3M83A

Crystal structure of acetyl xylan esterase (tm0077) from thermotoga maritima at 2.12 a resolution (paraoxon inhibitor complex structure)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
325
structure length
324
Chain Sequence
HMAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Functional and structural characterization of a thermostable acetyl esterase from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 121
structure length 324
sequence length 325
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3m83A00
1LPBB 4GDMA 4UBLA 5IH7A 2PUJA 1USWA 1CVLA 4Y2TA 1VE7A 4OB8A 3PUHA 4UBJA 2AJCA 4AO8A 3WYDA 3VKFA 1Q0ZA 5IVHA 2XUQA 5FLKA 4H7DA 1E89A 4EBBA 3QBJA 2BUAA 3F67A 5AKYA 5K3FA 5LZ8A 3H04A 4UHCA 1AC5A 1HQDA 1Y7HA 1GKLA 3WWOA 3ZLTA 1CIJA 3BE8A 5AKJA 5EIHA 2XMCA 5ALXA 4P9NA 1DX4A 1SCQA 1R9MA 4DMHA 2LIPA 4MQMA 2GZRA 2UZ0A 3ED1A 5AH0A 1XQWA 2AJBA 4DNFA 2WSLA 1TQHA 6YASA 3FAKA 3EBLA 5HF6A 3LS2A 2HA2A 3C45A 4ITVA 3C5WP 2ZJFA 5ALGA 4HAIA 5CXUA 4X85A 4BC0A 3WK5A 3PDCA 4QA9A 4Y2JA 1RWQA 4WFKA 3DS8A 3CN9A 3FCYA 2C5FA 5JAPA 1VXRA 3V1KA 4HVTA 2V97A 1HKHA 5BWCA 2ECFA 3STXA 3ZPXA 4X71A 3PF8A 4NMWA 4KAJA 2VT6A 4WFIA 2C4HA 5A2GA 1G4HA 5AKHA 3V1NA 4ZGBA 4BZZA 2GBCA 4CG2A 2OCKA 1HLGA 2PPLA 5T4EA 3I28A 4X3CA 4WCVA 3PI6A 4XWGA 1VA5A 1VLQA 3DYIA 2V9ZA 4PSDA 3WWEA 1QIKA 2WG1A 3AIMA 4W1PA 2B61A 3LCRA 1ZJ5A 5ALFA 2DFPA 1QONA 1CRLA 4OD0A 1YR2A 4B85A 3FLAA 4HRYA 5HCUA 5AM0A 5J3JA 2WHPB 4S0XA 3WK4A 3HI4A 2XMGA 3W05A 2BGNA 2DHDA 5LKAA 3RLIA 4W63A 1HPLA 1SCKA 2V96A 1CUJA 2Q0XA 1LZKA 2ZJ7A 2FUKA 5HK8A 1LGYA 5ALSA 1JJIA 3BDIA 5DYYA 1TCAA 3WL7A 3HACA 4E15A 1N5RA 1TRHA 3A2LA 2QR5A 4JYMA 4CIAA 2EDAA 1KEZA 5LZ2A 4G1FA 1YS2X 4IH9A 2PU7A 3L1JA 3WK7A 1R9NA 2CB9A 1BRTA 1XLVA 3FWHA 3AILA 2H7YA 5ALNA 1LPSA 4PSCA 2GBFA 4BE9A 4MYDA 2VJAA 4B81A 4N8EA 4KAFA 3AUKA 4BCDA 1AURA 2CJPA 1QE3A 1XZLA 1F0PA 1MJ5A 1XFDA 3IUMA 3BJMA 3D0KA 2G63A 2WUEA 3G7NA 5C8XA 3H17A 3PUIA 1ZGBA 4M0EA 4J3JA 4QWWA 2WJ4A 4ZWNA 4C87A 5EHXA 1FFCA 4UFOA 5JANA 3W04A 2WFMA 3FSGD 3I1IA 5JYCA 2HADA 3K9BA 5LIPA 1GPNA 2FJPA 1EVQA 2RHWA 3G0CA 1EXWA 2CEKA 1QIIA 4INZA 1ZI6A 4BRZA 3ZWQA 1HBJA 4F0JA 1EINA 4CCYA 3O9MA 1TIBA 3BIXA 2OCLA 1EB8A 4QLOA 3GFFA 3HABA 4EA6A 3WZLA 1MX9A 3STWA 3OC0A 4J0IA 2XUIA 1H23A 1Y37A 4OPMA 4UBIA 5JIBA 3IUNA 1EK2A 4UBKA 1G42A 4G9GA 1FFEA 4XX1A 4DMFA 1DQZA 4DMCA 4K6HA 3HXKA 2G4LA 3DKRA 3FYUC 3WL5A 5CH3A 1XZEA 2B20A 4JUIA 2G5PA 5FOQA 4D9JA 2HU7A 4UPDA 3G02A 2HRRA 3FOBA 1YCDA 2HHAA 2AJ8A 5C81A 4M0FA 2O2IA 5EHQA 3G9XA 1YS1X 1GT6A 2PSJA 2C5GA 3P2MA 2ACEA 3WA6A 2OAEA 4G5XA 1DT5A 1UKCA 1UT6A 1E8DA 2HA5A 1W76A 4BVLA 4KRYA 2AXEA 4L9AA 1ODTC 1WM1A 4RPCA 1A8UA 4KYVA 1BU8A 1TAHA 4FHZA 3ZV7A 2WIGA 1IMJA 4CG1A 3BL8A 1XQYA 2DHEA 5CW2A 1MNQA 4YX9A 4BTVA 1CUDA 4EY8A 3R3UA 3WKBA 4MQLA 1IVYA 5DNWA 3KXPA 4ARAA 4X6UA 3DQZA 4YASA 3A2MA 5JAOA 1MO2A 4KRXA 1Z68A 3AZPA 1XZIA 4A16A 3UMJA 5LKRA 3E1GA 3JW8A 1UOOA 4G4JA 5ALLA 5LZ7A 4E14A 1R1DA 4DYHA 2HA4A 4PO3X 1FSSA 4QDUA 2QT9A 3V48A 4UHDA 1JFRA 3I2KA 1W6RA 3PE6A 4K2AA 1U4NA 5AK4A 2WJ6A 4IO0A 4B9AA 1BROA 1EX9A 3D59A 5HKAA 5C8ZA 3WA7A 1C4XA 4G4IA 4U2GA 2HU8A 4U2FA 2H7XA 3KSRA 1DWPA 4XVCA 2VAXA 3C6XA 4HTAA 2JBWA 3FNBA 4G8BA 5AIAA 2CMFA 4A5SA 1X2BA 1CUHA 2YH2A 2GBGA 2HA7A 2Y6UA 5AI5A 2ONCA 5DLPA 1A8QA 5JAUA 5FXMA 1E5TA 1CEXA 4UBMA 5AO9A 1F0NA 1ZD2P 4C4ZA 4F5ZA 4G4GA 2Y2UA 2V98A 3DJYA 3D3NA 2PUHA 3W06A 1M33A 4BAGA 3AIOA 2B4KA 4Y9SA 1O6FA 2JGEA 2J4CA 4MEAA 3W9UA 3WKAA 4LXGA 4LXHA 5IVKA 3RM3A 1BEEA 3I6MA 1AUOA 4X00A 1EHYA 3B3QA 3WMRA 4L3WA 5ALQA 4W9RA 4ZRDA 1E3QA 4HXGA 1JKMA 2ZSIA 5ALOA 1H2WA 5ALMA 3R3WA 1IUOA 4ARBA 5EGNA 1ZGCA 4N5HX 4G8CA 4XJVA 1Q84A 3TRDA 2XLBA 3EQ7A 1ZOIA 5HF8A 3R41A 3DOHA 1W52X 2C7BA 5AKGA 2QUBA 3C6YA 2YYSA 2WFLB 1WCYA 2OQIA 4GEGA 2J3DA 2PKYX 3KDAA 4H77A 4QZVA 3ILSA 4QDZA 1DWQA 2WG2A 2PBLA 5FKJA 1NU6A 1YSCA 3X3HA 5BV7A 4UFPA 2BKLA 1UK6A 1MNAA 3E3AA 2QS9A 5CMLA 4BVKA 4F21A 2WHPA 1CUWA 4UBNA 3WK8A 2XUAA 3IA2A 3SK0A 2VEOA 3IUJA 4X7BA 5ALJA 1UKBA 1QIEA 2QTBA 4FLEA 4MJ3A 3A70A 3QZUA 4A23A 4CIBA 1R4ZA 2XDWA 2ZVDA 2WU3A 5ALKA 1WOMA 3VVLA 1PV1A 3HSSA 4Y2YA 5ALVA 5SYNA 4AX4A 3DNMA 4OSEA 2ZJ6A 2WLSA 3DKKA 4U2EA 3O95A 2XUKA 5ALTA 1HDEA 2HFJA 3DDUA 5K3BA 3G8YA 2WQZA 5AOBA 2I3ZA 4HS9A 3HJUA 2GBIA 2HDWA 4UHBA 4BYMA 1K5PA 1XZAA 5CT9A 5AI0A 5T4FA 1ZI9A 2O7VA 1NX9A 5D3ZA 3M81A 4LXIA 2JGIA 3AZOA 2VJDA 4Y2UA 1UK7A 4AXBA 5JATA 5DTIA 2R8BA 2VTVA 1KU0A 3R3ZA 1EDDA 2WUGA 4GLBA 2O2GA 1QIDA 2WHRA 2WTMA 2XMBA 4CCWA 4G8DA 1LPOA 5ALEA 1VE6A 1CUEA 3C70A 1CLEA 4AO7A 1XZKA 4E11A 1QGED 3H19A 5AOAA 4QLAA 3STTA 1LBTA 3FSGA 3BF7A 2QXTA 3O0DA 2WM2A 4GXNA 5EI5A 5AM2A 4Y2QA 4K6KA 1XRQA 1LZLA 3G0IA 1CUIA 1BS9A 3QPDA 3FBWA 1AMNA 1J1IA 2X5XA 1XKTA 3HC7A 4C89A 4ROTA 2YXPX 2ZSHA 2JGFA 4U2BA 3VXKA 2K2QB 2ZYHA 4BCCA 1T2NA 2WFZA 3K2IA 4Y2XA 2FX5A 5JZBA 1PFQA 1K4YA 3E0XA 2JGJA 2QKYA 4X90A 2WTNA 1JU3A 5AICA 3IIIA 3MGAA 2XUJA 4AB1A 3DOIA 4DNQA 4MEBA 1XQXA 5JASA 1CFJA 5ALZA 1JJBA 5LZ4A 2OXEA 1CR6A 2XE4A 3WK6A 4EY5A 5AJHA 4LYDA 5AK5A 3AFIA 1WPXA 5CH8A 1PJAA 1DT3A 1UZAA 1X2EA 1YB7A 2OGSA 3FYUB 2VA9A 4P92A 3WK9A 4BDTA 5A7FA 1FFAA 4BTLA 1ACLA 4J7AA 5DYTA 3H1AA 4RE6A 4DM7A 3BDVA 3OM8A 3IB3A 4Q82A 3VJKA 1VXOA 1U65A 4AMYA 4J0DA 1VA4A 4FWBA 4HXFB 2XQGA 4OYLA 2BGRA 4BBZA 4J0GA 4I19A 5ISMA 1DQYA 2XUPA 1J07A 3VISA 1QFSA 1CV2A 2HA6A 5HF9A 4DNPA 3QYJA 1DU4A 2QVBA 5FP0A 2VATA 2E3JA 3FLBA 3PFBA 5AI4A 2XUGA 4LKOA 3DCNA 5AI6A 1ACJA 3WWPA 3ICWA 3GZJA 4GBGA 3IBTA 1QJ4A 3H2GA 2QXUA 5ALYA 4ZXFA 3RK4A 4FNMA 4AN0A 1CUVA 4OU5A 3D5EA 4EB0A 5HKBA 2WIFA 3RKSA 1XRNA 1R88A 1FFBA 4B83A 3KD2A 4MWTA 1DX6A 5E2IA 3OURA 4FBMA 4FTWA 5D7BA 5JD5A 1A88A 1MTZA 5F4ZA 1UXOA 4EZIA 5T4HA 1MX1A 3NWOA 3W9BA 1JT2A 2XMDA 5AP9A 1XLWA 5HQ3B 1JMYA 1BN7A 4EY4A 4EY7A 4B84A 1GZ7A 2HL6A 4QEKA 4YK7A 2AJDA 1Q0RA 2RONA 3LIIA 5HK9A 3WJ1A 4WJLA 1MU0A 2I3DA 4AN1A 4UBOA 3QM1A 2XLCA 2XQJA 4KE8A 2HA3A 2PM8A 4I4CA 4GWLA 1XKLA 3KWJA 3L1HA 5K5EA 1N1MA 4Q34A 3ANSA 3N2ZB 1ORWA 4B82A 4CFSA 3MVEA 4XIIA 1VJ5A 4J03A 2Y2VA 3QMVA 3STYA 3AJAA 3M83A 1TCCA 3IUQA 1AX9A 3EQ8A 3WJ2A 2I78A 3ICVA 4ZV9A 3NOXA 4JEIA 1FJ2A 5FPPA 4DMKA 1VOTA 2HRQA 4AZ0A 3ZLUA 1CUCA 3C8HA 4BAZA 3VJMA 1NU8A 1XZHA 3OTQA 1UOPA 3Q0TA 5HZGA 4C6HA 1T4MA 2QMQA 1JMKC 2CBGA 1J2EA 5DNVA 2OGZA 2BAGA 2OQVA 4EY6A 3W2TA 1YA8A 1ZD4A 2Z5GA 2WIJA 4H7KA 2CUTA 2XT0A 3F96A 5T4BA 4NS4A 5K3DA 2ZYRA 2XQIA 1OILA 4B80A 5JD4A 4AO6A 2H9YA 3QPAA 5CBKA 3TJMA 1SOMA 1E66A 1L7AA 4DTCA 5K3EA 2XUFA 2XUOA 2ZYSA 4FFVA 1XZGA 1P0QA 3ESDA 5A7HA 1QOZA 2QRUA 4X95A 1QFMA 1ZD3A 4P93A 3QVMA 4QWMA 4DSZA 5ALIA 4G9EA 1K63A 4JYPA 3ESCA 3I2GA 1EDEA 3DD5A 1CUFA 3NUZA 5I7UA 5AK6A 3DEAA 4KE9A 5AKKA 1H22A 3STUA 1TCBA 3T52A 2O7RA 3D2AA 3QMWA 3H2IA 2YASA 1Y7IA 3WKEA 1QZ3A 2PSEA 1GXSA 4F60A 3A6ZA 1H2ZA 5CH5A 4J0JA 4RGYA 1J06A 4WFJA 5FPQA 1QIJA 2BFNA 1L7RA 1BN6A 5KWIA 2WIKA 1UFOA 4KJXA 1SFRA 4GECA 3R3VA 3O9VA 4AQDA 5DYWA 5IKXA 3IVMA 3WIBA 4B0PA 2P8SA 3CXUA 2WIDA 4HRXA 2VF2A 2IITA 4Z49A 3H2JA 1UK9A 2DQYA 2C0PA 1QIFA 4Y2RA 5SYMA 5C7YA 4FOLA 4BATA 4H7HA 2WJ3A 1RYYA 1YAJA 2XUHA 2QZPA 1QIHA 2RAUA 4OUKX 4ZREA 1GGVA 3D4LA 5AKZA 2QJWA 1AQLA 3IURA 4WY5A 1LLFA 3WI7A 3H2HA 2X76A 1K8QA 2PL5A 1L7QA 4FBLA 4N8DA 3V9AA 1IUPA 3OG9A 3JYHA 3G0BA 1WB5A 4J0KA 3I6ZA 5FDFA 4DNOA 1JJFA 3V1MA 4BDSA 5JALA 1GQSA 4MXDA 3D2BA 2J3QA 1LNSA 3NGMA 2VT7A 4TPKA 4RNCA 1XRRA 4QDTA 4H18A 3KWFA 2D5LA 4BC1A 1ZJ4A 5AKXA 2Z3ZA 3I2IA 4Y7DA 4X92A 1WB4A 2O2HA 1XZFA 4OB6A 3BF8A 5D6OA 4K5QA 2HA0A 4B9EA 3AZQA 3G9ZA 1YAHA 3GBSA 5KWJA 2HU5A 4FKBA 4J0HA 3LP5A 3R40A 3SX4A 3ZLVA 3D7RA 5H3HA 3U0VA 3WKDA 2DSNA 5ALDA 5CT5A 4J0CA 2RIPA 4QE3A 3S2ZA 4BVJA 3GA7A 2XMZA 4UHEA 4X91A 3WWDA 1AZWA 4I3FA 1MAAA 4DSAA 1VZ2A 5CRIA 2QOEA 3FYUA 4IQ4A 2BUBA 3BWXA 3I2HA 3ANTA 5A62A 2VQ6A 5LZ5A 1BEZA 1O6GA 4QNNA 3CCCA 3LLCA 2BUCA 1N5MA 4BP8A 5EIAA 1C7JA 1UK8A 1CUUA 2W6CX 3QPCA 5ESRA 4DGQA 3QMMA 3DLTA 1B6GA 4H0CA 4ETWA 3N0TA 4IH1A 2EDCA 5DNUA 2VAVA 1E8MA 1YASA 4GW3A 5LLSA 3C8DA 3I1YA 5DTJA 2JGLA 1QTIA 4LHEA 3OOSA 4IHAA 1AKNA 2OAGA 2VJBA 2DCMA 3HLKA 1U8EA 4GHWA 4W1QA 4Y2VA 1CUZA 4PW0A 4OB7A 4DIUA 5E4YA 3ESAA 3SWWA 3G0GA 3H0CA 3WKCA 5YASA 4WY8A 5AK3A 2XMRA 3F9CA 4UFNA 4B7ZA 1R50A 3FYTA 5ALHA 4OYYA 4OU4A 1QIMA 2OPHA 5IVDA 2OCIA 5ALUA 3M82A 1MAHA 5ALPA 3LIPA 2PSHA 1XRMA 5K3AA 4BE4A 1OCEA 2WG0A 4Y2SA 5AKLA 4Q05A 5ALWA 1CUYA 3FCXA 2XB6A 2JEYA 5HQ3A 2OLEA 2XUDA 3Q8WA 1CUGA 1SC9A 1EK1A 1WB6A 5HFAA 1UWCA 3BIWA 4BB0A 4B6GA 2IIVA 4ZI5A 3F98A 4X97A 3HZOA 3QH4A 3O4HA 2XMSA 3VVMA 4OCZA 5A71A 1UOQA 2DQZA 4EUSA 5CURA 2ROQA 1LPNA 5IVIA 3ESBA 5LYYA 5AM1A 3VDXA 5LP1A 3E4DA 1EDBA 3S8YA 4PSUA 3PFCA 2JIDA 4Q1VA 5E4JA 1VZ3A 3DL4A 5AKEA 3U1TA 3F8SA 2DHCA 3IDAA 1E8NA 4LYEA 2ACKA 2JGMA 3D2CA 1R3DA 1ZI8A 5A7GA 4M0MA 2FJ0A 2XQKA 1GKKA 3STVA 1MPXA 4P08A 5I9IA 5CXXA 4KEAA 4H7FA 3EQ9A 4YPVA 2OG1A 2QJRA 2WUDA 1LPAB 1ZD5A 2GYWA 5K3FB 3SC2A 3B5EA 1QTRA 5AI9A 1B41A 4N8SA 3C43A 3L1IA 4AZ3A 2JEZA 4KE7A 4TVKA 5EHNA 5AI8A 5KBYA 1EVEA 2GYUA 2VJCA 3C6BA 4KAAA 1JI3A 2H1IA 1GPKA 2J4FA 4H7EA 7YASA 1S8OA 4IH4A 3CCBA 4BCBA 1ISPA 4L0CA 1ORVA 1W4LA 3C87A 3I2FA 2PU5A 4FLMA 2OCGA 3FVRA 1C7IA 4NVRA 3C5VA 1ODSA 2NW6A 2ORYA 3O4IA 4Y2PA 4ZV7A 2IX9A 3IULA 2D0DA 1QLWA 3I6YA 4BRSA 2Z8XA 4FNGA 2WILA 1ODCA 3EF3A 2QM0A 3C6ZA 1H2YA 1BCRA 4FFWA 3UUEA 4EHBA 1ETHA 4V2IA 3WL8A 1MN6A 1XROA 1XRPA 4UHHA 3H2KA 4B0OA 4PV7A 1P0IA 5AM3A 5AKIA 2XI4A 1ZICA 4Q3LA 5D3KA 1WPRA 5DJ5A 5DWDA 3BJRA 4WDQA 1EA5A 5C8VA 5E4TA 1Q83A 4HXEB 3HRHA 4QDOA 3R3YA 2CZQA 2HFKA 2PVSA 4KACA 3DL7A 4JH0A 1WHSA 3F97A 5K3CA 5AM4A 4PF1A 4MWSA 3RARA 4BP9A 1QO7A 3WLAA 4BAUA 2RHTA 2BJHA 3G9TA 4TGLA 5JZSA 1THTA 1BCSA 1CQWA 1THGA 4JNCA 1RP1A 2EEPA 4Q3KA 2Y1KA 3WQHA 4BZWA 3UUFA 3ZI7A 4O08A 1XZBA 1XZJA 3GROA 1HL7A 1JU4A 1KU6A 4W1RA 4X94A 3R3XA 5JAHA 1ZIYA 3JWEA 4NZZA 5AM5A 1ZIXA 5I8PA 1CQZA 5A6VA 5EHZA 5ALRA 2DR0A 1QO9A 2H7CA 3KOOA 2X8BA 1AGYA 5KREA 1D07A 1K6EA 3DYVA 1XZMA 3WIOA 1XZCA 2R11A 1VKHA 1XLUA 1DINA 1X70A 5CT8A 4H35A 1MX5A 1XQVA 4FDMA 2C58A 2ES4A 5CT4A 3WZMA 3G9UA 1IUNA 2WFLA 2GZSA 1W1IA 3QITA 1XRLA 3FVTA 5EIEA 2ZYIA 4GI1A 1I6WA 5CT6A 3CN7A 3MUOA 2RI6A 3PICA 2BCEA 1YA4A 3WYNA 4WDRA 4U2DA 1DWOA 1YB6A 1QIGA 1IZ8A 4KR0A 2PX6A 1MT3A 5BWBA 4C88A 1CUSA 2WUFA 2WU4A 3TGLA 3H1BA 4H7JA 3GELA 2W22A 4L72A 3EIOA 5LZ9A 3I2JA 3H18A 2PSFA 4CCYB 5FV4A 2Y6VA 4U2CA 4CI9A 1CUBA 3O4JA 4X6XA 2QUAA 1UKAA 3MUNA 4H7IA 3TEJA 1CUAA 1LPMA 4E46A 1DTEA 4AMZA 4HZGA 5JADA 1BE0A 3OPMA 4FLFA 5BOVA 1P0PA 2I03A 5AOCA 3AINA 4PQEA 3VJLA 3K6KA 5AHXA 1IZ7A 5HFNA 5HF5A 1F8UA 3FLEA 3PF9A 2Z8ZA 2JGKA 1EI9A 3HEAA 4QDXA 1TKRA 3M3DA 1G5FA 5CTAA 1LBSA 4Q3OA 1WHTA 1P0MA 5EFZA 1A7UA 2HM7A 4N5IX 5JZ9A 4CG3A 3WWCA 4DLNA 4X93A 3WL6A 4UHFA 2HIHA 1TK3A 3GUUA 2XQFA 2GYVA 1FFDA 2VSQA 3R0VA 4PNZA 2PSDA 4C01A 1EH5A 4KE6A 4RE5A 1SCIA 5FUMA 1LPPA 2G5TA 1CPYA 1H2XA 4LIPD 5JD6A 4C4XA 2RGUA 3AIKA 3O4GA 1GQRA 1GPLA 1F6WA 4W1SA 1W75A 3A2NA 1G66A 2JF0A 4K6GA 2C0QA 1CUXA 5FRDA 3HYSA 1A8SA 4C4YA 1U2EA 1EB9A 2XMQA 2AJLI 2WHQA 1N8SA 3B12A 2B9VA 3V1LA 3BXPA 3G0DA 4FMPA 3T4UA 2OGTA 4MYSA 4UUQA 1OXMA 3YASA 5AIBA 2CKMA 1XZDA 4X6YA 5JARA 2Z3WA 2WKWA
chains in the Genus database with same CATH superfamily
4YA6A 5JFGA 1J8FA 3ZNQA 4EG7A 3UIEA 1M5RA 5CPFA 4EKIA 2PUJA 1KHTA 1U2PA 1O4WA 2V0CA 3CF2A 3PUHA 4MLPA 1HNZB 1XVAA 3PHGA 3T8YA 3ZWBA 2XTNA 1T34A 5C9ZA 1FCJA 1BO6A 3WYDA 4BFTA 3PBKA 5IABA 3CG4A 1DAGA 3U5TA 1X3LA 2QZSA 1ESMA 3B6MA 2BN4A 3P4XA 2IPNA 4GYWA 1GU1A 4F4JA 2JDID 4N6GA 5IVHA 3PK0A 3PKZA 2O0JA 2IK8A 2O1XA 1T8WA 4NJEA 4Y30A 4BVGA 4PC1A 3RJTA 4H1WA 1TZCA 3F3MA 5DBIA 2XKJE 4EBBA 3OCJA 1PFUA 2A5LA 1DO0A 1B26A 5AKYA 3GJZA 5K3FA 3D3KA 2AA3A 1FZQA 2I6SA 1F20A 4EFKA 2C9BA 3GCWA 3TLYA 4B8ZA 3ZLTA 4ZYLA 1CIJA 1NC3A 4NMLA 4RZ2A 2NTEA 5AKJA 521PA 1ZZGA 2XMCA 3A1DA 2D4HA 4EB3A 4LNUA 4NENB 4M8IA 1CR1A 1TJ4A 3BMQB 1SCQA 1ZOOA 4BX2A 1TB4A 3UKJA 1RNLA 4YONB 4DMHA 1DKLA 4PYMA 1Z6TA 3D6UA 3ER6A 2BMDA 1YZHA 1ZN9A 3PV0A 4J6FA 4V0NA 4DN6A 1RM0A 2H07A 4DL9A 2UZ0A 2YVLA 3IP7A 4PZZA 5BSRA 5DNCA 1ZAKA 4FNAA 5H9WA 2NZXA 4H6XA 4C2BA 4GR4A 5AH0A 3URMA 1XQWA 4IEIA 1MAUA 2CCGA 2NTYC 5JXIA 5I01A 2AJBA 1RQLA 9LDTA 3I5AA 3RTDA 3HJNA 4DV5B 4Q9NA 2WWIA 4WKGA 3WWZA 1ZRSA 2QLBA 6YASA 3HLTA 4CMEA 4DC0A 1FSPA 1PE0A 2PLNA 2PX8A 5IW8A 1KEWA 1KK0A 3IDQA 3V4SA 5KNBH 4WCDA 3CX6A 3OQIB 3P0FA 3L6UA 4FN4A 1EX7A 3CZ9A 2RB5A 4PLPA 4LEIA 4TRRA 3VC1A 4CL0A 3C4QA 3EZFA 4KODA 5ALGA 3G1TA 4MUMA 2W6ID 4X85A 2BGIA 4N5LA 4BC0A 5JXJA 5HTOA 4EZBA 4MV1A 1Y81A 5JI2E 1O87A 2YWDA 1DRVA 2WP0A 1XAJA 3RVLA 2AFHB 3W6OA 3PDCA 3FJ1A 4QA9A 4Y2JA 5IHXA 2DZDA 5KSPA 5F9FA 1IBRA 4Q1CA 1GTG1 3CN9A 2IXBA 3FCYA 3G5MA 1YJ5A 1CJBA 1QCZA 3PRJA 2LPMA 3R7LA 1CZOA 1FDRA 2ZAMA 4MVJE 2VF5X 2D5CA 4QFMA 3CRNA 4Q3EA 3V1KA 2JLWA 4JVOA 1PK9A 2W2LD 4EHLA 4G1UC 2GZ1A 2QD5A 1VKZA 5EJ9A 4KX3A 1IQRA 1Y1PA 4LY6A 1GA4A 4N40A 5JOQA 5FWXA 1L6RA 1HKHA 3OWXA 3MMSA 5CB0A 2R8RA 3EC2A 3AJRA 3ZHBA 3M3PA 3RVOA 1JTVA 3IOCA 4UAUA 3OEWA 4FR2A 1TMYA 1EUDA 3FGPA 1J25A 3AIIA 4OP3A 4KPGA 3Q6NA 3L9WA 1I3KA 1A7JA 4UARA 4HDMB 2OYCA 4CLRA 5JTTA 2YFQA 4BQEA 3WO0A 4N7JA 1A5ZA 3NCHA 2VT6A 2C4HA 1GJRA 1V71A 2VUHB 3NZEA 3D4OA 5TT1A 3CGWA 2XBMA 5DN6D 3EPPA 1UBMS 5J4LA 3ER9A 2FFJA 2RAFA 4K9OA 1N8KA 3QTBA 3CLRD 4BZZA 1IPFA 1J97A 2VT3A 4R2KA 3VU8A 2OCKA 3EA4A 1NUSA 5EJ8A 2IS6A 2PPLA 2PXCA 4GYKA 1GCOA 2G08A 3I28A 2ZANA 3PIIA 5TQ0B 3UENA 4DY6A 4K9MA 2X0NA 1JR6A 2P6OA 4DA8A 5DF1A 3HXMA 1UPUA 1KARA 1JBKA 1DJLA 1GYQA 1SIOA 1GNLA 2CVPA 2G40A 2VP0A 1JEJA 3L02A 3OPYB 1R0WA 3T0GA 5F3WB 1NRIA 1G8KA 1KYVA 2CNBA 2GPTA 3CSSA 3TJRA 1VLQA 1KKUA 4AY5A 4CT0A 5DTEA 3GPCA 2MYPA 1P4GA 2V7XA 4ND5A 5EMLA 1OA1A 3NIWA 5B3KA 1HA3A 1U98A 1V8DA 5CYGA 3CLHA 2G8LA 5F21A 1EP9A 3GLTA 5LQCA 1AKYA 1ZJ5A 3R3JA 4YT5A 3WGZA 5ALFA 1U0LA 4RFSA 5B1EA 2ZCJA 4NIMA 3K0FA 4ZEOA 1P1CA 1SOVA 3PQ5A 1RKVA 1VMDA 2SBTA 1AJEA 2AHRA 2QW8A 5T8KC 4I1SA 2PMBA 2JCSA 3DQQA 3QOWA 3ELUA 4HQOA 4H17A 4ZA2A 1JHMA 3AR9A 5C4IA 1D1TA 4U6QA 4F7WA 4OQMA 3WK4A 1U0GA 2BEUA 4GC5A 2FE4A 2HCBA 2XMGA 1D8TA 3OZAA 3OEYA 1UDRA 3W4KA 1FMFA 2BGNA 3ELDA 4CW7A 1XDUA 1PQYA 3E53A 3KLOA 1XJWA 3PDHA 3RLIA 5A4KA 4W63A 3ZCTA 2R47A 1QAOA 3LVBA 5DX8A 1UKEA 2Q5IA 3SBEA 3G59A 1WXXA 2BY4A 5CNIA 4TS3A 4X3PA 4ZAWA 4AY6A 4GE3A 1A72A 1CUJA 1FSFA 1LZKA 3MW8A 5DCYA 1UMCB 4JP3A 2B4RO 2ZI6A 5HK8A 1N2HA 1VSTA 4EI9A 3EXAA 5CIYA 5CX1B 1JSRA 5T6BA 5JSHA 4EHAA 2HT1A 2EKBA 3FR8A 1JA1A 2GCIA 1Q7EA 2FSVA 3L0YA 3S81A 4B47A 1SULA 3FVQA 4M7WA 5ALSA 3QELA 3TLXA 3A1NA 3KLBA 1AA9A 4L51A 1O89A 4AI6A 1C3XA 3ZUGA 4BKUA 2IYXA 3KZCA 5DYYA 3RYFA 5BUZA 3HACA 1PS9A 3WVNA 5EWMA 2F1JA 1Z34A 4AMVA 2ZJ3A 1TRHA 2G9NA 1K86A 4GO1A 4WNCA 1P1HA 1VPLA 4IDBA 1QRTA 4CIAA 1P4RA 5BMOA 1KEZA 2V7QA 5LZ2A 4PWYA 2PQ2A 4IH9A 2QU8A 1E5DA 1GGNA 1DAFA 3JRXA 4BV9A 1OX4A 2DSTA 3CZ5A 1G3UA 3FPBA 4RPKA 1SQ0A 1UXIA 4U9HS 3K6SA 3WK7A 1SG9A 3NP7A 3CX7A 4B6EA 4PZ0A 3TNJA 1U7UA 1RFLA 2DB3A 1UBRS 3TW4A 5GZ1A 2IH5A 2QMYA 3P9QA 1TK9A 5C34B 2O3RA 1TADA 2J5RA 5IJAA 4E12A 3IJPA 4N8EA 4PC6A 4ATNA 4EJ2A 2C07A 4BCDA 2CJPA 2QLMA 2VKQA 5EIBD 4FEYA 1SQ6A 3PYXA 3EXG2 1AHIA 1F0PA 4C0WA 5B58C 1RBYA 2P2LA 3I0NA 2FPSA 1TLFA 1VL6A 3PVCA 3BJMA 2CBXA 2G63A 2QENA 3D0KA 3W5CA 4UOEA 3KQUA 1QFZA 3MINA 2P9QA 2PLRA 3DE0X 2KBEA 3A4MA 3DFKA 3SJUA 4RGQA 3ZE6A 3LBYA 1C7RA 2E5WA 1XIVA 5LUAA 1S1MA 1U4SA 2PT6A 4IV5A 3SLKA 4D44A 3SYTA 3ZI4A 1K2VN 2Z0MA 4AN4A 3NKVA 1ILEA 3D0OA 4WWHA 1MJGA 1MRZA 3OZCA 4QHSA 4KO2S 4HUTA 5JCXA 4NR0A 1Z6AA 4B3RB 3IO3A 4FI3C 2MINB 3I9JA 3N1UA 4C87A 4KV9A 4U39A 4UFOA 5EYPA 4JQZA 5HZMA 3UW3A 3WIUA 5IWAB 2CEAA 3KQKA 3FX2A 1M2VA 2FVYA 1TAQA 3LHDA 3WNBA 3FSGD 4CMIA 2VZEA 1EM8B 3I1IA 4DCMA 5LIPA 1QKIA 1Z5WA 3F73A 1GPNA 2GCPA 1W0CA 4KUHA 2FKNA 4M1WA 4QKQA 5ADWA 5IFKA 1NN5A 1SO8A 1GY8A 2RHWA 3QTTA 4EJSA 6REQB 9MHTA 4A8PA 3LYHA 3LGAA 3R9IA 1ZC4A 4DWJA 5C5CA 1BD4A 4AP6A 1TM4E 5JMWA 4YRBA 1F2DA 3BBLA 1DX9A 3S1SA 1W47A 2QRKA 4GPIB 2ZIGA 4XEUA 2OBBA 3VGJA 1T8TA 3O9MA 5B7QA 2GEUA 3GFBA 3H5IA 3S5UA 3BIXA 1DBIA 3ZI0A 1E18A 2AR0A 3MJCA 1NVBA 1EB8A 1UCFA 2XF8A 1KYXA 1Q2UA 1BDBA 2UZ1B 3JD1A 3RSLA 4F97A 5AVQA 3B6KA 2JPDA 5ITVA 1N78A 3K9QO 1FB5A 4OJNA 1M6WA 1W93A 2NYUA 3LRPA 4X8MA 2XEXA 3PUJA 4RA9A 5L4NA 4FZ5A 3DW3X 1G4UR 2GAFA 1QWSA 1ESNA 3OE7D 4C7XA 1UJ5A 5A4AA 2F62A 4LI3X 1Z6XA 1RQGA 2G07A 3Q0IA 4OV6B 4OAQA 4YXWD 1GN9A 2BFCB 4H08A 2FEOA 2GK7A 1O96B 2H2HA 5KQLA 3U7QB 3IUNA 1Y9AA 3WFIA 2X8JB 2FWRA 2FRXA 3I0ZA 2HBQA 4YAJA 2H57A 3NTXA 3O3OB 4LCEA 4U8HA 4HK4A 3S8EA 3DTTA 8ABPA 5THKA 4DMFA 1KMMA 1IG0A 1DQZA 1QV6A 2CL0X 3N2YA 3ZE9A 3UMYA 2P8JA 3DKRA 3TRJA 3QVVA 4BV8A 5ESWA 4PWZA 5CH3A 1AUPA 2PZMA 3H2YA 1WD5A 1YO6A 2B20A 2GM9A 2QAGA 2VTKA 4JUIA 2G5PA 4UM9D 3MT8A 5FR2A 1ENOA 2CZGA 3K0SA 2V6MA 2W8BA 2BFWA 2CLLB 3EZYA 1HOXA 4FGLA 4AYTA 4CM7A 1Z15A 5LOVA 2HRRA 1V6CA 1SGWA 3ZCQA 1JA9A 1FDUA 1GGFA 2IZ5A 2YWEA 3F8WA 5AJTA 3V4LA 2R79A 2AEFA 4UM8B 4X6LA 4HB3A 3EUFA 4DLKA 2B99A 2JB9A 2OL4A 4DSUA 5C81A 2X5NA 3HB1A 1S0UA 2O2DA 1ATIA 5IZ4A 1MB0A 1UM9B 2HXGA 2P6UA 3G9XA 2HK7A 1IY9A 5JS8A 3THYA 3OOJA 1C9EA 4EPWA 5J1SB 4KOEC 2C5GA 1FA9A 1SBHA 4MYRA 1WL8A 1EGVB 2Z5VA 4OIFA 3ENKA 1OLSA 4CN8A 1ZCFA 2YHIB 1UZNA 2C42A 3EPKA 4X62B 1D0SA 1FQWA 1QO0A 1YBFA 3VOBA 1RQ7A 4F8EA 4DRYA 1FL9A 5I48A 2L17A 3SR0A 1PZHA 4IIGA 4MR8A 1D4AA 4IZ6A 1DT5A 3ORFA 2CUNA 3ZDYB 1OI4A 1PNOA 1W30A 1W76A 3QA9A 4BNZA 5JYDA 3ON5A 2GF0A 3ZK9A 2R1ZA 3SC2B 1Z5UA 2VSYA 5F9MA 4O5AA 3IPYA 2FPMA 4LKRA 5FBKA 1NMQA 1TFRA 3KAJA 3A9CA 1TDJA 1VKJA 3L1UA 4J1SA 5CLQA 5I9SA 2VQFB 4EDHA 3ERCA 1BU8A 4KYVA 2GUGA 3BXOA 2X15A 3Q0EA 2V4MA 4H60A 2OO7A 2LCIA 4M1QA 5DM1A 4F3KA 1L4GA 2CXHA 5CAEA 1NQAO 1FUIA 3PC3A 3VV3A 4CG1A 4ZRMA 1NZFA 1UPXA 2CLOB 2ETVA 1V37A 4CMAA 3IILA 3JWHA 1WABA 3L93A 5LDGA 5C1OA 3JASA 1NSTA 3KJIA 3EVBA 3OTIA 3W7VA 4YX9A 3V7NA 2BZSA 2Q45A 1PG5A 7ABPA 2FPIB 1CUDA 2AZ4A 4Q15A 3ZUPA 5BN1A 9LDBA 1YZNA 4EY8A 4LDAA 1FXWA 1NT4A 3MTQA 3KYCA 4BMOB 4TKVA 4YDQA 5CDHA 3RKRA 1PL6A 2HF8A 1TM1E 1V1JA 3MOSA 2YN4A 1CY8A 1L5ZA 2VNHA 1SKYE 4MWCA 2HIMA 1HQKA 1Z13A 3U0BA 4ALIA 3A6FA 2FQXA 1AGNA 5JPCA 1XELA 1JQKA 2O3TA 3DQZA 3ANYB 3EUWA 3GT3A 3BMNA 1RBQA 3AVPA 3GJ4A 4KRXA 1B43A 3VHQA 1LK7A 1U1FA 1XZIA 1YJAA 3DE5X 1A2OA 1N5LA 3ETJA 4IIBA 4N0EA 3UMJA 4CWAA 2NQ8A 1XZNA 2ZS7A 3PQDA 4FHEA 3AHEA 1A9RA 3CPJB 3NDIA 2FW1A 3JW8A 2GCOA 4HUQA 4QBHA 4NCAA 3MELA 3H9UA 1X80B 1L8AA 2YJ6A 5EJ7A 1BAPA 1OYYA 3O47A 1SVMA 2QT1A 3C74A 3L7MA 2AEMA 4LQ4A 3KUDA 1IZ9A 1FSSA 2HMAA 4WSOA 2AFIA 3T5CA 2QT9A 2G4CA 4CM6A 2QA5A 2NV6A 4Z4HA 1I0ZA 3TQRA 4QREA 4V0QA 4B5LA 4DE5A 4YRMA 1B6TA 3I2KA 2O0LA 4IGFA 1YULA 2D13A 4MUHA 4C4AA 2HGZA 1TIPA 4W9NA 4OBWA 3HPRA 1J1ZA 4YMLA 4US1R 1Y42X 2ETXA 2HSEA 2TECE 2YW2A 3NHUA 2BSQA 2D2XA 2FN3A 4J9VA 2JK1A 3BX1A 3IUBA 2V55B 3IOEA 4Z86A 1VHJA 1WCWA 5AXBA 5C8ZA 1ZXBA 2DT8A 3MCTA 1C4XA 2BI8A 1UIMA 1I1OA 2GD1O 2HUNA 3UB2A 1KOGA 4PZ9A 1DFGA 4EGQA 4U5QA 2HU8A 2GBLC 4MQBA 3WXBA 5KDDA 3HCAA 3B5JA 1LVHA 1IHXA 3JQ8B 4M0PA 1GDTA 1DWPA 3GFRA 3ICOA 4DCGA 4WJZA 4KQJA 4NXMB 1KOFA 2AT1A 5B7NA 4HTAA 2JBWA 5K4GA 3PPVA 4MUKA 1NN3A 1ZMBA 5AIAA 3SIPA 2CMFA 4JR1A 1YKGA 3K9NA 1CUHA 2GBGA 3SOZA 1NJ8A 1OTYA 4B6FA 4JODA 1T8SA 4MKFA 5AI5A 1E7RA 3GGGA 1TZ2A 3N6VA 2JI4A 3NPMA 3R23A 4M9UA 4O2BF 4NENA 4X0EA 3BMQA 5I8ZA 1PIWA 2PGAA 1P8JA 1IH8A 2WKPA 3D0RA 3PTZA 5DLPA 3T9BA 3T3HA 5JAUA 4BE7B 3T5PA 1RC1A 3EYAA 1BDHA 4TWRA 4UBMA 3VKWA 1F0NA 2NAPA 2OLKA 3QVKA 4KI0A 1PS0A 3WNZA 4UQOA 5CG2A 4F5ZA 3JQBA 5FBWB 3U7HB 4XDHA 2VHWA 2C4UA 4P2BA 3W06A 1C14A 3IYLW 2PANA 4IWYA 2UAGA 3G2IA 4BAGA 1WU8A 2Q5HA 4JI2B 1I8TA 2B4KA 1G0NA 1PS8A 3JVUA 1R0ZA 5G0TA 3NYQA 4MKZA 4BQRA 2IYQA 3CX8A 4N47A 3QFTA 2HWYA 3PXXA 4XJSA 4V0KA 3RSGA 3KX2A 6GPBA 4JIGA 4M9CA 4MUYA 4NDZA 2ODQA 3RUDA 4DFDA 5J4HA 1FUKA 2R6DA 1UBFA 4Q16A 4TLBA 2GK4A 3OQIA 5DYNA 5HE8A 3U37A 3UJDA 2Z6UA 3U7GA 2RHGB 4HDOB 3WP0A 5CA0B 1KZ1A 4GM4A 5JC8A 1FIUA 3TLEA 1X1RA 4B7UA 4LK2A 2BM0A 3LDUA 4LBWA 5CEEA 3COWA 4CMHA 1N6LA 1N32B 2CFIA 3V3TA 2J5BA 1T3ZA 1EUCB 4WLVA 3EEYA 3KOYA 2BH2A 1E94E 3MNFA 5A4IS 4X66B 5KYVA 3WLMA 5BWNA 1CZLA 1II9A 2AE1A 2PKEA 3VYRB 4BO1A 1ZK2A 4TYQA 5B57C 3PNLA 4L4RA 5GY7A 2ZTHA 4AJ2A 1F4VA 3HXPA 4OX9Y 2ERXA 2GN4A 4GNRA 2PUAA 1BWPA 4Q7MB 4ND2A 4ECEA 3CUWA 2WYOA 2HDOA 3WISA 3O1IC 4QYSA 1PK7A 5D01A 2GETA 2ZJ4A 3AR6A 4LJ4A 4PS1A 1VIDA 2ODWA 3DO6A 4K3UA 2FRDA 1ZGCA 3NBKA 2JKYA 4LRSB 2GSDA 4MB6A 4G4SP 1G3IA 5ICFA 1OWPA 1P2BA 3FIUA 3AI7A 1I36A 4HDMA 9ATCA 1JBEA 4KMSA 4PQFA 1U02A 2DM6A 4TL7A 5L7TA 1GSIA 3LZCA 1PW5A 2HSJA 2FHPA 3MYYA 4D9BA 3DAPA 3VH3A 5LSAA 5CA0F 2AJTA 3EGEA 5C1IA 2CGEA 4NYJQ 4ZKEA 1PGPA 3R6DA 2XLBA 3JYOA 3HSKA 1ZOIA 3JQPA 3R41A 4PINA 5JNWA 4EH1A 1G8AA 2PJUA 5TQ0A 4ZO4A 1DUIA 2QUBA 3R6GA 2CLKB 3BZWA 3HXTA 3KWMA 3FZYA 3CKYA 3OUZA 1L4LA 2WFLB 2ECKA 3MUEA 1ZA1A 3V8VA 3OPYA 4B6SA 5EE3A 2WU8A 1VBMA 1X0XA 4GEGA 3I3SR 4URUR 4W8HA 4UPVA 3KDAA 4H77A 4K81B 2I6UA 3AKZA 2X6RA 1D5WA 3KB6A 1P4AA 4CIXA 4QDZA 1ZR2A 3KU1A 3ECCA 3M33A 4JB8A 3KXDA 1NNUA 3HXLA 1GU0A 3CRQA 1MUUA 4UU1A 5FKJA 1L7XA 2MT9A 2H7VA 3H8JA 2IU4A 4QM6A 3EZ6A 4TL8A 4KMOA 4JN6B 1YB1A 1ZH4A 4QJ4A 4L5IA 5IC6A 2EFDB 1B16A 2O2XA 3D6JA 4OLFA 5TEVA 3LV8A 1A76A 3QHQA 1R8JA 1FW8A 2BKLA 3K7EA 4QSHA 5CFRA 3HV2A 4Q9LA 1EFRD 5K7SA 3O8NA 1T0UA 3OZEA 3ZIAD 1X7XB 2ONKA 1Z73A 4HDQB 3G13A 2FMIA 4ZAVA 2M6KA 3RUCA 3UK0A 3WMFA 4IIUA 4QYMA 1H8HD 2HMSA 4JBYA 3SK0A 2XWBF 2A0UA 4X20A 5ALJA 5DSZA 1MO4A 4PX2A 4J76A 3ZZ0A 5F98A 5IH3A 3B7WA 2A0FA 2D8AA 4NHOA 1S8FA 4LV8B 2B8WA 1KAHA 3LQFA 4TXHA 4DMUB 3OFNA 4RS3A 1UMCA 5AVXA 4BLPA 4E1BA 3C1AA 1T8PA 5ILOA 1P9NA 1RXVA 5CX1A 2BR5A 3BTUA 3FPHA 4DDVA 4CPDA 4QTXA 5KBYA 3DPUA 4OHYA 4LMRA 2VZ9A 4DPKA 3OUTA 1F0KA 5HUHA 2PSSA 4LSZA 1PV4A 1QVZA 3HQ4O 4FCCA 4LX8A 4YUVA 3VVLA 4F92B 2F8MA 3HSSA 3EGCA 2WJJA 3CEMA 5SYNA 3BOSA 1YUMA 1SXQA 3DNMA 1M8PA 4LJ6A 2YUTA 1M7BA 1V4BA 2ZJ6A 3H5AA 3EH2A 3DKKA 3KVNA 4I1YA 4U2EA 1E98A 2B4QA 4UZEA 4YCSA 2XUKA 4ZFNA 4MV9A 2YHUA 1IBMB 3NG1A 3G8YA 2XZLA 2WQZA 1U3GA 4ONEA 3Q9LA 1E0SA 4P4UA 4JJGA 2CL7X 3QE9Y 1LU9A 2GD6A 5M5BA 3ZLBA 3CH7A 2HDWA 3FMIA 1MJNA 1TF7A 3M4JA 3R44A 5LXTF 2FU5C 4UHBA 1N2ZA 2VHQA 4BYMA 1YHYA 2PG3A 2VJQA 2O4UX 4IIHA 4LZLA 1M72A 4R81A 2A0YA 1AKRA 1KP9A 3QRWA 5GZ6A 5CT9A 3P9SA 1WW8A 3I61A 2RHBA 5AI0A 5FULA 1VHLA 1O9BA 3L05A 3ZTTA 4U6NA 3I3OA 5D3ZA 4D9FA 3U4DA 3E9YA 2PJRA 4Z54A 4FYWA 3BC1A 1C41A 4N1AA 2F9FA 5F78A 3PC7A 2OO5A 4IDDA 2VJDA 3JD2A 1MAVA 1UK7A 1J70A 1M0SA 2G3YA 3JSXA 4GG1A 5JATA 4UUBA 2QIOA 3RG2A 1VTKA 3TTVA 2J33A 4HXYA 4FGZA 1JHPA 4NEQA 2G0NA 2QY9A 5F77A 5CK4A 3ZWAA 1ETUA 1GSHA 2P6MA 1NMYA 3AB7A 3EGWA 3R3ZA 4RK4A 4XM1A 1EDDA 2BFFB 1SKBA 3RSHA 1C8BA 4FWTA 2PUGA 3H2SA 2A67A 2WUGA 4D57A 5EMKA 2Y77A 1XXLA 1K89A 2O2GA 4JP5A 5CB4B 1N1GA 5KVCA 4YJ2F 3BFKA 5EQFA 1NBHA 1BOOA 4QOHA 2FETA 2AMJA 3RK1A 4GOND 4CCWA 4G5SA 4DLSA 5ALEA 1UQRA 2MINA 2PH7A 1Z83A 1KJ9A 2NO1A 1E3LA 4E11A 1GZHB 4JC8A 1SJ9A 3QSYA 1QGED 3SS8A 2XVYA 5MHTA 4GMGA 1QK4A 2HC9A 1KI9A 3WGJA 1EGQA 1EM8A 3DBIA 2N0SA 1YI1A 1R9JA 4BQQA 2QXTA 3IE1A 5CUQA 5BOSB 3DMFA 3AUYA 4BO2A 2VYQA 5GJCA 2IOHA 2QTLA 4LPKA 2VK2A 5BYKA 3C3PA 2YJ3A 3CLKA 3ZE7A 3OZRA 1O97C 1WZNA 4H31A 3UAOA 1YZKA 2I8AA 2QRQA 5JMOA 2QN9A 1LZLA 1WO8A 3IXMA 5EUQB 2HAEA 5EUBA 4DLBA 4KIWA 1UJCA 4GLLA 4UZFA 2HQ1A 1CUIA 2UZ1A 1LNZA 4KFTA 5CM2Z 1U7ZA 3BYZA 3R2JA 2TSYB 1G20E 4ROSA 5JCOC 2B83A 3HC7A 4JJFA 2NNWB 2WT9A 3I39X 5KB3A 5HDBB 3HB5X 1KJNA 4KWEA 5ECDA 4XRGA 3U49A 3RNOA 4BNVA 2YXPX 1U28C 3U4HA 1CHDA 4IIEA 2IZZA 2J30A 4U0KA 3SDBA 4CF4A 5L40A 1TYEB 4F91B 2Q6OA 4LF8B 1WSWA 1RMQA 2BFCA 3X2FA 1O96A 3U7QA 3D64A 3DHVA 4GICA 3H0KA 4N9WA 2K2QB 5KU7A 1U1CA 4EBFA 2BV3A 3IALA 2O2JA 3K2IA 2IE8A 2DAPA 2FX5A 1OPXA 1GGHA 1UINA 2RCNA 3PGVA 4MP3A 4TTVA 2J6CA 4RVCA 2C4KA 2JGJA 1QSGA 2EKLA 2QKYA 1POXA 4I9GA 4UEQA 4L73A 4X90A 3NJ8A 5AICA 1G1AA 3SJBA 3B5IA 3ECSA 1UJBA 2BCGY 2JJQA 1FRFS 2YVUA 3FKSA 4RZ3A 3NGLA 1R6AA 1YVRA 3OEHD 4FI3F 3K9FC 1U8AA 3NEAA 4DB2A 4NQZA 2X2OA 2EJWA 4P86A 1GG8A 1EG2A 1EWTA 2J6BA 1JJBA 2PT9A 1G6KA 4NNPA 1P29A 5ALZA 2R6JA 1M10A 1KFBB 3PB3A 2OXEA 1D1SA 3CPEA 4BBPA 1Y3FE 2KE5A 3N2KB 2OK7A 1XK7A 2IA5A 2XE4A 5D1NA 1NW6A 1RAHA 4CDGA 4YLYA 4Q3CA 1H6CA 1GGJA 2Q1WA 4LYDA 3AK4A 5AK5A 3T7RA 4W5JA 2Q1YA 1TLLA 3K0HA 5CH8A 1PJAA 1DT3A 5JBQA 5DLYA 1UM9A 3OHSX 3KE9A 3TZ6A 2QTVA 1OV6A 1USKA 2G36A 2WQ7A 3IR6A 3LQQA 1E6EA 3IPXA 3VZRA 2FSFA 4FFPA 3WK9A 1Q91A 1UFQA 2G9RA 4AMUA 5A7FA 4YCNA 1FFAA 2KSQA 2YHIA 5BO5A 3OJLA 3I12A 5LUBA 1H1DA 4DLPA 4J7AA 3OZGA 5NLLA 1NJ2A 2Q2NA 1R12A 4EEXA 5DYTA 3SHQA 2CD9A 1BX1A 2BDUA 3C3KA 3SZRA 1R3UA 4KRFA 1Z3IX 2UVPB 2WMOB 2JIRA 1E4YA 3TSWA 3IB3A 1KAGA 4RSRA 5E95A 4E7PA 2HQBA 1E1KA 1ZZEA 4AMYA 1ZJ6A 1KSGA 3SNHA 3ZQ6A 4H0NA 1VMAA 2XQGA 2BGRA 4F8JA 2WA1A 3BDAA 3NPAA 5DBOA 1DO2A 2CFRA 2ZJOA 4PX9A 3ZV3A 4DABA 2XOKD 3RU2A 2F8TA 1S3GA 1KBOA 2JI7A 2A5FA 2C4MA 2IF2A 3O1JC 2I4MA 3QF4A 3U26A 4H16A 4CF5A 2YV5A 2QM3A 4ZALA 3ABIA 4NU0A 1S9DA 4XDZA 3VISA 1QFSA 1CV2A 1AZSC 2WDPA 5HF9A 4DNPA 4ZVOA 1S01A 3SM9A 2C9OA 2YQ4A 1JJ7A 1RPNA 3HDQA 3BGIA 3JAWB 3PFBA 4F3CA 1KJJA 1EAYA 1FP4B 3ZY2A 5FUWA 5I4CA 4LKOA 2FPIA 2MSEB 2O8FB 4GPTA 5A6SB 1GD1O 3WWPA 3C3MA 4DSOA 1FRQA 1U0HC 3H2GA 2VJKA 3NHLA 3D3EA 3UJHA 4G0ZA 3VOTA 3EH1A 2J32A 3KXLA 5LD2C 1RWNA 3OO1A 1DQSA 1T5OA 4OU5A 5HEKA 4IXNA 2OA0A 3DOEA 4HGOA 4OMCA 5JVDB 4L57A 1XQ6A 2WTUA 5BV0A 4WK4B 1AF7A 1FFBA 3OMXA 3SVTA 1NRWA 4RKQA 4LOHA 5JE8A 3V6LA 5HZKA 3RC2A 1IJEA 2FW8A 2YMLA 1DX6A 1DDGA 1OA0A 1Y4ZA 2FQWA 1Y8QB 5U4XA 5D7BA 2E87A 3UAWA 4JLMA 4FGWA 4PVCA 3FCAA 3M5DA 5EKDA 5EMHA 1JQ5A 1U9ZA 1KJ8A 3WB2A 1M1YB 1QMPA 4XCVA 3KKMA 2VH2A 3NEJA 3QVGB 3BS4A 1V7ZA 3INRA 4NS1A 4OYHA 1NUHA 2A30A 2BKAA 3W9BA 1WDKA 1Z0UA 3WNQA 4OI0A 3RBXA 3F8TA 4ME6A 5JAZA 4JOSA 3DTVD 4CT5A 1XTQA 1JT2A 5KVQA 1T9ZA 3B1ZA 1XLWA 3O7WA 3V1TC 4Q3AA 4UCQA 4YRNA 1PJTA 4MH0R 4H3VA 1JMYA 2VI5A 5K6AA 5L7WA 1H93A 5GPBA 4N7MA 1R0SA 3RO7A 4ER6A 4KR3A 4FE4A 2O0MA 5BQPA 3GD7A 3NVMB 3SKYA 4LRTB 1MGOA 2VS1A 3P97A 3N3AC 4QEKA 1BVHA 3E03A 2J3HA 3CY6A 4BRWA 3LECA 4RKYA 4OQPA 4J3NA 1XDDA 4F5WA 5I9LA 4Z1OA 3MLEA 3ZVLA 4JR2A 1UXJA 3SC4A 4G0OA 3WRXA 4Z9FA 3DQPA 3HS3A 2PIDA 3PRKE 2PMWB 1YVDA 2ZB3A 2D2VA 3KLNA 4QQ8A 1DBQA 1EJ2A 4YRJA 4XQ9A 4I4CA 1GQ2A 2PGOA 3FFAA 4EM6A 2P5UA 4HWOA 1E6LA 1GAWA 3FOCA 3I73A 4HQ0A 5KOIA 1N1MA 3O3CA 5DGDA 3ZGVA 3AY7A 1FK8A 2H2DA 4JFRA 5JSZA 3T15A 3U39A 3CYFA 2AWOA 5IBQA 2IP2A 3VR4A 3O84A 5HUJA 2V5VA 4RA6B 1PTKA 1B0PA 4QARA 1TTTA 3DBVO 1ZD8A 1E79A 2JJ1D 2QRPA 4XIIA 1BMDA 3JRNA 2NSYA 1XMVA 6Q21A 4AQYB 3LOPA 3QMVA 2JFZA 3NIFB 3AC0A 3BXFA 4KXMA 4OHXA 2DTDA 2HKIA 1AX9A 3EQ8A 1QP7A 2ZUUA 3MCZA 3WJ2A 1JHAA 1JKJB 4BVEA 3ICVA 4DA9A 2QTZA 2PLAA 4GBED 4M7OA 5IKPA 3K20A 3SIWA 4WLOA 4QT0A 4YJKA 5LLDA 1D9XA 4WKCA 1CT9A 4M53A 3VR6A 2QLTA 1ICEA 3PC8C 2NUAB 3EN0A 5KJEA 4ZOAA 2HRQA 4K03A 3BWEA 2VDKB 3ZLUA 5JV5A 3EZ9A 4QICA 1KERA 3C8HA 4E2YA 4CKCB 3BB1A 5FEUA 3F7TA 3L4KA 4MA4A 4LI0A 2H0RA 4DJJA 3ACCA 1NU8A 1P5FA 1ZGGA 5EINA 5A0FA 4BMZA 4N7BA 1NP3A 1SBQA 4YROA 1XCOA 3H05A 4FC6A 1JP7A 2FFHA 2Q41A 4XGIA 1NIJA 4MITA 5CXSA 5AMXA 1J2EA 2D2EA 2YV4A 4JT8A 1DC8A 1ISIA 5B6PA 2CDCA 1SKUA 3AKCA 2OGZA 3GAMA 5GAJA 1YOVB 3FXAA 1NBMA 4N6NA 4R16A 1T8RA 2BLLA 2OV1A 1XNQB 2OBYA 4JXKA 5TGTA 1C80A 1EUCA 4Q5IA 2H29A 5LPNA 1CEQA 1UBOS 2EQ5A 1TAUA 2J3EA 1CG6A 4QJBA 4M99A 3RJ5A 3VUEA 4EY6A 1J8VA 3DWGA 1U8FO 4O0MA 4EJ0A 4MDEA 3T5DA 3L43A 1L5NA 4B75A 3Q9SA 3N2LA 3ZCXA 1GYPA 3T3IA 3C48A 1YE3A 3DZGA 1ZD4A 4X8HA 1NATA 3OP4A 5P8WA 2A0XA 3UMMA 5B53A 3VV2A 2R8PA 1DKOA 4LDZA 4E32A 1FYEA 2ZAYA 4B4KA 3EBPA 2QTMA 4G0XA 4LZWA 4M83A 4MGEA 3F96A 2VBGA 4O1MA 2OCAA 4V1CB 3OQVA 4DZZA 2GTPA 3J7AC 2J6IA 4C0JA 2ZYRA 3EULA 4LJAA 3OWHA 4POAA 3WXMA 1OILA 5JD4A 4DV6B 4X5OA 5C7OO 2YZMA 2O54A 2H1RA 5U4QA 2W37A 1KDRA 4ZYTA 1V6SA 3KKEA 3N8GA 3JD0A 2UYYA 1OZGA 4XPZA 2XZPA 2JRCA 3CGGA 5CBKA 3G8BA 3MA0A 1E66A 1UQUA 2GYYA 4BMSA 1L7AA 1N8NA 2BHLA 4JYCA 4OMUA 1Z16A 1WCXA 2HCFA 4R8LA 1ENZA 2VAPA 4CQMB 2BR3A 4MAMA 4UVEA 2FSIA 2YV2A 1XZGA 3MWDA 4Q7JB 4RQBA 1YR1A 1P9WA 1ML4A 1PFKA 1A4IA 1WZUA 2I7VA 2P41A 4H3KB 5ECWA 2QTWB 1WTAA 2HZBA 2DLDA 2B1GA 3MFYA 4G5QA 3RFTA 4NBSA 4BNXA 3T7DA 4A73A 4O25A 2AQKA 3IAS1 3UB3A 1YACA 2L18A 3G85A 1EDZA 3VH1A 4EHIA 3ET5A 2IUYA 4RQTA 2I67A 4MKIA 4G9EA 1K63A 5D2CA 3MBKA 5E3IA 3RRMA 4C3UA 3KQYA 4TLAA 5CG1A 1BE8A 4QVGA 2QLFA 3OJ0A 4AS2A 3COYA 2O5VA 1SU6A 2J3MA 4KXWA 4BX3A 2WB2A 4RHYA 1RRMA 2GHQA 3IBGA 5I7UA 2XCSB 3PUXA 2PEZA 5AKKA 4A2WA 2UUPA 3OU6A 3OZSA 4KTTE 2Q2VA 1JFSA 5KSZA 1ZO8A 2Q21A 3N59A 5JWOA 4IHJF 3GYGA 1KEUA 4EL5A 3K9GA 3TM5A 1KYQA 3C3BA 1X7XA 2Y1DA 4HFJA 4UUOA 3WQBA 1XDGA 1XMOB 4LY3A 3IUPA 1FE8A 2CFOA 4I5IA 1ZG3A 3E35A 3TGPA 1VDMA 3ACBA 2FMFA 1QJCA 2ZGVA 2YASA 2ZBUA 4MICA 1KQ3A 4L1KA 3DVQX 1MABB 4JJZA 1DRUA 4KNVA 1S3IA 2HPVA 5KKCA 3D9QX 1NPTO 1SG6A 4I4IA 4S2UA 2I76A 4FMCB 1F7VA 1GO2A 1X13A 4BECA 3CISA 1M2JA 1C1HA 4GPAA 2HY7A 1E1RA 1E0KA 3ZBQA 2R6R1 5EKUA 2VKTA 3CO5A 2ZTSA 1KI6A 1JAXA 2FF7A 1RLTA 2J87A 3HMKA 3LXXA 4GX1A 4PBTA 5FPQA 3ODPA 3UJ6A 3JD3A 1KGDA 3LUPA 3JAMA 3AO0B 3GUYA 3FFXA 4HWKA 5EKXA 4BU0A 2EHDA 5F23A 5IM5A 5ADHA 2NZ2A 3T1YB 4QOEA 2R60A 4L9SA 5G4KA 2NOAA 3MQFA 1SXIA 1NM5A 3K32A 3O21A 3OCXA 2CMGA 2Y3IA 3HFGA 4FGUA 4KIUA 5DYWA 4QU9A 1N7IA 1PGOA 2Z09A 2P3SA 4PRKA 1WHSB 2CK3A 4FSHA 4KMRA 3Q8MA 2J9ZB 4ZICA 4RJJA 4X1IB 2B1JA 2JJ2D 3K0CC 4P3NA 5EAIA 3CIFA 4PTYA 2QE7D 1E3WB 2VF2A 3U61B 2QN8A 3OY7A 2AOWA 1V8ZA 4JL5A 1UK9A 4E5NA 5JNVA 2C0PA 3NP9A 5HJ5A 5BMVF 1YVEI 4GGMX 4Q00A 2VUUA 2P2SA 2WJ3A 4H7HA 4IQ0A 3A58B 3TMYA 4DDMA 1LV7A 3ROGA 3ZW9A 1DJQA 2YDYA 2XUHA 1E9AA 2OE2A 2QZPA 1ITZA 1GNPA 4A6XA 5BQ5A 3SYNA 2J85A 1ZM9A 1FNDA 2O07A 3TSCA 3U17A 4YRLA 2P0AA 4XAQA 3N9IA 3GEDA 3V5NA 4LCJA 4K7JA 5BPFA 3HZHA 1R5OA 2AH5A 4ZREA 1Y5IA 2OBNA 3RAJA 2TRSB 3CVVA 4EKNB 3D4LA 5DLDA 2UZ4A 1AQLA 3SJCA 1E1CB 4ECAA 2BFFA 4NYMQ 3W2HA 4F56A 3WP1B 4YUZA 2H5JA 1JVNA 3UXYA 2V9CA 3L9XA 2A9FA 2XXAB 1XK6A 2B9EA 1QRAA 3KAQA 2J41A 4ZCSA 4HGNA 4X3OA 3SDSA 5E2AA 2CMDA 1HT3A 4GGPA 3GZNB 3LCCA 3OCWA 4YV1A 3TL2A 5DASA 5FPTA 3JYHA 3TRIA 2ZCVA 2GARA 2QDXA 3E7FA 1RCTE 3I5MA 1Q16A 1PTJC 4J0KA 1ULBA 4AULA 1P2VA 5HKKD 3PFIA 3W3ZB 4WI1A 4N82A 4CR6A 4E08A 5JXGA 4QUEA 4FMBB 3QMPA 2Q9CA 3ZD9A 4TX1A 4BDSA 4DEVA 4YUXA 3UCFA 5BYAA 2QUZA 1J5XA 1W34A 3GV0A 2GTIA 2ST1A 3B2EA 3I1JA 4LC9A 4O1IA 4WD3A 5BOSA 1YOBA 3EGIA 2EU8A 2YX1A 3VZQA 4CMCA 1T2DA 2QTRA 4PLWA 2H4YA 2R7AA 1DAHA 3E84A 4V0ME 3FUXA 5AJXA 5B2FA 2IP1A 1UP4A 4Y9RA 1PJ2A 2EERA 2O2SA 3B9QA 1Z88A 3NH6A 5H3LA 1I3CA 2D5IA 2ZKIA 2A9JA 4ZOBA 3OVMA 2OD2A 3JQAD 3LA8A 1XCMA 3LF2A 2J9RA 4L3OA 3GBPA 1RMYA 2TMYA 4TSRA 4KYUA 2ADOA 1KIFA 1VSUA 4Q39A 4NV0A 1P1BA 5CB8A 3ADCA 3GPBA 3NHRA 2GDZA 3E8SA 1KMCA 1JR4A 3GMSA 3LUBA 4FD2A 3RV4A 2ZSAA 5G0VA 4C2AA 4BUJA 3VSCA 5F35A 5B55A 1A97A 1Z4NA 3W2IA 4IXWA 1L1RA 1N9GB 4JZKA 4Z1MA 3SICE 2WF7A 3P0IA 4AIIA 4K5QA 2Y1GA 2WSSD 3LPLA 2WTXA 3BAZA 5A0TA 2ZI3A 1SVLA 3HFRA 4R4JA 4DQDA 4HI0E 3B20A 1P39A 2ZUSA 3QEMB 1M0EA 2YYZA 5L3QB 2HHJA 1WDMA 2NWQA 4L85A 4M8NE 4RYDA 1GG2A 5ICMA 3BIOA 5MFZA 3RREA 4DLTA 2CJWB 3LP5A 1W0JA 1A7AA 3DWFA 3R40A 4NCKA 3ZHCA 5FI5A 5H3HA 1DKQA 1YR3A 2I2BA 3SAJA 5BPHA 1HX7A 3B52X 3WR5A 4CKBB 1M2GA 3KHSA 4XIYA 1ISGA 3RS5A 4AUNA 3A05A 3AB3A 3DFZA 3GFPA 3K8YA 3SQOA 3NVDA 4J16C 1SVNA 4J0CA 1PP4A 4FX5A 3ITNA 2YWJA 3OCZA 4CTJA 4ERNA 3AF1A 3K73O 3WE7A 3EGDB 5J2TF 5HIAA 4C7OB 2NU6B 3N2KA 1RI1A 4LTDA 2XECA 3U4MA 3CRW1 2GNAA 3DMPA 3LUGA 2PZBA 4OI4A 2D0IA 2QRGA 4MW1A 1MAAA 4BXOB 1DOAA 2ACWA 2J7PD 1G0OA 4HY3A 5ITWA 4XB1A 4B34A 3PVZA 1VPTA 3JYPA 3WTCA 1OFGA 1IVSA 1AUVA 3P9RA 3KQQA 4PQYA 2OBXA 1U63A 2BUBA 2IHYA 3UV3A 4HNHA 5DO9A 3S2IA 3K0AB 3KZMA 3ANTA 2WUVA 1D4FA 3MJTA 4KG7A 4KWHA 1H3EA 2OB2A 1MJHA 2VQ6A 3RV3A 1I2AA 5E7MA 4BMDA 4D42A 1MO3A 1Z5NA 5G40A 3GRAA 1RAIA 1RKXA 2DYKA 2UVPA 4CGYA 1COWD 5CDUA 5I4BA 4QNNA 5CYPA 3SKVA 1OX5A 3MILA 4OXQA 5J58A 1N5MA 4DM3A 5C7LO 4XQ0A 1C7JA 1UK8A 3GUHA 2CL5A 5U9CA 3UJ9A 4B48A 3EVDA 4C6RA 1YS9A 1CUUA 1RYNA 4DGSA 4YMTA 4YMUA 5ESRA 2GCGA 3U9TA 4PSAA 2XUZA 1RAFA 2Q6KA 4NHEA 5CFLA 3AHHA 3E5RA 4HDAA 4NSNA 2Q9BA 1N6PA 3PEUA 4UVIA 2AOXA 2EG9A 1TW3A 5C4MA 3JQGB 3JAWA 1H2RS 2EDCA 5I4KA 1YASA 4KB5A 2BZ0A 1D1QA 2C3YA 2WE7A 3MN1A 1JQDA 1T9CA 5ER9A 1KO4A 2B1RA 3GJXC 3UA3A 1W19A 5FBHA 4IIXA 4HQRA 5A6SA 3KLMX 2W2OA 2B8EA 1VPWA 3LW7A 2PMEA 3KPWA 1HSZA 2W43A 3TEFA 2AFRA 2WVGA 2CN1A 3OOSA 4LHEA 4RV5A 4BNUA 3QEKA 3W5BA 1TJNA 2OAGA 4MVJF 1OBVA 3HLKA 3JWIA 1EFTA 4ESHA 1JE1A 1CUZA 1BGWA 1N7HA 3NASA 3GDOA 4ZVQA 1SXJE 4DIUA 2FB9A 4QG7A 1I4LD 4MCJA 1DJOA 5E4YA 2V8OA 5JVDA 1V25A 2AN9A 3CLVA 3H0CA 4IVRA 1DEXA 1N7JA 2B0JA 1WZCA 3M6VA 4TVBA 5YASA 3H11B 3U3XA 4B3HA 2G1PA 2W90A 4K0RA 5KTNA 3F9CA 1I7PA 4I1RA 4UFNA 5A03A 2NSHA 3D4NA 1R50A 3PX3A 1PSWA 3ENZA 4B7ZA 3INNA 1Y8QA 1LTHR 5IBCA 2EKZA 1G9XA 2HGSA 3R24A 2E6UX 5ALUA 1CB7A 3M82A 4HMQA 3QXJA 1GA6A 1XPOA 5LD2B 1VL2A 1IK4A 1XN1A 1M1YA 3OM9A 5JS7A 1PI3A 1LUAA 1ZVVA 2PR7A 4MV3A 3QVGA 4LYFA 3R5FA 3AHCA 5FTNA 3EA0A 4KVZA 4FWIB 1QBGA 5GIOE 3R5TA 2OHVA 3HFJA 3U7IA 5LQUA 4IF4A 2C4NA 1Y7TA 1PNTA 2VAMA 1M34E 2XX3A 1VFPA 1CUYA 4PTZA 1RQPA 5TE9A 4COOA 1R6TA 3IMFA 1V5IA 2ZYWX 1OHHA 3G6KA 1JQEA 4QJ5A 5DDIP 5FUXA 3OFJA 3OIYA 4LRUA 2WABA 4MPPA 5DXFA 2JI6A 4BIIA 1E58A 3DCIA 3A1EA 2C88A 2ONYA 3EY9A 3RBAA 1R9GA 2IELA 3QOXA 4LQCA 4FHCA 3SQNA 1EUYA 2I9KA 2R1VB 2HYIC 4WXPA 3RVQA 4Q1DA 1X1DA 3OE4A 3GEHA 1TMKA 3UICA 1DAIA 2GPSA 3F98A 4ZD6A 4E0BA 3QWBA 5ENDA 2LGJA 4X97A 4AKSA 3O4HA 5BR1A 3STHA 4R2MA 1FUUA 2CLIB 5BQFA 1TD1A 1WDTA 2JIZA 4D3DA 3GH1A 1TF5A 1PKXA 3DUWA 2ZTMA 5K0JA 1L5HA 2YWXA 5B30A 1LPNA 2EAUA 1R7RA 4W6QA 4K9RA 3NOVA 4B46A 5IVIA 3RS3A 4MLDA 4HTFB 1RHUA 3JRWA 4QGGA 2MSKA 4RHTA 4IDEA 3LBHA 3VM6A 6LDHA 3E4DA 1KJZA 3BCUA 1NMEA 4RA6A 2JIDA 2X2PA 1BMQA 3DL4A 2K4MA 4CUZA 3E9EA 4QT4A 4JJ6A 4L4ZA 2B6HA 2ESRA 1A2KC 1Q1NA 2D4AA 5AVOA 4D8TA 4MUIA 4LMBA 1XDBA 5KCZA 1JKJA 1QFYA 5AVRA 2JGMA 1JLLB 4M1EA 3GZTB 3JQQA 5F2EA 4EGJA 1KFCB 1CDZA 3L6DA 4DKXA 4TSFA 2E5FA 2C95A 1S1CA 4G3XA 1N3BA 2NUAA 4L8GA 3W7BA 4M22A 5K4HA 3KQNA 4CHTA 1SIBE 3RSFA 4CKCA 3U6KA 4H7FA 3J81A 2JLXA 1GNRA 5KO2A 3P5BA 4OHZA 4QJIA 4ZI2A 2QJRA 1ONSA 1CDDA 5TMEA 2X14A 4BFXA 4XJTA 2D7CA 3HJBA 3BB3A 4EL0A 5JT1A 1LFAA 4JELA 5K0GA 2RG7A 1PBNA 4ZZ2A 5FL7A 1CQPA 3HEMA 1Q77A 1QTRA 3SFTA 9ABPA 3WGNA 5HR5A 2JCGA 2H3HA 1W7AA 1M67A 1T1EA 2FFQA 3HY6A 3DFUA 3HB9A 3EG5A 1JYSA 2JEZA 2A94A 3A1VA 2WJVA 1GPWB 4PQGA 1FXSA 3QUQA 1EVEA 3HSYA 2VJCA 4NYIR 5B2ZA 1XPUA 1JI3A 1X14A 1LTKA 3DE7X 1FFGA 3OTOB 3ENNA 4H7EA 2ID7A 3K2QA 3BHNA 1DCMA 4I3GA 2F4NA 5LC1A 2Q46A 3SD7A 3L04A 3HXQA 3TXYA 1ZGAA 4V1CA 5DHPA 1NZDA 2FVXA 1XHFA 2QRMA 1VGVA 1BJKA 4RX1A 4PRYA 2YXNA 3WC4A 3WYGA 3WJ7A 3AF4A 4BN5A 3OY2A 4DIBA 4D4GA 2O19A 2C4WA 2NQTA 1ZESA 2CCKA 4BCBA 4CNBA 5K8CA 1NLYA 4RXUA 4KGVA 4WBNB 5KUTA 2IHUA 4L0CA 1ORVA 1UJMA 1K9VF 2W6OA 4JXJA 1JDSA 3BD7A 1RI5A 1B23P 3PNMA 3GXBA 4KREA 4CQMA 3SFVA 2QQEA 5FAKA 3RFVA 2PU5A 1RS0A 3WLKX 1QAQA 2DPMA 3T1HB 3Q7SA 4IG9A 5IXYA 4RU1A 1MA0A 4NVRA 4WVLA 2PFKA 1JTFA 3R7SA 3QU5A 4HJXA 2B34A 4F4DA 4GZ5A 4FFNA 3TDNA 1MC1A 3O0TA 3RRXA 1ODSA 3UWKA 2JFUA 3LY7A 4EABA 1RI4A 2WPNA 3V7UA 4ZKDA 3CURA 4HFNA 4Y2PA 1KKMA 1H0KA 4DHEA 2IX9A 1CY7A 1QDUA 2YDXA 3IULA 3S70A 3W9YA 4DV2B 5ELXA 4C43A 2FFRA 4PPFA 1QCDA 2ALJA 3RVNA 1ULZA 3I6YA 3JXEA 3L2OB 3EZ7A 3L5KA 4BRSA 3IIEA 2Z8XA 4X44A 5HZHA 4BKRA 3FWPA 1Z5VA 3FHCB 1SZJG 3KEMA 4IS2A 4L8FA 5ABPA 1AHPA 1U80A 3BT7A 2B78A 4O4HB 2V03A 3DE2X 1MXFA 1BYUA 1E1YA 3TL3A 2ZWOA 2X9QA 2ZU0C 3EF3A 3RH0A 1JQBA 5EXPA 3UH1A 3C6ZA 3ABRB 1B8PA 4ZOQI 4NFYA 4I8DA 1OZHA 3C1OA 4GVPA 1FQKA 4FFWA 3OQPA 2FMUA 3K96A 5EJGA 2R00C 4ASUA 4YRGA 3PWTA 4EG0A 5JXHA 2QX4A 4TMYA 3ZIDA 4KN6A 2VQSA 5JAQA 4J0FA 4NNOA 1T5IA 3G1WA 4JI6B 5AVVA 2AC7A 1RYDA 1PJLA 1IBLB 3WRYC 2YS6A 1M6NA 5BNIA 1F2UB 2P5SA 1MABA 2WZBA 4JIMA 2VUSA 4LHZA 3G2NA 1JG2A 1E1QA 3GC6A 2B5WA 3EARA 3NBUA 3F2IA 3MG9A 5AKIA 3RTCA 5BMVA 3U3ZA 3VZCA 1ZICA 4PLCA 5KQGA 2PS0A 1GARA 2ZUWA 5D3KA 5LDHA 2AZMA 4P0TA 4UVHA 4KPYA 1D2HA 4MDHA 5EMNA 3S1AB 1RCFA 4DDHA 3BJRA 1O9HA 2ODEA 3GEEA 3IDZA 1EXDA 2ZEJA 3GFGA 2D7DA 5SZJA 3KZXA 3VNQA 4K9LA 4JKYA 4NONA 5E4TA 4LRWA 1Q83A 2MR6A 2BTEA 1PJBA 2C5AA 3AL0C 4KO3S 4HLDA 4JSYA 1O95D 4E1VA 2BTQB 4GGOA 1Y9ZA 3JYNA 3F3SA 3LUFA 4IVPA 3UN1A 3GMTA 3OE1A 1QUFA 1USUA 2R44A 3R3YA 1NHGA 3EJ6A 1G8SA 3LNCA 1WF6A 1OJ7A 4JEMA 4W9MC 1VHQA 1GRNA 3FCUB 2QD2A 2YOGA 2ZJ5A 3MRTA 3PHCA 2ZUEA 1WHSA 3GIDA 5K3CA 2VDNB 4MWSA 4X1IA 2QTFA 4BLRA 1KDYA 2V4UA 1E3WA 3F6PA 3KOZA 2MOKA 4DLWA 3GDWA 3QW4B 2BJHA 421PA 3GP8A 4D5GA 2EZ8A 4GOMD 3U7JA 3ULKA 2QSJA 3L82B 4MQUA 1Q7RA 4R2LA 2B8JA 1N6IA 1THTA 2B6NA 1B6SA 3AHFA 4TM7A 3E3MA 1FP1D 2DQSA 2QRLA 1CQWA 3COSA 1THGA 4CLEA 2Q5FA 4D4IA 1ZW1A 1GZDA 2CHQA 2EEPA 2P7IA 5HCIA 2VWGA 2BFOA 1SKYB 4YRFA 2I6GA 2RGAA 4E4YA 4ENUA 1SUIA 2LV8A 3CX4A 4U6SA 4RO0A 3M1LA 4X1YB 5BURA 3SPXA 1H0HA 4AXXA 3A1TA 4Q34A 5JQGB 1E1CA 1XZJA 4EA8A 3L4JA 1IBSA 1VCIA 2C61A 1Q0PA 1CFZA 2EHJA 3ND9A 3R3XA 4PG4A 4IQGA 1DIHA 1N0WA 1NNSA 1J0BA 3B3GA 1K7SN 2CF6A 3NWEA 4H6VA 1QRDA 2QJTA 2FZLA 3O93A 4XI9A 1XTVA 4NTZA 2V7QD 4D4HA 3CZ4A 3QU2A 3GZNA 4ID9A 1U81A 3ESYA 4G1EB 3GPLA 4KH0A 3ZU4A 1UXKA 1MR3F 1NTOA 4P35A 4XVUA 2DR0A 1T8UA 5EC8A 3LUKA 3LMKA 1AGYA 3GRRA 2VF4X 1X19A 3GG2A 3L7NA 4Q4LA 5DNEA 1DE0A 4R7ZA 3TAXA 4DIKA 4WX2B 5KREA 2CC2A 2PUCA 4Q9DA 4NV3A 1P7VA 4DNXA 4W7HA 2ODNA 1T1RA 1XZCA 3SX0A 5C52B 2PXXA 1VMKA 2R11A 1IEVA 2ZT8A 2E21A 3MB5A 3FDFA 1RTTA 4ZVNA 3SOPA 1YBVA 4EFLA 4J90A 4HVCA 2MWMA 4H35A 3E5NA 5EE9A 5FA8A 3ET4A 1U2GC 1OBOA 4V0LA 1SB8A 3HU1A 4MIKA 3LQKA 3AT1A 3FD8A 5B1HA 5JQGF 1AV6A 3TRFA 3OLXA 3O1LA 4N03A 3TINA 2PZAA 1OZFA 3KDPA 2JKVA 2ON6A 3GGJA 3EFOB 1F0YA 2HO5A 1H8EA 2GZSA 3K05A 5E8RA 5J2TA 3N58A 2VTBA 2QVYX 4B8WA 1VIVA 3EVGA 3KYIB 2F64A 3CEHA 3HYTA 1UZLA 2ZLBA 4UEJA 1Z2AA 2CXTA 1KQOA 1L1FA 4KXUA 1SUWA 3CR7A 4GM1A 5EIEA 2PGDA 4FM9A 1QP8A 2BIFA 1N9GA 1P17A 4GI1A 4WUVA 3R4VA 2RHCA 2QTAA 2W2VA 4BRUA 2E0IA 4WESA 3SR3A 1YA4A 2J5KA 1XVVA 4TTPA 4UEKA 4YQEA 1PK8A 3JX9A 3UKOA 1O7JA 3GR6A 4HQFA 4I36A 3ZWKA 5L3QA 1YB6A 3NX4A 1SHUX 2YV1A 4H9GA 4KR0A 5SY6A 1NLFA 2AXPA 2PX6A 5FLYA 5BW4A 5JCOA 5TQJA 4F2DA 2WUFA 5C1PA 1UANA 2CJWA 2J7KA 3UCXA 1DKRA 1CU1A 1O2DA 3O91A 1SPBS 5CA0A 2JAWA 3HU2A 4PLHA 3QUTA 4RPHA 1KYYA 5DE3A 4DEXA 2QGFA 5JWHA 1VSBA 1U28A 1I7LA 2E89A 2BEVB 1X1TA 3D31A 4L72A 4QBFA 3KV1A 1QHEA 5IXJA 2XGJA 1ECCA 4JLSA 4DIEA 1O8BA 3GT7A 5FV4A 4OXKA 3EGDA 4U2CA 2VH1A 1T4DA 2NU6A 2BFBB 3TNYA 5LQAA 3W77A 4X65B 1NR5A 4HRVA 4P7BA 1ZIOA 2R5FA 2V7EA 2HV9A 4WZZA 4BXOA 4GM0A 1WVGA 4BLVA 5CW1A 4MGHA 5NULA 4OHFA 3GEMA 1U1GA 1LDBA 3HCCA 4QTYA 1U0RA 4E46A 1PNQA 5ITSA 2ZR0A 2GI4A 4DQUA 4JCOA 5ARBA 1D3AA 4JLKA 3K0AA 1V1MA 5TNXA 1E6CA 4MK4A 3EPJA 4ZOLB 5A1TA 4UUNA 1EIWA 3D7MA 3ZTWA 2OCDA 4YDSA 2HB6A 4C4TA 3NWBA 4DRZA 2X0IA 2I03A 1XTSA 1H6AA 3HY3A 3QP9A 3ZWCA 4MVJA 2JDIA 4BX9A 1QOQB 4D7AA 1KRHA 3AESB 2C9YA 3CE9A 4Z3KA 4KFSA 1JDUA 3K6KA 3N28A 2ZBGA 3CS3A 5AVSA 3NNNA 3R3SA 1CZRA 1R8YA 3HNOA 4HNAA 1F8UA 3FVWA 1KDOA 5DXJA 1D2CA 4BKOA 4YFYA 4ZVVA 4RZIA 1HSOA 1Z06A 3MWGA 1WW3A 3EISA 2DC1A 4ML3A 1KA9H 2FXVA 1FTSA 2RH4A 1P0MA 5D6NA 4YALA 4KR7A 5HE9A 3FOZA 1Z4QA 3ESZA 1V9SA 3JQGA 4J2OA 4WGFA 1NVGA 4I1OA 2O8BB 1BDJA 2ZPUA 4L0MA 3RNLA 1DIBA 4TYYA 3B9BA 3PNSA 3BGDA 5JZ9A 2FQ1A 1NRJB 3QOYA 4LE0A 4DR5B 4M0DA 5LQKA 2OZLB 4N48A 4UHFA 2GNOA 2IGTA 1R4NB 2Y4NA 1A2QA 1RHRA 3L8MA 2XTMA 3OC6A 3UYKA 4DDUA 4M6WA 1J8MF 2LIVA 3EVFA 1DFHA 1LX6A 2NT4A 2CXOA 1HE8B 4Y1RB 4GRDA 4GP9A 4TWZA 4PYQA 2C7VA 3JPWA 4IOJA 1Q0TA 4K9QA 3VVBA 3B2NA 2W48A 3IXLA 2GZHA 1YZTA 4AG3A 4AY4A 3R0VA 1GM5A 1XQ1A 1W36D 4DHWA 1GKYA 4KPUB 4M21A 3H11A 4QOJA 3PFNA 1R15A 2DWCA 3UV7A 3NHJA 4O4LB 1ONNA 2P78A 1FNNA 1X7GA 4GT1A 3AYXB 1SCDA 2VK8A 2LP4Y 3K94A 1P6XA 2ATIA 3ND8A 5FUMA 4RTJA 4PLGA 4FDUA 4KSCA 4A6EA 3NS7A 3OTWA 1P7YA 3IKVA 3RC8A 1AK2A 1U8TA 1ZPDA 4ZVLA 1RJGA 1T4GA 4FYXA 4ABYA 3RFXA 2JLRA 4RJLA 4TXLA 3VSDA 5JD6A 3TLGB 2MSNA 2VHXA 3V2GA 3WLTA 3A37A 4HNGA 5DHRA 3GU3A 3D4PA 4BFWA 3JARB 2EZ4A 4PVDA 1KO7A 5EZ6B 3V2HA 1GQRA 4DC1A 3O94A 5CGQB 3MWEB 1F6WA 4W1SA 1H2EA 1XCGB 2DVMA 1NF9A 4L95C 3GAAA 3CW9A 1AQYA 2JF0A 2FYTA 1KZHA 3O5AA 3T5BA 4GI5A 4I50F 4O6VA 1C2TA 2C0QA 3MF4A 4BFVA 1E0JA 1CUXA 5CCBA 5E2BA 1KZ6A 2IYEA 5FRDA 2FZWA 2X22A 1BWRA 4WLEA 2D1QA 2R7KA 1ZCBA 2R85A 4HEA1 3I8XA 4JJIA 1U2EA 4RW0A 2XB9A 5EWJB 1JLSA 1NV8A 2ZRPA 1VB5A 4TS9A 5JCJD 2PT5A 1EB9A 4AJNA 2DF8A 3SZGA 3CB4A 1JA0A 1WUJS 2QG9A 1BHO1 3C4JA 5DN6A 2RGEA 2R1VA 4JMPA 4JC4A 4BPBA 3TQIA 1E1DA 4C0AC 1QVRA 2WHQA 1N8SA 3B12A 3RHTA 1CW2B 3IT1A 2UXBB 2B9VA 3MJFA 2IEBA 1J2TA 4GPZA 1YS4A 5L3RA 5TGZA 2JAPA 3BXPA 2LZ0A 1ZMOA 2RHHA 3SIRA 1AM4D 4M88A 3AEQB 4Y1GA 4E21A 1GSAA 3G2QA 3ED5A 1TL7C 4C3OB 4MS3B 4DR2B 3TKLA 5JG7A 4ZHSA 2NAFA 2Z6AA 2EGGA 1BC5A 2M6RA 4MYSA 4HTFA 2QYTA 1Z5OA 3KBBA 1P80A 2BBOA 2GVNA 3UXHA 3CF4G 3DV0B 3Q3JB 1R37A 4UUQA 2RGWA 1P33A 4JLNA 1O54A 2PH5A 1KAOA 3GN2A 2REBA 4FC7A 5LP6C 2HLHA 5B1SA 2CKMA 5AVJA 3RWBA 3LFHA 2UKDA