A 5EINA 3S68A 1GQ2A 1MU0A 3GCZA 4E51A 1ML3A 5MF6A 5E7JA 3P9KA 2XHEA 3M6XA 3GDFA 2FJPA 3LPAA 1RUG1 4C4ZA 3P96A 2IXEA 4M0EA 5DGXA 3F9IA 4JI0B 3DPRA 3OCZA 3UJ7A 5A5DA 3NVMB 3VYUB 1QF7A 4FHCA 2X5IB 1KVTA 3FVVA 1JLSA 1FSFA 1JZ4A 1NA5A 4JRLA 1RAEA 4QECA 1P18A 3MWFA 3P45A 3PIIA 3F0TA 1ZEMA 3TAYA 5EZWA 3BDVA 2RHPA 2CWWA 2BGCA 1LVGA 3R7LA 4YJ3A 3ND5A 4ACAA 3IEIA 4XASA 2B37A 1E96A 1QHHB 3J8F1 4PSAA 3LKJA 1DINA 4GXTA 1FUKA 3PUHA 3IMEA 2XWJB 2Z0MA 3X1ZA 1L5ZA 4D45A 3CLPA 3GXUA 3HV0A 1TCVA 4P5DA 1RQ7A 1UM8A 4L9AA 3KT0A 4YDHB 2GRJA 3ROXA 4ZVQA 4DCNA 4B80A 3ZC3A 3I12A 4XC9A 4DCMA 4K6CA 3KKKA 1X7XA 4D3DA 4BQIA 3Q3CA 2WT8A 5EFOA 3GRRA 1E2FA 4D25A 2N46A 1CQXA 4HLQB 1ACCA 3D02A 1CZHA 1AH2A 1UXOA 5AUPB 4KPFC 2B7CA 3EIEA 4MUKA 4GA9A 2GVZC 4GPD1 2PL1A 5F21A 4X65B 1UKEA 2DVFA 3D8HA 3RYHA 2ACKA 2A6PA 3GJ5A 1RJ9A 3K0AA 3DCQA 3DVAB 4B85A 5FULA 1KPGA 1EPZA 5CEJA 2D1FA 3AHFA 2FD8A 1WNFA 2JA1A 3LDFA 3DBLA 1GD1O 2B4AA 2Y1GA 2GTHA 3A26A 5FXXA 3V7YA 3MUFA 2WAMA 3KSBC 3T7SA 4KGXA 1QC5A 3ZY5A 2IBSA 5LASA 1FOD3 1Z33A 1ULBA 3EIXA 4RJJA 5E7MA 3HXLA 2OFPA 2FY8A 2R25B 2R0HA 2WNUA 4WH0A 3R6SA 1RJFA 2ZHNA 4FSDA 1O58A 3WWDA 2FMHA 3EGDB 5GTDA 2C03A 1GN8A 2J3EA 3IT2A 4Y1RB 5EE1A 3M81A 3O38A 4R9AA 5LQUA 1RHI1 4RUKA 4UE2A 2H4HA 1CY1A 3NGXA 4ZXPA 2DUMA 1X2BA 3BWDD 3RJTA 1ZX5A 4PIZA 1LOGA 1SLBA 5ALOA 3ZIUA 1PDWA 4DRXB 4DXDA 4HQOA 2P77A 2NZJA 1ZBA2 3E2IA 4RW0A 1ND6A 1F5SA 1EAMA 3QYAA 1D0IA 2CYCA 5BSFA 1COWD 2ZOEB 4D3ZA 2EL7A 1OLXB 3DWIA 4HH4A 3KO8A 3ZMNA 4OVEA 4TYWA 2VDOB 2OX0A 1V9LA 5HKLA 3I32A 4N3AA 1II0A 4RO0A 4B6EA 1R0YA 3B3GA 2JJ8A 4I9FA 1FYXA 4CEHA 2A14A 2B9UA 2WFPA 4U4AA 5TPZD 1Y1PA 1RQLA 1ZZEA 1E5TA 3K73O 3S5QA 3FGZA 3DMFA 1MRNA 1P77A 5JAQA 1ZSVA 3W4IA 4HAUA 4KWHA 5ISMA 1UBUS 4X6YA 3W79A 1OFTA 4LQLA 3CZQA 2WKQA 4D8VA 4GC9A 5CIYA 2X4IA 3S81A 3W2EA 5JD4A 1O6BA 1KI2A 1RAGA 4E70A 5I7HA 2QY6A 1VBA3 5CKNA 2ZRKA 2GPWA 3RMYA 4DREA 2IS6A 1F1BA 1PJRA 3EXG1 2WKKA 1IG0A 4B87A 2V6MA 5E3IA 4HV4A 1JDVA 3FCAA 2UZ3A 1Q7GA 2XOKD 4D9JA 4S2FA 5F4BA 1XYNA 1P39A 4WCDA 1W6QA 1NE7A 1LBQA 3GIDA 1Z63A 3AP7A 2FAXA 1NUTA 3R3UA 4TS1A 3GJ4A 4U6SA 1VLJA 4PVCA 1DGLA 3MGAA 4BU1A 1ZJYA 3B3JA 1MTOA 3V1LA 1XXHE 3AL0C 2QAIA 1UEJA 1DBPA 1NHGA 3E9YA 1E3MA 5F1OA 1R5JA 2MSEB 4BO2A 4R1OA 4E4HA 3A6JA 3PZRA 5EJ7A 3UW3A 4KXUA 5JS6A 4H31A 4WZBE 3C7CB 5J96B 5KWSA 2B6HA 2JIGA 3C2UA 4EJ0A 5HCUA 1RT9A 1NY71 2NNWB 5EWLA 2W6JD 3SP1A 4CM8B 3NTLA 3HOBA 1QWSA 1US8A 1W7AA 1GUZA 4X90A 3TW8B 3FTPA 1YT5A 3TFWA 1CG6A 3KXDA 1T91A 2O8EA 4BVGA 3OT1B 5LCXA 3PXGA 3PGA1 4ARIA 4P7FA 5JEDA 4KMOA 2GOYA 2ZS7A 4V38A 4AWDA 2CGPA 4OP3A 3VOSA 1DEAA 4KJXA 2IJGX 5FA8A 4PQFA 3ACBA 4KG7A 4MMXB 3S5JA 2X2PA 1F7VA 1JH8A 2IYRA 1FXUA 1ICEA 3PNQA 1CUIA 1BX1A 5F7XA 3UA4A 2PZAA 4CIAA 2PMDA 1GKBA 3HHPA 3PC7A 5C46F 1N2OA 5AKEA 1HQDA 1V2HE 4DEVA 4IHJA 1BMV2 2GCNA 4U2CA 1FDIA 2GEJA 2J0UB 4ZOAA 5CYGA 5KB3A 1SA0B 2XQRA 2H54A 1KZ1A 1YA4A 3MF9A 5I0SA 3F7MA 4I8DA 4CKEA 4X91A 1NVWQ 4B31A 3TFOA 3PNOA 3LIPA 2APJA 3JUUA 3WYNA 1CIWA 1G2OA 3OBBA 1EFRA 1ZZCA 4LZNA 3X1WA 1NSFA 1O94D 1E5RA 3BWBA 4BMYA 4RR3A 1HUQA 2JG8B 1V11A 2VN8A 4BLSA 2JKZA 3OY8A 1T4CA 1UZAA 4DEXA 1QONA 1QHIA 3ENWA 2AZXA 4OAOA 4M8NE 4MMZB 3CPSA 2IUSA 2UXCB 3WRWA 1LOFC 4DARA 1KR2A 4B76A 3AUKA 2WA4A 1PJ3A 3PNYA 1Q1NA 2OR3A 3NIWA 2O2JA 2EJTA 1WIWA 4ZEXA 3QPVA 3ZNQA 3V7NA 1LB1B 1RYEA 3GLGA 1TME1 3I37X 5HA5A 5JVDF 2BFCB 3AIIA 3ZGYA 3SC2B 1O5OA 4LTNA 3W77A 2VBBA 4JVAA 1P3JA 4CMIA 5E6HA 1L1EA 4PHTA 5KAMA 1OU0A 5CDHA 3ORHA 1PR3A 1RNLA 1CQWA 1DKQA 2Q9BA 4B3TB 3ZOIA 3DE2X 2BFAA 3LFUA 1TU4A 4BNTA 4Z0PA 1OILA 4O2AA 4ZO4A 1O8PA 1XQYA 4KFCA 3T7KA 1JKIA 3VR4A 2G09A 3DE1X 3ON7A 1N5OX 4BMVA 3EXIA 3KT6A 3OZGA 2L82A 3KTDA 5CFNA 1FXZA 4MYTA 4EJSA 3MC1A 3ACCA 4V02A 2JDKA 1H4QA 4EG4A 4K1LA 3VDDC 3P5SA 4JJ6A 2BUKA 4U9UA 1T4DA 1P75A 4B6QA 1NP6A 4D1YA 1U0NA 3R2JA 3AKSA 4LJRA 1FDVA 3LIGA 2FZ5A 3IEVA 4PY2A 3GJ8A 2R1DA 1PF7E 2VL7A 4RZQA 1ISFA 5EMLA 3ANMA 1JX6A 3ZW9A 1CEXA 4BGDA 1OIXA 4QOIA 2IS4A 2Y92A 3VNSA 4X64B 2BZ1A 1Q91A 5CVJA 2C2OA 2DLCX 2Q1UA 3S8EA 3M49A 3I01M 1TUGA 1D4OA 2OQIA 4M0UA 1QYVA 3QE3A 2HSZA 1S0UA 3NWKA 3JVIA 1WZNA 5BPHA 4L0CA 1JZ6A 4MW1A 3WMFA 1MV5A 2D8MA 2O1EA 3TH5A 1PN3A 2CJPA 2W68A 1KOGA 1NQUA 1Y5LA 2IHZA 5BYBA 3JQAB 3LWCA 3WP3A 3V00A 1FSGA 4ND8A 2HWE3 1YASA 4R05A 2ORIA 3AFMA 2RBEA 1S2NA 1ZWKA 1H1TA 4HN9A 2GZ2A 1N6KA 4JHLA 3WAJA 1EM8A 1EA7A 5ALYA 4AEDA 3GU3A 3VXKA 2C1ZA 4GZ9A 3NM4A 3N9NA 5F3CA 2I7TA 4CHTA 3R9KA 2V7QA 2B5HA 1F17A 2LVBA 1DDLA 1T3TA 2FN3A 4UBLA 5K0SA 1U6IA 1Q7BA 1M2OA 4BAUA 2JDIA 4IDGA 2HU7A 3H5RA 3E03A 1IZ3A 3SQDA 5KTYA 5FTTC 2W2MA 3OZAA 3NJZA 4HUTA 4BL5A 5IJAA 2ZWPA 1TF2A 3VH1A 4LITA 4QAWA 3IQDB 3UFBA 3FROA 3ZQKA 1P9NA 2H4ZA 2WJGA 4I4TA 3AVWA 5K0UA 3H50A 1QJX1 3KLNA 4YVFA 1FQJA 2W46A 2XE6A 4UJ3A 2DCYA 3SBXA 2C5GA 2IEDA 2VH2A 4O2RA 3L4BC 3EQ6A 5AM5A 4RK6A 3I6YA 4ESOA 1W75A 4BZZA 1PSZA 2HWB3 3CNNA 1WMSA 3PHIA 1DWUA 4MLOA 3A25A 4K6GA 4KU8A 3KJIA 1E3LA 4J3NA 1WMBA 3C98A 3VZRA 4H7EA 4P82A 3NNJA 1DCKA 4URHA 2BMAA 5FYMA 4FFSA 4H08A 5HYVA 4KO1S 1DUSA 4L0DA 2W9XA 1ZNWA 4M8IA 1U99A 1B8VA 3OCYA 4RKYA 2BF7A 1QH6A 5IAGA 3T1YB 3R5XA 3ASVA 4OLFA 3LY5A 3Q8WA 1HB4A 1IWOA 1RPZA 3RSCA 1AA6A 5D01A 1AV7A 4CU6A 4P9JA 1SG3A 4AFNA 5EGNA 4NZYA 3A04A 3B1YA 4D5GA 2IDJA 1WHSA 5F9MA 2YU1A 3DEIA 5GGYA 3RFTA 3K05A 2PZLA 5GOTA 3UBMA 4HEQA 2XYQA 2BNOA 2I4LA 2QNKA 5MGBA 4DIMA 2JJMA 3UNPA 4ZXEA 3P97A 1C1FA 3MCTA 3U60B 4FPLA 5LJLA 2NM1A 3OFSA 3TQRA 1FDRA 3P9ZA 4EYQA 4C4OA 1FTWA 1PQUA 1Y1RA 1AYM3 3ETEA 5MFPA 3PI6A 4N6OA 1U9CA 1OYOA 2C2ZA 3WT3A 5AHKA 1IBKB 1G21B 4AAYA 1F3LA 3EPJA 5B3AA 2IPMA 1HG0A 2R041 4PRZA 3GFVA 2XJVA 2BNNA 1V8PA 2W98A 3N2KA 3JQAD 4RAQA 3JWIA 3RK1A 1ISHA 2JGMA 3KG2A 2Q3JA 5TR9A 2WQ8A 3K4AA 2C2GA 2AZ4A 1YONA 3PZBA 2DURA 1SCRA 3V1UA 2ZVPX 4DPKA 4XBQA 2BWCA 4HH1A 3CC8A 2ZUUA 1KJJA 4H18A 1WCIA 3LUHA 1VOTA 3FPSA 1OX4A 4ZDJA 1BA3A 2C0PA 5FLEX 3AYEA 3ETPA 1PZXA 2JATA 3ONFA 1EESA 3LUKA 3KBBA 4DVJA 4E5DA 4YR7A 3R7BA 5DAPA 2FPGB 1ARZA 5IK8A 1SM4A 1KS4A 2QVZX 3QI7A 2JG3A 3IDAA 3RTAA 4LC1A 5FK7A 4LC0A 3WMGA 1RUI1 1SKMA 5KSPA 3IKVA 2ORXA 1X8JA 4D9KA 1SD1A 3L7OA 1JSXA 2DBZA 3JQ8B 1E4EA 5DXAA 1JOPA 1MW8X 2IVZA 3A4TA 1ST8A 4YG3A 5E6SA 4UEOA 1WKBA 4PNZA 3ZHQA 4TLDA 2Z5GA 3CTPA 4CN9A 3LHSA 1SN7A 1VRVA 3BQ9A 3VPFA 1HT2E 4GBMA 3ZXSA 5T8KC 1CZLA 3OCCA 5ULLA 2KLHA 2JDZA 2BJHA 2W3JA 2R8EA 1TE1B 3GA0A 4DIDA 1W8OA 3CJIA 2Q2QA 4LRQA 3HD8B 4PI2A 4C9BA 1Z36A 3KKQA 1IVNA 4ZQGA 2A9FA 3PC6A 1JFLA 3O83A 2WU8A 1W06A 4II2A 1QFJA 2IHNA 3V0BB 4CMBA 3D3AA 1JAIA 3UYKA 3ZLTA 3LUFA 4WK6A 3ZSMA 4UDNA 1TAUA 3NAPA 3E7WA 2PKQO 5JJBA 4CYDA 4BFLA 1N3LA 1M74A 1XZKA 5AI6A 3DZFA 1XCMA 1EXWA 1ZLYA 4UEJA 2XY4A 1NMXA 4WD3A 4XLTA 2V96A 1KEZA 2WNVA 2CSUA 4ID9A 4JCCA 3DPIA 2YY7A 2BAGA 1NUQA 2R6QA 5F64A 1G5FA 4JUAA 1SLAA 2B8TA 3VR2D 4TMWA 2YIVX 2XMDA 3CONA 4U7JA 4GRAA 4KXQA 3BH6A 2Z6QA 4M53A 1A5BB 3H19A 4YVWC 4I66A 2FW1A 3UIEA 2WW8A 3ZDCA 1E9AA 1GUIA 2OHOA 3OMLA 3GYDA 1GPBA 3K20A 1WABA 1XFDA 4O4LA 2AOTA 1KTVA 1NNLA 5A3UA 4DBZA 3I5XA 4QX0A 2FQWA 1FS6A 4AZ0A 4QUDA 4S05A 2FDRA 5BWOA 2AOWA 4BO6A 1NOIA 1K0UA 2OBFA 1Q20A 1NP7A 2VT2A 5LXTF 5TE9A 5JY6A 1LU9A 3I9KA 3PXEA 2AD5A 4M3CA 1ODTC 3J8F3 3I1IA 4W8GA 1XEAA 1NONA 3AETB 4KOEC 1V9CA 5FFFA 3VNUA 4G8BA 2XUAA 1D09A 3PTLA 2WA1A 3FLTA 4JDUA 3M7AA 2EBHX 2SKEA 4NN0A 3SHRA 4BK4A 1W1UA 4M7RA 4MJXA 1X7GA 2FZLA 2KB0A 2IHVA 3ESDA 2PLNA 3WX0A 4BNYA 1NLRA 2IEYA 1YKFA 5HS6A 4K1ZA 1AR82 1V47A 4FAHA 1QG0A 2A5GA 4FZJA 2GMWA 4JASB 3V9PA 1SOUA 2FMYA 2IYNA 4AI3A 3X1XA 3T30A 5SV5A 2PGLA 3A3KA 4KQ1A 4P4SB 4HDRB 4ZCPA 4CL0A 3M4NA 1KMHA 3MGUA 3TCKA 2D74A 1UJ5A 4GMXA 2ZAGA 5HV0A 3VNQA 2PSSA 5M5BA 3BIWA 1WXFA 1E8MA 1E79A 1XZCA 1T6BY 1S3SA 2FCRA 2FQ1A 1YQTA 4LBYA 2QVYX 3SJAA 4QX8A 3LECA 3O8DA 4YVSA 2WKPA 1U28C 5LBCA 1K7XB 4QDJA 1R8XA 2F1JA 3NB0A 5ALKA 3FI0A 4F9TA 2DR3A 3RUCA 3A6LA 4DM7A 1POXA 3TLMA 3P19A 3MGCA 3C3KA 2VJDA 4F1JA 3WYEA 2ETEA 1I3NA 4NBRA 4YCDA 5CFOA 3AVYA 2GSWA 2W11A 2Z09A 3WG1A 3GPBA 1KYTA 2FZWA 2P2GA 1CR7A 4CTNA 4PLZA 3U4DA 3VBOC 4H7DA 4BBZA 4ZU3A 4L9BA 1Q5PA 3W7VA 3TL3A 4D4HA 1JQEA 1RKQA 2OHVA 1SWVA 4AULA 4L8GA 4LXGA 3P0FA 5DGHA 3DQPA 1CDZA 3DFFA 2V9ZA 2XVMA 1WQ1R 4A73A 4MDFA 2DKOA 3I2YX 2O7VA 4IE6A 4HQKA 2BGRA 2HJ9A 2Z5FA 3L4SO 4CP2A 3AR4A 5J63A 3I9JA 5GM0A 1DUVG 4EB3A 4YFWA 4F3KA 4QT4A 4LF5B 1H5NA 3CU7A 1XBFA 4EK9A 3TLJA 4IO0A 1Q21A 1JHXA 5DOVA 2ZJ6A 3PEUA 3ZU5A 2CBZA 5I9SA 4JU8A 3MTBA 2HNBA 3U7IA 2VPWA 3LQKA 4KMSA 3DL4A 4CODB 3HCCA 1TKBA 2A7AA 2C8VA 1E2DA 4CUKA 4J0JA 4JVLA 3JD71 2H92A 1QIJA 2YC4A 5LZ9A 3FA2A 4D8MA 2NXWA 2QZZA 1ULZA 4LUKA 4D0LB 2IUEA 2VHVA 2KLBA 3WWOA 3IVAA 5TEWA 5CVUA 2HQOA 5IAOA 4KGVA 4ZU5A 1PFYA 1KS9A 3BXEA 5KX5A 1IU9A 3RI8A 2H16A 1VLVA 5KHJA 1I80A 1GTJ1 4PDWC 1RM0A 2KX7A 1EP1B 4IDDA 1Q6ZA 3RPQA 3UA3A 3C8MA 3V4ZA 4N7RA 3JD4A 4IV3A 3UC9A 5IVDA 1KRIA 1ENQA 5TQVA 2Z5LA 2IE0A 1DAFA 1Z6QA 2BKLA 4NHLA 3FFBA 1FPN1 3DPRC 3GLFA 2A3YA 4LA3A 2X7XA 1XCOA 1W2WB 1DO2A 2NYYA 2BEWA 1A8HA 2PGJA 1Y1LA 3JARB 3IUNA 1H2XA 4NPMA 1QIQA 3ZI7A 3C3BA 1RZVA 2LROA 3UH1A 3QUSA 3WADA 2N47A 4EHBA 5H02A 5I01A 3PC4A 1K8QA 4DUZB 4ONEA 3CYFA 1I1QB 2BYTA 2XVGA 3LHKA 3HY6A 2OVFA 5KYWA 5K8UA 2Q5QA 3OQJA 1BSVA 4C4PA 5CNJA 3KETA 3MGKA 2ZAIA 1Z47A 4IUCS 4OBWA 1J06A 4OPMA 4U1RA 4DR4B 3EY4A 4JYCA 3S4YA 5KU7A 1C9KA 1G5PA 3KVOA 4QPIA 2JXAA 2AUNA 1OLUB 1CERA 1ZR4A 3KLOA 1GG9A 2QRPA 4ZYLA 4GMP0 5DZEA 1OVGA 1R0XA 1RPNA 4RQTA 3C8XA 3GVIA 3H11B 3VNRA 3E97A 4O29A 4OQQA 1UT8A 3V6MA 4PRLA 2PYDA 5KJFA 1EIWA 4H4DA 1QRUA 3H7IA 3NV4A 1L5QA 1PEDA 2JFFA 5IZCC 3QE4A 2DVMA 3EOZA 3KZVA 1WLSA 3V2IA 2QA5A 1P1CA 3PDWA 4DO0A 3T3GA 3T99A 3OU2A 2Q07A 4BB9A 3HQ4O 1MO4A 3VDCA 1E6WA 3P27A 2ZWAA 4QU0A 3B7MA 3K8QA 1MT3A 2WNUC 4BO5A 1K6JA 5A06A 1ZP6A 1PBTA 1XAGA 1W99A 2P9ZA 3CZ9A 2P3KA 1C1HA 4MQBA 2JFYA 1ETUA 3AL2A 5DLQC 3MVEA 4AS1A 2VJBA 3MEQA 1XZ8A 2XV1A 4BFSA 3QOPA 4UW6A 4QQ8A 1GPYA 2HEGA 5E89A 4MAFA 4GKJB 3Q72A 1Q15A 2WPNA 4KOAA 4AI8A 3AL6A 7ABPA 3W3ZB 3TL2A 4NR1A 2YWJA 1KK3A 1TME3 3DS8A 1MEJA 1YRLA 1QIEA 3DOEA 2JFVA 4W99A 1D7OA 1X7HA 4A0SA 1OSNA 2YQ4A 3HYNA 1KFKB 4ID3A 3R4VA 3QLUA 2E89A 1UQTA 3BZUA 1JJIA 3RZGA 3VGJA 3HKCB 1CUGA 1OLRA 5DK4A 3F2VA 1JHUA 2H2GA 1MJNA 2IFRA 2W71A 3KLMX 5JAPA 1Z0SA 1FDWA 2VP6A 1TC1A 1OBCA 1MABB 5KEIA 5JCJA 3LCPA 1KEEA 1A3KA 1BRTA 1AR61 5IKPA 2AI2A 2R7MA 3DYIA 5LZ4A 1W4BA 2ZZMA 1BE8A 1TLTA 2GN1A 1X8EA 2GKOA 1D6MA 1AKTA 4N5NA 2X10A 1E5VA 3NKFA 5DN2A 3PDQA 2L18A 3BTUA 5KMGA 2BN4A 3RVSA 4QWMA 2C95A 2BFUL 4WCFB 5ALIA 2P4UA 3J80A 2ZYAA 1H8TC 3ICPA 4MR9B 1CUCA 5GV8A 5K4LA 3Q7IA 2SBAA 4Y4YA 1R74A 2E21A 4HI0E 1ZRSA 5F5AA 4Q9DA 1CLUA 4DIBA 2N42A 3MQ4A 3C8UA 4RNCA 2PQ0A 1F4VA 3FCSB 4OXXA 4X1OA 5AJHA 1O95C 3FNGA 1V6LA 1JAYA 4M9CA 3OY2A 4MVJA 5FO0A 2ZAHA 1SVKA 2IE8A 621PA 1L4UA 3FWHA 4FFPA 1YSCA 1ASJ2 5K8VA 5THXA 1VL8A 3M2TA 3COYA 2QUBA 3FWZA 5BSUA 5K6TA 4GE3A 2I6SA 4DLNA 1USVA 3T5CA 2VBCA 2NXJA 3VSEA 2QPLA 1XJ5A 1Y9GA 4NPLA 2CEKA 1ZAKA 2ZHLA 4DQDA 4AJ2A 4PZZA 2L9LA 4MRRA 4MIOA 4HDSA 2BHTA 3E22A 1TVKB 4PPFA 5EXOA 2JD0A 2V7EA 5KOHB 2J3HA 4JZYA 2PEYA 3AERA 2QI9C 1AKUA 5J3UA 3FYHA 3IAHA 4B17A 3HN6A 4TL6A 1PFQA 5L8VA 1P0FA 5JSRA 1UBEA 4XMAA 4P14A 2ZPTX 3GJ3A 1L5SA 3GM8A 5F5CA 2V3VA 2VCBA 4UEWA 2HRZA 3VBUB 1POV1 2GBPA 1NR5A 1V70A 2YN2A 2DCMA 3GHYA 1ZOLA 2G0AA 4KR2A 1VCOA 1EEXB 2IYQA 4FILA 1NLZA 3GOQA 3UUFA 1I4WA 2FPWA 3ROZA 3W0LB 2C77A 3BODA 5IEBA 5GINE 1JDSA 2C3UA 3CZRA 1QJX3 5FY4A 4JBWA 2A5LA 1DT3A 2X0IA 4US1R 1M67A 4JHZA 5IKEA 1UM9A 4QBGB 4ES8A 4DDKA 3U61B 1YZGA 1Z35A 4JT4A 1R0SA 4DCGA 3UANA 1QBGA 2OHGA 5LBUA 1OH5A 2AZMA 3GALA 4LZOA 3ICQB 2W5FA 2GUWA 3ZIAA 1HE5A 3CVJA 1MQTB 4LKSA 5FNVA 2PS1A 4L5YA 3B9BA 2I9PA 3QX9A 4QHBA 1NVDA 4AJPA 3ETHA 1KQPA 2CV1A 2WS92 3S57A 1SC3A 4C2AA 4URYR 5EJZB 3AYZB 1I3HA 1XPWA 1CJPA 3UUWA 2CSXA 3QKRB 3HI6A 1WXEA 3TUJC 2VAWA 1I5PA 3B1XA 4ASMB 3HBNA 1YHNA