3M7PA

Fibronectin fragment
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
308
structure length
301
Chain Sequence
b'QPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FN1 protein
publication title Zinc Induces Structural Reorganization of Gelatin Binding Domain from Human Fibronectin and Affects Collagen Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 66
structure length 301
sequence length 308
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 3m7pA03
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 3m7pA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3m7pA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3m7pA04
1SS2A 1Z92B 1C1ZA 3T5OA 1MD7A 2MCYA 1ZJKA 2V5OA 2QY0A 4IGDA 1H03P 3IU3I 1OJYA 3L89M 3ERBA 4MUCA 3SW0X 1H8PA 4AYMA 2EHFA 4DJZA 2WIIC 1Q3XA 3NFPI 3RJ3D 1G4GA 4ZH1D 3OXUD 2KRIA 4CSYA 4J38B 1PPQA 3GOVA 5HYPA 3INBC 5I0QB 3EJHA 2IZ3A 1E8BA 2XWJI 2W81A 4AYIA 4AYEA 1OK2A 2RL0A 1CK7A 3CALA 5JPMG 3IX0A 3OEDC 3OP8A 2W80A 5FO8C 1G4FA 1TPMA 1L6JA 1PDCA 1QO6A 3TVJA 2XRDA 2BZMA 1OK1A 1QUBA 4WJG2 2MCZA 1OK3A 1MD8A 2RKYA 1E88A 1KS0A 2XWBF 4JHSA 1O9AA 2JGWA 2EC3A 1OJVA 1J7MA 1GPZA 5HZPB 2XRBA 1ELVA 2CKUA 4PZ5A 1OJWA 4AYDA 2RKZA 3KXVA 1CKLA 1UOTP 5HYTB 1U5MA 2IZ4A 4B2RA 5HYUB 2A55A 1SRZA 1H2PP 3ZD1A 3KZJA 1FBRA 4B2SA 4YNXA 1E5GA 2G7IA 2XQWC 2JGXA 1EAKA 4LOTA 4A5WB 3MQLA 1TPGA 4FXGG 2LOJA 1CXWA 1HCCA 2FN2A 2B5ID 1VVCA 2ERJA 4LOSA 1LY2A 2UWNA 2CG7A 2RLQA 1GKGA 2V8EA 1GHQB 3ZRZA 1HFIA 2JRAA 3O8EB 4K12A 4ONTD 1HFHA 1VVDA 2CG6A 3M7PA 2RLPA 2YBYA 1NWVA 2O39C 1H2QP 1GXDA 4KKDA 1QGBA 2YRAA 1H04P 1OK9A 1TPNA 3R62A 4C16A 3ZD2A 4F4OC 2KMSA 1GKNA 3GXEA
chains in the Genus database with same CATH superfamily
1SS2A 1YU3A 2RTSA 3ZLEA 2BG1A 1Z92B 1C1ZA 3T5OA 1MD7A 2MCYA 4IBFA 1YU2A 2XD5A 5BPVA 3K3TA 4HMDA 1ZJKA 4IBEA 2V5OA 2QY0A 4IGDA 1ED7A 1H03P 1OJYA 3IU3I 3ERBA 3L89M 4MUCA 3SW0X 1H8PA 4LG2A 4AYMA 2Y8TA 2EHFA 4IBIA 4GHAA 4DJZA 3WD0A 5DN4A 2WIIC 1Q3XA 3NFPI 4HMEA 3RJ3D 1G4GA 4ZH1D 3OXUD 2KRIA 4CSYA 4J38B 4NZ5A 1PPQA 3GOVA 1E6NA 3WSXA 4C16A 5HYPA 3INBC 3CI0J 5I0QB 3EJHA 2IZ3A 1E8BA 2XWJI 2W81A 2ZYCA 3F6KA 2IOUA 3N3FA 4AYIA 1OK2A 2RL0A 4AYEA 1CK7A 3L2AA 4MB4A 4OJ5A 3CALA 5JPMG 3IX0A 3OEDC 2D49A 2X2ZA 2Y2OA 2W80A 3OP8A 1YUEA 4MSLA 5FO8C 3ZLDA 1G4FA 1TPMA 1L6JA 1W1VA 3WD2A 1OGBA 1E15A 1PDCA 1QO6A 3TVJA 2XRDA 4IBDA 2Y2NA 2BZMA 4YIZA 1OK1A 1QUBA 4WJG2 2MCZA 2Y2LA 4NYYA 3KS4A 1GPFA 1E88A 1MD8A 1KS0A 1OK3A 2RKYA 2XWBF 4JHSA 3FKEA 4IJFA 4OUIA 1O9AA 1H0GA 2EC3A 1OJVA 4QNLA 3WD3A 1J7MA 2JGWA 3FGTA 3FGRA 4N7EA 4APLA 4IBJA 1GPZA 5HZPB 2XRBA 2Y2IA 1ELVA 2CKUA 4GHLA 2Y2QA 4PZ5A 4IJEA 4OJPA 4NZ1A 3KS8A 1OJWA 4AYDA 2FFFB 2RKZA 3WSYA 3KXVA 1YU1A 1CKLA 1UOTP 5HYTB 1U5MA 3L27A 4OJOA 2IZ4A 4BWCA 2Y2JA 3NJAA 4B2RA 5HYUB 2A55A 1SRZA 1H2PP 2Y2GA 3ZD1A 3KZJA 1FBRA 4B2SA 4TX8A 4YNXA 1E5GA 4IBKA 2G7IA 2XQWC 4Z2LA 4IBCA 2JGXA 1YU0A 1EAKA 4LOTA 4A5WB 1W1YA 3MQLA 1TPGA 1W1PA 2Y2HA 4FXGG 1E6RA 1H0IA 2Y2PA 3WD1A 2LOJA 3HONA 1CXWA 4NZ4A 3L28A 1HCCA 2FN2A 2JCHA 2B5ID 1VVCA 2ERJA 1E6ZA 1UR8A 4GH9A 4MB5A 4NY2A 2Y8RA 4LOSA 1LY2A 2UWNA 2Y2MA 2CG7A 2RLQA 2Y2KA 1YU4A 4HMCA 4Z2JA 1GKGA 2V8EA 1GHQB 3ZRZA 1HFIA 2JRAA 4OJLA 3O8EB 4K12A 3L26A 4ONTD 2UWXA 4OJ6A 4MB3A 1HFHA 3L29A 1VVDA 2CG6A 3HSHA 2JE5A 3M7PA 1GOIA 4IBGA 2RLPA 2YBYA 1NWVA 1RLHA 3WD4A 2Y8SA 4Z2HA 2O39C 1H2QP 1E6PA 1W1TA 4NYUA 4Z2IA 1GXDA 4KKDA 1AIWA 3VWOA 1QGBA 4Z2GA 3L25A 2YRAA 4IBBA 2I2LA 4NZ3A 5DN5A 1O6IA 1UR9A 1OGGA 3WX7A 1H04P 1OK9A 4Z2KA 1TPNA 2XD1A 3R62A 2KMSA 4PO7A 3ZD2A 4F4OC 1GKNA 3GXEA
chains in the Genus database with same CATH topology
1SS2A 1Z92B 1C1ZA 3T5OA 1MD7A 2MCYA 1ZJKA 2V5OA 2QY0A 4IGDA 1H03P 3IU3I 1OJYA 3L89M 3ERBA 4MUCA 3SW0X 1H8PA 4AYMA 2EHFA 4DJZA 2WIIC 1Q3XA 3NFPI 3RJ3D 1G4GA 4ZH1D 3OXUD 2KRIA 4CSYA 4J38B 1PPQA 3GOVA 5HYPA 3INBC 5I0QB 3EJHA 2IZ3A 1E8BA 2XWJI 2W81A 4AYIA 4AYEA 1OK2A 2RL0A 1CK7A 3CALA 5JPMG 3IX0A 3OEDC 3OP8A 2W80A 5FO8C 1G4FA 1TPMA 1L6JA 1PDCA 1QO6A 3TVJA 2XRDA 2BZMA 1OK1A 1QUBA 4WJG2 2MCZA 1OK3A 1MD8A 2RKYA 1E88A 1KS0A 2XWBF 4JHSA 1O9AA 2JGWA 2EC3A 1OJVA 1J7MA 1GPZA 5HZPB 2XRBA 1ELVA 2CKUA 4PZ5A 1OJWA 4AYDA 2RKZA 3KXVA 1CKLA 1UOTP 5HYTB 1U5MA 2IZ4A 4B2RA 5HYUB 2A55A 1SRZA 1H2PP 3ZD1A 3KZJA 1FBRA 4B2SA 4YNXA 1E5GA 2G7IA 2XQWC 2JGXA 1EAKA 4LOTA 4A5WB 3MQLA 1TPGA 4FXGG 2LOJA 1CXWA 1HCCA 2FN2A 2B5ID 1VVCA 2ERJA 4LOSA 1LY2A 2UWNA 2CG7A 2RLQA 1GKGA 2V8EA 1GHQB 3ZRZA 1HFIA 2JRAA 3O8EB 4K12A 4ONTD 1HFHA 1VVDA 2CG6A 3M7PA 2RLPA 2YBYA 1NWVA 2O39C 1H2QP 1GXDA 4KKDA 1QGBA 2YRAA 1H04P 1OK9A 1TPNA 3R62A 4C16A 3ZD2A 4F4OC 2KMSA 1GKNA 3GXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS2 A;  1Z92 B;  1C1Z A;  3T5O A;  1MD7 A;  2MCY A;  1ZJK A;  2V5O A;  2QY0 A;  4IGD A;  1H03 P;  3IU3 I;  1OJY A;  3L89 M;  3ERB A;  4MUC A;  3SW0 X;  1H8P A;  4AYM A;  2EHF A;  4DJZ A;  2WII C;  1Q3X A;  3NFP I;  3RJ3 D;  1G4G A;  4ZH1 D;  3OXU D;  2KRI A;  4CSY A;  4J38 B;  1PPQ A;  3GOV A;  5HYP A;  3INB C;  5I0Q B;  3EJH A;  2IZ3 A;  1E8B A;  2XWJ I;  2W81 A;  4AYI A;  4AYE A;  1OK2 A;  2RL0 A;  1CK7 A;  3CAL A;  5JPM G;  3IX0 A;  3OED C;  3OP8 A;  2W80 A;  5FO8 C;  1G4F A;  1TPM A;  1L6J A;  1PDC A;  1QO6 A;  3TVJ A;  2XRD A;  2BZM A;  1OK1 A;  1QUB A;  4WJG 2;  2MCZ A;  1OK3 A;  1MD8 A;  2RKY A;  1E88 A;  1KS0 A;  2XWB F;  4JHS A;  1O9A A;  2JGW A;  2EC3 A;  1OJV A;  1J7M A;  1GPZ A;  5HZP B;  2XRB A;  1ELV A;  2CKU A;  4PZ5 A;  1OJW A;  4AYD A;  2RKZ A;  3KXV A;  1CKL A;  1UOT P;  5HYT B;  1U5M A;  2IZ4 A;  4B2R A;  5HYU B;  2A55 A;  1SRZ A;  1H2P P;  3ZD1 A;  3KZJ A;  1FBR A;  4B2S A;  4YNX A;  1E5G A;  2G7I A;  2XQW C;  2JGX A;  1EAK A;  4LOT A;  4A5W B;  3MQL A;  1TPG A;  4FXG G;  2LOJ A;  1CXW A;  1HCC A;  2FN2 A;  2B5I D;  1VVC A;  2ERJ A;  4LOS A;  1LY2 A;  2UWN A;  2CG7 A;  2RLQ A;  1GKG A;  2V8E A;  1GHQ B;  3ZRZ A;  1HFI A;  2JRA A;  3O8E B;  4K12 A;  4ONT D;  1HFH A;  1VVD A;  2CG6 A;  3M7P A;  2RLP A;  2YBY A;  1NWV A;  2O39 C;  1H2Q P;  1GXD A;  4KKD A;  1QGB A;  2YRA A;  1H04 P;  1OK9 A;  1TPN A;  3R62 A;  4C16 A;  3ZD2 A;  4F4O C;  2KMS A;  1GKN A;  3GXE A; 
#chains in the Genus database with same CATH topology
 1SS2 A;  1YU3 A;  2RTS A;  3ZLE A;  2BG1 A;  1Z92 B;  1C1Z A;  3T5O A;  1MD7 A;  2MCY A;  4IBF A;  1YU2 A;  2XD5 A;  5BPV A;  3K3T A;  4HMD A;  1ZJK A;  4IBE A;  2V5O A;  2QY0 A;  4IGD A;  1ED7 A;  1H03 P;  1OJY A;  3IU3 I;  3ERB A;  3L89 M;  4MUC A;  3SW0 X;  1H8P A;  4LG2 A;  4AYM A;  2Y8T A;  2EHF A;  4IBI A;  4GHA A;  4DJZ A;  3WD0 A;  5DN4 A;  2WII C;  1Q3X A;  3NFP I;  4HME A;  3RJ3 D;  1G4G A;  4ZH1 D;  3OXU D;  2KRI A;  4CSY A;  4J38 B;  4NZ5 A;  1PPQ A;  3GOV A;  1E6N A;  3WSX A;  4C16 A;  5HYP A;  3INB C;  3CI0 J;  5I0Q B;  3EJH A;  2IZ3 A;  1E8B A;  2XWJ I;  2W81 A;  2ZYC A;  3F6K A;  2IOU A;  3N3F A;  4AYI A;  1OK2 A;  2RL0 A;  4AYE A;  1CK7 A;  3L2A A;  4MB4 A;  4OJ5 A;  3CAL A;  5JPM G;  3IX0 A;  3OED C;  2D49 A;  2X2Z A;  2Y2O A;  2W80 A;  3OP8 A;  1YUE A;  4MSL A;  5FO8 C;  3ZLD A;  1G4F A;  1TPM A;  1L6J A;  1W1V A;  3WD2 A;  1OGB A;  1E15 A;  1PDC A;  1QO6 A;  3TVJ A;  2XRD A;  4IBD A;  2Y2N A;  2BZM A;  4YIZ A;  1OK1 A;  1QUB A;  4WJG 2;  2MCZ A;  2Y2L A;  4NYY A;  3KS4 A;  1GPF A;  1E88 A;  1MD8 A;  1KS0 A;  1OK3 A;  2RKY A;  2XWB F;  4JHS A;  3FKE A;  4IJF A;  4OUI A;  1O9A A;  1H0G A;  2EC3 A;  1OJV A;  4QNL A;  3WD3 A;  1J7M A;  2JGW A;  3FGT A;  3FGR A;  4N7E A;  4APL A;  4IBJ A;  1GPZ A;  5HZP B;  2XRB A;  2Y2I A;  1ELV A;  2CKU A;  4GHL A;  2Y2Q A;  4PZ5 A;  4IJE A;  4OJP A;  4NZ1 A;  3KS8 A;  1OJW A;  4AYD A;  2FFF B;  2RKZ A;  3WSY A;  3KXV A;  1YU1 A;  1CKL A;  1UOT P;  5HYT B;  1U5M A;  3L27 A;  4OJO A;  2IZ4 A;  4BWC A;  2Y2J A;  3NJA A;  4B2R A;  5HYU B;  2A55 A;  1SRZ A;  1H2P P;  2Y2G A;  3ZD1 A;  3KZJ A;  1FBR A;  4B2S A;  4TX8 A;  4YNX A;  1E5G A;  4IBK A;  2G7I A;  2XQW C;  4Z2L A;  4IBC A;  2JGX A;  1YU0 A;  1EAK A;  4LOT A;  4A5W B;  1W1Y A;  3MQL A;  1TPG A;  1W1P A;  2Y2H A;  4FXG G;  1E6R A;  1H0I A;  2Y2P A;  3WD1 A;  2LOJ A;  3HON A;  1CXW A;  4NZ4 A;  3L28 A;  1HCC A;  2FN2 A;  2JCH A;  2B5I D;  1VVC A;  2ERJ A;  1E6Z A;  1UR8 A;  4GH9 A;  4MB5 A;  4NY2 A;  2Y8R A;  4LOS A;  1LY2 A;  2UWN A;  2Y2M A;  2CG7 A;  2RLQ A;  2Y2K A;  1YU4 A;  4HMC A;  4Z2J A;  1GKG A;  2V8E A;  1GHQ B;  3ZRZ A;  1HFI A;  2JRA A;  4OJL A;  3O8E B;  4K12 A;  3L26 A;  4ONT D;  2UWX A;  4OJ6 A;  4MB3 A;  1HFH A;  3L29 A;  1VVD A;  2CG6 A;  3HSH A;  2JE5 A;  3M7P A;  1GOI A;  4IBG A;  2RLP A;  2YBY A;  1NWV A;  1RLH A;  3WD4 A;  2Y8S A;  4Z2H A;  2O39 C;  1H2Q P;  1E6P A;  1W1T A;  4NYU A;  4Z2I A;  1GXD A;  4KKD A;  1AIW A;  3VWO A;  1QGB A;  4Z2G A;  3L25 A;  2YRA A;  4IBB A;  2I2L A;  4NZ3 A;  5DN5 A;  1O6I A;  1UR9 A;  1OGG A;  3WX7 A;  1H04 P;  1OK9 A;  4Z2K A;  1TPN A;  2XD1 A;  3R62 A;  2KMS A;  4PO7 A;  3ZD2 A;  4F4O C;  1GKN A;  3GXE A; 
#chains in the Genus database with same CATH homology
 1SS2 A;  1Z92 B;  1C1Z A;  3T5O A;  1MD7 A;  2MCY A;  1ZJK A;  2V5O A;  2QY0 A;  4IGD A;  1H03 P;  3IU3 I;  1OJY A;  3L89 M;  3ERB A;  4MUC A;  3SW0 X;  1H8P A;  4AYM A;  2EHF A;  4DJZ A;  2WII C;  1Q3X A;  3NFP I;  3RJ3 D;  1G4G A;  4ZH1 D;  3OXU D;  2KRI A;  4CSY A;  4J38 B;  1PPQ A;  3GOV A;  5HYP A;  3INB C;  5I0Q B;  3EJH A;  2IZ3 A;  1E8B A;  2XWJ I;  2W81 A;  4AYI A;  4AYE A;  1OK2 A;  2RL0 A;  1CK7 A;  3CAL A;  5JPM G;  3IX0 A;  3OED C;  3OP8 A;  2W80 A;  5FO8 C;  1G4F A;  1TPM A;  1L6J A;  1PDC A;  1QO6 A;  3TVJ A;  2XRD A;  2BZM A;  1OK1 A;  1QUB A;  4WJG 2;  2MCZ A;  1OK3 A;  1MD8 A;  2RKY A;  1E88 A;  1KS0 A;  2XWB F;  4JHS A;  1O9A A;  2JGW A;  2EC3 A;  1OJV A;  1J7M A;  1GPZ A;  5HZP B;  2XRB A;  1ELV A;  2CKU A;  4PZ5 A;  1OJW A;  4AYD A;  2RKZ A;  3KXV A;  1CKL A;  1UOT P;  5HYT B;  1U5M A;  2IZ4 A;  4B2R A;  5HYU B;  2A55 A;  1SRZ A;  1H2P P;  3ZD1 A;  3KZJ A;  1FBR A;  4B2S A;  4YNX A;  1E5G A;  2G7I A;  2XQW C;  2JGX A;  1EAK A;  4LOT A;  4A5W B;  3MQL A;  1TPG A;  4FXG G;  2LOJ A;  1CXW A;  1HCC A;  2FN2 A;  2B5I D;  1VVC A;  2ERJ A;  4LOS A;  1LY2 A;  2UWN A;  2CG7 A;  2RLQ A;  1GKG A;  2V8E A;  1GHQ B;  3ZRZ A;  1HFI A;  2JRA A;  3O8E B;  4K12 A;  4ONT D;  1HFH A;  1VVD A;  2CG6 A;  3M7P A;  2RLP A;  2YBY A;  1NWV A;  2O39 C;  1H2Q P;  1GXD A;  4KKD A;  1QGB A;  2YRA A;  1H04 P;  1OK9 A;  1TPN A;  3R62 A;  4C16 A;  3ZD2 A;  4F4O C;  2KMS A;  1GKN A;  3GXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...