3M83A

Crystal structure of acetyl xylan esterase (tm0077) from thermotoga maritima at 2.12 a resolution (paraoxon inhibitor complex structure)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
325
structure length
324
Chain Sequence
HMAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and structural characterization of a thermostable acetyl esterase from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
total genus 121
structure length 324
sequence length 325
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3m83A00
3QVMA 5ALZA 1DX4A 2OG1A 4IQ4A 1XZAA 4CCYA 3G9UA 1W52X 1ZI9A 1JT2A 1VE6A 5T4FA 1QFSA 1DQYA 4FDMA 4DNOA 4LXIA 5D7BA 5HF6A 1GT6A 3H0CA 3VJMA 3WKEA 3I2KA 3DS8A 3WI7A 1HDEA 2HFJA 3FYTA 5DJ5A 1CUJA 3GFFA 4EA6A 4C88A 1SFRA 2WHPA 2WU4A 4GHWA 1VZ2A 1E8DA 3D2BA 1X70A 4JEIA 3LIPA 2ZYIA 1F6WA 3FAKA 3SWWA 5DTIA 3ESCA 1MT3A 3WZLA 2PX6A 5ALRA 4Y2RA 5HF9A 2DFPA 5E4YA 3L1JA 4W1RA 1R9MA 3AIKA 3DL4A 3EQ8A 2FJPA 5JZSA 4Q1VA 3S2ZA 5ALTA 1QJ4A 5ALWA 2VT6A 3VJKA 4PW0A 1EDEA 3ZLTA 1X2EA 4G4JA 4O08A 4HXFB 4CIBA 1ZD3A 2XE4A 5LKRA 2B9VA 4J7AA 3VVMA 1JKMA 2O2IA 2JGFA 3WL8A 2EEPA 3H2GA 1QOZA 4C87A 3E3AA 1N5MA 3W9UA 5AOBA 2DSNA 5BV7A 1G42A 4L3WA 1DINA 4G4IA 1CUFA 2PSJA 2RHWA 3WWCA 4X90A 4J0CA 2X76A 5JZ9A 2WHPB 1R4ZA 2XUIA 2IITA 5D3ZA 5AK3A 5FRDA 1ODSA 1QIGA 1CVLA 4F5ZA 4TGLA 5HFAA 1LBSA 1QE3A 4AZ0A 5A62A 1EVEA 3HLKA 3BF8A 5BWCA 4EY8A 5EIEA 1VXOA 3O4IA 4KRXA 4Y2PA 4DYHA 4B9EA 4Q3KA 4A5SA 2DQYA 4F0JA 2Y2UA 2RONA 2DHCA 2VAVA 1A8QA 1A8SA 4ZREA 2AJ8A 2OAGA 5ALOA 5E4JA 1IZ8A 1J1IA 5AKLA 5DNWA 4INZA 5LP1A 2R8BA 2YYSA 2QKYA 3L1IA 4CCYB 1DT3A 2WG0A 2GYWA 1ISPA 2WTMA 3EIOA 4HXEB 4AQDA 1W75A 4BAGA 3OC0A 3DYIA 3W04A 4WCVA 1U4NA 1UK9A 4EHBA 1F0PA 4UHBA 3IBTA 3D59A 4IH4A 5AM1A 3I1IA 4K6KA 4C01A 5FPPA 1GKLA 4MYSA 5FOQA 2QOEA 3AZPA 3LIIA 3R3XA 1N1MA 1YS1X 2E3JA 4PSCA 4DMHA 5K5EA 5JAOA 2GBFA 2HM7A 3D3NA 3NGMA 3BWXA 4NZZA 2Z3ZA 1G66A 1EINA 1IMJA 3HJUA 4KACA 1WPRA 3H19A 5K3AA 4BAZA 5JALA 3GELA 4DNFA 1P0MA 1VOTA 1JMKC 1ZD4A 2CBGA 3O9VA 5CW2A 5JD6A 1XQYA 5AKYA 1UFOA 2CB9A 3T4UA 3FYUC 4HRYA 4TVKA 4Y2UA 4BATA 2H7YA 3C87A 1XQVA 2JGIA 3PUIA 4QEKA 1VJ5A 3BIXA 4FBMA 1BU8A 1YS2X 3PF8A 3ZV7A 4B0PA 1H23A 2DCMA 3H04A 4FTWA 2GBIA 5LZ8A 2XUQA 3KOOA 2HA3A 3D7RA 4J0DA 5AKEA 5KWJA 2ES4A 5AK4A 5CT8A 5T4HA 1G5FA 4U2DA 2J4FA 1YAHA 2HADA 1MX5A 5CH5A 3WK8A 4IH1A 3E4DA 3GROA 4GLBA 3CXUA 4H7HA 1A7UA 1PJAA 5H3HA 5ALVA 2XUHA 1KU6A 1WPXA 3PUHA 3G02A 2ONCA 4H0CA 4LXGA 4RE6A 3FVTA 4OU4A 3F98A 3WMRA 3K2IA 1ZIYA 4XX1A 3WKCA 4DSZA 4W1PA 1QZ3A 4CG3A 2XQJA 2IIVA 4U2EA 4RPCA 3EF3A 5HKBA 4M0EA 2XMQA 4QWWA 3FWHA 5ALSA 3WLAA 4EY7A 3IURA 4DMCA 1ACLA 3I28A 5HK8A 4F21A 4D9JA 2JGMA 3KDAA 4NMWA 4UBKA 5JARA 4J0GA 4X94A 4G8CA 2GYVA 4G1FA 4PF1A 3WJ1A 1EVQA 1WB6A 3OTQA 1FFBA 1YR2A 5DYTA 1X2BA 3QPAA 2WJ3A 3R41A 5I9IA 4DMKA 2BGRA 4UPDA 3JYHA 3BXPA 3T52A 5AM4A 1OCEA 3OM8A 2OGTA 4K6HA 4X85A 4BTLA 1CUXA 3GA7A 1CUCA 4EUSA 4YX9A 1UK6A 2C0QA 2I03A 2OLEA 5E2IA 1C7JA 2D0DA 3M83A 1Y37A 1EDBA 2XLBA 1EXWA 1TCAA 3IIIA 1H2XA 2XUGA 2ACEA 3DCNA 2O2HA 1WM1A 4PNZA 1EDDA 1UT6A 1GXSA 1K5PA 4UUQA 5HF8A 1MNAA 3ANSA 4OB7A 5AKZA 1QIHA 1ZOIA 1YB6A 1XRRA 4OD0A 5AICA 2WFLB 2UZ0A 3VXKA 2FUKA 1L7AA 1E3QA 2OXEA 1WHSA 5K3EA 1CUUA 4RNCA 1L7QA 2Z3WA 4N8EA 1H22A 3W9BA 1XRMA 3OOSA 4QDTA 3M3DA 3F67A 2DQZA 4X6UA 4B82A 3HXKA 4MQMA 1UZAA 3ANTA 3R3YA 3WK4A 3STTA 2G63A 1R1DA 4QE3A 2QS9A 3BDIA 4PQEA 1Z68A 4X7BA 2XMRA 5DNVA 1XZGA 1JJFA 3W06A 4J3JA 1GPNA 1LPSA 3AINA 2HA4A 4PSDA 2R11A 2QTBA 5ALGA 3STYA 2J3DA 3IUMA 1H2YA 4TPKA 1HLGA 1QIEA 1QIIA 2DR0A 5LLSA 3R0VA 1LPOA 3IULA 3C5VA 2Y6UA 2CJPA 4QA9A 4I4CA 4GEGA 3QMVA 2WILA 5A7HA 4C4XA 4I19A 3ZI7A 1CR6A 4UHHA 4GBGA 3ZLVA 3QZUA 3STWA 1E8MA 1QGED 4QZVA 4U2CA 3D2CA 4G9GA 5HF5A 4BVJA 2V9ZA 3G8YA 4AN1A 2HRQA 1ORWA 3AIOA 2XMSA 4ITVA 3UUEA 2C5GA 5JAHA 2QUAA 1BCSA 4FLFA 1HKHA 2W6CX 2G4LA 2HA6A 4H7DA 4BB0A 1YA4A 3HZOA 4A16A 1HBJA 3BF7A 5FXMA 5IH7A 2Y6VA 1FFCA 1SCKA 4HVTA 1J2EA 1CUYA 1CV2A 3GUUA 1CUAA 1K6EA 3YASA 7YASA 4LYEA 4JH0A 2FX5A 3JWEA 4KE7A 1RYYA 4UBOA 4UHEA 3DEAA 2PKYX 4X00A 5F4ZA 1UKBA 4JNCA 4I3FA 2VEOA 2WHQA 3S8YA 4FFVA 5AK6A 5EHNA 2CUTA 4J0IA 4BCBA 1OILA 5AM5A 3WA7A 4OB6A 4FFWA 1XRLA 1TCCA 1QIMA 5CH8A 3O4JA 1CUZA 3FYUB 5AI8A 5CT4A 1CUHA 1U2EA 1EX9A 4KYVA 2JIDA 1F0NA 1QIDA 1N8SA 4KE8A 1XZIA 1ZGBA 4IHAA 4HS9A 4BVLA 3BJRA 1P0IA 1C7IA 5ALIA 2NW6A 4CG1A 3IB3A 5A6VA 1R88A 1O6GA 1DU4A 1UWCA 2EDAA 1CUGA 1MO2A 1G4HA 4AZ3A 2Q0XA 2PU5A 1XZLA 4WFIA 1AUOA 1CUWA 2XMZA 4Q82A 5K3FB 1UOQA 1MU0A 2X8BA 5K3BA 5DNUA 5ALFA 2BUCA 5J3JA 3QH4A 4Q3LA 3QPDA 2G5PA 2C58A 4HTAA 4B9AA 2XMBA 4H77A 1CUDA 1TQHA 5K3DA 3FVRA 2XUDA 1ZIXA 2WUEA 5FPQA 5BWBA 1XZEA 1TCBA 1LBTA 3F9CA 1DX6A 3BE8A 3DDUA 3FYUA 3IDAA 2WG1A 1L7RA 2ZJ6A 4UHDA 2BUBA 4QDOA 2HIHA 4G9EA 2DHDA 2ZYSA 4HXGA 1E5TA 2ZYHA 5HCUA 3EQ7A 2AXEA 4FMPA 4OU5A 4B6GA 4W1QA 3IUQA 1ZICA 5JIBA 2PL5A 1P0PA 2XLCA 2QRUA 3UUFA 5ALMA 2WIDA 5CTAA 3OG9A 2WHRA 1CUBA 4X92A 3WL5A 1AX9A 2RAUA 4B83A 2CZQA 5AKGA 5JD4A 4C4ZA 3WYNA 4X95A 4ETWA 1Y7IA 3WWDA 3G0IA 4WY5A 2CMFA 1MNQA 4ZI5A 3HEAA 3WZMA 1B41A 2OCIA 3HACA 5ALNA 2O2GA 5KBYA 2QMQA 3DL7A 5I7UA 3RM3A 3PICA 4BRSA 2BCEA 3HABA 3AZQA 2YXPX 3ESAA 5JATA 1DT5A 2IX9A 3AJAA 1LNSA 3VDXA 3BJMA 5AJHA 1BEZA 5IVDA 1XZKA 1SOMA 1N5RA 2GYUA 5EHXA 3WWEA 4CI9A 4QLAA 2I78A 4YPVA 3HSSA 3A70A 5AK5A 1U8EA 3C6ZA 4X91A 4H7JA 3LS2A 1CFJA 3WKAA 5AIAA 1ZJ5A 3CCCA 1GZ7A 1BROA 4LYDA 4YASA 4JYMA 4P93A 5C7YA 3WWPA 5AM3A 1TKRA 1J07A 1XFDA 1WB4A 4DNQA 4ZV9A 5HK9A 2Y2VA 3WIOA 4UBIA 4E11A 1JMYA 1HQDA 4GXNA 4V2IA 3EBLA 5ALEA 2D5LA 3G9ZA 1GQSA 3PF9A 5IVHA 3FCYA 2RIPA 5AKKA 2ECFA 3QMWA 5C8VA 4C4YA 4BYMA 2B4KA 5ALXA 1TK3A 4K5QA 1QTIA 5AP9A 3CN7A 5AOAA 3B12A 3QPCA 2OGSA 1SC9A 1XZDA 2HA2A 5EFZA 3B5EA 3AUKA 1QIJA 1THGA 1I6WA 2RHTA 5C81A 4J0KA 3LCRA 3ILSA 1RP1A 2VSQA 3TRDA 1JU4A 4E15A 5A2GA 3HYSA 2XQIA 3AILA 3V1KA 5SYMA 3STUA 4W63A 4AO8A 4ZGBA 3AIMA 5A7GA 4GDMA 1IZ7A 3DLTA 1DWPA 5AI9A 4ROTA 1VLQA 2PSHA 1EK1A 2G5TA 1YASA 1ZGCA 2EDCA 3WYDA 3KXPA 1UK7A 4H35A 1Q0ZA 3DKRA 6YASA 1DWOA 4DNPA 4FBLA 5BOVA 3WK7A 1A88A 2YASA 4CG2A 5D3KA 1XLUA 3W2TA 4BRZA 2HDWA 1FFDA 4Y9SA 5CRIA 2HA7A 5E4TA 3QBJA 3FSGA 3ICWA 5D6OA 2JF0A 3G9TA 1YCDA 3FLBA 1QLWA 3WK5A 5CH3A 5FUMA 2WFMA 5AO9A 1CLEA 2XUOA 2PM8A 3KSRA 3HI4A 5JADA 3PDCA 1JJIA 4FLMA 1XROA 2WLSA 2X5XA 3Q0TA 2V97A 2WJ4A 1OXMA 1ODTC 5DYYA 5ALQA 2WIFA 3R3UA 1E66A 1H2WA 1UK8A 4WY8A 3H2IA 1UOPA 4JYPA 1UKCA 2XMDA 3I2JA 1ETHA 4BCDA 3O4GA 4AXBA 4BP8A 4DIUA 3H17A 4QNNA 3O95A 2JGJA 2XUFA 5AI4A 1UKAA 4MWTA 3U1TA 1DQZA 4MQLA 2JGEA 1AZWA 4ZRDA 5CT9A 1ZD5A 1BRTA 3G0BA 1XZCA 2QM0A 4LKOA 3WIBA 3ED1A 3WKBA 2Z8XA 3AZOA 1WHTA 4Z49A 3G0DA 4J0HA 2HHAA 1AMNA 5C8ZA 2XI4A 4DSAA 4M0MA 5JYCA 4PO3X 3DNMA 1CPYA 2H7XA 4H7FA 5FP0A 4AN0A 1WCYA 4Q3OA 3LP5A 1CQWA 2BJHA 1EHYA 4ARAA 3KWJA 3WQHA 1CEXA 2ZJ7A 1QFMA 4XVCA 2OAEA 4Y2YA 1A8UA 1ZI6A 1EI9A 5ESRA 1BCRA 4UBLA 3C8HA 2BKLA 1XLVA 4NS4A 5AKHA 2QJRA 1XZMA 3OPMA 3RARA 1THTA 4WFJA 2HU7A 4N5HX 2ZJFA 1KEZA 3G0GA 4GECA 3RK4A 1F8UA 3VVLA 2QR5A 1QO9A 1NX9A 1ZJ4A 4B81A 2WFZA 4UFNA 1UXOA 5HZGA 4P08A 1K8QA 3EQ9A 5ALLA 4QLOA 4OSEA 3STVA 3ZWQA 3KWFA 4MEBA 1T4MA 2PU7A 3CCBA 3E0XA 1QIKA 3R3ZA 4QDXA 4EZIA 2GZSA 3C5WP 3I6YA 4OPMA 4BP9A 2BFNA 1KU0A 3N2ZB 4Y2JA 2XMCA 4EB0A 3DOIA 2JGLA 5LZ4A 4KEAA 4AO6A 4AMYA 5LIPA 3GZJA 4FWBA 1FSSA 4Y2VA 4Y2SA 1LZKA 4RGYA 3TGLA 3ICVA 4J0JA 5IVKA 5CT5A 2V98A 1VZ3A 5LZ5A 4BE4A 3FBWA 3MVEA 5HFNA 3C6BA 5DTJA 2DHEA 4GI1A 5A71A 1GPLA 1VE7A 4UFPA 3C6XA 2ROQA 3OURA 4ZWNA 3W05A 3PFBA 2WU3A 4KE9A 1YA8A 4EY5A 4KAFA 4U2BA 2WQZA 1Y7HA 5AKIA 2JEYA 3V1LA 4NVRA 1EA5A 4BVKA 2VA9A 4S0XA 3VJLA 2PSFA 4X6YA 1EB9A 1WB5A 4MXDA 2H7CA 5JANA 2OCGA 2XUAA 3MUNA 2PSDA 3C6YA 3BL8A 2XQGA 1CUSA 1MX9A 3B3QA 5HKAA 4W9RA 3CN9A 4X6XA 4FNGA 1BN6A 5KWIA 2OPHA 5CURA 5FKJA 1K4YA 4BTVA 1S8OA 4WDQA 4KJXA 1XRPA 4G8BA 3ZLUA 3R40A 4LHEA 4FLEA 4BZZA 3STXA 3F8SA 3AFIA 2VJCA 1JFRA 1ZI8A 3NUZA 1XLWA 4AMZA 4EBBA 1GGVA 4W1SA 4WJLA 3MUOA 5AKXA 1W4LA 4UBNA 1Q83A 2VJDA 5YASA 5LZ2A 1BEEA 5A7FA 2WJ6A 1XRQA 4IH9A 2PBLA 3FLAA 4MWSA 4PV7A 1GKKA 3VISA 2ORYA 4GWLA 2XUKA 3WA6A 4EY6A 2GBCA 4BBZA 1Q0RA 5EHQA 2AJDA 1RWQA 2O7RA 1EH5A 2WIJA 1AURA 1WOMA 3RLIA 4BCCA 4RE5A 2VQ6A 2Z5GA 1SCIA 2HU5A 1UOOA 3D4LA 4Y2XA 4B80A 5CBKA 1LGYA 1NU8A 5FV4A 1JJBA 1GPKA 3SK0A 3ESBA 3I2GA 3O0DA 5LZ9A 4E14A 1VXRA 3TEJA 2B20A 4DMFA 2QVBA 2WTNA 3C8DA 3IA2A 4BC1A 1FJ2A 2BAGA 2OCLA 5CT6A 3FLEA 5AIBA 4H7EA 3HRHA 5AH0A 2XQKA 1LZLA 1JI3A 3R3WA 2AJBA 5C8XA 3O9MA 4DLNA 4XJVA 4MYDA 3D0KA 2OCKA 2C5FA 2ZVDA 3DJYA 3IVMA 5JAPA 2QXUA 3PE6A 2BUAA 4K2AA 5ALYA 4OUKX 2RGUA 2CEKA 4ZXFA 2PUJA 5HQ3B 1Q84A 1AGYA 2WG2A 4CIAA 5JD5A 4MJ3A 1B6GA 2CKMA 2VF2A 4H18A 4C89A 3F97A 5ALUA 2WIKA 5LKAA 1IUNA 2GBGA 2WIGA 4UHCA 2O7VA 1AKNA 1CUIA 1XKTA 3V9AA 3VKFA 3A2LA 1BE0A 1YSCA 4F60A 4FNMA 4UBJA 1MTZA 4A23A 2FJ0A 2ACKA 2Y1KA 1LPNA 2VAXA 4B7ZA 1ZD2P 3RKSA 4B84A 1AQLA 4X71A 5EIAA 2K2QB 4UFOA 5LZ7A 2H1IA 3WL7A 1DWQA 4Q05A 3WWOA 1E8NA 2HA5A 2XDWA 1CQZA 1XZFA 2Z8ZA 2C4HA 5ALPA 1QIFA 4B85A 5AM0A 1LPPA 3E1GA 3QITA 3A2MA 1AC5A 2P8SA 2QT9A 1E89A 5HQ3A 2PVSA 1EK2A 2XMGA 3H2KA 1J06A 2HRRA 5AKJA 1FFEA 4FHZA 3DQZA 4BDTA 3A2NA 4MEAA 1EB8A 5EHZA 3V1NA 1HL7A 3O4HA 4ARBA 4E46A 4OYYA 1IUPA 5CXUA 1VKHA 3D2AA 4JUIA 3DYVA 3QYJA 3UMJA 3PI6A 1VA4A 4P92A 2HL6A 1LPAB 4XWGA 2OQVA 5SYNA 3FNBA 2XUPA 2GZRA 2WSLA 3WL6A 3PFCA 1MX1A 1LPBB 3FOBA 4B0OA 2HA0A 4UBMA 3A6ZA 4N8SA 3TJMA 1XZHA 4K6GA 5ALDA 1C4XA 4J03A 2PUHA 4KR0A 4X93A 5JZBA 4YK7A 3V48A 2I3DA 5JASA 2RI6A 3H2HA 2VTVA 4G4GA 5AI0A 1SCQA 5EI5A 2WKWA 3H2JA 3WK9A 3I2HA 3KD2A 4AO7A 1CUVA 4BZWA 5IKXA 4Y7DA 2W22A 3N0TA 2ZSHA 5EGNA 3I6MA 5CXXA 3WK6A 2J4CA 4L9AA 3U0VA 1R3DA 5IVIA 2QUBA 4U2FA 4HZGA 4QDUA 3C70A 4KE6A 2HU8A 2PSEA 1ACJA 4WDRA 1BS9A 3GBSA 4U2GA 1MAHA 3D5EA 1U65A 4DM7A 4PSUA 1ODCA 4BC0A 1FFAA 1XZJA 4QDZA 1BN7A 3Q8WA 2AJLI 2WUGA 1PV1A 4N5IX 4AX4A 3H1BA 2XB6A 3HC7A 3BIWA 4XIIA 2J3QA 3ZPXA 4HAIA 1IUOA 1LLFA 2VATA 3FSGD 5ALHA 1CIJA 1MAAA 2JEZA 4G5XA 1MPXA 1DTEA 1TRHA 3BDVA 2HFKA 4WFKA 4LXHA 4M0FA 1CRLA 3I1YA 5DLPA 2H9YA 3I6ZA 1XQXA 4EY4A 3IUJA 1CUEA 3P2MA 2LIPA 4G8DA 4N8DA 3DKKA 5EIHA 4IO0A 3I2IA 2QXTA 5FLKA 3V1MA 4P9NA 1XKLA 3M81A 3QMMA 4OB8A 1O6FA 4X3CA 1R50A 5ALKA 1GQRA 5AOCA 1IVYA 4BAUA 4BDSA 1NU6A 4FOLA 2B61A 2OGZA 3IUNA 1YB7A 2JBWA 1XRNA 2XQFA 4X97A 5AM2A 1ORVA 2XUJA 4Q34A 3G7NA 3K9BA 5FDFA 4FKBA 1H2ZA 4Y2TA 5K3CA 3R3VA 2VT7A 2ZYRA 3F96A 5T4BA 5K3FA 4ZV7A 3DD5A 4OYLA 3L1HA 5AHXA 1YAJA 2WUDA 4CCWA 1MJ5A 3WJ2A 3X3HA 3DOHA 1K63A 5T4EA 1MN6A 4H7KA 1HPLA 3ESDA 5JAUA 2I3ZA 3QM1A 1QTRA 1QO7A 2VJAA 5AI5A 1W1IA 4KAAA 5KREA 2AJCA 2V96A 2C7BA 2BGNA 2QJWA 3C43A 3LLCA 5DWDA 3WKDA 5ISMA 4OCZA 1USWA 3M82A 3SX4A 4KRYA 4DTCA 2PPLA 2QZPA 4HRXA 2C0PA 1R9NA 1PFQA 1P0QA 5LYYA 4Y2QA 2YH2A 1M33A 1T2NA 5DYWA 1TIBA 3I2FA 4LIPD 2WUFA 3NOXA 2JGKA 2XT0A 1W76A 3G0CA 1TAHA 4QWMA 5AI6A 1XQWA 5I8PA 3G9XA 3NWOA 4UHFA 2OQIA 3MGAA 1QONA 1XZBA 4L72A 2ZSIA 4DGQA 4BE9A 3K6KA 5ALJA 3H1AA 1D07A 2VJBA 3SC2A 4H7IA 2WFLA 3FCXA 1JU3A 4GW3A 4AB1A 4L0CA 4C6HA 3C45A 1W6RA 4KAJA 2WM2A 3H18A 4CFSA 1LPMA 5CMLA 3JW8A 1VA5A
chains in the Genus database with same CATH superfamily
3E84A 4FE3A 1DX9A 2R2GA 3TIIA 3VZDA 2G71A 4O3FA 1DX4A 1WHTB 5MGNA 4ZVRA 3IP8A 1CS0A 2A5GA 1C2TA 3CX6A 1SMKA 1H6AA 4HUQB 3ZU5A 4JVOA 4TZTA 5K05A 3G9UA 3WS7A 4MGIR 2Q3MA 2W4IA 3I5UA 1OWNA 3E2IA 3HSYA 5F7ZA 3G1WA 5T4FA 1DQYA 4NBTA 3RYCA 5KNLA 3NJ8A 4K9OA 2EC5A 4LXIA 3NEYA 2QX7A 3KOMA 2D4HA 5F33A 5CA0B 1SD5A 2I4LA 4J6EA 5HF6A 2CL0X 3K05A 4CWAA 2Q9AA 2ZIUB 2CNNA 2CZCA 1K66A 2BR5A 5ER6A 2JBAB 2Z2IA 1O8CA 3CSDA 5JFGA 3OZFA 3N76A 4P83A 2WJVA 2O19A 1CDOA 1IWPB 2XRZA 3GFFA 5F64A 1II0A 3A1WA 5BUQA 3L0YA 3LUBA 2HIGA 2EG9A 5KKCA 5GGXA 3UT5A 4RS4A 5L3SB 3TLCA 4D2IA 4OFBA 4R4JA 4NXMB 3OUTA 2FDCA 2ODQA 3H13A 4HWOA 1ZNXA 3MCVA 3PFGA 4MARA 2JC3A 5DXFA 4A15A 5A3QA 1KEWA 2WJHA 1AM4D 2B4TO 4TMWA 4WLVA 5IM5A 1NYQA 1XUOA 3DAPA 3LGSA 1F6WA 3HRKA 3Q9UA 4MUAA 4OGLA 4MO9A 1NXWA 3TLJA 4D8TA 3ESCA 4YCBA 1PWHA 2DWOA 3A32A 3FJ1A 3VNSA 5JCJA 3WTBA 5AUNB 3ED5A 1V7CA 2J9ZB 5ALRA 3MMNA 1NKVA 1Z36A 2AG1A 5EGSA 5IC4A 3OQNA 1BRMA 1CQIB 1C0EA 5CGQB 2DFPA 1B8VA 1A8PA 5E6SB 3TM5A 4D96A 1SC1A 2DM6A 4W1RA 4G63A 2HF7A 1NP7A 5AQEA 3UMGA 1WABA 2ZCJA 3ZDEA 4HUTA 3EAFA 1TUIA 2O4UX 2NO4A 3IPXA 3B3AA 3PJEA 4HMPA 1FP7A 2DR3A 2GN0A 2J9YB 4Q1VA 3S2ZA 2JCVA 3R75A 2GO1A 4YLEA 4K9SA 5ALTA 5DSTA 3OEYA 4FE7A 4RXTA 3R0ZA 5EPEA 4DG5A 4BPBA 3G1TA 1M76A 2X0RA 4IUDS 5C1BA 3TM4A 4HX5A 4P35A 3RV4A 1V8OA 2FDXA 5HW0A 3JS5A 1O2DA 1T2AA 4POOA 1XTBA 1KC3A 1EHIA 4HXFB 1FPMA 3A4VA 1ZD3A 3MLBA 2B9VA 3WLQA 3UV6A 2FW1A 1YRBA 3FG9A 3G79A 4XLLA 2PKWA 1ZK3A 3BZBA 5SZIA 3WIEA 2Q99A 1TU3A 4M9CA 5CW1A 2Q5HA 1QF7A 1Z6GA 1QZZA 2IYZA 2P7HA 2WYWA 3CIOA 4F9FA 4B3HA 3WL8A 2ZITA 1AY0A 5K45A 4BLVA 2V7QA 3QE4A 2VXBA 3A9WA 1GCUA 3BQ9A 2JAUA 3CUTA 2HIAA 4AF6A 3DZGA 2AYXA 2Y0BA 3RC2A 1E4OA 4WKGA 2C9ZA 3H9CA 1BG6A 3CR3C 1VJGA 3R7WB 1WEKA 1DINA 1RJWA 1R15A 2OPBA 5C5DA 3OT1A 3L0CA 4ZQIA 1EJ0A 1R0CA 2KBFA 3F6SA 2ESRA 4J0CA 3OX1A 4NONA 3KQOA 5TDHA 4IXDA 1H0KA 3BTVA 4OQLA 3K0FB 3L8GA 3LTEA 3PGMA 4Q16A 4F86A 5HYVA 4B2YA 3E7DA 4I14A 4YRMA 5CVVA 1II8B 1DJNA 3RS8A 4L78A 2P7IA 3TN7A 1BCSB 1KQPA 1MIOA 2QR2A 2X8JA 4DLUA 3ZTWA 3DT8A 5HDBB 4F5ZA 2E5LB 1D4OA 2VZ0A 3QVLA 1LBSA 4MWOA 3LZ6A 3LU1A 1M3SA 2PV0A 3GLIB 3EW9A 1QFZA 1QE3A 3GLUA 1YKGA 3KOYA 4PG4A 5F76A 1UJ2A 3RS0A 4D4GA 5A62A 5L7YA 2PUCA 1W44A 2ZVJA 3K9GA 5D85A 1RWPA 1SXHA 3DV2A 3LBIA 5DTRA 1CF2O 2NTNA 3O4IA 2JLQA 4DYHA 2P5SA 5DSZA 4DANA 3IEIA 2OOKA 4K6OA 2XGMA 4J0QA 5TMEA 3UH0A 2LR0A 4M9UA 4A5SA 1DXOA 4B9EA 2Y2UA 1KETA 1UIMA 1STOA 1WW8A 2HNKA 5TF4A 5JBNA 3AM4A 1A8QA 2COKA 3ELWA 1A8SA 4G65A 1RPJA 5FX2A 5IG2A 1NQUA 1PUXA 2MT9A 3MLAA 2WA2A 4PX5A 4ZO6A 5E4JA 3SY8A 3T4PA 4G01B 5GONA 1HKUA 1W7AA 3O8LA 4S24A 4MI3A 1KZHA 5AKLA 5DNWA 4ARUA 3PEWA 3HCOA 3GCWA 2XZTA 3PDHA 1RHKA 4MVJH 1KH2A 2GM9A 2QKYA 2GNOA 1M2GA 3FKSD 1QPBA 1V8DA 1IBRA 4PXAA 4E5UA 1N25A 2YN4A 3SS7X 1RQ7A 4PYMA 2FW7A 3KAKA 4TKLA 4PIPA 5C8YB 1LY1A 3QUQA 2QN1A 4P4UA 4RY0A 5ADUS 2WQ7A 1QAOA 5IC5A 3GLFE 4R1QA 3FCUB 2G4CA 3EIOA 3V3KA 1O97D 4EZBA 4TV8F 2ATCA 4Q01A 5AOVA 1XYYA 3H05A 3N28A 4D6PA 2QN3A 3PKZA 5A4IS 3ETGA 3RSZA 2O2JA 5DSXA 2Y27A 1MEOA 1DIAA 3EQZA 1NJGA 4AG3A 4BNXA 1WQ4A 3TB6A 2QL5A 2JLXA 1F0PA 2GGSA 1FVHA 1P31A 3NKVA 3W1WA 2HYIC 4KR3A 3IBTA 4B7AA 4L08A 3VSDA 1CJTC 4E21A 3D59A 2H2FA 1G5HA 1NAHA 1KQGA 3ZHZA 4F4UA 5CLIA 4QYWA 3OO0A 3SZ3A 3IODA 2QQFA 4ZTZB 1CJUC 4UQLA 5JRDS 1I4DD 5FV7A 1XCBA 3GZTB 3GZ4A 4AJJA 5LNK1 4LJKA 4L7VA 1VG0B 4L2IB 2NZWA 1WEHA 3BUSA 1PJ3A 1ZHHA 1QSGA 2FSVA 3HFJA 3RSFA 1A27A 3HM2A 1BVHA 4EG8A 1R0SA 3LIIA 3R3XA 3CKYA 3LPCA 4L6AA 4WN9B 4HWKA 1OAOC 3NU1A 2VP9A 3R24A 4OLBA 3DQPA 5F5LA 2BN4A 2FQWA 3ND5A 3T5BA 3IV9A 2VH2A 3QHAA 3WL3A 4MW7A 2IK8A 5EQTA 1QRSA 4NZZA 4TVBA 2TSYB 2Z3ZA 1BTOA 2AT1A 4D9GA 4UW9A 1NKSA 3S55A 4GPBA 4ITUA 5BQPA 1NRIA 2RK3A 1EXDA 1L8OA 3LMKA 5DVZA 2ZJBA 2EF1A 2J59A 1N6HA 2X23A 3CZQA 3R5HA 3TB4A 4KN5A 4WRRA 7MDHA 1QH1A 4A0RA 1ZWLA 2QLTA 5J1TB 2FR8C 5JALA 1ZGZA 3DT6A 1RZRD 1DRKA 5GONB 2CJFA 3E1KA 3GFBA 2I6XA 4FDLA 1XK7A 3UWKA 4F2PA 1I0IA 1VOTA 2FZKA 2H18A 3F78A 4XVRA 4UM9D 5IH3A 4DN6A 5FWNA 2ADFA 2ZJYA 2FETA 3KKLA 4N49A 2JW5A 4D5EA 4LF7B 2WU1A 3O9VA 1RWKA 5JD6A 3GLHE 5AKYA 4Q66C 2XOXA 3IBFA 5IJ0B 1TADA 4EKNB 2JIRA 1W9HA 1ZMRA 5J2TF 2A6PA 1FTYA 1FDVA 2C9DA 4Z99A 4HVLA 2AZTA 1OFTA 1LW6E 3RSOA 3OTIA 5CM2Z 5JNWA 5L3VA 1P61B 1T6XA 3PFFA 1WRBA 2ZT5A 4YCMA 3ESXA 4K7JA 2HF8A 1NULA 4YRPA 2D5BA 5JQGB 4JFAA 2ODWA 1FX0B 2YVQA 4PZCA 3M1IA 3AY3A 4KTVE 4QBIA 1J20A 1XVLA 1YBFA 4TYMA 5EPUA 1S1CA 3V46A 2PRIA 3IT1A 3WGOA 3K15A 4IUYA 5BQ3A 3C87A 3COWA 2VDNB 3ADPA 3F90A 1HDOA 1U2QA 1UPBA 1Q95A 2GN9A 1P5JA 2P65A 2WWHA 1VKJA 4CF6A 1Y6GA 2F1IA 3GRCA 3IAXA 1NVXQ 3W5CA 3ZVMA 1KHHA 3IVXA 2X4LA 4XLZA 2IHYA 2RGNC 1CP2A 4F97A 3TINA 1YQDA 3G3EA 3QVGA 4DFDA 4WX2B 3PXUA 5IS2A 4EF4A 2GBIA 2RSLA 5LZ8A 4CLXA 4PC2A 1UPFA 2XUQA 5HVNA 2IHJA 2H1HA 2W2KB 4MUMA 3WYFA 1Q15A 2ENUA 1T26A 1RYEA 4ZOLA 2D3WA 1SXJB 5KWJA 1G7RA 1PTJA 4HGYA 5B6IA 1Q0LA 1NNI1 4FEEA 1Z29A 2Q6KA 5AK4A 1R6AA 3I42A 3UJDA 2CLCX 4U2DA 2IHUA 5CPBA 1BMFD 5H3LA 2HMUA 2J4FA 2NU8B 2IYVA 3RHTA 1JA0A 2ARKA 1AS2A 2MU1A 2RH4A 1M9NA 4UXHA 1COZA 1RYDA 4XQGA 4EHKA 2JARA 3ZE7A 2WINI 5CH5A 4IH1A 1YQXA 3X2SA 4H17A 1U0GA 4IEEA 2YR0A 4KNYA 1KFKB 3U19A 2VVTA 1U1EA 3CXUA 1A4XA 3QEMB 1PFUA 1TM1E 4GGOA 1A7UA 4YI5A 5LBIA 4AVYA 2RJNA 4Z7NB 3ZVNA 4JENA 4QFBA 4NV0A 3ENWA 5H3HA 5ALVA 1R0WA 2R6JA 1DC6A 2B34A 1PDWA 3OBBA 1TYZA 4P2GA 4BFLA 1WY7A 1W5BA 3MIZA 2ZIFA 1QNLA 1WPXA 2BGUA 5KYXB 3G02A 4H0CA 3LDGA 4LJ4A 4LXGA 4A2PA 5AVJA 1C8LA 4TROA 4NFLA 3PT9A 3BSWA 5LLTA 1TPZA 5HXAA 1N75A 4OU4A 5LQDA 3QW4B 1MCZA 2ID4A 4LZZA 1I10A 3F98A 3AFHA 4NNPA 1YHNA 4ZAYA 3WMRA 4DV1B 4NG5A 4FFMA 3TSOA 2P4UA 2GEVA 1LF5A 4K81B 1EM8B 2R1TA 3CU5A 4L76A 3RJZA 1CY8A 1ZITA 2XTNA 3B1XA 3OX3A 4ESHA 1NVKA 3ZD7A 2G06A 1GM5A 3O8OB 1NDHA 1W30A 3OCXA 3Q7RA 4G5QA 2F64A 3X1XA 2VWQA 3M89A 4LJRA 5LL6P 1I1HA 1IWBB 1C29B 1QYRA 2IIVA 3BZWA 5DPMA 2PX5A 1KPIA 2V3WA 5ITZB 5JXWA 1Z5UA 3AJ8A 4TZKA 3LUKA 3U6KA 1V5GA 4R3WA 5KYWA 3B9RA 4LTDA 5EMMA 3W5BA 4JJIA 1JEJA 1IULA 3Q3CA 3LBHA 5I7RA 3U7HB 3K71B 5ALSA 2VPTA 1UXJA 4EY7A 1GL6A 3IURA 4IGFA 1HC7A 2ZTLA 1MA3A 1ND6A 2PQ0A 4N01A 4YHBA 1LA2A 3PQEA 4FB4A 1D6SA 3AVUA 3I28A 3EVNA 3BRSA 1CF9A 3GW8A 4HNUA 3PHLA 4OGKA 2BEWB 5K8TA 1ICIA 3KCNA 1NJ2A 1ZIOA 4W5RA 3TECE 1OIVA 5LJIA 3OICA 2BIFA 4K2HA 1YGYA 1XPRA 1TQDA 3L5KA 4IFBA 4MRAA 4KIWA 3M4YA 4WK6A 3DDNA 3KUDA 1G98A 2R1UA 2AF3C 3NHFA 3S5JA 3ZJ4A 5CVDA 3NHUA 3SVLA 4A8HA 4G8CA 4L8VA 3B6IA 5BRJA 1L5YA 1V45E 5DOZA 5BN4B 5JNRA 3D8SA 3IBGA 4K9RA 2Y93A 3LHDA 3F6PA 2C3PA 2L18A 4HADA 4NK4A 5LJLA 4KYUA 2O5EA 2UZAA 3BDAA 1WB6A 2IJGX 4P8RA 3NAMA 1EWRA 4XJTA 4CMGA 1W93A 5KU7A 2GPJA 5DYTA 4E4YA 4Q7KA 2W6JA 4BKMA 1V3QE 3GJRA 3H1TA 3SR0A 3AOGA 4QOFA 3MB5A 2WJ3A 1OLSB 1U0FA 2EVWX 3FJYA 4M1YA 5JVDA 5G3YA 2E6UX 1KZ6A 5I9IA 4J94A 1UF9A 2ZT6A 5JSUA 3VI4B 4L8YA 4NDNE 1R0LA 1BXRB 3JYHA 4V38A 4KU4A 1Z7BA 1R0KA 2CXTA 4O4HA 3BXPA 1I3CA 1M83A 5AM4A 4JT9A 1BMQA 1OCEA 4KREA 3OM8A 3KTOA 4DJTA 2VBFA 2PX2A 1S89A 4GZ5A 4XIJA 3ZHUA 1NUUA 4UEOA 1W48A 4XGKA 3C3EA 1CUCA 2WT9A 2QLFA 1SQ0A 3CWCA 3EQ6A 4P4SB 5KYWB 2G83A 4FILA 3ONWA 2PGNA 3DM9B 2OLEA 1RRMA 3KXKA 3OCWA 5E2IA 4DWWA 4YYZA 2B8EA 1A9RA 3FHOA 4I9NA 3EPHA 4NZNA 1BE6A 2BFAA 2CKDA 1EMDA 2CMKA 4LYYA 2EP8A 2CYAA 3DEIA 3QV2A 5JS7A 1GGFA 2OXTA 1GSOA 1KSJA 1DG1G 1MO4A 2FN3A 3FHJA 4ZVMA 4BO5A 2IPNA 1JVNA 2IPLA 3JQFA 5H0IA 3TJZA 1U1IA 3E03A 1T9KA 3N8DA 1F48A 3UATA 3UAGA 1X7WB 2X2PA 4EO7A 1Q57A 2UUBB 4G1UC 2QNIA 3G0HA 4YH1A 4JXZA 2O8FB 2JJYA 4BMNA 3DCNA 3KD3A 3GEDA 1SURA 3WB0A 3ZG6A 4DLKA 4EJMA 2O8CB 2GMWA 2WF9A 3V8NA 4AP5A 3BORA 2QI9F 2C42A 4UE2A 1FTNA 2VG8A 5KOYA 3A6LA 4DJAA 2OECA 1K5PA 1KYWA 1MJHA 2GJKA 4DLPA 4CEIA 4OO3A 1RI4A 3WSWA 3G9QA 3OECA 3ZHVA 5G1PA 2ZI5A 3LVFO 1EFLA 1B23P 2FFQA 2AVDA 1QU2A 3E9MA 1DIOB 1QIHA 4INPA 5TQ2A 1FRFS 1W8DA 3H2ZA 3RSGA 3TTWA 1JTFA 1XRRA 2OXRA 3IFSA 1AHHA 4S1OA 1EWVA 1PS9A 5EAIA 4URUR 1ZN2A 3RC3A 5A3JA 3A9UA 4A8JA 4O2AB 4BNVA 2OXEA 3I53A 4RS3A 1OBFO 1ISHA 4DSNA 1F20A 1KEKA 2C7RA 3KEFA 4YQFA 3OD5A 4RNCA 4DWJA 3BA6A 4NBRA 1K2WA 4YRGA 2B94A 1L7QA 4JN6B 3LBYA 2FW8A 1A5BB 5KC8A 1T1EA 1V3UA 1PSWA 1E7RA 3DVAB 1XMSA 1GNVA 3B5IA 3Q6NA 4DXDA 3WGHA 3AIIA 3WADA 5ARDA 1WF3A 4IWNA 4MUKA 3T3GA 1E3IA 1XJ5A 5J5VA 4UNQA 4CU5A 2FMXA 3JYPA 3VH4A 3IYLW 3PHIA 2EU8A 4PPFA 2H63A 2KPOA 3NVAA 5EN4A 2J67A 1OFUX 4MQMA 4QC2A 5TY0A 1EEHA 1G4AE 2DUUA 3FZYA 4HQFA 5DZSA 3B38A 2P2ZA 3KQVA 2JIPA 4LGMA 3WK4A 3DZBA 1HUQA 3HDHA 4FMCF 2PZFA 3IVCA 4R7GA 4EENA 4IVQA 1V8FA 2AC7A 4TYPA 4TYYA 4M46A 1NBOA 2AOVA 2G63A 1R1DA 1KR2A 2ZRFA 2R00C 3L4EA 3ORQA 2Q7XA 4MROA 1XCJA 2QS9A 3H5RA 4M55A 5CVUA 4CM5A 1O4WA 3TQCA 1OFHA 1AE1A 2ZIZA 3PFIA 3MYRA 4MZDA 2QD4A 5TV2A 3RNOA 3V8VA 1R4NB 4F4JA 2WU0A 2H2HA 3CH4B 3A4YA 2HHCA 2Q2OA 3W2HA 1ZO8A 5KQRA 1GNRA 1GGEA 1LPSA 2PANA 2R65A 3TLAA 3D8UA 4P3PA 4PG8A 1PJQA 5JDCC 3R09A 4D41A 2HA4A 1LSSA 2CLMB 2C59A 3HP1A 3QFSA 3OZBA 4CE6A 3PFWO 1WE2A 3UGKA 1G64A 1E6EA 1FLDA 1UZUA 1RPZA 1ANKA 1W5AA 1UFVA 1XTIA 4V0OA 2XZOA 1IHOA 5TR9A 1UZLA 1ORDA 4LJAA 4PYOA 3STYA 1NT2A 4DBZA 2PUBA 2J3DA 1SWWA 2H4XA 5COQA 3RCBA 1GUZA 1DJOA 2EL7A 3CUVA 1NAIA 3M2TA 2GZ2A 1R66A 2GVDC 1H2YA 1QO0A 1YQQA 2WF6A 1I1OA 4N65A 4F56A 3BJZA 4K3VA 2ZJOA 1CR4A 1QIEA 4PO8A 2QMZA 1TF5A 1ONPA 1RPNA 1JKIA 3AJ9A 3TQRA 3KQWA 5FEMA 4INJA 3W3AD 1J0CA 1MB0A 2O3QA 1EU1A 3ABRB 5HCNA 4C4PA 2F3PA 1Y1TA 1T9CA 4QA9A 1JYEA 2CVOA 4DEVA 1UBLS 2BFBB 1P39A 1WPQA 3KVYA 1EFVB 1JG7A 1N57A 2GPSA 5LYJA 4GEGA 4FYVA 1JJAA 4P31A 4RHXA 4XYMA 2EP7A 2FSHA 1P5RA 1SAYA 3PHCA 1NX6A 4N7JA 4YAUA 4LMAA 4BEWA 4J07A 4D9IA 4F1KA 1UDXA 3LQKA 2PRSA 1AZTA 1ZSNA 3BSSA 5IF3A 4KGZA 4UHHA 1DKOA 4GBGA 3ZLVA 1DAEA 2WM9B 3D8BA 3NNDA 4MV0A 3STWA 1QUEA 1WZ2A 3SC2B 3AF0A 2ZR7A 4G0OA 1ZJ6A 2QRZA 2XVYA 3GQBA 3LHIA 4D45A 4EWLA 4BNFA 4U2CA 3PA8A 4I7EA 5I9MA 3RS5A 1E1QA 1Q19A 2NO0A 2Q1TA 4JK3A 4R6WA 3UJ3X 1TKAA 4JYCA 1CEYA 1N6KA 1N6NA 2FPLA 2WLTA 4BVJA 2WYOA 4FYPA 5KHLB 4QGGA 3BICA 4YO7A 3E27A 2WDZA 2GCPA 5FYQA 5HX7A 1N7JA 5BN3B 3AIOA 1UKVY 3VDMA 4JWKA 1VCNA 2XMSA 1YIOA 3M3PA 1YBAA 3UEOA 4DIOA 2QUAA 1BCSA 1NXTA 2XDYA 1AS0A 5BN1A 3E3OA 4UOZA 1AUPA 4QARA 4YEDA 4J7UA 4LV8B 5BWMA 3OLCX 3T3HA 2Q1UA 4WCDA 1Y3FE 2VYNA 2BSXA 3QEMA 2XYPA 3TNLA 1N9KA 2OCYC 4TS3A 4PLZA 5K8IA 3TYXA 4Z1OA 2G4LA 3QEAZ 3AWDA 5A9RA 2XT6A 1KA9H 1QZTA 1PR4A 3NORA 5D5PA 1XQ6A 2IIPA 5KJFA 6ABPA 4MMZB 4NFYA 4AWXA 2ODEA 2QN9A 1F5NA 1IZ0A 2XJ4A 4WXYB 5DYIA 4D9MA 2GESA 4O1IA 1HBJA 3C14C 4CEJA 3BF7A 3V2GA 1QP8A 1BFUA 2C92A 3ITKA 3GRZA 4KIFA 1AIPA 2AFHB 2Y6VA 5E8JA 3ER6A 1YRWA 2Q0HA 4H6VA 4C21A 1EWYA 4R5MA 3VBCA 1OYOA 1JKFA 2M6RA 3FHCB 3VUFA 2QP3A 3WSTA 4EEKA 2PGDA 5JOQA 4YUWA 4CTKA 1XNHA 4ZMBA 1CV2A 3VUEA 1EAMA 1P19A 3GUUA 3L9WA 4OQ4A 5LYJB 3E58A 3UT5B 5L3SA 1T0UA 2R25B 4H3SA 3MG9A 3V1UA 1P1FA 1Y81A 2J9GA 3QNMA 2FX5A 2ZBPA 3CNLA 3JWEA 4MRMA 2Q07A 2AFVA 2FSSA 3F5DA 3RS9A 5GJBA 3REGA 3HL0A 2BT4A 3VR3A 5CBPB 3GLFB 1I0ZA 3DFUA 5KTYA 2SKDA 3IEUA 1CZOA 1EFPB 1RKVA 4HPWA 3T34A 3P0HA 4HN2A 4I3FA 2A58A 2WHQA 1Z35A 2C84A 5D8DA 3FKJA 2NT3A 4LYGA 5BMVA 5DGDA 4WA8A 1R8JA 2G72A 3K2BA 2Q4EA 3Q1LA 4IRMA 4OB6A 1X80A 4X3OA 4K9QA 4PZYA 3BPSA 4WKPA 5GV8A 2JGDA 4DPLA 5F5XA 1YJAA 1UH5A 3UK1A 5AI8A 1X7XB 2D1TA 2VUTA 3E22B 3OLYA 1CUHA 1DHRA 3NANA 2X1HA 3UAOA 4C07A 1EX9A 1ZNYA 3O3MB 4EGFA 4UNNA 4C4TA 1N2IA 3GCZA 5B2FA 4WTOA 4WLOA 2L42A 2X8WA 4PRKA 1VIVA 3A6DA 1QIDA 2Q3LA 3IT2A 2XECA 4U8GA 1HNWB 1J2JA 4D8WA 2ZM5A 1XZIA 4HS9A 2WWFA 2G1JA 3O47A 1P0IA 2IYXA 1H69A 4M8LA 3BAFA 2P5YA 2LZ0A 3FPAA 1L9KA 2Z9CA 4I4LA 5ALIA 5FBLB 4B43A 4CQLA 2HMYB 5CX4A 4ZJZA 5EJ4A 5JSZA 4ZA2A 4HDKB 3AEZA 1B8NA 2HF2A 4XAQA 1WUHS 3HCBA 3GJ8A 3PGXA 1X1QA 1DL5A 3MRVA 2W6QA 4TXLA 4Q9HA 3KFVA 2DWPA 4RYLA 4HFRA 4JT8A 2H6EA 5D3QA 1ZA2A 3KU4A 3P2IA 2R48A 1QS0B 2BWJA 3F2IA 1Q91A 3HDVA 5THQA 2F1JA 3HKEA 1U11A 4IIJA 3E7XA 5JD3A 4YYEA 5AJTA 2R4UA 1KQFA 3GMDA 2CHEA 5CIYA 3UNXA 4BASA 3KJGA 3CZ5A 4UE3S 3G2HA 4Y0VA 4Q3LA 4BMCA 3CPSA 1FYFA 2UAGA 5GY7A 1N1DA 2AG8A 3U40A 3AUFA 3KWMA 3TUZC 1GZUA 3OCYA 4HTAA 4B9AA 1G6HA 4FGZA 4HDMB 4QO7A 5DGTA 4H77A 4BEJA 1U8FO 2YWDA 4RQUA 3OZIA 4Z4GA 3RV3A 4DNXA 3O2NA 1HYGA 1YRHA 3A4LA 4E07A 4GLLA 4L7QA 4ARZB 1GD1O 1L7DA 3GJQA 4P4LA 1CJBA 1KJWA 3OKFA 5K3DA 1G63A 4BL5A 1Z26A 2WUEA 3K16A 5FPQA 2YQZA 3GFTA 1A98A 1UJ5A 1N0UA 2OCXA 1XZEA 5BWBA 5I8ZA 1DX6A 1QVAA 1R2QA 2DKNA 3BEDA 3PHBE 4KXVA 4OH7A 4RZXA 2CK3D 3V4SA 3X44A 2NACA 3E81A 4M0PA 1HH4A 3D3WB 3NV7A 3QI7A 2FY8A 3QI2A 2Z6QA 5I5EA 3K5HA 2BUBA 2R7NA 4QDOA 1SJ9A 4JP1A 4UNSA 4DLBA 2HIHA 4TV8A 2YOGA 4JUDX 2B37A 2DHDA 4RCZA 2CXUA 4WKCA 3UUWA 3T1OA 5AW1A 4QUJA 1NPTO 2I4TA 3FZNA 1B6RA 1KAGA 2H4ZA 2ID8A 2YICA 4RESA 5CR9A 3UPDA 1V1RB 3NBXX 4JFRA 2VHQA 3RKRA 4YT2A 5M5BA 1YZQA 2GOYA 1ZC3A 3FW1A 3ZR4B 3CEMA 2B99A 4QU8A 1Y82A 1DGQA 2O07A 2P6OA 5TPZD 4JI7B 1LNQA 2W6ZA 1DXYA 4UUOA 1LBIA 16PKA 3OZTA 2FX2A 2WOOA 1NBAA 1JQAA 3I0MA 3KHKA 4RCYA 3GCGA 2AI2A 4KXFB 4D3ZA 2F2TA 4D6YA 3BGDA 2DUMA 4RA9A 2GPAA 1LDNA 1U7PA 3K30A 3NHAA 4JLBA 1H6DA 1TVCA 5ADVA 3OF5A 1MOQA 2E1RA 2OHHA 4I5EA 4NOKA 5K3SA 5TQ2B 3A36A 3UUFA 5K03A 1GNTA 1OXTA 1PSZA 4LYAA 3OG9A 2WHRA 2PZGA 5EVCA 2ZAGA 3VC7A 2D6FA 5B53A 3ONFA 3WHIA 1IDN1 4B8WA 1CUBA 3NHMA 2CXPA 4JBXA 5EWJB 2D06A 2FA9A 1NJ1A 1YOBA 2PUWA 4II7A 2FZWA 2E89A 4FFBB 3WL5A 2O1EA 2XJ9A 1AX9A 1F17A 4Z4HA 1YE3A 2FG6C 4R8LA 3WDSA 4E3WA 3R3JA 2DY0A 2O14A 4AN4A 1XU7A 2QDKA 2R1TB 1L5ZA 3MNFA 5I01A 3HPRA 3ENNA 4C4ZA 3UKOA 1XAIA 1VQ1A 2VN8A 4X95A 3VC2A 3C7DB 3PHHA 1E4VA 4WD3A 1XXLA 1OUMA 2DFKB 4HB4A 2OYRA 2FPUA 4BVEA 5KTOA 4YJGB 3RREA 4EHFA 1K3UB 4PPYA 3HEAA 3QUCA 4DPMA 1O08A 4JJGA 1NUSA 3L79A 2OV2A 1PS8A 3QOXA 2UKDA 2XKJE 1W0KD 1IY2A 2HPAA 1RRFA 3DLAA 4ZAXA 3RB8A 4YP1A 4NOLA 3ZX5A 4ML3A 1Q1ZA 2QMQA 3DL7A 4IEIA 1I32A 5I7UA 1Q7RA 1UJMA 5D87A 3PICA 1PWZA 3TTSA 3HDGA 1N2CE 1NLZA 4BRSA 1U90A 2BCEA 2X40A 1G18A 2GNPA 4PRLA 2P6PA 3WLJA 4AIRA 1T24A 2X2EA 2V3VA 1WXWA 1W47A 1S4QA 2NSLA 4RVSA 4XQ0A 3ZNNA 1HDZA 3L1VA 4NJMB 1E1RA 3U4AA 1DT5A 2XKKA 4ZCSA 1RNLA 3T9CA 1V8PA 4YCCA 1IM2A 3AJAA 2QTZA 1LNSA 2GFIA 1PJ4A 4KO2S 4ZQFA 3VDXA 1AQYA 5E1BA 2ZYWX 2FKAA 4ANFA 5JSZB 2OKCA 2Y99A 2QMYA 2OM2A 1BEZA 4UCXA 3O31A 5B7PA 4AXXA 1ZH2A 1NQVA 7AT1A 3RT1A 5ILOA 2IP1A 2GYUA 3H42B 5EHXA 1C8BA 3SJZA 3KBBA 5H68A 4DVGA 1Z22A 2CFCA 5KNCH 3HV0A 4BYGA 2IPMA 1ML3A 2I78A 1DV1A 3HXPA 3PITA 3M6IA 2A33A 1Y7PA 4X24A 1FS5A 1Z33A 5AK5A 4FQ5A 5GZ6A 3Q2OA 2V7VA 1H42A 4QRDA 2AC4A 3GYGA 3TQTA 3LS2A 2C3OA 3ZXXA 4NCAA 2V5UA 5HE9A 2V5VA 1P6XA 4FKMA 3HEMA 3RTEA 1KYYA 3S28A 4M7OA 4CM4B 4DQ0A 4EUFA 4YASA 1VJDA 2I8CA 5F1PA 4GBJA 4P84A 5AM3A 4B4DA 5IN4A 3F7TA 1XEXA 1J07A 1TFUA 1VLHA 4U7TB 2QTFA 4KKVA 1WB4A 3ZWAA 4DNQA 4EJ6A 3GLHB 4ZV9A 2Y2VA 2ZAMA 3UB4A 3WIOA 5CB4B 1PHRA 2FOIA 4UBIA 2Z6UA 3A9RA 1PJTA 3IPRA 4TV9F 4TSFD 3K0HA 5ECWA 1WF6A 2YY6A 1E3DA 4GXNA 3A04A 3EBLA 4V2IA 4BTEA 1GEGA 1NLUA 1PG5A 4O59O 3FTCA 2HV9A 1G41A 1MOPA 1N3YA 2R1VA 3K8ZA 3L6OO 4YAJA 4C4AA 1PQUA 5IVHA 2BM1A 1OHHD 3QNUA 2I76A 3U2QA 2BHSA 1JILA 5C53B 3AM5A 2WWRA 5LDGA 2PTGA 2X22A 2YXNA 4BQOA 3NAQA 3UXYA 1PT8A 1N2JA 1EXMA 1TK3A 3O94A 2OEPA 3FGZA 4MKZA 1JEOA 5JFOA 3S2SA 3EF0A 3BCUA 1VG8A 3CR8A 3CN7A 1C3JA 2RGBA 3SVZA 5BPHA 2PT9A 4YUYA 1ZM7A 3EIHA 3FIUA 3QPCA 5JSYA 4CM7A 1ZGGA 2VCYA 1SC9A 1BXGB 1I7QB 5AJVB 2FSUA 3HJGA 3EXIB 3OJLA 3X0DA 3INRA 1PL6A 2VPQA 1RE1A 5D01A 3VOTA 5TXGA 4R3UC 4B3TB 2XGOA 1HI9A 2FPMA 3PDIB 4OBBA 1ZQ9A 4OSPA 4BKQA 5DBFA 4W82A 2ETVA 3SYKA 5A6SA 3KVVA 3LCRA 1W1UA 2QB5A 1HG0A 3DB2A 1XNQB 3ILSA 2H11A 5HM6A 4DV3B 1UJ4A 3FPGA 2QJOA 4HH1A 2E5WA 4C08A 1C3LA 4GZ6A 3WO1A 6LDHA 4D80A 3C97A 5IT5A 4GG1A 1SHUX 3PC6A 5D3MA 2EKZA 2JVIA 2Y67A 3CKKA 2E9SA 3VKGA 5KAPA 4CM3A 5LN1A 1TUBB 2HPVA 1TB4A 2Q29A 4F2HA 1NJSA 1OZAA 1I7LA 3AILA 3DE7X 1Q11A 3N9IA 5SYMA 4IV8A 1EUDB 2RHHA 2VF5X 4JT4A 5IJXA 3GLTA 4M7WA 4NTZA 2XEDA 1XMQB 2JAWA 1MH9A 3E0QA 3N53A 3RJMA 1ZGAA 4DEYA 3IOMA 4GLOA 1IZ7A 3DLTA 3W8EA 3FNFA 4RD6A 5G53C 3L4JA 5AI9A 2C88A 1E3JA 2XTJA 5F1OA 2DF8A 3I12A 1IMOA 1VLZA 3SEQA 3HR8A 4M6WA 2JBHA 5LP6F 3LDAA 4FFSA 1ZGCA 3PUXA 2J7PA 1YS7A 5BSFA 1A9YA 3MAJA 4EF6A 1A5TA 4Q9NA 1NR7A 2Q1WA 5E38A 4AK9A 1PLJA 2FPXA 1DXHA 1JHOA 4FBLA 5BOVA 2V58A 2PMBA 1A88A 2YASA 2VXCA 3L7JA 4RIGA 4W9MC 3H9EO 4ENQA 1PZMA 3KKNA 1MRZA 3HCDA 5KTKA 4C0BA 1XLUA 2FP4B 4YMGA 1X74A 4I36A 4B4UA 2YOFA 2ZE6A 4LQLA 3AVTA 3GG2A 2FLVA 2XE8A 2P9YA 4UAUA 2HDWA 1WWKA 4NXNB 4DJ5X 3UK0A 4OIFA 4FVTA 2QMHA 2ERYA 4RA9B 3WFJA 2AG0A 2HA7A 4H27A 2I6QA 3GJ6A 4YY3B 4X60A 3MK31 3H5WA 4AYXA 1BO6A 1NVWQ 4PQYA 4EFNA 4C0QC 4MW1A 2PMWB 4E5NA 1JXQA 4HY3A 5DGXA 5DIFA 5I7AA 1Y33E 5CLGA 1SVLA 4MTCA 1XL0A 2CFSA 1VPWA 1E2UA 3Q3GE 4G0YA 2PT7A 3MD9A 2CF6A 2YDYA 3OE1A 4N4AA 2Q6LA 3O8QB 2XUOA 4R1SA 4ZO7A 5C8YA 5DKFA 3ZJ5A 4CR8A 1VM6A 1ONOA 2HXYA 1Z5ZA 3X1DA 5CCBA 1JGTA 1SPXA 2C04A 2DLDA 5BNTA 3OIFA 2WLSA 1ZUD1 1HNZB 1YZUA 3HB7A 3JQ7A 2G70A 1HV8A 2QTVA 1Q0PA 2O2SA 4GAEA 1UCFA 1OXMA 1QHFA 4LN1A 4RLSA 1ODTC 2BEVA 3UMVA 3CNOA 1NLMA 3IR5A 1YZTA 1P1IA 3R1IA 2KWIA 3A1SA 2YINC 2V7BA 4Q37A 2EFCB 3Q7TA 4KAXA 1NFRA 2C0CA 2YWBA 4H6XA 4C29A 4ENPA 4BP1A 1TJ5A 3OJWA 4X1YB 1UOPA 4P3KA 1SG9A 2E4XA 4V0NA 5JJIA 4TXNA 1FDUA 3I2JA 2BFWA 4I9HA 1KC1A 1UT8A 4CIXA 2GSWA 4EB3A 3DF7A 3H3XA 1FYWA 3PSHA 2WIBA 3QVGB 4UAGA 2FN7A 1XA3A 1AF7A 2DTEA 5FHQA 2WNSA 2IYQA 3UYKA 4BP8A 2YRWA 4DIUA 4UREA 1NRJB 2IHBA 3C48A 1ZNZA 1UP7A 4CUZA 3L43A 4Q6BA 5JJKA 4KDFA 2QGFA 1ZGHA 3CWQA 1VFPA 3TOVA 4L95C 1TIPA 3UJ7A 4ZANA 1Z7YA 2OK8A 4K46A 5AI4A 3HS3A 1U7OA 3U3KA 1UJCA 5ILQA 5LPNA 3I9JA 2D5AA 2JGEA 3H4VA 4WZAB 2VQEB 2HREA 721PA 1ILEA 2PL3A 2O5CA 5FEUA 5CT9A 1CZHA 1ZD5A 2PLWA 2W58A 3G0BA 5F23A 1KFEB 2ENWA 1S02A 2IYPA 3F2VA 1X19A 2FZVA 3U4IA 1KSGA 1RBMA 4CJXA 2CLFB 5C2JB 2Z8XA 5DBGA 2C9MA 2CV0A 2IUUA 3LBFA 1DARA 4J0HA 2RAPA 2XADA 3OWXA 3ZGLA 3PRKE 2I1WA 1JG1A 3QEOA 1QH8B 4KQJA 2XI4A 5ENVA 3BHMA 4LXYA 1DG3A 2MSKA 2LP4Y 3RHZA 1HE8B 4U8HA 4E4TA 5GZ1A 4LHYA 1E1DA 3CA8A 3OPYB 5C34B 2Q5CA 2H7XA 4H7FA 1SA0B 4AN0A 1FK8A 2PUDA 1HSOA 3OI7A 3DZJA 5KPDA 1JKJA 4Q3OA 3LP5A 4XSVA 5L6LB 5EIBD 4K6CA 2Z6AA 1N3BA 2BJHA 1XWWA 3OTGA 4Q3CA 1VG1A 5LB4A 3HVRA 3TQFA 4WY2A 4CTNA 2AN9A 2AR9A 3FF4A 5IT0A 1R18A 3SZLA 5SY6A 3EPKA 2QBYA 3FLMA 4TS9A 2JI7A 3N5CA 2OORA 2GK3A 3L8DA 2XB4A 2Q49A 1W4BA 4O8CA 4ZIRB 2VPYA 1H2EA 3C3PA 1O94D 4FYYA 4MIOA 4EF5A 3WAGA 3D43A 3MUEA 2OV3A 4P80A 2TMGA 1FPQA 1CXZA 2UVPB 3MGCA 4FCCA 4HJRA 4Q7EA 4R2KA 5E3IA 5BV1A 2JB9A 2WV9A 1ZI6A 4NI5A 4Z0TA 1X1EA 2O0LA 3U7RA 3G2PA 3ZHSA 4ZCMA 1Y4UA 1A5ZA 1YB2A 2W6OA 4URHA 3LFHA 4NS4A 1HYHA 2P4SA 2QJRA 2Z43A 1UMBA 2DTXA 2GCOB 2P9BA 3KYBA 3Q9NA 3N59A 2BP7A 3BXHA 3RARA 4C1NA 4GZ3A 1THTA 2FU5C 3RTBA 1W85B 1ZW1A 4NYJR 2VPIA 2MTBA 2PQMA 3TCKA 4ETMA 2O57A 2WJZB 3N2LA 2J3IA 2C95A 1C30A 1M0WA 3G0GA 3IP1A 2ZDHA 4Z3OA 1P33A 5FLEX 1C1HA 3P9NA 2Q41A 1PGPA 5TMBA 1G21B 2VJPA 3VVLA 2WAYA 4OJMX 1AVTA 1W19A 2H1FA 5DBOA 2FF5A 1REQB 1UFRA 3RAGA 1H5NA 4IHJB 1GNLA 3TPZA 1PIWA 2ZP1A 4R98A 2JS7A 1V26A 1V5IA 3NKLA 4P7BA 3IDSA 1N77A 1N9GB 1P3JA 5C8DA 1HYEA 5CM8B 4RABA 1G4UR 1US8B 5HZGA 1IQRA 2ZG6A 5KS2A 3QXGA 1NVMB 4AECA 3TTYA 1EUDA 5AW3A 5AVRA 2NTEA 5BQXA 1FQOA 2ZRKA 4LF9B 4IRUB 4HR7A 5HUJA 2Y1OA 3KHUA 3A6EA 4KVZA 1TOAA 2QAGC 2WBLC 1PL7A 2O8VA 4JSTA 2YXLA 4RADA 1RRGA 1AKUA 2DPGA 3NTLA 5JI3E 3ZWQA 4M4SA 3KWFA 4MW4A 2OL4A 5TT0A 4RDIA 4BZXA 3B13B 1KDTA 4YO8A 1L5KA 2G8NA 4MO2A 2W2TA 1W0JA 2BEKA 2E4VA 2C5SA 4QDXA 4EBFA 2ZYDA 2W2OA 4EZIA 2GZSA 2IS2A 3MPUA 2OG2A 3C5WP 3FDZB 3PIDA 3DC2A 3P9YA 3RLFA 1T8SA 3N2ZB 3QLJA 2XMCA 3M8KA 4F8EA 3QQPA 5JROA 4DUZB 1B93A 1FFGA 2PH1A 4DJDC 4F9EA 1Z0IA 1PEKE 5L51A 3IH5A 4RJKA 5CA1A 2GTPA 1KVRA 5LQRA 5LIPA 2R47A 3GZJA 1ODFA 1FXUA 4QUHA 2FOLA 5IT4A 2AR0A 4PO9A 4FYKA 4CKCB 3PQ3A 4DV6B 5HZHA 5LA6B 3L84A 1VP3A 1NG9A 3PPVA 1DS6A 4AMVA 3ICVA 4K26A 2P67A 5IVKA 4DV0B 3DV9A 1KVQA 3N2KA 3QX7A 1P5FA 1XEXB 4XPIB 3PNVA 1VZ3A 1SN7A 5TQ0B 1R12A 5KOHA 2C9YA 4DQKA 4H0NA 2EZUA 4NEQA 4PYNA 4XFDA 1G2IA 4BE4A 1O5OA 3JARA 3MVEA 4QSMA 3WO0A 1GP2A 1U0RA 3DHEA 2IXBA 3IQIX 5CVEA 5A71A 2GD6A 3DOUA 2CNOA 1PK9A 2QTTA 4UVGA 3C6XA 3LDFA 4FZVA 2ROQA 2CV2A 4FYXA 3OURA 3TSCA 2NYUA 1UWKA 5E6RB 1NBME 4DCCA 2BTEA 1TLTA 4UDYX 1GPMA 5CFPA 1DZIA 1N78A 4I5GA 3ADOA 5A0FA 3EY9A 1PVVA 5JH7F 4B87A 1KYVA 3GNTA 4F2DA 1PZXA 1NXVA 1U4OA 2WU3A 4W7SA 3A25A 3HJBA 3AHDA 4OHXA 1T3TA 4P53A 2W7TA 1WXGA 4YRBA 3H99A 4JL5A 4KFCA 3RC7A 1QOQB 3RIMA 4JYAB 1NOKA 1H1LA 3JYOA 4U2BA 2WQZA 5DTEA 4PGFA 3PGA1 3O4VA 4I4NA 3WBKA 3HKBB 1WMFA 3MM4A 1EA5A 1E9FA 1JLSA 2RHMA 2VA9A 4S0XA 1G8FA 1KS2A 2JRLA 5U1PA 2RI0A 1N3IA 2XZPA 2REBA 1I33A 2ZANA 1VE5A 3WLRA 4B32A 5DLDA 1UJBA 1WB5A 3R3SA 4QKQA 3FFBA 3WE7A 3FUXA 1FU4A 1PQPA 1JXMA 2XUAA 5IX8A 5JANA 1Y9EA 3ZDCA 2V0GA 1VIAA 4HJXA 5CYPA 5F35A 5CAEB 2V0CA 3Q6IA 4KG7A 3ACCA 2GDJA 1PQWA 3EF1A 4DIKA 1NF2A 3GWZA 3U80A 3WLFA 1SXPA 1R6DA 2VDOB 2I80A 3G2LA 2O54A 1ZH4A 2XQGA 1MX9A 1B8PA 4MYUA 4I5DA 1E62A 3AEUA 3SFVA 1OXUA 3PNQA 4G9BA 4MUFA 2P6NA 4FUTA 3CN9A 3Q41A 5B58T 2PBZA 2QHXA 1T4GA 1UQTA 4NZYA 4X6XA 3D0RA 3Q7QA 4QXOA 2OPHA 4CV3A 5KWIA 1O0BA 4KRFA 1X1RA 3FX2A 4ZAZA 1OBCA 3OOJA 1L7XA 3PFHA 4RPKA 5CURA 4Z4IA 5E3JA 1OQAA 2GCOA 4Q21A 4C6RA 2NGRA 2B5WA 3J7TA 3IL2A 1P9LA 2G17A 2GDZA 5FWAA 3SXUA 1M0TA 4X7PA 1U80A 3GFOA 3DWGA 1OZGA 4WDQA 4KJXA 1GTJ1 4LOKA 2BHTA 1L4BA 2F4NA 4GFDA 3TIXB 4G8BA 1C7ZA 3M9WA 4EEXA 2P0AA 4G1CA 1E2HA 1WZEA 2CD9A 4QELA 1T2CA 1GLGA 1K75A 2Q5JA 2WHXA 4H3VA 2GARA 4HEJA 5EMNA 1EIWA 3AQIA 4I08A 5KI6A 4FSDA 5IFKA 3EVEA 4MUBA 5J5AA 2FCAA 3BFPA 5F12A 1N9GA 1ZI8A 2ZBUA 1KOGA 1E7SA 1UEIA 3ZE6A 1XLWA 1YUMA 1ZN8A 1DFIA 3EVCA 1C1XA 3L8EA 1C9YA 2OSBA 4MRPA 4RL4A 3DEJA 1UWLA 3MUOA 5AKXA 2BFMA 1X92A 5FBVB 3WLLA 4WEOA 2EOAA 5YASA 3CKLA 1BEEA 4F4CA 1S1MA 2WJ6A 1M5TA 3BXFA 4GOND 2BMFA 1GGHA 4EJSA 2WJWA 3DEFA 1P1JA 2BMJA 1XRQA 3D3KA 3P94A 4J2TA 4EZEA 1P6UA 3MHTA 2P9CA 1LDYA 1M6EX 3FLAA 1GKKA 1XTTA 2QORA 3AR3A 2AEFA 3O93A 2CNLA 4R2LA 3VISA 2AH5A 3VO8A 3PD1A 1FP1D 4GWLA 4RTSA 3IOYA 4KODA 4KIUA 2IBMA 4OJNA 4HC4A 5E2AA 1SBYA 4B31A 1FBNA 3A7DA 1I3OA 2BF4A 3OM0A 4OXQA 2HSZA 2Q8NA 4KX3A 4POAA 4O3MA 3WRYA 2IQ5A 2FDRA 2O7RA 3KJZA 2JKZA 1KNQA 3PZRA 4H7PA 1XTUA 1EH5A 3LOUA 3SQNA 3TD6A 1U7TA 2UZ1B 1KRWA 2HDNB 3HU5A 1TW2A 5T64A 3Q8LA 3VA7A 1MB9A 2R6ZA 4MLZA 2P79A 3PR2B 1GDTA 1BU5A 3DDSA 1I24A 2W6MA 3QJ5A 3JD2A 1NUPA 1FCJA 3T7TA 3D4LA 2HMVA 5JMWA 1NMQA 4X8HA 4B80A 3RW9A 2CFRA 3EDCA 3HO6A 2W11A 4G23A 5ENZA 1NVVQ 3VR6D 3GUHA 5ITWA 5FV4A 4NH4A 3SK0A 1KBQA 3I2GA 5BW6B 4ND5A 5TJ9A 4CIVA 4DIDA 1IQUA 1NONA 2MSEB 2E21A 3N86A 3W90A 3HI6A 1OKKA 1OJ7A 1DEHA 2GRAA 5LZ9A 4HS4A 2ZR8A 4N3CA 4E70A 3MJRA 4H1TA 4XYBA 5HKOA 2WI8A 1RBYA 3KV1A 3WLHA 3TBFA 5KU1A 3G2IA 2WTNA 3NDRA 4HYTA 3C8DA 4BC1A 5AW8A 3RO7A 1N9ZA 4JGBA 4HEQA 4I1OA 4UDXX 4YAEA 4HNSA 5AIBA 5DCYA 4JVNA 1RVDA 4EHLA 1X9HA 5IUNC 1CYEA 4FX5A 2SKCA 4P86A 4N0PA 1TO6A 1GYPA 2R86A 2SNIE 2V4MA 4H6PA 1EE2A 1UMKA 3GP8A 3NBYC 2ZZNA 2B69A 3D8RA 4FW9A 4XCVA 3OIDA 3ICQB 1OFUA 1CD5A 2QG9A 2AX3A 3ONDA 4NL4H 3G89A 1YJ5A 4DPKA 1ZWKA 5B3LA 1QYXA 5G4KB 5C8XA 2OZLA 3O9MA 4XJVA 3U3RA 4ZOLF 5DWVA 4CDMA 3AI1A 3PRHA 3W9SA 4MVJM 4BNNA 1F2TA 3IJEB 3L0BA 4OJYA 5KINB 5TGZA 4KSBA 4LBZA 1DVRA 1U7DA 5A02A 2EFJA 1G7CA 4DREA 5HM8A 5TIIA 3BVPA 2E4WA 4DA8A 4CF7A 1RM5A 2AUNA 4TLLB 3AHHA 1LK5A 4C3ZA 1B6TA 4M99A 3NBZC 5GJCA 4OK3A 5ALYA 2WMDA 3W9YA 1W73A 4O2AF 4EHNA 3RG2A 1N32B 3MTGA 1BXRA 1JZQA 5TB5A 4OQFA 3T1TA 2LBPA 2CWDA 1AOXA 3I73A 2X7HA 3PYXA 1IEXA 3AO0B 2NUBA 5AVWA 2YWRA 5BVGB 2HB6A 2PUJA 1MC1A 2YW2A 5HQ3B 2R6HA 4Q48A 1D09A 5ELXA 2CY0A 3ZK8A 2CDNA 4YJKA 5KTPA 1V41E 1X1TA 2WG2A 2G07A 3MTAA 1MABA 1PBTA 2F3RA 4HQLA 3QXSA 5E6RA 4C5BA 5BXQC 2SCUB 5F1YA 1R4MB 2AN5A 1Y6QA 3NBFA 1JBQA 2BGTA 5TPZA 3UHOA 5A5FA 3OF3A 2Q1SA 2P9JA 2YNMD 4CKBA 3UFXB 4KL8S 4YIKA 1IVSA 5B1IA 2DUJA 1VPVA 2CKMA 2VF2A 3HFRA 2CD7A 4RV9A 2ALJA 2O59A 1DOZA 5ALUA 2J48A 1E6MA 1DC8A 1TM3E 3OESA 4O0LA 2PSSA 3KJEA 4J1NA 1GU1A 5JW6A 3Q3HA 4B33A 2GBGA 2O5RA 2UYHA 4X7RA 3KL2A 4CKYA 4JC4A 4XIYA 2O7VA 1VMIA 4FGJA 5GIPE 2E7ZA 5AJYA 1CUIA 1XKTA 3DZKA 2VKQA 1ZVVA 4F5YA 1F7VA 5HQJA 5DBIA 4YP5A 3UBTA 3EMBA 5TE9A 2DQKA 4F60A 1KE2A 5A5EA 4A23A 1MTZA 2FVYA 3K5IA 4KR9A 4YRKA 2WUWE 1WUYA 4RF2A 3K20A 5B37A 5P8WA 3WJAA 1JQDA 1NYTA 2GK4A 3IIEA 4MCAA 4IIUA 1LPNA 2EKQA 2VAXA 4M87A 4RC9A 4PZDA 1TUEA 2X58A 4QGBA 1D03A 1B8UA 4QTYA 3LKDA 3VSBA 1AD2A 1MQ9A 2P9HA 5KVQA 3D0OA 4X71A 4PZUA 4MWDA 4UXIA 3ZHXA 1XG5A 2P1DA 3DLBA 1J4AA 4ADSG 4OAQA 1GGKA 3WWOA 4WINA 4HO1X 3M4JA 4I4IA 3ZK9A 4KI7A 2RD2A 3KTAB 4L3VA 4XZ3A 3MTIA 2ZJ2A 1WU7A 1KTIA 4P3OA 4RFVA 1RM4A 1TCVA 2RHOA 3FCEA 5DHRA 2YX1A 4AX8A 1EJBA 1LPPA 4AZTA 5HPYB 1XDUA 3JQ9C 3OH8A 1UBHS 1Z17A 1ZD1A 4B3GA 3NO4A 1Q2XA 3S40A 2PD6A 3K0BA 4Y0AA 2TMDA 3A2MA 1ZBQA 1W1WA 2P8SA 1E89A 3KLOA 3LV8A 1LSJA 5BSTA 4JP2A 5HQ3A 2EW1A 3ELUA 4XB2A 1QC5B 3ZCUA 4QICA 1Y9JA 4MS3A 5HSGA 4F46A 2HWKA 2ZKLA 5B4TA 4G4SO 5GWXA 3A2KA 1T9HA 3Q9SA 3UT0A 3H2KA 2VZLA 5AKJA 5JZOA 2ZRCA 3EPRA 4FHZA 3NVKI 3T1QA 2Y1CA 1DTWB 1XYGA 2QGNA 1FXWA 3G8CA 3KAQA 4MEAA 4I1VA 1EB8A 1G5TA 2OV4A 3B1JA 4IL5A 3F6EX 1WUJS 2G28A 1YF3A 4DKJA 1QE0A 1JB9A 4Y6RA 1U5CA 5EUMA 1V2GA 5IHXA 1B0ZA 4O2BA 2CDCA 3KCQA 3MTEA 5KX5A 1U3TA 1ZK4A 3O1LA 1LLQA 2GZHA 1TFRA 2J0UB 2NQ8A 3OE7D 3PC3A 1UADA 5EZYA 2BY4A 2P2SA 2FPPB 1E9AA 3QYPA 1P77A 5L9AA 4R83A 3DYVA 5AW9A 4KGDA 1ADBA 3QYJA 3GJXC 3IAAA 2NVWA 3R6TA 1ZLXA 1VHLA 3ITNA 1E79A 5FA5A 4O5AA 4X41A 1SKAA 1XNJA 5E95A 4PNHA 5HIJA 4XWGA 1LPAB 4COOA 3KDSE 4J29A 1WDKA 3PUJA 1I2CA 2GCEA 5CLLA 1QRAA 1MH1A 2FFBA 3MS4A 2OQVA 4KH1A 3VU8A 1UP6A 5IBCA 1CJCA 2I2XB 1NR5A 4H15A 1ZEMA 2WE7A 3DMFA 3WL4A 1XRSB 4QUKA 3VV2A 4AZ3B 1P2TA 2I6TA 3D7SA 3RJ5A 1Q0TA 5INTA 3Q3EA 2HLNA 2J7PD 3BRCA 3PFCA 2J9FB 2K5UA 3WL6A 1CETA 1OWOA 1JEQA 3QE9Y 3JR7A 1QYCA 2B1GA 2PYDA 4U7HA 2DY1A 3F6CA 4XXHA 3CYFA 3A6ZA 2OZEA 4V03A 2XTAA 2C54A 4N8SA 3TL2A 4IO1A 3V4FA 4G5YA 1XZHA 3CJRA 4BU0A 4YCSA 2H8KA 4YCJA 4DUGD 4E7OA 3I6IA 4EFKA 1LUAA 4XR4A 1KEUA 4Z4EA 2PZEA 4ME6A 4RW0A 4J9VA 5KDLA 1PNRA 3UA3A 3H7IA 1U3GA 2B4YA 2IBTA 2JJQA 1H8EA 4ER6A 4D9KA 4BEVA 1KIAA 3WIUA 4X93A 2IV3A 2XNDD 4CLOB 4OOEA 1OJLA 2EEZA 2YJ3A 4YK7A 3QBVA 5JZBA 4ZEXA 5DT2A 4RTOA 4EKGA 1OXSC 3A4MA 5JASA 1ULTA 1JSCA 1QYVA 4IJKA 3REQA 1U7UA 4YCNA 3BEOA 1OKKD 1EX1A 4ZALA 2UUPA 4Y3UA 1M72A 1K97A 4FR5A 3ZEAA 1VKRA 3RVRA 4QGHA 3RT9A 4LVUA 3WB1A 1BS2A 4L8GA 4N03A 4TLDA 2RGXA 2QMEA 1G8HA 3KD2A 1XD2A 2NTYC 3WTCA 4ZYXA 1CUVA 1SBTA 2FPSA 3IAM6 3JD0A 1WUIS 3AJRA 2FUG6 4NJEB 3TQQA 5BR8B 2ODTX 2FPPA 3D3WA 3CNNA 3DM5A 2W22A 5I9LA 1YCGA 4ENWA 1AZSC 1U8AA 4NC9A 2I1LA 1PJ8A 3U0VA 3IQEA 4A6PA 2D3TA 2VP6A 4A27A 3IIJA 1FXWF 2QUBA 2Y1DA 3EVBA 5CEEA 5I48A 3CVWA 4R2JA 2BCJQ 2QY9A 3IRVA 1SM4A 4ZT2A 1Q7EA 5TNXA 2PSEA 5DO9A 3KRTA 3E3NA 4RVFA 5TEVA 4B3MB 3RRBA 4HB0A 4R68A 4U0JA 1ZUHA 4BJ3A 1TC2A 1BKSB 1SXJD 2P27A 4OM7A 3D5EA 4U2KA 1X7YA 4OI4A 2IUYA 3QLTA 1F2UA 1ODCA 4BC0A 3QLUC 3ENKA 1FFAA 5H82A 3V4OA 1CEEA 4QDZA 3ZIAD 2EWWA 1X39A 2JFPA 2Z30A 2PRJA 1PV1A 1WBJB 4N5IX 1IUKA 4GT1A 3PUZA 1CIVA 1IE3A 1IYZA 1BDMA 2WF5A 2CXHA 4KC0A 5IJWA 1GKYA 1DC3A 1LF0A 1J42A 1BS1A 3PX2A 4NMLA 4AY6A 5CVCA 5TGTA 2XB6A 3UW3A 5CFMA 3DZ8A 2NPIA 1FFYA 3V8PA 1PFYA 1Q7CA 1KFCB 5BYBA 1IATA 1FOEB 4L1KA 5J47A 3FSGD 2OHGA 2OZPA 3DE4X 3PXGA 5ALHA 3LO5A 2NLOA 2EBFX 1MAAA 3OIGA 4A7PA 1HZZC 1V8ZA 4JJKA 2Y92A 1LI5A 1FLNA 4HWPA 3IPCA 3WGLA 1JDJA 4NSNA 2FPRA 2GF2A 4ZEWA 5CJPA 3FCCA 3ZQ6A 2QVCA 3HQ4O 1B1CA 3D7KA 2QVZX 1B2RA 2PMCA 2QD3A 4XH9B 2VQFB 2GO7A 2WJAA 1KPHA 2VP4A 3INNA 1UDRA 3BHIA 1YRYE 1U8YA 3VR2D 3NTXA 4JJ6A 1ENOA 1OYVA 1JIKA 4JWTA 5EEHA 4L8FA 4R0VA 2WF8A 4JXKA 3PX7A 1CRLA 1AGPA 1N5OX 1Z88A 3C4JA 4B5KA 4UQOA 4JUAA 2J33A 2Y1XA 3AEYA 3UIEA 5HJEA 4Y6LA 3NBMA 3NRCA 3ZWWA 2Z56A 1G20E 1CRWG 3V7WA 2OHIA 2R7AA 3ABOB 2I99A 5A06A 4RO0A 1WLSA 2BFCA 5L7WA 2DQ4A 3D3QA 3H0EA 3U7GA 2Q8PA 4N76A 1P7ZA 5IJZA 3PLAE 2J6HA 5ELMA 3UMRA 1P17A 4JLSA 3EYWA 1EX7A 4HNTA 4G8DA 2DLCX 1HLDA 5AJXA 1TA0A 2GERA 3CLRD 4IO0A 5SYAA 5IUJC 2APJA 3LM8A 4KPUB 2IS6A 4ZGGA 2JFWA 4ZPXA 1EGAA 3IS3A 3M81A 3FTFA 5TRTA 4OB8A 3ZWBA 1TJPB 2A67A 3FUCA 4PCLA 1K7FB 4O4LF 2ZSJA 1R50A 3T8YA 3ZV4A 2VDRB 5ALKA 5HA5A 4KXMA 2H2GA 1IVYA 3VR5H 2R2AA 4PLTA 4YJFA 4BAUA 1NU6A 3K0KA 3MJFA 4BDSA 2EKLA 4E7PA 2OGZA 4WBSA 1XKQA 1ZVJA 1RM3A 1YB7A 5FTJA 3QYFA 3JU3A 3DDWA 4X97A 3U9LA 3IUBA 2C29D 3V8QA 1PDOA 2VDLB 4YQZA 5KHOC 5A4FS 2VP5A 3SZOA 1M7GA 4IIHA 1A8IA 2V1UA 5AW2A 1MPTA 2QUJA 5JHHB 1LDGA 3K9BA 4HNGA 4IJWA 2NXJA 3UN1A 4FEYA 5FDFA 1T6BY 4YTEA 3OCJA 4FKBA 1V16B 1IBLB 2XWJI 2HJHA 4WNYA 1RHJA 3EXHA 4JP3A 1LBHA 5FOVA 4RTPA 1D04A 1SZJG 1PK8A 4MS1A 1DIRA 1NTOA 2GD0A 4WJZA 1MJGA 1M2EA 5T4BA 3K5PA 2JIZA 2ZSBA 4TMZA 2CVFA 4J0EA 4ZCLA 3EEBA 5DULA 1T3LA 1XDSA 4AAYA 3NEAA 4Q4LA 2X9GA 3FZGA 3LFTA 2RGAA 1YNSA 2R1VB 2REOA 3CE9A 3LT2A 4EA9A 1SWVA 4ZCTA 5T4EA 3HH8A 5EP4A 3I72A 2R44A 1HPLA 4FI3C 2CHFA 4KXUA 4HMQA 4RHTA 3QM1A 3GPCA 1QO7A 2RIRA 3HO8A 2W2VA 1PV2A 3CW2A 4GVXA 2G1PA 3RUHA 4KAAA 3GCXA 5KREA 1LVHA 4WLUA 1FLVA 3QVUA 2AJCA 2CLEB 1VCMA 2XVAA 1SCAA 4RIHA 2PPVA 4C05A 2B98A 1KI1A 1JSRA 2FUG1 5HJ7A 1R4MA 2O2YA 1XAJA 1IM8A 5JV5A 3SJBA 3OQOA 1UINA 2DMRA 4KO3S 5EJ9A 3JQ8A 3BBLA 5KO2A 2PAAA 4IJMA 4WOKA 5ALDA 4B7CA 4KR6A 2ZUSA 1M2OA 1Y3CE 2RK6A 4RSMA 3U5ZB 3BTOA 3FUTA 1D5WA 4DTCA 1M1YA 2PPLA 1DDIA 1D2NA 1S6YA 3ZYZA 2I3AA 2FN9A 4P0TA 1XVUA 3U3ZA 1Q7TA 3NH6A 5LYYA 3UOWA 4ICIA 5EQDA 1DDGA 1D3AA 4AKTA 3OZSA 4PC7A 1X1AA 1FC0A 4AW9A 1ZONA 2CUZA 1AO3A 2A94A 2FWAA 4BQPA 3I92A 6CHYA 2O1XA 4L6IA 2KM1A 1HFWA 3EWSA 2PQ6A 4LZOA 4RFSB 3TW4A 3VDQA 3ZWCA 2FNAA 4JYBA 4LI3X 4AZVA 4B7XA 2UV8A 4FYJA 3VR4A 2PIAA 4N9QA 3GPIA 2CDAA 5EMJA 5K6AC 1G9TA 3CISA 4V1CB 4D9EA 1OH6A 2R00A 1N7GA 3AU9A 4LZNA 4WOBA 1X8KA 2GF9A 2CVHA 3AI3A 5KNCA 1TAHA 4P3XA 2X0DA 4QWMA