3M7PA

Fibronectin fragment
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
308
structure length
301
Chain Sequence
QPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FN1 protein
publication title Zinc Induces Structural Reorganization of Gelatin Binding Domain from Human Fibronectin and Affects Collagen Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 66
structure length 301
sequence length 308
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 3m7pA03
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 3m7pA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3m7pA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3m7pA04
3SW0X 1QGBA 1H03P 4FXGG 3ERBA 1CKLA 3KXVA 3NFPI 2KRIA 1VVCA 1L6JA 1HCCA 2IZ4A 2YRAA 1CK7A 2ERJA 1OK9A 5I0QB 2A55A 4KKDA 3ZD2A 4LOTA 2XRBA 1ELVA 2RKYA 3GOVA 5HYTB 1E88A 3R62A 3RJ3D 1H04P 3INBC 1TPMA 1SS2A 5FO8C 5JPMG 1CXWA 1GXDA 1FBRA 3IU3I 3L89M 4PZ5A 4A5WB 5HYUB 4WJG2 1C1ZA 4JHSA 4LOSA 2EHFA 2RL0A 3GXEA 1QUBA 1TPNA 1G4FA 4C16A 2BZMA 4AYIA 1GKNA 2B5ID 1E8BA 2JGWA 3EJHA 3OXUD 2MCYA 4ONTD 1OJWA 4MUCA 4IGDA 2JGXA 2XWBF 2CG6A 2XRDA 2O39C 3ZD1A 4B2RA 1H2QP 2RKZA 1OJYA 3M7PA 1KS0A 2EC3A 1HFHA 1GHQB 1NWVA 4CSYA 2IZ3A 1J7MA 4J38B 1MD8A 3TVJA 2UWNA 2W81A 4AYMA 1UOTP 1TPGA 1H2PP 1QO6A 1E5GA 2V5OA 1MD7A 1OK1A 2RLPA 4B2SA 4K12A 3KZJA 3OEDC 1GPZA 4F4OC 1LY2A 3O8EB 3OP8A 4YNXA 1PPQA 2CG7A 3IX0A 1SRZA 2KMSA 2LOJA 1VVDA 1GKGA 4AYDA 2FN2A 1Z92B 2G7IA 1O9AA 2XWJI 2JRAA 1OK3A 1H8PA 1G4GA 2WIIC 4ZH1D 5HYPA 2QY0A 5HZPB 1PDCA 2CKUA 2MCZA 2XQWC 4DJZA 1EAKA 2W80A 2RLQA 1HFIA 4AYEA 1U5MA 2YBYA 1Q3XA 1ZJKA 3MQLA 3CALA 1OJVA 3T5OA 1OK2A 2V8EA 3ZRZA
chains in the Genus database with same CATH superfamily
3SW0X 1QGBA 1H03P 3ZLDA 3L26A 2I2LA 4FXGG 3ERBA 1W1VA 1CKLA 1GOIA 3KXVA 4Z2KA 3NFPI 2KRIA 1VVCA 1E6PA 1L6JA 1HCCA 4MSLA 2IZ4A 2YRAA 1CK7A 2ERJA 1OK9A 3WD4A 4NZ1A 2A55A 4ZH1D 5I0QB 4KKDA 3ZD2A 4HMEA 4LOTA 2XRBA 1E6RA 1ELVA 2RKYA 3GOVA 5HYTB 4OJLA 1E88A 3R62A 4PO7A 2Y2LA 3RJ3D 2IOUA 1H04P 4NY2A 3INBC 1TPMA 1YUEA 1SS2A 3ZLEA 5FO8C 1OGBA 3F6KA 3FGRA 5JPMG 1CXWA 1GXDA 1FBRA 3L28A 3IU3I 3L89M 4PZ5A 3WD0A 4IBBA 4A5WB 4Z2IA 5HYUB 4YIZA 4WJG2 1AIWA 1C1ZA 4JHSA 4LOSA 2Y2NA 2EHFA 1YU1A 4NZ3A 4Z2GA 1OGGA 2RL0A 3GXEA 1QUBA 1TPNA 1G4FA 4N7EA 2BZMA 4AYIA 4C16A 1GKNA 2B5ID 1E8BA 2UWXA 2JGWA 3KS4A 2BG1A 1O6IA 1ED7A 3EJHA 2JCHA 4IBKA 1GPFA 4HMDA 3OXUD 2MCYA 4HMCA 4IBCA 4ONTD 4NZ5A 4Z2JA 1OJWA 4MUCA 4IBIA 4OJPA 4IGDA 4IBGA 2JGXA 2XWBF 2CG6A 2XRDA 2O39C 3ZD1A 4IBDA 4B2RA 1H2QP 1H0IA 4NYYA 1OJYA 2RKZA 2Y2KA 3M7PA 2Y2HA 1KS0A 2EC3A 1HFHA 2FFFB 1W1PA 2D49A 1GHQB 1NWVA 3L25A 2Y2JA 3N3FA 4CSYA 2IZ3A 1UR9A 4IJFA 1J7MA 4J38B 1YU3A 1MD8A 4APLA 3TVJA 2UWNA 3WD3A 2W81A 4TX8A 1UOTP 2Y8TA 4AYMA 1TPGA 1H2PP 1QO6A 3L27A 3VWOA 3WD1A 1E5GA 4OJ5A 5HYPA 2V5OA 1MD7A 1OK1A 2RLPA 3K3TA 2XD5A 5DN5A 2JE5A 4B2SA 4K12A 3KZJA 3OEDC 1GPZA 4GHLA 4F4OC 1W1YA 1LY2A 4MB3A 1E15A 3O8EB 3OP8A 4YNXA 1PPQA 3L29A 4BWCA 4QNLA 1H0GA 2CG7A 3ZRZA 3IX0A 4MB5A 4NYUA 1SRZA 2Y2PA 3WX7A 2KMSA 2LOJA 1VVDA 1GKGA 3FKEA 4Z2HA 2RTSA 4LG2A 2ZYCA 2Y8RA 2FN2A 4AYDA 1Z92B 4IBFA 2G7IA 1YU0A 1O9AA 2XWJI 3HONA 4MB4A 2JRAA 3HSHA 1OK3A 2X2ZA 3FGTA 1YU4A 1H8PA 2Y2IA 1G4GA 2WIIC 2Y2QA 4OJ6A 2Y2GA 2Y2OA 4OJOA 3KS8A 4IBJA 2QY0A 1PDCA 2CKUA 1UR8A 2MCZA 4IJEA 2XQWC 1E6ZA 1EAKA 3WSXA 3L2AA 4DJZA 3CI0J 3WD2A 1E6NA 1W1TA 2W80A 2RLQA 4IBEA 2XD1A 5DN4A 1HFIA 3WSYA 4AYEA 1U5MA 2YBYA 1Q3XA 1ZJKA 3MQLA 4NZ4A 2Y8SA 3CALA 1OJVA 3T5OA 5HZPB 2Y2MA 4Z2LA 5BPVA 4GHAA 1RLHA 4OUIA 4GH9A 1OK2A 3NJAA 2V8EA 1YU2A
chains in the Genus database with same CATH topology
3SW0X 1QGBA 1H03P 4FXGG 3ERBA 1CKLA 3KXVA 3NFPI 2KRIA 1VVCA 1L6JA 1HCCA 2IZ4A 2YRAA 1CK7A 2ERJA 1OK9A 5I0QB 2A55A 4KKDA 3ZD2A 4LOTA 2XRBA 1ELVA 2RKYA 3GOVA 5HYTB 1E88A 3R62A 3RJ3D 1H04P 3INBC 1TPMA 1SS2A 5FO8C 5JPMG 1CXWA 1GXDA 1FBRA 3IU3I 3L89M 4PZ5A 4A5WB 5HYUB 4WJG2 1C1ZA 4JHSA 4LOSA 2EHFA 2RL0A 3GXEA 1QUBA 1TPNA 1G4FA 4C16A 2BZMA 4AYIA 1GKNA 2B5ID 1E8BA 2JGWA 3EJHA 3OXUD 2MCYA 4ONTD 1OJWA 4MUCA 4IGDA 2JGXA 2XWBF 2CG6A 2XRDA 2O39C 3ZD1A 4B2RA 1H2QP 2RKZA 1OJYA 3M7PA 1KS0A 2EC3A 1HFHA 1GHQB 1NWVA 4CSYA 2IZ3A 1J7MA 4J38B 1MD8A 3TVJA 2UWNA 2W81A 4AYMA 1UOTP 1TPGA 1H2PP 1QO6A 1E5GA 2V5OA 1MD7A 1OK1A 2RLPA 4B2SA 4K12A 3KZJA 3OEDC 1GPZA 4F4OC 1LY2A 3O8EB 3OP8A 4YNXA 1PPQA 2CG7A 3IX0A 1SRZA 2KMSA 2LOJA 1VVDA 1GKGA 4AYDA 2FN2A 1Z92B 2G7IA 1O9AA 2XWJI 2JRAA 1OK3A 1H8PA 1G4GA 2WIIC 4ZH1D 5HYPA 2QY0A 5HZPB 1PDCA 2CKUA 2MCZA 2XQWC 4DJZA 1EAKA 2W80A 2RLQA 1HFIA 4AYEA 1U5MA 2YBYA 1Q3XA 1ZJKA 3MQLA 3CALA 1OJVA 3T5OA 1OK2A 2V8EA 3ZRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW0 X;  1QGB A;  1H03 P;  4FXG G;  3ERB A;  1CKL A;  3KXV A;  3NFP I;  2KRI A;  1VVC A;  1L6J A;  1HCC A;  2IZ4 A;  2YRA A;  1CK7 A;  2ERJ A;  1OK9 A;  5I0Q B;  2A55 A;  4KKD A;  3ZD2 A;  4LOT A;  2XRB A;  1ELV A;  2RKY A;  3GOV A;  5HYT B;  1E88 A;  3R62 A;  3RJ3 D;  1H04 P;  3INB C;  1TPM A;  1SS2 A;  5FO8 C;  5JPM G;  1CXW A;  1GXD A;  1FBR A;  3IU3 I;  3L89 M;  4PZ5 A;  4A5W B;  5HYU B;  4WJG 2;  1C1Z A;  4JHS A;  4LOS A;  2EHF A;  2RL0 A;  3GXE A;  1QUB A;  1TPN A;  1G4F A;  4C16 A;  2BZM A;  4AYI A;  1GKN A;  2B5I D;  1E8B A;  2JGW A;  3EJH A;  3OXU D;  2MCY A;  4ONT D;  1OJW A;  4MUC A;  4IGD A;  2JGX A;  2XWB F;  2CG6 A;  2XRD A;  2O39 C;  3ZD1 A;  4B2R A;  1H2Q P;  2RKZ A;  1OJY A;  3M7P A;  1KS0 A;  2EC3 A;  1HFH A;  1GHQ B;  1NWV A;  4CSY A;  2IZ3 A;  1J7M A;  4J38 B;  1MD8 A;  3TVJ A;  2UWN A;  2W81 A;  4AYM A;  1UOT P;  1TPG A;  1H2P P;  1QO6 A;  1E5G A;  2V5O A;  1MD7 A;  1OK1 A;  2RLP A;  4B2S A;  4K12 A;  3KZJ A;  3OED C;  1GPZ A;  4F4O C;  1LY2 A;  3O8E B;  3OP8 A;  4YNX A;  1PPQ A;  2CG7 A;  3IX0 A;  1SRZ A;  2KMS A;  2LOJ A;  1VVD A;  1GKG A;  4AYD A;  2FN2 A;  1Z92 B;  2G7I A;  1O9A A;  2XWJ I;  2JRA A;  1OK3 A;  1H8P A;  1G4G A;  2WII C;  4ZH1 D;  5HYP A;  2QY0 A;  5HZP B;  1PDC A;  2CKU A;  2MCZ A;  2XQW C;  4DJZ A;  1EAK A;  2W80 A;  2RLQ A;  1HFI A;  4AYE A;  1U5M A;  2YBY A;  1Q3X A;  1ZJK A;  3MQL A;  3CAL A;  1OJV A;  3T5O A;  1OK2 A;  2V8E A;  3ZRZ A; 
#chains in the Genus database with same CATH topology
 3SW0 X;  1QGB A;  1H03 P;  3ZLD A;  3L26 A;  2I2L A;  4FXG G;  3ERB A;  1W1V A;  1CKL A;  1GOI A;  3KXV A;  4Z2K A;  3NFP I;  2KRI A;  1VVC A;  1E6P A;  1L6J A;  1HCC A;  4MSL A;  2IZ4 A;  2YRA A;  1CK7 A;  2ERJ A;  1OK9 A;  3WD4 A;  4NZ1 A;  2A55 A;  4ZH1 D;  5I0Q B;  4KKD A;  3ZD2 A;  4HME A;  4LOT A;  2XRB A;  1E6R A;  1ELV A;  2RKY A;  3GOV A;  5HYT B;  4OJL A;  1E88 A;  3R62 A;  4PO7 A;  2Y2L A;  3RJ3 D;  2IOU A;  1H04 P;  4NY2 A;  3INB C;  1TPM A;  1YUE A;  1SS2 A;  3ZLE A;  5FO8 C;  1OGB A;  3F6K A;  3FGR A;  5JPM G;  1CXW A;  1GXD A;  1FBR A;  3L28 A;  3IU3 I;  3L89 M;  4PZ5 A;  3WD0 A;  4IBB A;  4A5W B;  4Z2I A;  5HYU B;  4YIZ A;  4WJG 2;  1AIW A;  1C1Z A;  4JHS A;  4LOS A;  2Y2N A;  2EHF A;  1YU1 A;  4NZ3 A;  4Z2G A;  1OGG A;  2RL0 A;  3GXE A;  1QUB A;  1TPN A;  1G4F A;  4N7E A;  2BZM A;  4AYI A;  4C16 A;  1GKN A;  2B5I D;  1E8B A;  2UWX A;  2JGW A;  3KS4 A;  2BG1 A;  1O6I A;  1ED7 A;  3EJH A;  2JCH A;  4IBK A;  1GPF A;  4HMD A;  3OXU D;  2MCY A;  4HMC A;  4IBC A;  4ONT D;  4NZ5 A;  4Z2J A;  1OJW A;  4MUC A;  4IBI A;  4OJP A;  4IGD A;  4IBG A;  2JGX A;  2XWB F;  2CG6 A;  2XRD A;  2O39 C;  3ZD1 A;  4IBD A;  4B2R A;  1H2Q P;  1H0I A;  4NYY A;  1OJY A;  2RKZ A;  2Y2K A;  3M7P A;  2Y2H A;  1KS0 A;  2EC3 A;  1HFH A;  2FFF B;  1W1P A;  2D49 A;  1GHQ B;  1NWV A;  3L25 A;  2Y2J A;  3N3F A;  4CSY A;  2IZ3 A;  1UR9 A;  4IJF A;  1J7M A;  4J38 B;  1YU3 A;  1MD8 A;  4APL A;  3TVJ A;  2UWN A;  3WD3 A;  2W81 A;  4TX8 A;  1UOT P;  2Y8T A;  4AYM A;  1TPG A;  1H2P P;  1QO6 A;  3L27 A;  3VWO A;  3WD1 A;  1E5G A;  4OJ5 A;  5HYP A;  2V5O A;  1MD7 A;  1OK1 A;  2RLP A;  3K3T A;  2XD5 A;  5DN5 A;  2JE5 A;  4B2S A;  4K12 A;  3KZJ A;  3OED C;  1GPZ A;  4GHL A;  4F4O C;  1W1Y A;  1LY2 A;  4MB3 A;  1E15 A;  3O8E B;  3OP8 A;  4YNX A;  1PPQ A;  3L29 A;  4BWC A;  4QNL A;  1H0G A;  2CG7 A;  3ZRZ A;  3IX0 A;  4MB5 A;  4NYU A;  1SRZ A;  2Y2P A;  3WX7 A;  2KMS A;  2LOJ A;  1VVD A;  1GKG A;  3FKE A;  4Z2H A;  2RTS A;  4LG2 A;  2ZYC A;  2Y8R A;  2FN2 A;  4AYD A;  1Z92 B;  4IBF A;  2G7I A;  1YU0 A;  1O9A A;  2XWJ I;  3HON A;  4MB4 A;  2JRA A;  3HSH A;  1OK3 A;  2X2Z A;  3FGT A;  1YU4 A;  1H8P A;  2Y2I A;  1G4G A;  2WII C;  2Y2Q A;  4OJ6 A;  2Y2G A;  2Y2O A;  4OJO A;  3KS8 A;  4IBJ A;  2QY0 A;  1PDC A;  2CKU A;  1UR8 A;  2MCZ A;  4IJE A;  2XQW C;  1E6Z A;  1EAK A;  3WSX A;  3L2A A;  4DJZ A;  3CI0 J;  3WD2 A;  1E6N A;  1W1T A;  2W80 A;  2RLQ A;  4IBE A;  2XD1 A;  5DN4 A;  1HFI A;  3WSY A;  4AYE A;  1U5M A;  2YBY A;  1Q3X A;  1ZJK A;  3MQL A;  4NZ4 A;  2Y8S A;  3CAL A;  1OJV A;  3T5O A;  5HZP B;  2Y2M A;  4Z2L A;  5BPV A;  4GHA A;  1RLH A;  4OUI A;  4GH9 A;  1OK2 A;  3NJA A;  2V8E A;  1YU2 A; 
#chains in the Genus database with same CATH homology
 3SW0 X;  1QGB A;  1H03 P;  4FXG G;  3ERB A;  1CKL A;  3KXV A;  3NFP I;  2KRI A;  1VVC A;  1L6J A;  1HCC A;  2IZ4 A;  2YRA A;  1CK7 A;  2ERJ A;  1OK9 A;  5I0Q B;  2A55 A;  4KKD A;  3ZD2 A;  4LOT A;  2XRB A;  1ELV A;  2RKY A;  3GOV A;  5HYT B;  1E88 A;  3R62 A;  3RJ3 D;  1H04 P;  3INB C;  1TPM A;  1SS2 A;  5FO8 C;  5JPM G;  1CXW A;  1GXD A;  1FBR A;  3IU3 I;  3L89 M;  4PZ5 A;  4A5W B;  5HYU B;  4WJG 2;  1C1Z A;  4JHS A;  4LOS A;  2EHF A;  2RL0 A;  3GXE A;  1QUB A;  1TPN A;  1G4F A;  4C16 A;  2BZM A;  4AYI A;  1GKN A;  2B5I D;  1E8B A;  2JGW A;  3EJH A;  3OXU D;  2MCY A;  4ONT D;  1OJW A;  4MUC A;  4IGD A;  2JGX A;  2XWB F;  2CG6 A;  2XRD A;  2O39 C;  3ZD1 A;  4B2R A;  1H2Q P;  2RKZ A;  1OJY A;  3M7P A;  1KS0 A;  2EC3 A;  1HFH A;  1GHQ B;  1NWV A;  4CSY A;  2IZ3 A;  1J7M A;  4J38 B;  1MD8 A;  3TVJ A;  2UWN A;  2W81 A;  4AYM A;  1UOT P;  1TPG A;  1H2P P;  1QO6 A;  1E5G A;  2V5O A;  1MD7 A;  1OK1 A;  2RLP A;  4B2S A;  4K12 A;  3KZJ A;  3OED C;  1GPZ A;  4F4O C;  1LY2 A;  3O8E B;  3OP8 A;  4YNX A;  1PPQ A;  2CG7 A;  3IX0 A;  1SRZ A;  2KMS A;  2LOJ A;  1VVD A;  1GKG A;  4AYD A;  2FN2 A;  1Z92 B;  2G7I A;  1O9A A;  2XWJ I;  2JRA A;  1OK3 A;  1H8P A;  1G4G A;  2WII C;  4ZH1 D;  5HYP A;  2QY0 A;  5HZP B;  1PDC A;  2CKU A;  2MCZ A;  2XQW C;  4DJZ A;  1EAK A;  2W80 A;  2RLQ A;  1HFI A;  4AYE A;  1U5M A;  2YBY A;  1Q3X A;  1ZJK A;  3MQL A;  3CAL A;  1OJV A;  3T5O A;  1OK2 A;  2V8E A;  3ZRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...