3M84A

Crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
348
structure length
348
Chain Sequence
AMAGLKYEDAGVNIEAGNQAVERMKQHVKKTFTQDVLTGLGSFGSLYSLKNIINNYDDPVLVQSIDGVGTKTKVAVMCGKFENLGYDLFSAATNDIVVMGAKPITFLDYVAHDKLDPAIMEELVKGMSKACAECGVSLVGGETAEMPGVYQAGEIDMVGVITGIVDRKRIINGENIKEGDIVFGLSSSGLHTNGYSFARKLFFDVAGNKHTDTYPELEGKTIGDVLLEPHINYTNIIHDFLDNGVDIKGMAHITGGGFIENIPRVLPQGLGAQIDKDSFATPAIFKLMQRIGDISEFEMYRSFNMGIGMTIIASQDQFDKMQELAKKHTNTKLYQIGKITNSGKVEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Phosphoribosylaminoimidazole Synthetase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Ligase
molecule keywords Phosphoribosylformylglycinamidine cyclo-ligase
total genus 99
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 3m84A01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 3m84A02
3QTYA 3VTIC 3MCQA 3WJPA 5AVMA 2Z01A 3VIUA 3C9RA 3VYTC 2Z1EA 2I6RA 3VYSC 3C9SA 2Z1UA 3KIZA 1VK3A 2Z1FA 3MDOA 2YYEA 3C9UA 2V9YA 2RB9A 1CLIA 1VQVA 2HS0A 3WJQA 3P4EA 3VYUC 3FD6A 3U0OA 3D54A 2HRUA 3C9TA 2Z1TA 3WJRA 2HS3A 2ZODA 3FD5A 2ZAUA 3M84A 2YXZA 2HRYA 2BTUA 2HS4A
chains in the Genus database with same CATH superfamily
5C8YB 5JH7A 1SA0A 3JAWB 3CPQA 3Q8HA 3WGLA 3ELCA 1Q7YH 3TD4A 2RHOA 4DRXB 3JAMM 3CCSF 4HNAB 5HY2A 1COMA 1FSZA 5CA1B 3MDOA 3N2KA 3CCEF 4TV9A 3HTNA 1CK2A 1VQVA 3F0DA 2AIFA 5JQGA 3GHZA 4BVTA 4YJ3A 3E22B 2UYKA 3IMPA 2Z1TA 3RYIA 5GINC 3VO8A 2FGYA 3E20B 3FFMA 4B45A 4X3LA 4RHAA 5FLXM 3S03A 3CXCF 3HKBA 1W55A 2BTUA 3VOBA 3T80A 3WXMB 3F6MA 4TUYB 3CCMF 3QTYA 3MCQA 3VYTC 5J2TB 3CD6F 5FNVB 5JCOC 4G4VA 2Z1UA 2W8BC 4G88A 3KHNA 4BT7A 1Q8RA 5KMGA 5IJ0B 2BTOA 3I3FA 2RB9A 4E6EA 3OBYA 3VI6A 3WGNA 5JCOA 2RHHA 4X1KB 2ALEA 2VAPA 4O4LA 5G4VC 1OFUA 1FNKA 4ERHA 3FD5A 2Q1XA 3RE3A 5KMGB 5IT9M 3HJWC 2N48A 4YJ2B 3CC2F 2ZOVA 1VHAA 1JN1A 2OTJF 4NWOB 3C9SA 2LBTA 5HXUA 2KG4A 5GAPK 3OONA 4LCKA 1UFYA 2CSLA 3V3TA 2DT4A 3RYCA 1VQ5F 3L7QA 2CZWA 2VGNA 5JQGB 3HAXD 3VOAA 4BT4A 1YI2F 1NMUB 1E7KA 4FFBB 1CN7A 1VQKF 4C81A 1NQ3A 2EWCA 2HRYA 1W581 5EYPA 3M4SA 3HWUA 1VQOF 3JARA 4ZHQA 2JNBA 3C9RA 4X1KA 4BW0B 1YITF 2K1SA 3LYBA 5GONA 3SIVA 2UYJA 4ZI7A 2P6YA 5J2UA 3VCZA 1JJ2F 4BVRA 3PAFA 1YJ9F 3M1XA 3RYFA 4ZHVA 4LNUA 1IV3A 2VAWA 1M90H 1JFFA 2UZHA 3HKDA 3WGKA 1VQPF 4G4YA 4U3JA 4ZI7B 1H7MA 1VQ4F 3WPXA 1QVFF 2HVYD 4I50B 4O2AB 3CCLF 2ZF8A 3CPWF 3WJPA 5AVMA 2RHLA 1KQSF 2L26A 3GTZA 1YGYA 1U3PA 1TUBA 1H48A 1U3LA 1VK3A 1M1KH 3J80M 4G4XA 4R40B 4O2BA 3OBWA 1Z5VA 5EO3A 2FC3A 3S0YA 5GIPC 1QD9A 5JH7B 1NJIH 3QUWA 2QI2A 4C4WC 4X1YB 3LWPC 4TV8B 5EZYB 5IJ9B 4ZHQB 4IIJB 1VQNF 3F0GA 3LWRC 5MN5A 1GX1A 3EORA 2ZVZA 1VH8A 3RYHB 3JAKB 4G4ZA 4X1YA 3HKCA 4WBNB 2B33A 1YJWF 3OW2F 1KC8H 1GO1A 1SA0B 3K0TA 2R6R1 5ITZA 3C9TA 4O4IA 3S02A 1T0KB 5LYJA 1JY8A 4TV9B 2ZODA 4EI9A 5LOVB 3LWVC 3N4ZA 4C8GA 3ERNA 3E1YA 2H6LA 3NVKE 3P10A 3I55F 3G6EF 2BO1A 5ITZB 4BVSA 3VYSC 1Q81H 3WGMA 3HKBB 2AIZP 1XHOA 3JATA 2OTMA 3WPWA 2H8CA 3RYIB 2GVIA 3VMFB 4EB6B 1QVGF 3LWOC 3S0WA 2HP0A 1KNJA 1T0AA 2LBXA 1FNJA 3NVIB 2LCAA 1W57A 2HX0A 5LA6A 5IJ0A 5EAZA 1OAPA 4DRXA 4IHJB 2KGWA 3C8LA 2UYPA 4O4HB 1PXWA 3VIUA 1IV2A 2AMTA 2HQSC 1S72F 5KX5A 3ESJA 1RLGA 3HKCB 4WBNA 3JAKA 4U39A 5LP6C 2HS0A 5LOVA 5LYJB 4ZHWA 2F9ZC 4X20A 2QA4F 3CC7F 3K2XA 1KNKA 2CVLA 3CB2A 1RQ7A 3K14A 4YJ2A 1ZWZA 3CYQA 2CW4A 3G4SF 4TZZA 1RA4A 5J2UB 4I55B 3JATB 2YXZA 1RLUA 3R0PA 1H47A 3HKDB 3I7TA 2OZBA 5HY1A 4X3MA 2OHWA 5JVDB 5CA0B 2I6RA 3N4YA 4X20B 5CB4A 4LNUB 1X52A 3V7QA 5HWEA 1SZQA 2R751 2IQQA 1ODEA 5BMVB 3KJJA 1CLIA 1W59A 3G71F 5CA0A 5JVDA 2HP0B 5EIBC 3IEQA 1VQLF 3CCRF 3V4DA 5GANK 5DCVA 1TVKB 1Q82H 5J2TA 5FNVA 3LWQC 1YQNA 5A2QM 4O2BB 2Z1EA 1W40A 1N8RH 3PLAC 3S06A 4ZOLB 2BTQB 4KWEA 3V7EA 3KJKA 4O4JB 3IR9A 5LP6B 2GZLA 2CHSA 3WJQA 3FD6A 4DXDA 3D54A 3IKFA 1FFXB 1DT9A 5EYPB 1Q86H 1SDSA 3B6NA 4O4JA 3M84A 4C82A 1Z5WA 5MN6A 2UYNB 4B5CA 3VTIC 3N2GB 1W3EX 1DBFA 3JCMM 1YHQF 3AGKA 2IG8A 3RYFB 3GYQA 3LDTA 4TV8A 2VAMA 3UT5A 1XBIA 4BY9D 3C9UA 2NMUA 3FPIA 4FFBA 3NK6A 2VGMA 1R1MA 2RHJA 3D00A 1K73H 3JASB 1RQ2A 2ZVYA 4BVQA 1YIJF 1TVKA 1VQ8F 3RYCB 5MN4A 3RYHA 1VQ7F 3N2KB 3MCAB 1W5AA 4F6RB 4HNAA 3MBMA 3TD3A 1W5FA 4O4HA 3K12A 3D01A 3CCJF 4G4WA 5LP6A 5FJ4C 1X7OA 3S0HA 1VQ9F 1ONIA 2V9YA 2DYYA 1QU9A 3P4EA 2OTLF 2HP3A 5EB1B 1FFXA 1W5BA 4TUYA 1W41A 1W2BF 1K8AH 5C8YA 2HS3A 4NQ3A 3JVHA 3CC4F 2CHTA 1IPAA 3CMAF 5KX5B 4O4LB 4B62A 3HKEB 3CCUF 2WALA 5LXTA 2Z01A 3SIUA 4I50A 4O2AA 4YJ3B 3IEWA 2CWJA 4EI7A 2I6DA 5CA1A 4IHJA 3NMUC 1K9MH 3KIZA 2Z1FA 2YYEA 4PWTA 3DC2A 3F0FA 3F0EA 3JASA 3JALA 3U0OA 4EI8A 3HKEA 1GZ0A 3QHDA 2MQEA 4F6RA 3KE1A 5HP8A 2HS4A 1X25A 2QTPA 3DDNA 2IAFA 5EWRA 3JALB 4NUTA 5B8FA 3WGJA 5HY0A 4IIJA 1QAHA 1XV2A 3O85A 1XRGA 3RA5A 3CMEF 5IJ9A 2KTVA 3ZO8A 5IYZA 4BT3A 3IKEA 4I55A 3I56F 4O4IB 3NK7A 5G4UC 3VYUC 3JARB 4BT5A 4BT6A 4I4TB 4RQOA 5BMVA 2GLZA 4ZOLA 4BT2A 2G9IA 1VQ6F 1U43A 1W5EA 3ON1A 2Q1YA 3ZP4A 5LXTB 4EB6A 1X7PA 3CYPB 2LBWA 4M8IA 5EZYA 4ZK7A 3LMEA 3UT5B 3ZP7A 4U3JB 3CG6A 3TD5A 4C8EA 5EB0A 2HRUA 3ZOPA 2UYNA 5HXZA 3N2GA 3LFOA 3WJRA 5GIOC 4X1IA 2PHNA 1PF5A 3RA6A 2ZAUA 3BYQA 3FBAA 5LA6B 5GONB 3E22A 3J81M 1UI9A 4B46A 3CCVF 5HY4A 1W42A 1GO0A 1IV4A 4C8IA 2H8EA 5IYZB 4X1IB 3MQWA 2VXYA 1TUBB 1JFFB 1YJNF 4I4TA 1J7HA 3JAWA 1VQMF 4ZHYB 1JD1A 1U40A 2PMPA 2QEXF 1IV1A 2KTUA 1KD1H 3CCQF 5HP7A 5EIBD 3J7AR 4XCQA 3P0ZA 5CB4B
chains in the Genus database with same CATH topology
3QTYA 3VTIC 3MCQA 3WJPA 5AVMA 2Z01A 3VIUA 3C9RA 3VYTC 2Z1EA 2I6RA 3VYSC 3C9SA 2Z1UA 3KIZA 1VK3A 2Z1FA 3MDOA 2YYEA 3C9UA 2V9YA 2RB9A 1CLIA 1VQVA 2HS0A 3WJQA 3P4EA 3VYUC 3FD6A 3U0OA 3D54A 2HRUA 3C9TA 2Z1TA 3WJRA 2HS3A 2ZODA 3FD5A 2ZAUA 3M84A 2YXZA 2HRYA 2BTUA 2HS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QTY A;  3VTI C;  3MCQ A;  3WJP A;  5AVM A;  2Z01 A;  3VIU A;  3C9R A;  3VYT C;  2Z1E A;  2I6R A;  3VYS C;  3C9S A;  2Z1U A;  3KIZ A;  1VK3 A;  2Z1F A;  3MDO A;  2YYE A;  3C9U A;  2V9Y A;  2RB9 A;  1CLI A;  1VQV A;  2HS0 A;  3WJQ A;  3P4E A;  3VYU C;  3FD6 A;  3U0O A;  3D54 A;  2HRU A;  3C9T A;  2Z1T A;  3WJR A;  2HS3 A;  2ZOD A;  3FD5 A;  2ZAU A;  3M84 A;  2YXZ A;  2HRY A;  2BTU A;  2HS4 A; 
#chains in the Genus database with same CATH topology
 5C8Y B;  5JH7 A;  1SA0 A;  3JAW B;  3CPQ A;  3Q8H A;  3WGL A;  3ELC A;  1Q7Y H;  3TD4 A;  2RHO A;  4DRX B;  3JAM M;  3CCS F;  4HNA B;  5HY2 A;  1COM A;  1FSZ A;  5CA1 B;  3MDO A;  3N2K A;  3CCE F;  4TV9 A;  3HTN A;  1CK2 A;  1VQV A;  3F0D A;  2AIF A;  5JQG A;  3GHZ A;  4BVT A;  4YJ3 A;  3E22 B;  2UYK A;  3IMP A;  2Z1T A;  3RYI A;  5GIN C;  3VO8 A;  2FGY A;  3E20 B;  3FFM A;  4B45 A;  4X3L A;  4RHA A;  5FLX M;  3S03 A;  3CXC F;  3HKB A;  1W55 A;  2BTU A;  3VOB A;  3T80 A;  3WXM B;  3F6M A;  4TUY B;  3CCM F;  3QTY A;  3MCQ A;  3VYT C;  5J2T B;  3CD6 F;  5FNV B;  5JCO C;  4G4V A;  2Z1U A;  2W8B C;  4G88 A;  3KHN A;  4BT7 A;  1Q8R A;  5KMG A;  5IJ0 B;  2BTO A;  3I3F A;  2RB9 A;  4E6E A;  3OBY A;  3VI6 A;  3WGN A;  5JCO A;  2RHH A;  4X1K B;  2ALE A;  2VAP A;  4O4L A;  5G4V C;  1OFU A;  1FNK A;  4ERH A;  3FD5 A;  2Q1X A;  3RE3 A;  5KMG B;  5IT9 M;  3HJW C;  2N48 A;  4YJ2 B;  3CC2 F;  2ZOV A;  1VHA A;  1JN1 A;  2OTJ F;  4NWO B;  3C9S A;  2LBT A;  5HXU A;  2KG4 A;  5GAP K;  3OON A;  4LCK A;  1UFY A;  2CSL A;  3V3T A;  2DT4 A;  3RYC A;  1VQ5 F;  3L7Q A;  2CZW A;  2VGN A;  5JQG B;  3HAX D;  3VOA A;  4BT4 A;  1YI2 F;  1NMU B;  1E7K A;  4FFB B;  1CN7 A;  1VQK F;  4C81 A;  1NQ3 A;  2EWC A;  2HRY A;  1W58 1;  5EYP A;  3M4S A;  3HWU A;  1VQO F;  3JAR A;  4ZHQ A;  2JNB A;  3C9R A;  4X1K A;  4BW0 B;  1YIT F;  2K1S A;  3LYB A;  5GON A;  3SIV A;  2UYJ A;  4ZI7 A;  2P6Y A;  5J2U A;  3VCZ A;  1JJ2 F;  4BVR A;  3PAF A;  1YJ9 F;  3M1X A;  3RYF A;  4ZHV A;  4LNU A;  1IV3 A;  2VAW A;  1M90 H;  1JFF A;  2UZH A;  3HKD A;  3WGK A;  1VQP F;  4G4Y A;  4U3J A;  4ZI7 B;  1H7M A;  1VQ4 F;  3WPX A;  1QVF F;  2HVY D;  4I50 B;  4O2A B;  3CCL F;  2ZF8 A;  3CPW F;  3WJP A;  5AVM A;  2RHL A;  1KQS F;  2L26 A;  3GTZ A;  1YGY A;  1U3P A;  1TUB A;  1H48 A;  1U3L A;  1VK3 A;  1M1K H;  3J80 M;  4G4X A;  4R40 B;  4O2B A;  3OBW A;  1Z5V A;  5EO3 A;  2FC3 A;  3S0Y A;  5GIP C;  1QD9 A;  5JH7 B;  1NJI H;  3QUW A;  2QI2 A;  4C4W C;  4X1Y B;  3LWP C;  4TV8 B;  5EZY B;  5IJ9 B;  4ZHQ B;  4IIJ B;  1VQN F;  3F0G A;  3LWR C;  5MN5 A;  1GX1 A;  3EOR A;  2ZVZ A;  1VH8 A;  3RYH B;  3JAK B;  4G4Z A;  4X1Y A;  3HKC A;  4WBN B;  2B33 A;  1YJW F;  3OW2 F;  1KC8 H;  1GO1 A;  1SA0 B;  3K0T A;  2R6R 1;  5ITZ A;  3C9T A;  4O4I A;  3S02 A;  1T0K B;  5LYJ A;  1JY8 A;  4TV9 B;  2ZOD A;  4EI9 A;  5LOV B;  3LWV C;  3N4Z A;  4C8G A;  3ERN A;  3E1Y A;  2H6L A;  3NVK E;  3P10 A;  3I55 F;  3G6E F;  2BO1 A;  5ITZ B;  4BVS A;  3VYS C;  1Q81 H;  3WGM A;  3HKB B;  2AIZ P;  1XHO A;  3JAT A;  2OTM A;  3WPW A;  2H8C A;  3RYI B;  2GVI A;  3VMF B;  4EB6 B;  1QVG F;  3LWO C;  3S0W A;  2HP0 A;  1KNJ A;  1T0A A;  2LBX A;  1FNJ A;  3NVI B;  2LCA A;  1W57 A;  2HX0 A;  5LA6 A;  5IJ0 A;  5EAZ A;  1OAP A;  4DRX A;  4IHJ B;  2KGW A;  3C8L A;  2UYP A;  4O4H B;  1PXW A;  3VIU A;  1IV2 A;  2AMT A;  2HQS C;  1S72 F;  5KX5 A;  3ESJ A;  1RLG A;  3HKC B;  4WBN A;  3JAK A;  4U39 A;  5LP6 C;  2HS0 A;  5LOV A;  5LYJ B;  4ZHW A;  2F9Z C;  4X20 A;  2QA4 F;  3CC7 F;  3K2X A;  1KNK A;  2CVL A;  3CB2 A;  1RQ7 A;  3K14 A;  4YJ2 A;  1ZWZ A;  3CYQ A;  2CW4 A;  3G4S F;  4TZZ A;  1RA4 A;  5J2U B;  4I55 B;  3JAT B;  2YXZ A;  1RLU A;  3R0P A;  1H47 A;  3HKD B;  3I7T A;  2OZB A;  5HY1 A;  4X3M A;  2OHW A;  5JVD B;  5CA0 B;  2I6R A;  3N4Y A;  4X20 B;  5CB4 A;  4LNU B;  1X52 A;  3V7Q A;  5HWE A;  1SZQ A;  2R75 1;  2IQQ A;  1ODE A;  5BMV B;  3KJJ A;  1CLI A;  1W59 A;  3G71 F;  5CA0 A;  5JVD A;  2HP0 B;  5EIB C;  3IEQ A;  1VQL F;  3CCR F;  3V4D A;  5GAN K;  5DCV A;  1TVK B;  1Q82 H;  5J2T A;  5FNV A;  3LWQ C;  1YQN A;  5A2Q M;  4O2B B;  2Z1E A;  1W40 A;  1N8R H;  3PLA C;  3S06 A;  4ZOL B;  2BTQ B;  4KWE A;  3V7E A;  3KJK A;  4O4J B;  3IR9 A;  5LP6 B;  2GZL A;  2CHS A;  3WJQ A;  3FD6 A;  4DXD A;  3D54 A;  3IKF A;  1FFX B;  1DT9 A;  5EYP B;  1Q86 H;  1SDS A;  3B6N A;  4O4J A;  3M84 A;  4C82 A;  1Z5W A;  5MN6 A;  2UYN B;  4B5C A;  3VTI C;  3N2G B;  1W3E X;  1DBF A;  3JCM M;  1YHQ F;  3AGK A;  2IG8 A;  3RYF B;  3GYQ A;  3LDT A;  4TV8 A;  2VAM A;  3UT5 A;  1XBI A;  4BY9 D;  3C9U A;  2NMU A;  3FPI A;  4FFB A;  3NK6 A;  2VGM A;  1R1M A;  2RHJ A;  3D00 A;  1K73 H;  3JAS B;  1RQ2 A;  2ZVY A;  4BVQ A;  1YIJ F;  1TVK A;  1VQ8 F;  3RYC B;  5MN4 A;  3RYH A;  1VQ7 F;  3N2K B;  3MCA B;  1W5A A;  4F6R B;  4HNA A;  3MBM A;  3TD3 A;  1W5F A;  4O4H A;  3K12 A;  3D01 A;  3CCJ F;  4G4W A;  5LP6 A;  5FJ4 C;  1X7O A;  3S0H A;  1VQ9 F;  1ONI A;  2V9Y A;  2DYY A;  1QU9 A;  3P4E A;  2OTL F;  2HP3 A;  5EB1 B;  1FFX A;  1W5B A;  4TUY A;  1W41 A;  1W2B F;  1K8A H;  5C8Y A;  2HS3 A;  4NQ3 A;  3JVH A;  3CC4 F;  2CHT A;  1IPA A;  3CMA F;  5KX5 B;  4O4L B;  4B62 A;  3HKE B;  3CCU F;  2WAL A;  5LXT A;  2Z01 A;  3SIU A;  4I50 A;  4O2A A;  4YJ3 B;  3IEW A;  2CWJ A;  4EI7 A;  2I6D A;  5CA1 A;  4IHJ A;  3NMU C;  1K9M H;  3KIZ A;  2Z1F A;  2YYE A;  4PWT A;  3DC2 A;  3F0F A;  3F0E A;  3JAS A;  3JAL A;  3U0O A;  4EI8 A;  3HKE A;  1GZ0 A;  3QHD A;  2MQE A;  4F6R A;  3KE1 A;  5HP8 A;  2HS4 A;  1X25 A;  2QTP A;  3DDN A;  2IAF A;  5EWR A;  3JAL B;  4NUT A;  5B8F A;  3WGJ A;  5HY0 A;  4IIJ A;  1QAH A;  1XV2 A;  3O85 A;  1XRG A;  3RA5 A;  3CME F;  5IJ9 A;  2KTV A;  3ZO8 A;  5IYZ A;  4BT3 A;  3IKE A;  4I55 A;  3I56 F;  4O4I B;  3NK7 A;  5G4U C;  3VYU C;  3JAR B;  4BT5 A;  4BT6 A;  4I4T B;  4RQO A;  5BMV A;  2GLZ A;  4ZOL A;  4BT2 A;  2G9I A;  1VQ6 F;  1U43 A;  1W5E A;  3ON1 A;  2Q1Y A;  3ZP4 A;  5LXT B;  4EB6 A;  1X7P A;  3CYP B;  2LBW A;  4M8I A;  5EZY A;  4ZK7 A;  3LME A;  3UT5 B;  3ZP7 A;  4U3J B;  3CG6 A;  3TD5 A;  4C8E A;  5EB0 A;  2HRU A;  3ZOP A;  2UYN A;  5HXZ A;  3N2G A;  3LFO A;  3WJR A;  5GIO C;  4X1I A;  2PHN A;  1PF5 A;  3RA6 A;  2ZAU A;  3BYQ A;  3FBA A;  5LA6 B;  5GON B;  3E22 A;  3J81 M;  1UI9 A;  4B46 A;  3CCV F;  5HY4 A;  1W42 A;  1GO0 A;  1IV4 A;  4C8I A;  2H8E A;  5IYZ B;  4X1I B;  3MQW A;  2VXY A;  1TUB B;  1JFF B;  1YJN F;  4I4T A;  1J7H A;  3JAW A;  1VQM F;  4ZHY B;  1JD1 A;  1U40 A;  2PMP A;  2QEX F;  1IV1 A;  2KTU A;  1KD1 H;  3CCQ F;  5HP7 A;  5EIB D;  3J7A R;  4XCQ A;  3P0Z A;  5CB4 B; 
#chains in the Genus database with same CATH homology
 3QTY A;  3VTI C;  3MCQ A;  3WJP A;  5AVM A;  2Z01 A;  3VIU A;  3C9R A;  3VYT C;  2Z1E A;  2I6R A;  3VYS C;  3C9S A;  2Z1U A;  3KIZ A;  1VK3 A;  2Z1F A;  3MDO A;  2YYE A;  3C9U A;  2V9Y A;  2RB9 A;  1CLI A;  1VQV A;  2HS0 A;  3WJQ A;  3P4E A;  3VYU C;  3FD6 A;  3U0O A;  3D54 A;  2HRU A;  3C9T A;  2Z1T A;  3WJR A;  2HS3 A;  2ZOD A;  3FD5 A;  2ZAU A;  3M84 A;  2YXZ A;  2HRY A;  2BTU A;  2HS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...