3M83A

Crystal structure of acetyl xylan esterase (tm0077) from thermotoga maritima at 2.12 a resolution (paraoxon inhibitor complex structure)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
325
structure length
324
Chain Sequence
b'HMAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Functional and structural characterization of a thermostable acetyl esterase from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 121
structure length 324
sequence length 325
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3m83A00
1ZIXA 4DLNA 4BE4A 3W06A 1MNAA 5LKRA 3EQ7A 2YYSA 5E4TA 4I19A 1E8DA 2K2QB 1ORWA 2I3DA 4G8DA 4MWSA 2BJHA 1BEEA 5A7GA 4RE6A 4WY5A 5FPPA 1XZGA 1H2YA 2G63A 1X2EA 1VJ5A 5KWIA 5JANA 3C6BA 1XQYA 4O08A 4P9NA 4KYVA 1ZI9A 3QPAA 1C7IA 2VAXA 2XQJA 4UHBA 3H2HA 2XLBA 1BN7A 2VF2A 2Y2VA 2QKYA 1LZLA 1FJ2A 3BF7A 4QLAA 3F97A 3G0BA 3IURA 4IH1A 4U2CA 4BBZA 1MJ5A 1YA4A 1W4LA 4PO3X 3EBLA 3ZPXA 3E4DA 3X3HA 2HA4A 4NZZA 4UFOA 3SX4A 4C4XA 3AUKA 2BUBA 5ALQA 1XKLA 3QBJA 4WFJA 1BE0A 3FCXA 4Q3OA 3WWCA 1XRNA 4DNQA 2WG1A 4G8CA 3GA7A 2WUFA 3QM1A 3IULA 3HRHA 1ZOIA 3H1BA 1CEXA 1MAHA 4N8DA 5ALUA 1QLWA 3STTA 5JD5A 4K6HA 3HABA 3C5WP 4HVTA 4ZXFA 3OURA 5JD6A 3OOSA 3G9UA 2C0QA 2C0PA 3QZUA 1JJBA 1EK1A 1XZDA 1R88A 5ALMA 4OU4A 4Q05A 5YASA 4GHWA 4Q3KA 3O0DA 2GZRA 2Y6UA 4ARAA 1IMJA 1UKAA 1BU8A 5FOQA 3LS2A 4HXEB 2Z3ZA 4B81A 2WUDA 3HXKA 3IIIA 4L3WA 3PUHA 1QIGA 3HC7A 4MJ3A 4C4YA 1VE6A 4Z49A 2HFKA 4OSEA 3WZMA 2XT0A 3G02A 4BZZA 3W9BA 4MQMA 1Y37A 5CT4A 1WM1A 5AI9A 1Q84A 3BIXA 3HEAA 3WWOA 4H7IA 2WKWA 2HADA 3F9CA 3F98A 2CZQA 2XUAA 1HQDA 4UHEA 1XFDA 5A62A 3C8DA 1UXOA 1XLUA 1T4MA 1LBSA 1VA4A 2JF0A 4DSAA 1P0MA 4MEBA 5AKLA 4C01A 2PSFA 4DYHA 3VKFA 4L9AA 4B9EA 1P0IA 4PSUA 2QMQA 4FFWA 4U2GA 1YAHA 3A70A 2ES4A 5K3CA 5IVIA 2B4KA 4XIIA 2J4FA 2H1IA 2QT9A 3R3XA 4HZGA 4YASA 4MXDA 2FUKA 2UZ0A 3L1JA 3KDAA 1PFQA 3VDXA 3RARA 3WK5A 5ALFA 1HLGA 2VT7A 1QIIA 4QDOA 2EDCA 4X6YA 2HU7A 4UBOA 2RI6A 3WIOA 4BRZA 3QMWA 1WB5A 5K3AA 5AIAA 5CH8A 2Z5GA 1SCIA 2GBGA 3BL8A 5FUMA 1R50A 3DEAA 1MT3A 5AKXA 3H19A 2VJBA 3LLCA 4YX9A 4J0CA 3AIOA 3N0TA 3FVRA 5J3JA 3WKDA 1WHSA 4X7BA 4PQEA 1UFOA 1L7AA 3PE6A 2XLCA 3I2GA 4X6UA 3C70A 1DTEA 3D5EA 1JU4A 3B5EA 4EHBA 4Y2SA 1XZFA 2ZYHA 5KREA 3HACA 2Z8XA 2BCEA 2ACKA 3ESBA 3K2IA 3JW8A 4BCDA 1BS9A 4G5XA 4XVCA 1FFAA 3ZV7A 2WIKA 2RHTA 1YAJA 1P0PA 3V1MA 1K4YA 4ZV7A 4WFIA 1GGVA 1EVEA 1GPLA 3I1YA 2QUBA 2WHRA 1A8UA 3FCYA 4Y7DA 5AK3A 5SYNA 2WJ4A 4EZIA 1YS1X 1R9NA 1CUWA 4B0PA 4GI1A 1H2WA 3EIOA 3NUZA 5IVKA 2O7VA 3F8SA 5K5EA 2O2IA 3BDVA 3WA6A 4GW3A 2CB9A 4KACA 2WUGA 2G5PA 3BWXA 5BOVA 1W76A 4WCVA 2HL6A 4BZWA 4KE7A 4KE8A 3WZLA 5JZBA 3STWA 4FNMA 4UPDA 1GPKA 3WWEA 3HSSA 1CUEA 2C58A 4ZI5A 1AURA 3BF8A 3PUIA 4P08A 3A2NA 2OPHA 2XUJA 4BAZA 1NX9A 3AJAA 3SWWA 5ALPA 1QZ3A 2NW6A 4M0MA 2OCIA 1MPXA 4LHEA 4N8SA 1AZWA 5AI5A 3WL7A 4FBLA 4EA6A 1XLWA 3FAKA 4B0OA 3HLKA 1CUYA 3K6KA 1J06A 3SK0A 3IVMA 3ESAA 1LPNA 1QIFA 6YASA 5AI8A 5I8PA 1LPBB 2XQKA 4B6GA 4G9GA 1XZKA 5LZ9A 2DHCA 1QIMA 5KWJA 1UK7A 4G4JA 1CUUA 3W05A 4HS9A 3WK6A 2VA9A 3WMRA 2JGKA 2HA6A 1UT6A 4ZGBA 3WK8A 4INZA 1K8QA 3EF3A 2XMCA 3I2HA 1XQWA 1XZLA 4IH4A 1THTA 3AIKA 3KWFA 3R3YA 5HCUA 2RAUA 3STUA 5ALYA 4U2FA 1S8OA 2OCLA 4UHFA 3ANSA 4Y2UA 1VXRA 3IUNA 1RP1A 5ALWA 4DSZA 1BCSA 5A2GA 3FYUA 3IB3A 4AZ0A 2H7YA 1CUXA 5HFAA 2PSEA 3PF9A 1SCKA 3K9BA 4QWMA 1LLFA 1F6WA 3C5VA 1JJIA 1KU6A 1ZGBA 2BUCA 1XRMA 5IVHA 2HRRA 1QFMA 3WKBA 4DMHA 3PI6A 5AKIA 3H2JA 2HU5A 1ISPA 1L7QA 1ZD3A 3U0VA 4J0IA 1DINA 3WWPA 3C45A 2ECFA 2DCMA 3O4GA 1K6EA 3W2TA 3M82A 4LXGA 3DYVA 3M3DA 5JD4A 2XMDA 3FYUB 5D6OA 1HL7A 3LCRA 4E46A 2GZSA 4QNNA 3WA7A 1O6GA 1D07A 5AOAA 5JIBA 2XMGA 4IH9A 4XX1A 2PVSA 4QDUA 2AJBA 5FV4A 1R9MA 1ZJ4A 2XUHA 3HJUA 5LIPA 4QDXA 1TCBA 4Q34A 3WK4A 3CCBA 1ZJ5A 4U2DA 4X93A 5JYCA 5CH3A 2ZJFA 4PNZA 1TIBA 1CUCA 2PUHA 2JGMA 4K2AA 3FLAA 5CT5A 1LPAB 4D9JA 2Z8ZA 5HKAA 1XRLA 2Y6VA 3EQ9A 4E14A 2JBWA 2PUJA 4NS4A 4P92A 4QWWA 1CV2A 1IVYA 1VKHA 2BGRA 4X90A 1CFJA 1GZ7A 4U2BA 4KE9A 1XRRA 3OPMA 5CT8A 5I9IA 2J3QA 4AQDA 2HDWA 2VT6A 1VA5A 4CIAA 1KEZA 3DKRA 3BE8A 3DCNA 3MGAA 3KXPA 1A88A 1W6RA 4BRSA 2XB6A 3JWEA 1F8UA 3C8HA 1MTZA 4GBGA 4TPKA 2ZJ6A 1UZAA 4J0KA 4KE6A 2HM7A 3DYIA 2W6CX 1C4XA 4Y2QA 3WQHA 2QRUA 4CG1A 2DQYA 2FJ0A 3H2IA 1AUOA 3VISA 5AKYA 1MO2A 3D7RA 3G9XA 5HF6A 1CUGA 3FLBA 7YASA 2O2HA 5EIEA 2AJCA 2WG2A 5HZGA 4HRXA 4Y2TA 2PKYX 3DL7A 1CUZA 4H7JA 3V1NA 2IITA 1UK6A 3P2MA 4CCYB 2DFPA 2B20A 3O9MA 3OM8A 3BDIA 4UHCA 1GQRA 5EHNA 3FSGD 3A6ZA 2XMSA 2ORYA 2PM8A 3FOBA 4WDQA 1W1IA 3ED1A 1EX9A 1Q0ZA 4NVRA 4QDZA 1OCEA 4X92A 4UUQA 4FTWA 3WL6A 2XQFA 3T4UA 4A5SA 5JZ9A 3GZJA 3LIIA 5AK6A 1IUPA 3O4IA 2X5XA 4H7DA 4X97A 4Y9SA 1LGYA 3O4HA 4AO8A 4YK7A 1YCDA 5ALHA 2WFMA 1CUIA 4MEAA 2PSDA 4MYDA 4U2EA 4N8EA 4UHDA 5CT9A 1ORVA 3QITA 2JEZA 4IHAA 3G0GA 4Y2PA 4FOLA 5JAUA 3D59A 3DOHA 1LZKA 4LIPD 5CURA 4H7HA 5EIHA 1OXMA 4FFVA 5JASA 4X3CA 1CIJA 1FFEA 1AGYA 3VJLA 4BP9A 1J07A 2I78A 4H7EA 1EK2A 4TVKA 5AKEA 2V96A 4GECA 4EY7A 1NU6A 4H0CA 4X85A 1TQHA 5D3ZA 2QVBA 1GKLA 2WM2A 5ALKA 4GDMA 2YH2A 4N5IX 5HFNA 5FP0A 4K5QA 4EY5A 1EA5A 4BE9A 2QUAA 2JEYA 3TRDA 2JIDA 3KSRA 4Y2XA 2XUIA 3RKSA 3VXKA 3ICVA 4WDRA 4C87A 5T4HA 4FBMA 2ACEA 4DMKA 3FWHA 1XLVA 2RGUA 5ISMA 1EHYA 1E3QA 3C6ZA 5LLSA 3O9VA 1TRHA 5CRIA 5EHXA 5ALJA 3FSGA 2XUPA 1QJ4A 4J0HA 1XZEA 5AICA 3B3QA 3I2KA 2ZJ7A 4ZRDA 4QA9A 3HZOA 2BFNA 2ZSIA 2XUDA 3R0VA 2OGTA 2G5TA 5AKZA 4BC0A 2ZVDA 3V1KA 2X8BA 1YASA 3G0IA 5C81A 5DLPA 3DL4A 1QGED 2XUGA 4OPMA 1IZ8A 2HU8A 4EBBA 3Q0TA 1GT6A 5D7BA 3T52A 2O2GA 4UHHA 1JI3A 2I3ZA 3WI7A 1QO9A 2VEOA 3C6YA 1QE3A 1XQXA 3B12A 1XZIA 2HIHA 5K3BA 3UUEA 2WFZA 2VJAA 2XUQA 1UOPA 1Q83A 3RM3A 1X70A 4EY8A 4CCWA 1QTRA 1BN6A 4EB0A 4GWLA 1H2XA 3JYHA 4ARBA 1I6WA 5CTAA 1GKKA 5EGNA 4FLFA 5AKJA 5ALDA 5FXMA 1GXSA 5AM4A 5AM0A 5LZ7A 1AX9A 4AO6A 5JAPA 1MU0A 1XROA 2ZYIA 3O4JA 1DQYA 4DTCA 3R3WA 2AJ8A 4DGQA 3CCCA 5AKKA 4KEAA 3KWJA 3E1GA 2D0DA 3UUFA 1R4ZA 2C5FA 5AHXA 5E2IA 2PPLA 3CXUA 2B61A 2J3DA 4LXIA 3MUNA 1JU3A 1AKNA 1LPPA 3R41A 4F21A 4DNPA 4DNOA 2EEPA 4BCCA 3PFBA 3RK4A 4OB7A 1FFDA 3KD2A 1IUOA 1BEZA 4UBLA 1MN6A 1CUJA 4BP8A 3BJRA 5AK4A 4DMCA 2GYVA 1L7RA 3DJYA 2GBIA 4H18A 3BJMA 5DTIA 1U8EA 5DNVA 4X6XA 1LPSA 5CXXA 2X76A 4M0FA 4TGLA 2QTBA 4N5HX 3Q8WA 3DKKA 2J4CA 1EB9A 2HFJA 4BCBA 4G1FA 3NWOA 4Q82A 5C8XA 1Y7HA 4KAJA 2JGFA 4BB0A 4LYEA 2PBLA 1JMYA 2R11A 2OAEA 4B82A 2RHWA 5JARA 1ZD4A 1EDDA 4L72A 3QYJA 3ZLUA 1A8SA 2DHDA 1DQZA 1O6FA 4B9AA 2WSLA 1WB6A 1QIHA 3C87A 4LXHA 3QVMA 3WIBA 2OCGA 3G9ZA 1YS2X 2YXPX 3WWDA 3BXPA 4ETWA 5AKHA 5EHQA 4HTAA 3H04A 4QDTA 4QE3A 4KJXA 1BROA 1DX6A 4CG2A 2HA3A 1W52X 3STXA 3R3VA 4JUIA 1AQLA 2WFLA 2ZYSA 1XKTA 4DNFA 1DT3A 4G9EA 3UMJA 3CN7A 5HK9A 3D2BA 1F0NA 3I2IA 2EDAA 3D2CA 3U1TA 1YSCA 1M33A 3R3ZA 3WK9A 4C89A 1JJFA 5DNUA 5AP9A 2GYUA 3DQZA 1UOOA 3H1AA 4ZREA 5HK8A 3WLAA 1XZBA 2QM0A 1SC9A 1DX4A 1CUDA 5DYTA 1J1IA 1CQWA 2DHEA 3OC0A 1ZD5A 4S0XA 1HPLA 5ALRA 3VJMA 1JT2A 3FVTA 5C8VA 1CUVA 2AXEA 2IX9A 2WFLB 4AN1A 4BVJA 2OAGA 1WOMA 1MX1A 3EQ8A 5HQ3B 5T4FA 3VJKA 1HKHA 4CI9A 3V1LA 1CUFA 1TCAA 4J0DA 4PV7A 1IUNA 5C7YA 2W22A 3AIMA 4H7FA 4CFSA 3FLEA 4LKOA 1WCYA 3D2AA 1VOTA 3I6MA 3W9UA 3ILSA 3NGMA 5AM3A 2PX6A 4OU5A 2DR0A 5HF9A 3ICWA 3WJ2A 2WJ3A 5AO9A 2XUOA 2VTVA 4EY4A 3HYSA 2QXUA 1B6GA 2YASA 3FBWA 5DYWA 3QH4A 1XRPA 5BWCA 4H7KA 3M83A 3S8YA 4JH0A 5JATA 3D0KA 4BAUA 5ALIA 2VJCA 1XZAA 3AZPA 4B83A 4PSCA 5ALSA 1ZICA 1VZ3A 2O7RA 2WIFA 4UFNA 4GLBA 3I6YA 4Y2YA 3V48A 2OXEA 2QR5A 3NOXA 4G4IA 2WQZA 5K3EA 1BCRA 1VE7A 4BDTA 1WHTA 3G7NA 3I28A 1AC5A 5AOCA 3MUOA 3ESDA 5AM1A 3R40A 4HAIA 4J0GA 3LP5A 1YR2A 1UK8A 4CCYA 2E3JA 1MAAA 4W1PA 1G66A 1P0QA 1PV1A 3F67A 3W04A 3TGLA 4PW0A 5A6VA 1CUSA 5BV7A 5E4YA 3YASA 1QOZA 1N5MA 4ZWNA 1ETHA 5LZ8A 4ROTA 4HRYA 5ESRA 4AMYA 2ZYRA 5IH7A 1EB8A 2WILA 5AM2A 2PSHA 5ALZA 1ODSA 3IDAA 3STVA 1OILA 2B9VA 3GROA 5HF5A 2WUEA 4PF1A 1QIJA 2VQ6A 4MQLA 1DWQA 5A7HA 4EUSA 3H0CA 1TCCA 1MNQA 4AMZA 2XQGA 1USWA 4F5ZA 2PL5A 1LPMA 1CUAA 5DYYA 2JGJA 2P8SA 1XZHA 4V2IA 4CIBA 3QMVA 1PJAA 4XJVA 5DWDA 5EI5A 4KAFA 1HBJA 2WU4A 2V98A 5E4JA 2OQIA 5ALEA 5ALXA 2HA7A 2DQZA 1XZCA 2CBGA 5AI6A 3WJ1A 1TK3A 3DLTA 4QEKA 4AB1A 4W1RA 1A7UA 1UK9A 1ZI8A 1YA8A 2QJRA 4AN0A 1RYYA 5AM5A 4YPVA 2VSQA 1ODCA 1CPYA 4KRYA 2BAGA 2IIVA 5AK5A 2WIGA 4I3FA 4I4CA 2XDWA 3PICA 5T4EA 4F60A 3G0CA 1LNSA 3OG9A 2QZPA 3O95A 3AINA 2OGSA 1CLEA 4ITVA 1TAHA 3WK7A 3M81A 4QLOA 4UBNA 5EHZA 3PF8A 2WTNA 2XQIA 3S2ZA 3A2MA 4UBKA 4OYYA 2I03A 3IUMA 4KRXA 2WTMA 4JYPA 4OCZA 4BYMA 1CUBA 1AMNA 3C6XA 2C5GA 4RNCA 1E66A 4OYLA 4G8BA 2WHQA 4X95A 2HRQA 2QJWA 1N1MA 2Z3WA 4JYMA 1LBTA 4FLMA 5FPQA 2FX5A 1CR6A 2Q0XA 3DOIA 3FYTA 1E8MA 3ANTA 3PFCA 5EFZA 4CG3A 4X91A 2CKMA 3N2ZB 1W75A 2OCKA 4E11A 1X2BA 1Z68A 1WPXA 4W63A 4K6GA 3DS8A 4OD0A 3A2LA 3CN9A 3MVEA 5HF8A 4RE5A 5JZSA 3STYA 2OLEA 3ZWQA 5AJHA 1G5FA 5CMLA 1JMKC 5LP1A 2XUFA 5CW2A 1YB7A 2C7BA 1CQZA 4PSDA 4FKBA 3DD5A 3WL5A 3G9TA 2ZSHA 2JGEA 1EDBA 3H17A 3SC2A 1XQVA 1SFRA 2BGNA 5H3HA 4MWTA 2JGLA 1UKBA 2DSNA 2VJDA 4JEIA 1WPRA 4FLEA 5DNWA 1DWOA 5AKGA 1JKMA 3AILA 4DM7A 1Q0RA 3KOOA 2WG0A 3ZI7A 1BRTA 1B41A 4H35A 4J03A 5KBYA 1C7JA 1ZIYA 1MX5A 1EINA 2OGZA 4ZV9A 5ALVA 4NMWA 1NU8A 2AJLI 3IUJA 1T2NA 2Y1KA 4AX4A 1SOMA 3WYDA 3G0DA 2WLSA 1VLQA 1QFSA 4P93A 1R1DA 4UBMA 2XMQA 3AZOA 3L1HA 4X94A 3VVLA 2V9ZA 3F96A 3HI4A 3WKEA 3GUUA 1H2ZA 3AFIA 4L0CA 1H22A 1DWPA 2CJPA 4W9RA 4BAGA 4BVKA 1ACJA 1WB4A 2ONCA 5JAHA 4LYDA 1CUHA 1VZ2A 2XMRA 2Y2UA 4C88A 2D5LA 5CT6A 1TKRA 1U4NA 2WU3A 3WKCA 3QPDA 5SYMA 2WIDA 4B85A 2GYWA 4E15A 1ZI6A 1GPNA 5ALTA 2R8BA 3I6ZA 5AI4A 5A71A 3IA2A 5LZ5A 2FJPA 1JFRA 4QZVA 3H18A 4W1SA 2QOEA 3WYNA 3I2JA 4X00A 1R3DA 4B80A 4M0EA 1SCQA 1EXWA 4WJLA 4FWBA 4F0JA 5AH0A 3GELA 5DTJA 3DDUA 1YB6A 4W1QA 1LPOA 1EI9A 3OTQA 2CEKA 5K3FA 4UBIA 2AJDA 1ACLA 4RGYA 4RPCA 5ALNA 2ROQA 1Y7IA 2BKLA 3GFFA 5IKXA 4H77A 2BUAA 2WIJA 2CUTA 2WHPA 1CRLA 5JALA 4GEGA 1EVQA 1H23A 1E89A 1XRQA 4MYSA 4J0JA 4Q3LA 1K5PA 5FKJA 4AZ3A 2XMBA 5F4ZA 3H2KA 4WFKA 4KAAA 1XZMA 5HKBA 5DJ5A 4J3JA 1QO7A 1QIDA 2H7XA 5CH5A 2CMFA 5K3FB 3IBTA 2XE4A 2OQVA 4XWGA 2RONA 3I1IA 4JNCA 4Y2JA 2VATA 1EH5A 1QONA 4BATA 1GQSA 1UOQA 3V9AA 4A23A 3R3UA 4G4GA 3ZLTA 1ZGCA 2GBFA 5HQ3A 4IQ4A 2WHPB 3E3AA 1UWCA 2HHAA 2WJ6A 4BTVA 5CXUA 1F0PA 3E0XA 2C4HA 1FFBA 2PU7A 3DNMA 4J7AA 2XMZA 2GBCA 4GXNA 4FHZA 1MX9A 4B7ZA 1U2EA 5ALOA 3ZLVA 2XUKA 2RIPA 1N5RA 1U65A 4HXGA 4AO7A 1KU0A 1QIKA 3GBSA 1IZ7A 1K63A 5JAOA 5D3KA 2LIPA 1VXOA 4OB6A 4A16A 1DU4A 5IVDA 1E5TA 1J2EA 1UKCA 3L1IA 3LIPA 1EDEA 3H2GA 3I2FA 5LYYA 3TJMA 5JADA 2H9YA 5LZ2A 2XI4A 5A7FA 4FDMA 2HA0A 5T4BA 3QPCA 2PU5A 4C6HA 5LKAA 3TEJA 5ALGA 3PDCA 5AIBA 4BTLA 4DIUA 1FSSA 2JGIA 2HA2A 4B84A 5LZ4A 5ALLA 3WKAA 4HXFB 1A8QA 2QXTA 4UBJA 4BVLA 5FDFA 3D4LA 4C4ZA 4Q1VA 2QS9A 3VVMA 4EY6A 4BDSA 4KR0A 5EIAA 5AOBA 1G42A 2VAVA 1QIEA 3ESCA 1G4HA 2HA5A 4Y2VA 1QTIA 3RLIA 3G8YA 1HDEA 1DT5A 1FFCA 2PSJA 3QMMA 2G4LA 1N8SA 2H7CA 3C43A 4OB8A 3AZQA 5I7UA 1E8NA 2OG1A 4WY8A 2V97A 3FYUC 4DMFA 1XZJA 5CBKA 1ZD2P 4OUKX 3WL8A 1THGA 3FNBA 5C8ZA 5BWBA 4X71A 4FMPA 3BIWA 1CVLA 4BC1A 4K6KA 1RWQA 3IUQA 5FLKA 4IO0A 4AXBA 5K3DA 4Y2RA 5AI0A 4UFPA 5FRDA 3D3NA 1ODTC 4FNGA
chains in the Genus database with same CATH superfamily
1PQPA 1Z0ZA 1QH0A 3AUUA 4WY2A 5HKLA 1UXIA 3ITDA 4C5CA 2QU7A 4EPXA 1AGXA 2MJLA 1FX0B 4KQJA 3A6LA 5A9RA 2XA1A 1NQAO 3EIWA 1LQUA 2WWTA 4HNRA 5SY6A 3M8KA 2C96A 5I8ZA 2O8CB 1SD2A 1GA4A 1GPH1 3QHPA 2I3DA 2OKCA 4M36A 1VL6A 1UUFA 2XVMA 1AKYA 3GNTA 2BE9A 5DXFA 2FAXA 2AF4C 5TGDA 4YPFA 1W88A 2H07A 4B09A 3LO8A 1SWVA 4MS1B 1RJGA 1UEJA 3H5RA 4O33A 3W1WA 1ZJWA 2FFBA 3W8RA 4C0WA 3M3PA 2OV2A 2ZWMA 2UVPA 1H2YA 1OZ0A 1D6MA 1C30A 2G63A 4LGYA 4CKEB 3U3MA 4CIDA 4GL2A 1HX7A 2PVPA 5E6SB 2PUDA 2IFTA 3JQAD 4U9UA 1VJ5A 1H94A 2YJ5A 1NXXA 4BNNA 1NE2A 3JQ8A 2FFAA 3F6RA 3ZU6A 1KC1A 2CHGA 2EFDB 3BHNA 1AOXA 4FI3F 4Q4DA 1RHQA 1VHTA 2X15A 1PFYA 1XQYA 1W8DA 1PNVA 3C6BA 5E9WA 4RPLA 1DE0A 4OTZA 1IXYA 4M1QA 4TV8B 1D5CA 1LUAA 2FFQA 1SN7A 3OX3A 4WBSA 1NC3A 3I3SR 3T8YA 4G1UC 3IA7A 3Q5DA 1BN7A 1UEXC 1C0IA 2CLFB 4IRUB 2VF2A 2E4AA 1IBLB 1WCXA 1L5SA 1KO8A 2QD4A 3LFTA 4KN5A 4MJ7A 4D5EA 3TTSA 1I4DD 1TVKA 2J3JA 3E0QA 2REQA 2QKYA 5J2TB 4M9XA 1LZLA 2ZE5A 4LKRA 4MTLA 5KYGA 1PJTA 1P91A 2BELA 1WMSA 1R10A 1CS0B 1TUBA 1VL5A 4MO2A 4QLAA 4DYDA 3HA7A 4OHXA 1JHZA 3VI4B 5LYJF 1E32A 3BORA 4U2CA 5CDUA 1YA4A 4BLOA 5LN1A 5F2KA 3LY5A 3E4DA 3OX4A 2DGDA 3X3HA 3K9WA 1MCZA 2I4OA 3SLGA 4INOA 3SZMA 4AL4A 2JATA 4C4XA 2O3QA 2ZS7A 4PX3A 1KAMA 3NJ8A 1FW8A 2IKSA 4J49A 2AE2A 4Q9DA 4AS1A 2ZJ4A 1X1CA 1CT9A 2BOVA 2RIRA 3ZZ0A 2B34A 2FRDA 3DAHA 4KQHA 3K15A 1J21A 4Q3OA 3QEMA 4WCFC 3OD5A 1VBFA 3R23A 4IGKA 5EZYB 1XRNA 4FUQA 1M2NA 2IE0A 2UZ1A 2WVAA 3LW7A 4NNPA 3SZOA 1E1NA 1TB4A 3LX8A 3N2NA 3QOYA 3VZRA 1PYOA 3GA7A 3P0IA 5EJ7A 1AQ6A 1TF2A 6REQB 1TNDA 2NTVA 2C2YA 2WAMA 3IULA 2NTNA 2G76A 2XOEA 1ZOIA 4P80A 4N8DA 1C8VB 1R6DA 3CNHA 4O2AB 1QLWA 1BA3A 3FKJA 4KIGA 5JD5A 1MRNA 5DZSA 3LUKA 3ZNNA 3ZY2A 5P21A 4ZVRA 1QNFA 1ZNZA 4QU5A 3PPXA 1ZR2A 2X0NA 4GBED 5EJGA 2G17A 4UCWA 4GOLD 1WULS 2ZTMA 3OEHD 4A26A 3EW9A 4N76A 2HYDA 3HL0A 3UJNA 1XZDA 1JAZA 2Z1NA 4IKOA 3SHVA 1NSFA 4ZT5A 3BXZA 3ZU3A 2F3QA 3PHBE 3BIJA 2Z9BA 1XG5A 1W30A 3FZGA 2IDMA 3R9IA 4B2YA 4GHWA 3W2GA 5JJIA 5G40A 1ECJA 3JZIA 5ARBA 4IDEA 4MVJM 1XDDA 4TSFA 5LA6A 2A0XA 2P5UA 2RKWA 2FN8A 3IHTA 2XGGA 2Y6UA 3HUFA 1IMJA 4AUMA 5T57A 3QEOA 1SXJC 1Z2DA 1T6NA 1V9SA 1ZN8A 3G17A 4C7KA 4DCNA 4B2PA 3CJTA 3LS2A 1ULSA 4O2BF 1PGNA 1Q0LA 2WUDA 3HXKA 4U3JB 4OIFA 3JQQA 4QYXA 3CEAA 1P17A 3PUHA 3BIOA 4MJ3A 3RTEA 2P78A 1I6KA 4LSMA 3AT1A 4FIZA 4LFBB 1Y8QB 1A4XA 2OBFA 3AHFA 1B2LA 4OQDA 5KYTA 3IL2A 3VUEA 3HY6A 3WZMA 2WY2D 1Q0QA 4BZZA 4YCLA 5LQNA 1EIWA 3PFFA 1G2OA 1YJCA 1H9CA 3MUFA 4PCVA 4YJ2B 1K7CA 3D5TA 3ECSA 4UTRA 1NI4B 2PS1A 4HGPA 4L4ZA 4MQMA 1R6AA 1Y37A 5CT4A 2J8ZA 2QL6A 2IU0A 3I6IA 5CFZA 2ECOA 1YR7A 1WM1A 1YHYA 2I2AA 1KI2A 2F9LA 4HH0A 4ZRNA 4KPUB 1DJPA 4LF4B 3RRMA 1Q84A 3GCXA 3LCVB 4DS3A 5H16A 5C46F 3FVWA 2X6QA 2PJDA 1G8PA 3HEAA 5TE9A 1CIPA 4WKNA 3VA7A 1NZFA 2CFIA 2YXNA 4LECA 2QDKA 2BGWA 1JE1A 1V1MA 2HADA 5JLJA 2JKVA 1LKZA 4CF5A 2VYND 3UFXA 3TQHA 2I9PA 1ZW1A 3P9KA 4DRZA 1JEJA 4LZAA 3JD0A 1RZRD 3PG5A 1GADO 5AVKA 1NBMD 1KQGA 1QB7A 2IE8A 4P6VF 5KYUB 3B1ZA 3PGA1 4IXNA 5JROA 3C8DA 4GDFA 1Q3HA 1LC0A 1XLUA 1NXSA 4AF8A 3DKVA 2M2IA 4H0FA 2RFLA 4CMEC 3D4OA 1NLFA 1RM5A 3OPYB 1VA4A 1T2VA 1Z2OX 5FQNA 3NJ4A 2ZI4A 1DEXA 2OUKA 1KEPA 2WJWA 5DIFA 4W5NA 3OLCX 4MVJF 1JIIA 4MEBA 4OHBA 1WDWB 5ECYA 3VR5D 2PSFA 4DYHA 3VKFA 1NG9A 1Q1NA 1Z88A 1WMBA 1SK8A 2NYRA 3DC2A 3CB2A 3NUQA 4BMPB 3DPSA 4ZHQA 4FFWA 1C4KA 2PJRA 3DE2X 4JI5B 2ES4A 4BNMA 1QMPA 4HEA6 4MJXA 3D5QA 4RVCA 3TRIA 1ZUWA 3QWIA 5T8KA 1J22A 3EZLA 2WJHA 4HLQB 5DNAA 5K6AC 3GLGE 4D0NA 2GJ4A 2H1IA 3DE3X 1IXRC 1ONBA 2R3SA 1JIKA 3K6JA 2Q6LA 3AUXA 3NBQA 3H42B 3EA4A 3R3XA 3WRXA 4CI0B 5A1TA 1FS4A 4XYGA 1JDJA 1ZLXA 4MXDA 1NM5A 4FW8A 2O8DA 3B1KA 1L7PA 4F56A 1SIOA 2Q4RA 3EZ9A 4I5IA 1L5QA 4EJMA 3UG7A 1PFQA 3UNXA 5B7GA 1OYWA 3CQ9A 4QUHA 1NHGA 2JI6A 2W4IA 4GFDA 3ZGOA 4HQOA 4QC2A 2YV2A 1HA3A 1L4EA 1OYYA 4MQFB 3INTA 5J1SB 3MAAC 3GLVA 3Q8XB 1WBJB 4C0KA 1QIIA 4E12A 3TD9A 4MW5A 3TMYA 1QV6A 1W19A 4TM7A 3GJ0A 3IO5A 3WP1B 1FCJA 1G1MA 4BB5A 9LDTA 5DISB 4DL9A 2ZB2A 4PLFA 1D2NA 1RBZA 5FOXA 4PY2A 4UBOA 3V8BA 4AP5A 1KYWA 4RA9B 4TT3D 1U6KA 1QGDA 1ZM3A 4J1QA 1CZLA 2AN5A 2ZIVB 4XVRA 3M6VA 5EG5A 1TMGE 5JNLA 3O38A 5AIAA 1Z5GA 3PXBA 4LOIA 5KEIA 5EERA 4MOWA 4KN8A 1T5OA 2F9FA 2GM3A 2JNWA 2Q1WA 3GLHA 5KMGA 4ZI3A 1CP3A 3WE7A 4NZNA 3IPRA 1QB8A 2YDYA 3EUEA 1L5ZA 3OEHA 1A7JA 1Z8HA 3HHPA 3QVKA 1QZXA 3HYRA 4MQEB 3KZCA 1Y5LA 2J0VA 3R7BA 1R50A 3ECAA 1MT3A 3HO6A 3L5KA 2NT3A 4OKIA 3G2QA 1LK7A 2PTHA 1LI7A 3GUYA 3O8BA 5AKXA 1CZKA 3BC1A 1R00A 5ICCA 4YX9A 3G2JA 2VYVA 4J0CA 5AKKA 4LFAB 1M5TA 3OPNA 1WPQA 2NYUA 1HI9A 2OORC 4PPFA 1FSPA 1N2ZA 2QRHA 5IFLA 4RS3A 4RY0A 1MO5A 2FDCA 4OREX 3DBVO 3CNNA 3THSA 1UJ2A 2A9PA 2NZUG 3N0TA 4OHKA 5DSXA 3RVOA 3T5AA 2QN7A 1ZVVA 1E63A 2H2WA 4IRMA 5J3JA 2W9XA 3WKDA 4HDCA 1EQ2A 1BKSB 1RLOA 5BQOA 2IEIA 3DWFA 3HCCA 3L6DA 4NH4A 1Z34A 2RGNC 2QTZA 4WLVA 3TDNA 2OVFA 3H3JA 5CHYA 3HWWA 1HOTA 5EP4A 4PQEA 1UFOA 3OEYA 1KHHA 3BTUA 3R5JA 5LD2B 1ZGJA 2QYOA 2EWMA 5CIWA 3IFSA 3Q8KA 3G2HA 2R1TB 3EK2A 3QWFA 1K5DA 2V58A 2WYHA 1MO3A 1DTEA 2G09A 2VHEA 4FQ8A 4JC4A 4R1OA 2EGHA 3B5EA 1RM4A 2B7BA 3LLMA 4KQWA 3TFOA 3G85A 1XZFA 3RRNA 3E5MA 1TUEA 1XDGA 3HACA 5CFOA 3OQNA 3F47A 3IPAA 1GPYA 3O4FA 1J8VA 4MGIR 5EEHA 2QBYB 1XQ1A 3UEOA 3MHPA 3ESBA 1MIOB 1ISHA 4TQ9A 5I9MA 1XAGA 1S4QA 2GEFA 2HCBA 2DR3A 2YZ2A 3JW8A 1WUKS 1FRVA 2O3UA 3OQIA 3Q3JB 3PNSA 4JP1A 1WO8A 4WXYB 3IAAA 4C22A 2TECE 2JAPA 3BSYA 3JR3A 3OOYA 5DX1A 4H16A 4ZAFA 2CFTA 4YUXA 2E55A 3LM8A 3K0AA 1SHZA 2QYTA 5JVDB 3T3IA 2G25A 4HATA 4ZV7A 2VKTA 3MTGA 2MSKA 3CKKA 5C0OE 3WOHA 1K7FB 1ULZA 3KUDA 3PXDA 4FOTA 4LK2A 4X63A 4PHTA 2QUBA 4XYMA 2VDLB 1H6BA 4J7CA 4HZUA 1G0NA 3UJ9A 5CAEA 1I3OA 4WKCA 3WLKX 5K20A 3FE2A 1NBMA 1F38A 3WZ2A 2WJ4A 1EJ2A 4EZIA 4RULA 4IJKA 1YS1X 2HK7A 3AHEA 4LRQA 2XNKA 4LXXA 4RELA 4F91B 3EVGA 4JQYA 3FUTA 4LJ8A 2QJTA 4B0PA 3EODA 4LOKA 2P2SA 1QANA 2JD0A 4CM8B 1NF2A 4GR4A 3ESQA 5DHRA 1P9OA 1Z5VA 1L8QA 3ASZA 1T3HA 3EMBA 5B2ZA 5KYXA 1PZHA 1VPDA 3EIOA 1GP2A 4MPRA 1W2GA 1DIBA 2APJA 4UMDA 3ICQB 1QORA 4UHJA 1PEAA 1A82A 1X1SA 2R85A 4BKMA 5IVKA 2EATA 4FE4A 3QU5A 3HBFA 4UAJA 3AFOA 5K5EA 3M4XA 4DDUA 2AT1A 3FD8A 4JV5B 4Q4HB 2CB9A 3V1YA 2WUGA 2ACWA 2FUNB 3ZD6A 3RIHA 2DFKB 3DD1A 3V80A 3MFQA 2A84A 1NVWQ 2HL6A 2HQSA 4W6ZA 1JLMA 1R8QA 2HBRA 1N2GA 3GLIB 2O2CA 4YDHB 2PUCA 2FGJA 3EVEA 2LWIA 3SYTA 1E94E 3NGXA 1VIDA 5G4LA 4YJ3B 2WM8A 4KE8A 2NUAA 2FEWB 4FS8A 1M2EA 5FWYB 2Z30A 2D06A 3VNBA 3HA5A 1VMAA 3AWDA 3KUKA 3B1JA 4H6PA 4KOAA 1JDBB 4UPDA 2M32A 3HCWA 2XYVA 3UG6A 4ZMRA 2W37A 1R0ZA 1UQTA 4EX7A 1E2GA 4GF5A 4F72A 4OJQA 2EX1A 3I37X 1W85B 3BRQA 2J85A 2BONA 1EZ1A 1QJCA 1AURA 5HW0A 1HY3A 3QYFA 4ME6A 1XRJA 3FDIA 1EBFA 4NCAA 4FZRA 1JVBA 1LVUA 1X7HA 1KAOA 1XDUA 4MROA 1WD7A 3KBBA 1NYLA 3D8TA 2VPXA 1VYTA 3OU6A 2X4LA 3KB8A 2OPHA 3T1QA 2WUWE 3GJ8A 4QXAA 4HT3B 4ZIRB 5A4MS 6GPBA 3B53X 3O4VA 2JCGA 4BP1A 3BCUA 2NW6A 3Q3CA 4MVCA 3U6KA 1JYSA 3ELBA 3LU1A 2OCIA 3QUQA 4HK4A 4LHEA 4M0MA 1NP3A 1TCVA 4WKGA 2JHCA 3HH8A 4BNGA 2A1UA 1VSVA 2FMHA 3BL5A 2EHJA 3AIIA 3L7KA 1FDUA 2AFHB 2D59A 3JVIA 5AI5A 4F4FA 3THXB 2BFDA 2WF8A 1XLWA 3FAKA 3GHYA 3OQVA 2GAJA 4FBLA 1KMHA 4B47A 4B0OA 1CUYA 2VK8A 2PQ6A 3K6KA 1NC1A 2VOEA 3C3AA 4MQ4A 1Z6YA 4ZVNA 5L95A 1HLDA 2JJ1D 1PFVA 5KSYA 3ESAA 1LPNA 2ZJBA 1HE3A 2ZIUB 3BE5A 3A6FA 2XHEA 3FCEA 5AI8A 3WLPA 4CRWB 4DLPA 1Z6XA 1DELA 2YJZA 3A9TA 3FKSA 5FTNA 5AHKA 2JKZA 4KXNA 3VH1A 3GEIA 1KIFA 5EMNA 3N86A 5GY7A 3Q3GE 5AXAA 3CVYA 4A0FA 4IMPA 4G0WA 4ENSA 1QIMA 3I0ZA 5AVRA 1VCMA 4TLDA 3I23A 1TRKA 4X3PA 4TKZA 1QO0D 5PNTA 2F4NA 5A2QA 2K7FA 5BYKA 3WK6A 4M4SA 2VA9A 4L95C 2PX4A 1OR8A 3A27A 4OH7A 4UVDA 4W5OA 1E1KA 1G21A 3GBPA 5IJWA 4A7PA 4P3NA 5B6PA 3UMCA 1TU4A 4I1UA 4OJNA 1UBEA 4H6XA 3B8HA 2A67A 4PHHA 4R3UC 2PMFA 4TS9A 4E6PA 2BZSA 2NU9B 1XQWA 1XZLA 2JHAA 4JHLA 5FWXA 1ESCA 3KWFA 3LVBA 3MCWA 1NMEA 3ZWBA 3SOZA 5SZKB 2CNWA 5ALYA 4NRDA 8ABPA 2DUWA 1T9GR 1ZVKA 2OY0A 5LFAA 4JODA 1U0NA 1H1DA 4MSUA 1KSJA 1S8OA 4UHFA 3ANSA 4HQ6A 1S3IA 2X8JA 2X19A 4Y2UA 3EGXB 5ED0A 5GV8A 4LFCB 2BHRA 4TV9A 3SZRA 4MAAA 3SHFA 1R5NA 5AFSA 2DP4E 3HJBA 1ZNXA 1C29B 5CDFA 1XMVA 3FJOA 2EIHA 3QHAA 2GWRA 5EQDA 1V48A 4BASA 3IDFA 3FYUA 2PX3A 4PG7A 3IB3A 1XT6A 3QKWA 4TXHA 4DJAA 2Q6OA 1NASA 3EFOB 2GF9A 2H7YA 1G8YA 1QQAA 3DOCA 4YBRA 2CF5A 4DVGA 1ZMBA 3MCUA 1ZH6A 4IDOA 2VRNA 3K9BA 4CEIA 3TG2A 1VJ0A 1ZA1A 2ZWAA 1Q0TA 1TW3A 1IHOA 2W93A 4OP2A 3HXMA 4FEEA 2K5UA 3HSYA 4F85A 1D4FA 1KU6A 2UYCA 4MKHA 4QUBA 4N3NA 4XI9A 1Z13A 5DM0A 1I0IA 1O2DA 2NV0A 2GJKA 2VPQA 4GMGA 4WLOA 1ODJA 3RVLA 1Q1AA 4WESB 4AY6A 4XFDA 3VMFA 4Q00A 4GL4A 3KQVA 1M8PA 3N05A 5EMHA 4FDTA 4EHNA 1IJBA 2FWAA 1L7QA 4MUXA 3SQMA 3ZWVA 1ZD3A 2QE7A 1PR5A 3U0VA 3B48A 4OAQA 4WZBA 2XEXA 1I36A 3E4CA 1DINA 3WWPA 1MAWA 3SR4A 4KRGA 1PF7E 2ECFA 3RC9A 1YB2A 3L6RA 3MPUA 1AKQA 1PL7A 3IPXA 4YYZA 2H17A 3JASB 3WRYA 1AU9A 3LT1A 3ZD8A 5LP6F 4BPBA 3WBBA 2YWDA 4QD3A 1HH4A 1BCSB 2ATVA 3F6SA 3FOAA 4EAQA 4EUFA 1MJFA 2EW2A 2XD9A 1RXCA 2BZGA 4S1NA 5D6OA 2F2TA 3QVWA 5LB4A 2PT5A 3RLIA 4PONA 4GLFA 2FMIA 1JR3A 3LHDA 3IVXA 4DADA 4Z6KA 4MPDA 1OWLA 1R4MB 2OHFA 2ZJ2A 4A73A 4WBNA 1D07A 4GZ3A 3DLIA 5I7OA 2E89A 1YGYA 3ILVA 1E1YA 1BDHA 3R5KA 5HTOA 1BVYF 1S9HA 4F2GA 4ZYXA 2WAOA 5LQMA 4Z86A 2P4EA 2PVSA 3GA5A 2IQIA 2FI1A 1AS3A 1E9SA 5DXAA 3W5SA 1I01A 3GH1A 5FV4A 3HJFA 1BE8A 1F8FA 3RBAA 1ZJ4A 3HJUA 4HDAA 4P4LA 2OOSA 2BZ0A 2FZ5A 2Z5VA 5JQGA 1TCBA 1KK1A 4FJ2A 4C4TA 3GGSA 3UW1A 4RDIA 1OKKD 3CCBA 1AB5A 3RS9A 4KQGA 1Z62A 4L57A 4KIWA 1RQPA 2ZRQA 4RKYA 2J07A 3QUAA 4MLPA 1E96A 5TEVA 3V46A 1FP6A 1LRLA 3USZA 3QLVC 4HV4A 1FMFA 1GU7A 1P9NA 3TLCA 2ZJFA 1TIBA 2R4TA 2HHHB 1CUCA 2CXXA 2QX9A 3N0VA 4K2AA 1IRXA 3OEWA 1WEKA 2WZCA 1OXSC 4TQGA 3VDRA 3ETHA 1YNOA 1NV9A 3DTVD 1GU0A 5BNZA 4D9JA 5IF9A 2XNSA 3H4IA 1C0LA 3MSCA 2I6XA 1ML3A 3Q11A 5IT9A 4HO1X 1M2VB 1GSHA 2PUJA 2VK1A 3E3OA 4PANA 3ZU5A 3JQ7A 4PXSA 5CB6A 1LDBA 3U3ZA 4EB6A 3C39A 3LQKA 1PJRA 4QWWA 2YBEA 3V3TA 3CUEF 5IJXA 3RYIB 3T12A 1KFJB 3BXHA 4RWEA 4BIIA 4DCTA 2XXAA 4MX8A 3FSRA 3IAM6 1TPZA 4YQYA 3QF7A 5FWAA 2NYVA 1LDMA 3HB9A 4MZDA 4PE5B 1T2DA 2XZTA 2O0JA 1BIFA 2VI5A 1XRRA 4KE9A 2BH2A 3F71A 1XDSA 1QO0A 2R96A 2HDWA 4D3DA 4WBXC 3M5CA 1E2FA 1P72A 1F2TB 2VT6A 1NQWA 2WR8A 3I04M 4CIAA 3FTPA 1YH3A 4Q3NA 4DEYA 1B0ZA 4K26A 3GUVA 3KXPA 2ZJZA 4JOSA 2ARKA 2JLAA 4KVFA 2EIXA 2E7ZA 5DGDA 3D4PA 4URXR 1DAKA 2V7BA 3P0RA 1TYEB 2WVGA 3N2KB 3U7QB 2DULA 4G1CA 2B2XA 1I14A 5CBPB 1EAMA 3ZV5A 3H5VA 2I8CA 4DCVA 5JTUA 5LM3A 4ND8A 4XDZA 1GYRA 1JECA 2OXIA 5IF3A 1IOZA 1C8KA 4ZYZA 4TPKA 2GN0A 5ITWA 1Q74A 4WSOA 4J0KA 4KE6A 1WKBA 1DX9A 1HRKA 2HM7A 2EJUA 5L4NA 4QIHA 1OX6A 3NV9A 4DMMA 1X9HA 1NYRA 1X0VA 4RZSA 1TA4A 1AUPA 1C4XA 1SUDA 2YNMD 3TWOA 1EJBA 2I4IA 3WQHA 1LQ2A 1HV8A 2DQYA 2FJ0A 2NM0A 1AUOA 3H2IA 3C3MA 3LDFA 4ZCPA 3W6UA 2C61A 1X7WB 1OGIA 2CJWA 2P2LA 2WJJA 2YWBA 1J42A 4ETMA 4QJ3A 3BXFA 3G9XA 4XDHA 3PJGA 3QBVA 2DMRA 1PJ2A 1BCRB 4RTLA 2H1WA 3SDSA 7YASA 3SZ3A 1EK0A 2AJCA 2DPHA 3G5MA 1SVKA 1VLMA 1PVVA 2QTHA 3DR3A 2D8MA 4NBUA 3W34A 3ZKWA 1XXHA 2V1UA 3DL7A 4XB6B 4H7JA 1S7GA 4KLRA 3BAZA 4P58A 1FF9A 3U9LA 1FTYA 1U6JA 3V1NA 4NQZA 2H2IA 4BFZA 1V5IA 3SR3A 3PEFA 1ULHA 3TZKA 2DFPA 3T3NA 5FOUA 3GK3A 4XE5A 5FR1A 2H59A 2EYUA 3ZJ4A 4DQLA 1TGYA 3RNLA 4P4UA 3O9MA 1E1CB 1RWMA 4O4HB 4EMBA 4ZYVA 2W43A 1FY2A 3U5TA 1ATIA 4Q15A 3KDSE 4C14A 4R1PA 2NQ8A 2FSIA 1GQRA 3BDIA 3NYQA 1RBYA 4P3PA 1BNCA 1LTQA 3A6ZA 1WABA 2WB4A 1ISIA 3A37A 2IEGA 2UVQA 4YMTA 2WMNB 4ZCLA 3NVKI 4IJQA 3DHWC 3FOBA 5ETJA 1Q11A 2A1IA 2AN4A 1N75A 2GM9A 3OTGA 3PD1A 4LW8A 3T7CA 2PH5A 4Q16A 2C5SA 2Q5JA 1G41A 1AH2A 5EP2A 1W47A 3M4YA 2PRYA 3IAHA 2B99A 4D9BA 1EX9A 1XIVA 2J4DA 1NX6A 4BLPA 4OXQA 4AZVA 3B7WA 2H7VA 3CLUD 4I55B 1XJWA 1OOEA 1REQB 1LJLA 4HFJA 4HJXA 4P4GA 1WB9A 2A9QA 4YCAA 3LUHA 4X92A 2HSWA 3ZWNA 1JR4A 3IT0A 2JC3A 3BE4A 4JR2A 4UUQA 5ENVA 3WL6A 2XQFA 2GCPA 1F17A 1RRKA 2CB0A 2BMDA 2CFCA 4TTPA 2VT2A 4JOCA 1BXGA 1L5RA 1O95A 3R5TA 3W90A 2PMKA 2PRSA 1ORRA 2R7KA 3EXEB 3V33A 5ICFA 3ZE1B 1F0KA 4TZ0A 1SA0A 2Y9MB 1T5TA 1UWVA 4A82A 1E9AA 5AK6A 3JD4A 3O4IA 5HE9A 1XWWA 4QUEA 3I09A 3MMXA 4PEVA 3TBKA 1Z5UA 4CHTA 2C4UA 2G06A 4H7DA 4I50F 2I6QA 1MJHA 1OKKA 1P1CA 3PYXA 3F7NA 4LYGA 4XDGA 4ASUA 5CVTA 2XOXA 4GPZA 4P22A 1U5AA 4R2XA 4U4AA 4H1WA 5A0TA 2G80A 3LBAA 2AN9A 2WYOA 3SM3A 4D80A 2PLWA 5ALHA 1QWSA 3MB5A 1CUIA 3MEQA 4QQ8A 4OSPA 3TFQA 1V8ZA 2QQ0A 2XVZA 2UZ4A 1PBTA 2Q3EA 2BTEA 3M9XA 5HBGA 3KELA 2Z6UA 4UHDA 3DTVA 5CT9A 4JBLA 5FR2A 1J5XA 4DOMA 4FM9A 2HT1A 2JLWA 1QU2A 2Y05A 4AK9A 4UM8B 1TJ4A 4Y2PA 1WTAA 3GJXC 4UE2A 4DB2A 1IN1A 1U2GC 2GN2A 3Q4GA 1X94A 1H2AS 2VUTA 2R97A 1LZKA 1XTKA 9MHTA 3HCRA 4QOIA 4X1IB 1DQRA 4BRWA 1P2BA 5DGXA 1I1QB 4DIFA 1YMVA 1VMKA 1B93A 3PQ5A 1HQKA 3IXLA 1TU0A 4AROA 1UC8A 1OREA 1QHSA 1R18A 3D8NA 5JASA 1YQ9A 1H69A 1LF0A 2OSVA 2QD1A 1Z29A 3P2YA 4MARA 4R0NA 1CIJA 4ABTA 1G3RA 2AI3A 2OB2A 4ILEA 1AGYA 1UPTA 4OAPA 2P3SA 3VJLA 1R37A 4AM8A 3QTTA 3PVSA 4FFRA 4YMHA 4JJ8A 4EI2A 4RVFA 2I78A 2EQAA 4TLAA 5TX7A 4K9NA 1PYDA 4EGAA 2BFWA 3NT4A 1F48A 4ISBA 2EKLA 5AKEA 1KVSA 1GCAA 2V96A 1BEUB 3WLQA 3FGZA 1NU6A 3KOXA 1L7MA 1STOA 2JIPA 3K4QA 4H0CA 4M46A 3TPFA 1FFHA 2QD2A 2W11A 4IJWA 1O5IA 4TUYB 5DW0A 5L3QA 4DV2B 1P5JA 4X85A 2EZ9A 2X13A 4D4HA 1LQTA 4DV7B 3EXHB 1BHO1 5ALKA 1X1EA 4RY8A 4CMBA 4BO4A 4P31A 3OE7D 4LA4A 4GDMA 4UAVA 5C7LO 2H85A 2Q21A 4PYIA 4WN9A 1C3OA 1JEQB 1OWMA 2HLPA 3E9MA 3WQQA 2FN9A 3NT2A 4Q9IA 5IVPA 3TQTA 2FPPB 1GUBA 1ORIA 3NHFA 1XU4A 1M10A 4J16A 4A8JC 4K5QA 1KAQA 1N57A 4O5OA 2VHJA 4OEHA 4U2KA 5IUNC 3PRKE 2QL7A 4TLMB 3VVCA 3ANMA 3I9MA 3I76A 4FYWA 1OIXA 3R8XA 3CX3A 3RIYA 5B2EA 1HE1C 3EAGA 3VXKA 4EI7A 2DBZA 1GG5A 1NJSA 2JCYA 1XMIA 3HKEA 3VHXB 3K0FB 1GTZA 5AW7A 5L45A 4D0RA 1S01A 2HU2A 4OHRA 2W2PA 4OI1A 3ZE6A 4FDAA 2FSVC 5P8WA 4DMKA 5HNKA 4QPPA 2VOJA 5TARA 2AZ4A 2H9AA 3LRPA 3AF2A 3IAS1 2TMDA 2G83A 3HY3A 4DUZB 4K3UA 2XA9A 4BNJA 3COYA 5DCUA 3W5DA 1E3QA 1W4CA 3TLZA 3N8DA 3CISA 2H1FA 2VWHA 2DUNA 1PK8A 2WAAA 4F5WA 4DA8A 4F4UA 2JFYA 3LUDA 5CRIA 4HWGA 1QHXA 2A3NA 1XDZA 4GYJA 5ALJA 3STHA 5LPNA 1TM3E 2PQ0A 2XUPA 3WGHA 4U63A 4ZJZA 2I99A 4L15A 3KJEA 1KVUA 3HU2A 4BLSA 5KINB 3QFTA 3DR5A 4JT2A 4ZRDA 1UJMA 2OG2A 4CLHA 4QA9A 2IUEA 3UWSA 3ET4A 3KQWA 3PFWO 2ZATA 2ZSIA 3R0VA 3WV5A 3ZR4B 4RA6A 1GGFA 5K1ZA 4OQLA 3T35A 2N9UA 4D82A 5EJ8A 4DILA 4BC0A 5KOIA 2HIGA 1HO3A 1NRIA 1BHSA 1PI3A 1Q3TA 4PRZA 3V1KA 4YT8A 5G0SA 1YASA 1OT3A 1LNQA 3P4YA 4P53A 3WGYA 3DL4A 5FO0A 5TC4A 1X6VA 5BSRA 4E70A 3NG1A 1I32A 3Q2KA 1EUYA 3V97A 1FOEB 1XTRA 4EA6A 4OPMA 1IZ8A 1SUAA 5IBRA 1IN4A 3UCEA 4EBBA 3GLFE 1CW2B 5CCEA 3Q0TA 3AKCA 2BSXA 2Y77A 3QF4B 1KJWA 1JH9A 3H3XA 5D7BA 4JXJA 4DWOA 5M3BA 2CCGA 2GJAA 2PGJA 2FUEA 4YJGB 7AT1A 1R0YA 2BIFA 2QUZA 1YKFA 2WSMA 3ADKA 2RB5A 1KY5A 3OMLA 3FIJA 4P3KA 4M0LA 4CQLA 4N9WA 2HF8A 4UHHA 3ENQA 2YZGA 3V1TC 2J1LA 4JI1B 4D79A 1T6YA 2RGGA 2ZJYA 1BFUA 1QO9A 4YV7A 2VSFA 1P77A 2WDPA 3B12A 2D5CA 3O91A 3T38A 5CDGA 1GZ4A 2O3RA 5K3BA 3RUIA 3C5EA 3RSCA 1WMAA 1EVLA 3K70B 5H68A 3TW0A 1V8OA 2HO4A 1XQ9A 3QFCA 4G25A 4Q0MA 1BH2A 3DCJA 4KXUA 2GN6A 1UOPA 4OBEA 2CXNA 3DXYA 3RM3A 4Z9BA 5EJ9A 5CK5A 1M5RA 3URKA 4EY8A 1YJ8A 1XWFA 2ZRJA 3JQGA 1QTRA 2L69A 5CU7A 5INTA 4YRQA 3P32A 1UDCA 2QLMA 5L7YA 3NAMA 4YRNA 2Z83A 3GJ3A 2PFSA 4TV8F 3A6GA 1IBKB 2RGAA 5C5DA 3IXMA 1WUHS 1Z36A 4WPGA 1Q57A 2H8KA 1PJQA 2ATXA 3DO5A 3MTDA 3AB7A 2XGJA 4FLFA 5C51B 1G8SA 5IANA 4C30A 4NKRA 2ZZMA 1NBWB 5J2TF 1HDZA 4YUVA 2EP8A 4XWWA 4QX6A 4L5IA 2V0CA 3OF5A 4Z0NA 5IRCD 2NXEA 3GJYA 4S24A 1NW9B 7MDHA 1RRFA 3MS7A 5KQRA 1M1NB 3GCDA 3MTJA 2VAPA 3F6BX 5AM0A 4E30A 4NL4H 5A4IS 2XRZA 1HM5A 2VBIA 4C0XA 2Y1WA 1NXOA 4JHXA 4AO6A 5I4CA 2IPNA 5COQA 3QKSB 3BDAA 4Z0HO 3UV3A 3ZEIA 1JQEA 5FL7A 4DMUB 1ND5A 4HFNA 3F6EX 4C5AA 3NTRA 2AJ8A 4E4YA 1Z0JA 5CD1A 1QQ7A 1FPMA 4EGQA 2G9ZA 2JVJA 3WADA 1PGJA 1SOAA 1XD2B 2O2SA 4XD7A 4YRIA 1ZM2A 2E5WA 1VSQA 3S68A 5EZYF 3EZ2A 5AHXA 1GDTA 2FEXA 3OE7A 4PBTA 5ILOA 4L5YA 2WTUA 2ZYUX 2AC2A 1GZUA 2HZ7A 5IC5A 2VWGA 2IHZA 5E2IA 3UMRA 1IPEA 4JDUA 3MJDA 2CMDA 3CE6A 1DIHA 3TOVA 1JU3A 1UPUA 4P4NA 1AKNA 2G4VA 4XH9B 4ZA2A 1KZ7B 3N1UA 5FPHA 2JFWA 3A32A 4O2AF 1LPPA 2O3JA 1ADBA 3R41A 2J0SA 1LDNA 3G2MA 2XCSB 1UXKA 4C29A 3LUGA 4I1SA 4X20A 3CVUA 1AQUA 3OMWA 3PFBA 1T8YA 3I6BA 1VB3A 3U7GA 1FFDA 1O94A 1IUOA 2UKDA 4GT1A 5AHRA 2M6KA 2P4UA 3CH4B 3DVAB 1BEZA 3C4VA 3EGVA 5F3DA 1WL8A 5KNDD 2ZRBA 2ZOSA 1VSTA 3QVUA 3BJRA 4G5QA 3GRCA 4IO1A 1A5TA 1NR7A 4D1YA 5A4DA 1K5GA 1L7RA 2NU7B 3VR3A 5EPOA 1LSUA 3BJMA 3HWRA 1U8EA 3K31A 1NJFA 1GOTA 1TM4E 2W98A 3Q0EA 3QVVA 3RUDA 1N0IA 1YE5A 2JB9A 3MCVA 3Q8MA 1P2GA 1POXA 1V8FA 1I3LA 5L53A 3OTOB 3I0MA 1N2CA 1RM3A 2OV1A 2ZIFA 3VO9A 4XQCA 2R00A 2BW0A 4PLTA 2VPYA 2GEBA 2B8JA 4IGAA 4DKXA 1A2BA 2QX4A 1SRRA 2QTBA 1DRUA 2CXHA 3Q8WA 4EHLA 3NAGA 1SO8A 5MGBA 1R6BX 5FYQA 1C7QA 2GTHA 2NV2B 3MJ4A 4O59O 5CR9A 3DG9A 3S5JA 2FPKA 5KKCA 1RC8A 2HFJA 1D6JA 3QFHA 4L16A 4KXVA 4Y3UA 2I1LA 3QXXA 4D9EA 4O0MA 3G5LA 3NWOA 4RVGA 2QRZA 3DSRA 1QP4A 1Y7HA 4KAJA 4WXRA 3NBAA 1JX6A 2J9FA 2H8GA 1E20A 3KKQA 3HR8A 1BDMA 5LQSA 5K0TA 1YB5A 2EP7A 1ENZA 3HCNA 3HKCA 3O4RA 3V6LA 3DAFA 2IY7A 1RMTA 4YJ2F 5CVCA 3S0JA 1OHHD 2OAEA 1WZ2A 5A5FA 1Z08A 3B3FA 3LC2O 5EE3A 1Y1PA 4L72A 3O2JA 3TD2A 4L9WA 2FEKA 4UXIA 4XB1A 4FVTA 4PFSA 5DVZA 3T1NA 1L6IA 5DK6A 4UU7A 1DNPA 1BGXT 2P9HA 4M8SA 3KLOA 2YYYA 3MRVA 1W1WA 3VAAA 3ZLUA 2DHDA 4F2HA 8ADHA 1MMFB 1O6FA 4KB5A 3WB1A 5K8VA 1HXHA 4H27A 2J3IA 3NNSA 2WSLA 4RQUA 3PC8C 1QRRA 4FKZA 4WOCA 4EY3A 2HMAA 4HB0A 1PR6A 1QIHA 1WB6A 2J32A 3MTBA 3QA9A 3FFWA 3OM1A 3SIWA 3ENZA 1YS2X 1WCIA 5EQTA 1B3BA 2YXPX 3DMDA 3WWDA 5K45A 3CA8A 2J7KA 2P3LA 3IKLA 5JY1A 2UZ3A 1SCAA 2QN2A 3EX7C 2AOTB 1RRMA 1DV2A 1WDKA 5AKHA 1B6SA 4N65A 3E1KA 4O2BA 4WOPA 3W1EA 1YS6A 4OF4A 3RRFA 3RBXA 5G1NA 2DH6A 2IOQA 1MABB 4Y0VA 3EXIA 3VOTA 3CX6A 4BZXA 2QGZA 4CG2A 1G5RA 3C74A 3R3VA 4QGGA 3EOZA 2CL5A 4D8TA 2OD9A 1AQLA 2WFLA 3C15C 1P81A 1USUA 1L1QA 4M38A 5A3VA 2AYZA 4GI5A 4URUR 3VH2A 4MWDA 4V38A 3QX9A 3MAJA 1HT3A 4UNPA 5HK9A 4HUQB 1U11A 3S4YA 4F8YA 5J23A 4N3AA 3FWZA 1O54A 1H65A 3IKVA 4FJ0A 4RH1A 5TSDA 1J0AA 1X15A 1DG3A 1YSCA 1NQVA 3WK9A 1IHPA 5BW4A 4C89A 5LLTA 1E1RA 3MWJA 1UM9A 2B7LA 1JNXX 1VLVA 2NN3C 1QYCA 2X7XA 3WLFA 2FPXA 2PS0A 1SB8A 2PUWA 5EZ6B 4XYLA 3EWAA 3LYAA 3U1VA 3T5CA 5F64A 3UOWA 1NAHA 1NJ5A 3L8MA 4INJA 2Q8QA 4PLWA 2W6JD 3TRFA 1SXJD 3TBFA 4JC8A 4RMGA 4YLEA 4BMDA 2P9EA 1SC9A 1ZAKA 5DHUA 4N3GA 2F1IA 4RGQA 5MN4A 1VPEA 3CBGA 3H4MA 3Q3VA 4RCVA 1JV2B 1T0IA 2F43A 1ZJYA 4GKVA 4A2PA 1X77A 3I4CA 3P9RA 5BYBA 3OC0A 4S0XA 2MSDB 3HBLA 1SXHA 1E2DA 1KXJA 3D4IA 4IBOA 4PG4A 4RF3A 2H1RA 3VJMA 1JT2A 3NVAA 4GMFA 1RYZA 3N2GA 1CR1A 4FYJA 4QO7A 3TX2A 4DMLA 1MB2A 5C8VA 2P4HX 1VCIA 2PZKA 4B6EA 4BV9A 2OAGA 3OZFA 4OQEA 1H0KA 4MP3A 1WOMA 2PXAA 3N39C 4LMPA 3RF6A 4ID9A 2JVKA 4IV8A 2VP9A 3AEXA 5F76A 3VJKA 3WYAA 4EPRA 3N6VA 1EUCB 4TRNA 1KO5A 1N5OX 4JLVA 4CI9A 3EULA 1XHFA 1CUFA 1A9XB 2ZCUA 4M8IA 4C7BA 1FXWF 5KNDA 3L4KA 4MQUA 1GGJA 2N42A 3AY3A 3DT6A 3HU1A 4NABA 5K9ZA 3ERCA 1XCOA 2Q4OA 2OQRA 2W22A 3TQCA 3LT4A 4H7FA 1QHGA 3ADBA 1VMDA 4D9KA 3FIUA 4IF6A 2F90A 5IT5A 1XAIA 5KSWB 1Z3IX 2B94A 3N7TA 2PL9A 1H5UA 4LKOA 3UGJA 3VTFA 2BWJA 3V4LA 3WL3A 2HJ9A 1BW9B 5BW5A 1HLPA 4L8FA 4X84A 3ILSA 2HHCA 1RE1A 3I9KA 1Z56C 3NGMA 1PEYA 5J1TB 3S1SA 3FHCB 3WMFA 1H4QA 1V2GA 2XZLA 4DARA 2NZXA 4WLNA 4XGIA 1UFVA 2JFFA 2NZWA 2I4TA 2XRYA 3CZRA 1QK4A 2DR0A 4L5BA 1QGUA 1ECGA 4F96A 3S70A 1N6NA 2VDWB 3FB1A 4JWTA 1B00A 1T1RA 1GPAA 1YFZA 2VTVA 3HYSA 3PX3A 1D2GA 1SD5A 4QNRA 1X3SA 1NXVA 1Q15A 1CZRA 2QXUA 3MC1A 4LGMA 1I3CA 4MVJI 4OATA 5DYWA 4QPJC 1XRPA 2GK3A 2JI9A 2IKQA 1KQPA 2K87A 2IBSA 1VKJA 4FQ5A 2XWBF 5AW4A 2IDKA 5CB8A 4REQA 4HB2A 3NEYA 3QI7A 2WHXA 2Q45A 4KV9A 5AW8A 4BAUA 3TD6A 3D3WB 1S4MA 2YTZA 3HWSA 2PE5A 4DDKA 1VLJA 3AL3A 1SHLA 2EJWA 4IJ6A 4L27A 2LE0A 2HBYA 4HPWA 3I9LA 3AZPA 3H11B 3E9EA 4B83A 4NXMB 2P2NA 4PSCA 4DDMA 5ALSA 5BPFA 5BUQA 3DT8A 4AUNA 5DNCA 1EDOA 1RWNA 1ZICA 3WP0A 3L07A 3O8OB 4KI0A 5EKXA 3I6YA 3D8RA 4J6FA 1XX6A 5JVDF 4TMXA 4RSRA 3HV0A 3REQA 3B6MA 3PPWA 5DGTA 4IIFA 1G2IA 3SD7A 4EJSC 5JHGB 2O6HA 4PR0A 1HYEA 3WBJA 3WHPA 1F1JA 2ZBDA 1ICIA 3MW8A 5THXA 4BDTA 1L7XA 2AFIB 1V3UA 2CFSA 3JD2A 4IWXA 1Y9ZA 2EW1A 1G7TA 1Q6ZA 2RSLA 2AWNA 4KQ9A 2HRZA 1Z7WA 3I28A 4RD4A 4MW2A 4AJJA 4RZ3A 4BGDA 3SP1A 3PL1A 1LSOA 1PEKE 1FEZA 2A86A 3ESDA 5D1NA 5AM1A 3UAWA 4LF8B 3AB8A 2ZUVA 2O2JA 3NS7A 3ZHVA 4M0KA 2REOA 1E3LA 4B73A 5CFRA 3CRNA 3FPEA 1FUKA 1Q7GA 2RGXA 2CK3A 3G5UA 2HNKA 1V6CA 4CCYA 2QLTA 1IDN1 2ATCA 5J2UB 2BEWA 1J7JA 3DDCA 3GW8A 3N28A 4W1PA 4M76B 1F12A 2QRLA 1G66A 2OPBA 4KODA 4EUHA 4YAKA 1C1DA 1OLOA 1XU9A 1YKGA 3RANA 4RKWA 3TUJC 4BO5A 1CUSA 5KJ6A 5E4YA 3I05A 3UMBA 1QOZA 3AF1A 4I81A 2BCGY 3DUFB 4D9HA 1HG1A 4KR6A 1N5DA 4ZWNA 4OHOA 1ETHA 4IG9A 5LZ8A 4JYCA 5B55A 2V1XA 3RC2A 5AOVA 2Q99A 4WOJA 5CGZA 1X80B 1YXMA 1K8XB 1NY6A 2EC5A 1K86A 4EF4A 3JQFC 2Q5QA 4NU8X 4F86A 1PO7A 2DUMA 2JAUA 4CM4B 3DMNA 1PD0A 3ZCPA 4YJ3F 2Q3FA 2ZKIA 4HAOA 1R5OA 1K6IA 3DZHA 4NFYA 1SG6A 1X9GA 5IH7A 2W6JA 3C2QA 4C2TA 1WDMA 3F8WA 3KYCB 1VECA 5AM2A 1I3NA 1E77A 2EBHX 1ODSA 2VTDA 1JXQA 4L5JA 1CDEA 1JKJA 1Q44A 4HN2A 5FAXA 4D0LB 1Q77A 3LLVA 2EQ5A 2HXGA 2ZW9A 1X87A 3A4IA 3CH7A 1F7VA 2WUEA 3B5IA 4L9RA 5C2JB 4OUDB 3F4KA 2HF2A 4EM6A 2VQ6A 2Z4SA 1QE0A 5F1OA 3UF0A 3PC3A 4YRDA 2HWXA 3JQ9C 4HAWA 5HG0A 2OFWA 1UANA 5A7HA 2VC2B 1XCPA 5JSZA 1TYDE 4AMZA 1MNQA 4N12A 2JRCA 1VLLA 4F5ZA 3EA5A 2QUHA 2GSDA 2RCNA 1LPMA 1M72A 2AXQA 3N74A 5C35A 3S2SA 3F3YA 1B0PA 3EHDA 3TCKA 2IYXA 4QFMA 1P9WA 3HM9A 3H75A 2PN1A 1MP0A 5DYYA 2JGJA 4Y0AA 5KTKA 1PIWA 3B9PA 3QVLA 4CIBA 5EWLA 2XCOA 1F8YA 1PJAA 4HGNA 4NTZA 3P9NA 2GZ2A 1V37A 3PGKA 2J87A 2JBHA 1UPBA 2R48A 5LQKA 3J81A 1T5HX 1SG0A 2WU4A 4H1VA 4RVOA 2BISA 2H11A 2PNJA 4Q66C 2O7QA 3E7FA 3VC7A 5ALXA 4W9NC 4QXRA 2DQZA 2H16A 3KSBC 2PLAA 1M1YE 1XZCA 2K7ZA 4LSWA 4MGEA 1Q1QA 4DQKA 2ZJ1A 2ILTA 2IHVA 1W6UA 1Y3FE 2ENUA 3VZDA 4UQOA 3RSQA 2VEDA 1HT1E 3CB4A 4GXQA 4PN3A 3PXAA 3KAKA 1TK3A 4V39A 2P40A 2Z04A 3DLTA 3JQ8B 4U0JA 4CMEA 4DM3A 5AVZA 1D4AA 4MI3A 4H4EA 1XMJA 2V7WA 4O25A 3N3AC 5EXTA 4BJ5A 1GSOA 2W2XA 1ZI8A 3H5AA 4G65A 4OXIA 3ZH9B 4QICA 3L0YA 3DV2A 3GVHA 1YULA 2QJRA 3A6KA 1ST2A 2AI1A 2NQ2C 4OGWA 3W6PA 4D9FA 2NSYA 2GXQA 3E5RA 1RYYA 1HK7A 3FR7A 3E8XA 1Y6QA 2FOIA 2RARA 3NVDA 4QBGB 1TVKB 4E0BA 5IKMA 1E6MA 2FMXA 1ODCA 2REQB 3AMVA 4OLJA 4F5EA 5F2OA 4CF4A 3Q0IA 3ZDYB 1AV6A 2BAGA 2D1SA 5SICE 4KITB 4EGFA 1TUBB 4NYIQ 5L9AA 1ADCA 2I7TA 3M34A 5K6AA 2XBLA 5GIOE 5A4JA 5C52B 1AY0A 1TD1A 4Z2YA 3DE7X 3S99A 4L07A 3G6WA 3H5WA 5AK5A 1S6YA 1MOSA 2VQSA 2WIGA 3D8UA 2QEQA 3H6HA 3FNEA 4I3FA 4ZTUB 1CEQA 4ZCQA 4Z4FA 1TDJA 3LDHA 3AUAA 4CE6A 1HZJA 4FGJA 1VLHA 3LBIA 3BMQB 1ZN9A 1LNSA 1YRYE 2H63A 4OX9B 2QROA 1KZGB 3E9NA 5AUQA 2G72A 3AR2A 4BFVA 2WQ6A 3ETGA 1WMFA 2OGSA 2QQEA 2VXYA 3QEMB 2E2WA 2WSSD 4TXMA 4ZO4A 5B1SA 4BTEA 4MHTA 2UZ1B 2ZM6B 3ZJYA 5M04A 3SX2A 2C7PA 4UBNA 2GEUA 4JI4B 4D9CA 3IRVA 4FHEA 4MAMA 4MGHA 2PH1A 1J9GA 3SQDA 2XQIA 1KKUA 3AESA 4ZVPA 1NVDA 4QJIA 4V0SA 5IBQA 4MI9A 3T1OA 4L73A 3IV9A 3OZRA 2MR5A 3IUMA 1YONA 1IPFA 1BO6A 1SZDA 3JWPA 3TB4A 2I3BA 1J8QA 1ZJZA 4OCZA 5TPZD 3ZZ1A 2ONZA 1I80A 3JV7A 1C3EA 4PSAA 2IUUA 4CN9A 4ZDIA 2ZUEA 4MA5A 1AMNA 1QQBA 4KBYA 3RFTA 1EP1B 2C4WA 4YCSA 5I7RA 4KNWA 4MKXA 3FFBA 4RNCA 1JALA 1HR0B 3COVA 3LX6A 3HVRA 1KRXA 1YU6A 1JHVA 1BG6A 1WP4A 5EIOA 2OK7A 1ZK1A 4G8BA 4Z3DA 1NVUQ 2XVXA 4ZT2A 1IY0A 4U7GA 1O87A 2B4AA 2C98A 5ICMA 2OORA 1PT9A 1N1MA 2NACA 2ORVA 1U7WA 2DFTA 3HVHA 2AOVA 4BZPA 1TFRA 2GLXA 4PZUA 4DIMA 3OIWA 1LBTA 3BUSA 4F4IA 4O1MA 3PDUA 1YZFA 2IVZA 4MUBA 4YQZA 4C9BA 1EVKA 2I0FA 1E5QA 2OILA 4RKFA 4RK6A 4BO7A 1T2AA 3BWDD 3EHEA 3W3AH 2Q0XA 4KNYA 3KKMA 2ODAA 3A4VA 4GOJA 1USVA 3ANTA 4O8ZA 4EPWA 2ADFA 3E84A 3W5CA 4IVNA 3UJCA 4RFVA 5KHOC 4FWTA 3ZLBA 2G1KA 2CV1A 1I2MA 4JJGA 5EFZA 4RGVA 4M0DA 5TV2A 5C5IA 2FMTA 1XAJA 5G1PA 1ZZGA 4ZQCB 3TLKA 1YFJA 2CF6A 7MHTA 1NLZA 5AQEA 1GUAA 4V1CI 3K09C 4L7VA 2DAPA 4E11A 5GZ1A 2H08A 3K0HA 1HZZC 4TLCA 2CL7X 2RHHA 1SOWA 1ULUA 2FPWA 4MRNA 3D02A 4YWHA 2KPOA 1T4CB 3T7IA 1KWGA 3MVEA 1VKOA 2A33A 3VTKA 4FNAA 5HF8A 1OY1A 1KYVA 5F9HA 2CUKA 3DO6A 3GRRA 3PPVA 3K5HA 4RE5A 4CQMA 1KOGA 4LQLA 3TLBA 4M60A 1U80A 4NESA 1IZ0A 4NZOA 3STYA 2EG9A 5EHIA 4UD6A 4M1KA 2ZP1A 1CG6A 4YREA 3BK7A 3LVFO 1Z5NA 1Z0KA 3N2LA 3OP1A 3PDWA 3I4FA 5JJLA 1GSAA 1XXLA 1YB1A 4RV4A 3TIGA 4MB2A 5CMLA 4E3ZA 3OUUA 2JG3A 1F1BA 1FNSA 2OUIA 3QNWA 1Z37A 4NPCA 1DAMA 4E09A 2Z56A 2MMCA 3GPBA 4AKGA 5EUBA 4M1YA 1V1MB 2JGNA 3ISVA 3L0IB 2I67A 4JEMA 1E4OA 3BWEA 3W7AA 1T1IA 2WE7A 4JQZA 1BAPA 5KNBH 4IQGA 4HVAA 3LUCA 1US8A 4DMGA 4RD1A 1ZCZA 2VF7A 5CM2Z 3G9QA 1QYRA 3EIFA 1VDMA 2R4UA 1P2TA 3WLLA 3JQAB 4JJZA 1RVDA 3H87A 3ZDFA 4PZ9A 2BGNA 4TMVA 2ZSJA 4JP2A 4U9IS 3LSYA 3D8SA 1V7ZA 3PC6A 2QAGC 4B4VA 4W7HA 2D0IA 4M1ZA 2FW8A 3L7MA 4R9UC 4FZ5A 2VJDA 4HF7A 2EWWA 3PZRA 2ZAYA 1Z75A 1SUCA 1T6ZA 3DYBA 2QRKA 2JRLA 4PVCA 4D4MA 5JAIA 3S2YA 2ZBGA 2IYYA 1HNXB 1B43A 4TKUA 4UZFA 4ZHQB 3WFJA 1JKMA 4BGEA 4V03A 3IQDB 3G6KA 5FPSA 4CMJA 2E4WA 2FLKA 5CB4A 3IP7A 5E95A 3KOOA 1OV4A 5CLQA 3GUZA 4NEHB 4RZXA 4HZIA 3ZI7A 4AYXA 1ADYA 1OF1A 1IBSA 3UWMA 5C18A 4A92A 2CCKA 4H35A 1B74A 1RXYA 1MDFA 4MGZR 3SS9X 1PFUA 3NATA 2ZETA 5KQLA 1C7JA 3C7AA 5BY2A 3O8NA 3EG9A 3FWKA 2WP8J 1D8AA 1XR3A 2YS7A 1MX5A 2FPLA 1EINA 1YMUA 3TL2A 4TL9A 1JIUA 1TU3A 1QH8A 2GPAA 4DY6A 4J6EA 4F3CA 1AXRA 4NMWA 1A0OA 1XE3A 2AJLI 3IUJA 5LQDA 2LP4Y 4YP7A 5CEEA 3MJHA 1CS4C 2Y1KA 4JQSA 2QZZA 3JR7A 4IJUA 2WSSA 4AX4A 2IT1A 4KLAA 2Q27A 3C3PA 4BO8A 4CMGA 4PC2A 1A98A 3KPJA 1I6MA 1SHUX 1UBTS 2DY0A 2FG6C 4HNAB 1GNSA 2XMQA 3C1AA 2X5NA 1AUXA 3L1HA 4X94A 5DOVA 2EFHB 2HSJA 2IYZA 2FYTA 2AE1A 1Y81A 1LK5A 3GC6A 3KFLA 4L4YA 4QAJA 5IYZA 5JDIC 1MEOA 3CWQA 3R09A 1CD5A 1XL0A 3GUUA 4K8OA 4O4HF 4NAVA 1LU9A 4FGKA 3QHQA 5F9MA 3RG8A 3AVWA 2EJCA 1ZVMA 3GLHB 4XFKA 3SBDA 3U13A 4EFNA 1JQDA 3FTFA 1YUNA 3QVSA 3G0HA 4B6SA 1GRVA 1X8LA 3FNQA 4BAGA 1R8YA 3QYAA 4PIMA 5ERXA 3U26A 4BVKA 1H4TA 2A9RA 2QJFA 4L8YA 4RORA 3T15A 3V4ZA 5LDDC 3HPQA 1KZYC 4OBXA 3IKMB 3V7YA 5EVJA 1OSNA 1PFKA 2BY4A 2P2ZA 2V7QA 2PLNA 3BXOA 3HCEA 4N0MA 4WE3A 1I4EB 3PR2B 4J90A 1TO1E 2FE1A 1K9SA 2A9KA 1NULA 3OU2A 5JOQA 4DDHA 4I55F 4A0RA 3BX1A 1OWPA 4MINA 2KX7A 2WU3A 3CTPA 1WXIA 3KJHA 2OXTA 3P97A 3S55A 4GO1A 3QPDA 4B85A 2WIDA 5GP1A 1QAOA 2GYWA 3PQ6A 1ZI6A 1GPNA 3CBQA 3JXEA 4GOXA 2R8BA 3UIEA 1U8TA 3I6ZA 4L3VA 5DNYB 4RXTA 1Z12A 4MPJA 5DDIP 4XTCS 1DIAA 1UBNA 1JFRA 1SMKA 2R86A 4B2IA 3ONEA 4DLLA 1WCWA 3H18A 4PWYA 1ZOOA 5KAMA 3SIRA 3LKZA 1EE9A 4FN5A 3DVLA 3MRXA 4NBVA 1JPUA 2KE5A 4W1SA 3WYNA 1SC4A 4N03A 4X00A 1FVOA 1XELA 1LCIA 3CO0S 4LWPA 1EFHA 1SCQA 1DPGA 1U3DA 4NFLA 3IMGA 1O58A 2PFGA 5L7WA 1Z2EA 2G5CA 3NYRA 4OM8A 1YB6A 5DTJA 1LPOA 2PGXA 3KCNA 5EE9A 4QJ4A 3TSWA 1EI9A 3IUYA 1EK5A 1NBEA 3OQIB 5K3FA 1GKIA 3RU2A 3RUCA 1X3LA 3H9UA 4S2UA 4BLVA 5IC4A 1T35A 1ACLA 4I9GA 3TRHA 3GV0A 4QECA 4NMHA 3UPUA 2O3TA 4U8GA 2J7PD 4O4JB 4YAUA 5AVQA 3K71B 4E51A 5DI9A 2B98A 3OWOA 1B8UA 4MA4A 4K9KA 5ALNA 5LMZA 1D0SA 4IY1A 2R1VB 3LBFA 3ZHRA 2Q0QA 3W0LB 1IOWA 4RIHA 4UU0A 2D1QA 2X4GA 2COEA 4E5UA 1YTLA 2A5YB 1JIVA 1NJ2A 2G9VA 2FPMA 2ORIA 3NIFB 4NC9A 4DSNA 4HZUB 1SPXA 3Q9LA 4LC0A 2I1WA 4D9MA 1N3BA 1M6NA 5GM1A 1PP4A 1L7VC 2WHPA 2SHKA 4NHOA 4DG9A 1AQYA 4A1OA 5JALA 3B2EA 4GEGA 3IESA 1EVQA 5K7SA 1H23A 2YIDA 2ZR7A 4WZZA 4JU8A 2J9GA 1W49A 3CEHA 4Q3LA 3KQUA 2QTNA 4EYQA 1J8DA 1LI4A 5BMVB 2D5BA 3JATA 4I50A 2H4XA 1SCNE 2AXNA 4GIBA 2QLBA 1DHTA 5KYXB 4TUYF 3ROMA 4J91A 5JE8A 1XZMA 3W6ZA 1G7SA 1HFKA 5DJ5A 1DJLA 3CCFA 1U2TA 3BH0A 1QIDA 1YI1A 3K1YA 1NQOA 1YR6A 5AXBA 2LVBA 5CH5A 2PTGA 4CYMA 1CR2A 2QRGA 4IV0A 1ECBA 1S89A 1SC3A 2QY6A 1EKXA 1FYFA 2XE4A 1KO7A 2AW3A 2X9QA 3GZNA 4I66A 4BFXA 4CT0A 4CTMA 5DGIA 2O54A 3KD3A 2RAFA 2RHOA 4YALA 3KL4A 4NZYA 4IWYA 5GQSA 1XVVA 5JNUA 3CX8A 1N92A 2DQSA 721PA 3AVUA 4D7AA 1P7YA 4JNCA 4Y2JA 4BGUA 3H9JA 5CVDA 1L9KA 1GPDG 1XC7A 1RHKA 1OPXA 1ZH0A 4X54A 1OIWA 3K8YA 2A9FA 4KFRA 2O14A 3R3UA 2HF9A 4GRAA 5DM4A 2NZJA 2NUAB 3ZLTA 1J0DA 5KQMA 2GK4A 2VG8A 2XWJI 1X7DA 1MHPA 4Z99A 4C0QC 2QLJA 5HQ3A 3O8CA 4KX3A 4IEEA 1ORHA 5JY6A 1P5ZB 2XSZD 2QTAA 4QM6A 3E3AA 5DNDA 3UK0A 2HHAA 4DR3B 2WJ6A 4PIPA 2FETA 3PUVA 4ROSA 4UM9D 5B3AA 1F0PA 5AUPB 3OI7A 4F46A 1O03A 3P27A 4LHZA 3P9XA 1KHTA 4C0BA 3OFNA 1OT5A 3DNMA 3QPUA 1XSEA 3CVVA 4BMSA 3BB1A 4JJ6A 4KWTA 3QNMA 4R1TA 4KQFA 3LPDA 4XM0A 1E9DA 4MQ6A 5EIBD 3RK1A 4YP5A 1J2JA 2W0SA 3EY9A 3RVMA 3H2YA 1V95A 3HVIA 2EX0A 2GK7A 4V0KA 4ENRA 3ZI4A 2D6FA 4HRVA 4B7ZA 1RZVA 1C1HA 2XXBA 1OAOC 2A1UB 3TSYA 3ZLVA 6CHYA 3J81k 4E5SA 4BQEA 3A10A 1G18A 3CIOA 5DTRA 1XTBA 3TO5A 2ZYTX 3QUTA 4UASA 2NX2A 1M7GA 2GGSA 2QX8A 3THOA 1T1GA 1NZJA 1U3UA 2BFDB 3U44A 1KMHB 5DRTA 1MIHA 4GP7A 4RF5A 2C54A 2VP0A 2QAIA 1KU0A 1AK1A 1QIKA 3HKBA 1AKVA 4M7OA 3W3AA 3VH4A 4ZI2A 3LYLA 1IMOA 3DEIA 3ZXUB 2CNDA 5D3KA 2PRKA 1G16A 4B1FA 4CMIA 5JAOA 4IGEA 4A16A 2GM4A 1EFUA 2FK7A 1C0KA 4J0QA 1VRWA 2X0RA 4F8EA 2Y1OA 2ECQA 3QBDA 3L1IA 1UEIA 4Z4QA 1IM8A 2HJGA 3A0UA 1ZGHA 5KVVA 3KL2A 4IQFA 4Z2AA 1ZM9A 3A1CA 4UDOA 2F62A 2XI4A 1BKYA 3OJWA 2W58A 3CRRA 3B3GA 3W8DA 1AUVA 3I01A 2WRZA 3BWMA 2FPOA 1U0GA 4LOHA 1E4EA 4R8LA 2HX1A 1G21B 5T4BA 7GPBA 1I5OA 4C6HA 4DCJA 3U44B 1T4GA 1RYBA 4KR9A 1JFSA 2QP3A 4EG1A 2W71A 3HBAA 2YZKA 4B5KA 3WLMA 4N0DA 1Z8NA 3GEDA 3KQHA 1PDOA 2G7ZA 4IIYA 5FWXB 1PLLA 5LBIA 2RB4A 1HQYE 4QULA 4JJIA 1JXAA 1GQQA 3Q41A 5D87A 5G1OA 4ZCMA 5JSFA 4HX5A 4BTLA 1IK4A 2CL0X 5GIPE 1J09A 3GJ7A 3GQBA 4DIUA 1FSSA 3BJIC 4OHYA 4RVUA 2VSNA 1TPYA 2BFBB 1N8NA 2WHEA 4OSOA 2HIAA 4PZEA 1G38A 3F5SA 3V4PB 4U7PB 4DANA 1N2SA 2P5TB 2X8JB 4I7EA 4ZRMA 1U7XA 4MR9B 1F2DA 4Q9NA 4TV9B 4CLEA 3RT9A 2QXTA 1WKVA 3OQJA 5FULA 1RQXA 4R7TA 5KNBA 2C8KA 3HO8A 4EG7A 4B3CA 3UAVA 4C4ZA 5CA0F 2B4YA 2QS9A 2HWKA 3V4OA 1RKVA 3FMVA 2ZI5A 1QGYA 5HZHA 4KR0A 3RABA 2PWZA 2VR1A 1Z0AA 4Y8VA 1FC0A 5AOBA 3L0DA 4HQFA 1KI6A 1E1LA 5EHGA