3M8ZA

Phosphopentomutase from bacillus cereus bound with ribose-5-phosphate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus (strain atcc 14579 / dsm 31 / jcm 2152 / nbrc 15305 / ncimb 9373
molecule tags Isomerase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8zA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8zA01
4NWJA 1FSUA 3DPCA 4GTWA 5C66A 4MY4A 4CXUA 4KJGA 1P49A 4UORA 3BDFA 5DLVA 4LRAA 2W5XA 4LRCA 1EW2A 4UPLA 4MHXA 3SZYA 2VQRA 2GSOA 1ELXA 3MK2A 3T01A 1EW8A 4GTXA 4LR2A 1ALIA 2W5VA 4N7TA 4UPHA 5INHA 3E2DA 5IJQA 2XRGA 4KM4A 1K7HA 4LR9A 4ZGAA 5K4PA 1ALJA 2ANHA 3B5QA 3IGYB 4KAVA 3UNYA 1E33P 3IGZB 1AJCA 3T02A 1ANIA 2D1GA 2W5WA 3DYCA 2X98A 1EW9A 1KH5A 4UPIA 3WAXA 1AJBA 4CYRA 2W8SA 1URAA 1ELZA 4CXSA 4LRDA 2W5TA 5EGHA 5AJ9A 1ALHA 4NWXA 4ZG7A 1HJKA 3NKQA 5EGEA 1AJAA 3NKRA 4LR8A 2IFYA 3IDDA 4TN0A 5L0EA 5DLWA 3UN2A 2GSNA 3BDHA 3TX0A 1URBA 1ED9A 2W5SA 2GLQA 1HQAA 2IUCA 4KJDA 1SHQA 3CMRA 1ED8A 5IJSA 2IUCB 4LRBA 3NKPA 4LR7A 1KH4A 3M8YA 5DLTA 3WAWA 2XR9A 1E1ZP 3NKMA 4FDJA 5GOVA 4ZG6A 4ZG9A 1KHLA 3M7VA 1Y6VA 4GTZA 3M8WA 5LQQA 4LQYA 1AJDA 1ANJA 1AUKA 5LIAA 3SZZA 2W5QA 1ALKA 3BDGB 1EI6A 1EQJA 5LRMA 4QAXA 5HRTA 4LREA 2GSUA 1ELYA 1KH9A 3KD8A 3LXQA 5KXAA 5L0KA 4LRFA 4UPKA 1E3CP 3NVLA 5TJ3A 4FDIA 3MK0A 3OT9A 1HDHA 2G9YA 3M8ZA 1Y7AA 3A52A 4MIVA 2RH6A 2W5RA 1EJJA 1ZEFA 4CYSA 5LRNA 4B56A 1KHNA 3WAYA 3UO0A 1SHNA 3WBHA 1B8JA 1O99A 3BDGA 1KH7A 2QZUA 1N2LA 1ZEBA 5GRRA 3TWZA 2GA3A 4CXKA 1N2KA 3Q3QA 3UN3A 3ED4A 1ZEDA 3UN5A 1O98A 3T00A 4GTYA 2ZKTA 4UOPA 5L0BA 4KAYA 1KHJA 3NKNA 1KHKA 3NKOA 3MK1A 3WAVA 2W8DA 4YR1A 3TG0A 1E2SP 4UOOA
chains in the Genus database with same CATH superfamily
4USTA 3VCDA 4TY8A 4C3KA 2DIVA 2JEIA 2JEJA 1NDCA 3BSCA 4LRAA 1UFWA 4OJ1A 3TOQA 2RUSA 3IBFB 1U2CA 3SSQA 1SJ1A 4YHHJ 2YX1A 2UUAJ 1FVSA 4X4UA 4KV8A 5LT5A 4ERDA 2W9CA 4QW8A 2Y1RI 1KSPA 4NWXA 2IPOB 4M5DA 3CO0P 2Q6CA 3AT1B 1FXDA 5BYRA 4G1IA 1MG7A 4I7FA 3EXCX 3V6JA 5J1EA 4FDJA 1IUJA 2EG1A 2IVMA 3BYPA 2BRKA 4LUBA 1NK6A 1FTCA 2E9TA 5DG8A 5GAHU 4DR7J 3SYZA 3UCZP 2ZHAA 1YWXA 3RJMB 4CDIA 4RW6A 1F9FA 1JX4A 1VJQA 1SUQB 4LF7F 1N6QA 2ZKTA 3ILIA 1KLMB 3K8WA 1YJRA 2F63A 5KFUA 2RT3A 4GKJF 3P5TL 3CJ4A 3A8EA 3DMJA 2HAIA 3TJ9A 4NI2B 2H1YA 3RB0A 1ELXA 3M2VA 2CVIA 1XN9A 3MM8B 2HQFA 4QW9A 4R25A 1IWGA 1TL1B 3MEGB 2AEMA 1CQNA 2ZM6J 1U1PA 3BGRB 1ZOTA 1REGX 3H5SA 3UDVA 1RLCL 4ZMMA 4RW9A 2ZOMA 1FWKA 3M8RA 4DLEA 2HIYA 1ED9A 3C14A 3PYEA 4C98A 3MPDA 1S76D 1NPRA 2E5LJ 1Q95G 2OUGA 1CC7A 5E41A 3HHDA 2A2CA 2W5QA 3UCGA 4ZJOA 4O3PA 1RZMA 1RTHA 2BQ3A 1JIHA 5J1PA 4ZP6A 2JX2A 1XMQF 2W5RA 1ZM3A 2N7CA 1X9MA 3TVYA 3CB4A 2KM8B 2K3KA 5GRRA 3PRDA 2MMYA 1KRPA 4RUHA 1S6PA 2HRYA 5KFKA 2PA8D 1N48A 1BHNA 2XWXA 2XS2A 1F3FA 5DLVA 1EP4B 3M8PB 4EFAC 1WOSA 2O5DA 1WORA 4N8NA 1HBUB 2YWEA 1QUPA 5IJQA 3PR5B 1T3NA 3J80U 3Q8RB 4JI1F 1TK5A 4LSLB 1OY8A 4OZNA 4LRDA 2RKIA 3FSIA 3M9MB 2XCAA 5EGEA 4MAKA 3MD1A 1SL0A 3PFOA 3EM1A 5F8IA 4AXJA 3QNWB 2YKNB 1B0PA 4ELVA 4UTGA 4CLLA 4ZPAA 2B7CB 3R5BA 1R8HA 4WE1A 4NZ7A 2WSEC 2OPQA 2CPEA 4N56A 1S9GB 1HBOB 2BV3A 2E1AA 3O1LA 1RSCA 4ZVSB 4BS2A 3FC9A 2KRBA 1R0AB 2L41A 2WVBA 3GIRA 3L7UA 1R27B 4GTWA 1HYSA 2CAJA 2PEBA 2QFIA 4DSFA 2XGPA 2QA1A 2D7SA 2RS8A 3T6JA 2NQPA 4Y2IA 1IWAA 1J5OB 2U1AA 4DQIA 2BXJA 1KNZA 5IWAJ 4IO9Q 5EHHA 1FEHA 1O51A 1HNVA 4WPAA 5E33A 2WZ1A 4CTAA 5E7OB 1TAUA 1FRMA 1WG5A 2J8AA 4U7UD 3W61A 1RCOB 5E3RA 3MMCB 2QSFA 3MR7A 3BO2A 4TU7A 5FIIA 1KHVA 4AT1B 4X65J 3PYFA 3JSBA 5HANA 1NH8A 4I6YA 1UWBB 2OPSB 2AJ0A 3QJPA 2HS0A 5GOVA 1ZZNA 5KFVA 3I0RB 3B4MA 3GJQB 4URSA 1R43A 2ZDOA 4LBHA 2R8KA 3C16A 4RUAA 3D5MA 4PG6A 3WDOA 5KFZA 3M9OB 3FEZA 5IV4A 3M8ZA 3ZO7A 5KFJA 1YRUA 2Y1JA 1A0OB 1ZEFA 1C1BA 2VJUA 1YZ7A 2DB1A 4CXKA 2PSZA 4Y6IA 1VQMS 1RACB 2AV5A 1SH3A 4PUOB 4ZPVR 4RW7B 3G8TA 5A8KB 3F56A 1S1XB 3BF4A 4EK2A 1YJ9S 4XO0A 2M9KA 5K20B 3US5A 1TZ0A 4HTJA 4ZVQB 2HHXA 4N7TA 3E2DA 5GAGU 1HR0F 1PC4A 3OVAA 3A8KA 1S79A 3HCXA 5CZXA 1S6OA 4TYAA 1KVIA 3IRXA 4MTPA 4L3KA 4CT8A 3FEXB 2P6TA 3CJKB 1RT7B 2EK1A 2E29A 2VU5A 2HS3A 4IOBA 2W7AA 1CJUB 3KOAA 3UD5A 1NXIA 3T9ZA 5FLXU 1JB0C 1NMEB 1T9VA 3HVWA 3FRZA 1SI9A 4QIVA 4A47A 3DYAA 4MK9A 2J6SA 5KFHA 5I3UB 3X1LB 2H5IB 1RWMB 1VR6A 4FYWB 2AIRB 4ZVPB 3VAFA 3IR5B 2J5AA 1IBLF 2HK2A 1RQ0A 3UNGC 1AZSB 3P5BP 5KFLA 3OUYB 2H9ZA 2QA2A 4DV3J 1X5OA 4WKRA 4B3RF 2FTRA 1FT8A 5IS2A 2GVZB 2V9WA 4ED2A 2OELA 5T7LB 1TMJA 3NAHA 1CLFA 4DR3F 1X9SA 1M1HA 3R5DA 2NS1B 4DR6J 4DV2F 3C19A 1AJBA 2AZ3A 2MLZA 1T9WA 2B9EA 1FK9B 3ETMA 1DQ9A 5CQGA 1HHQA 2KRRA 3D9BA 1V9OA 4QQBA 3I32A 1E6YB 3GJSB 4L73A 4CH7A 4DG1B 4WP8A 4CYUB 2AJ4A 3R3TA 1M5KC 4A8WA 2RHQB 3OT9A 4P6QA 2DNGA 2E7VA 3RB6A 3P45B 2BW2A 1TTHB 2DEJA 1M90T 2F3JA 3VALA 2L9NA 3J7ZT 4V19X 2GW8A 1BWVA 2OMLA 1N36F 4O4GB 3MAAA 1LW0A 3Q22A 2CPJA 2C3UA 5J2NA 2R7VA 3TYTA 4KH0B 3KLGB 4ZHRB 4JOUA 2GVDB 4MJKA 2DNNA 3SMZA 1U6FA 3D0HE 2DGTA 4YP3A 3DRRB 5KFNA 3ZZPA 2YNGA 3CCTA 3B8HA 1ZBTA 1QAJA 1ALJA 1S1UA 2ZC3A 4KE5A 1D3WA 1UJ6A 1YKWA 4EYHB 4ECVA 4TLRA 3KHLA 4JI2J 5D4OA 1IKVA 3W8GA 2IUCB 4DHVA 3MECA 4HTIA 4MMOA 3NKMA 1FJ7A 2HNDA 2XC9A 4FS1A 4WYLA 3W3SA 5KFDA 3THPA 4DUZJ 4UOGA 3ENWA 3PIPQ 1KS2A 2CWKA 2H3EB 5LIAA 5D8HB 3OL9A 1NSKL 2B6AB 1S9GA 1VRQC 3G86A 2LU1A 3OHBA 1VRTA 1U1KA 1FRXA 3LP1A 2YWKA 4WTOB 2K2PA 2N7YA 3E8OA 4PQUA 2W8LA 1TMMA 3ED4A 3T5HA 2KN4A 1Y00A 3KLEB 4P9SA 4CCHA 4OI4A 3TAMB 4NLWA 5KTQA 3PRVA 3DOKA 2D1CA 1S72S 2WCXA 1VQPS 3MPVA 2GAGC 2LQ8A 1VQ6S 4DV7F 2HURA 3QQCD 4YDDB 3UVJA 1WSRA 4LF8J 3T02A 4C0HA 3KK2B 1OQ3A 4CO4A 3EZUA 1Q82T 2I38A 3UN2A 1HWLA 5JVGQ 4WBFA 4NLTA 3Q8SB 4PWDA 3D68A 4M5JA 2HIQA 4ILRA 4FF4A 1FNXH 1C0UB 1HD1A 3DRPB 3SFUA 3W64A 3EPGA 1Z4UA 3JYTA 4FYVB 1JLQA 2VD3A 2BJ9A 3GFXA 3R9LA 2BZ2A 1HNIA 1T11A 3BDGB 1PYSB 3ADAC 2MQNA 4XDCA 4PCQA 3S6EA 5ETQA 3ET6B 2E5JA 3L09A 4NLPA 2BANA 2C3YA 3OXGA 4Z2XA 2MKJA 2P9EA 2CKWA 4LFBJ 4LF4F 3DU5A 1JWWA 1FFSB 2R8IA 1RYRA 3D0IE 3RRHA 2JC1A 4OZ2A 3CSKA 1H74A 3M4XA 3HP6A 2VFSA 2CQ4A 3DXBA 2HNZB 4MYTA 2QJ3A 1S0VA 2CG4A 3RBEA 3I5BA 4X4QA 1FJGJ 5KG4A 2VQEF 1IM6A 2ZH7A 1UCNA 3IDDA 2R8HA 1F3VA 3R8YA 5CXTA 3BDHA 4ER8A 2G0CA 2WOMB 4Q2MA 3NKPA 3WAWA 3IN5A 2HFVA 3OLBA 2VFTA 1SJRA 1D9DA 5LJ3Y 3LGMA 1ZA1B 2MHNA 4UW2A 3CCZA 2ZVIA 1DQ8A 1ELYA 2O1PA 4RX6A 1J2VA 2RQKA 4ZPDA 3N5BA 2J9DE 1C2PA 2WVDA 3WIVA 1GFWB 3HVRA 4A8MP 4DFKA 1GXUA 4Y0FA 1AZSA 4B3TF 2CQHA 3K5MA 4LF6J 2E1RA 4DS4A 1H38A 1UVIA 2HHQA 4CLTA 2BOAA 4PZVA 5K8PA 3D3CJ 4F7VA 2HZCA 4L3NA 2HEKA 5K4PA 2J76E 4CWBA 2SXLA 3EJMA 1S49A 2E5HA 1XWLA 3A8IA 1JLCA 1S12A 3IBCB 4PYDA 1DAXA 1HIYA 1YJNS 1HJKA 3RR7A 2KI2A 3L4BC 3N0VA 4FNHA 3JSMA 3MOJB 2KHDA 2A1BA 3PW4A 3TEHB 3M05A 1V5IB 4B9UA 2CUYA 3PJXA 1MMNA 2M0GB 4WU2A 4QAXA 2M2BA 3I0SB 2AD9A 5SZTA 3W62A 1HBMB 4EMDA 2QSWA 3A52A 1NHVA 1FFGB 3OBIA 4X4VA 4ED7A 3EZ5A 3MZIA 5HQMA 1FKOA 5HBMA 4XIUA 2CJAA 4DR5J 2RU3A 2QA4G 4M5IA 4DDFA 2F5GA 2AYMA 1LK5A 4ZDNA 2KG0A 4PEOA 1GAOA 1JJCB 1ZH5A 5H1SV 2V68A 3CO9A 4PXBA 2ZEJA 3CVKA 1H3DA 4C0OC 4M5MA 2DNZA 2CDQA 2IUCA 3OFFA 5EX3A 2VQFJ 5DLTA 3TX8A 1VK8A 5ITHA 2W2OP 4WZQA 4GTZA 1B4SA 1N54B 5F8HA 4OI6A 4NA2A 5A0YB 2WB4A 1WF0A 4R5PA 3OQ2A 4ZN3A 2V2ZA 1L3TA 2HQ3A 3TR5A 1DLOB 3WHIA 4F0HA 2FGCA 3MR6A 3VAHA 3QRPA 4KJIA 5KT3A 2WBRA 5CH7B 1WHVA 3RTVA 5AXMA 3VGSA 1OY6A 2IAJA 3KLHB 2Z4PA 4UOOA 3HT0A 4QWCA 2DHGA 3HSJA 1HNWJ 4TXSA 4YFUA 3T01A 3H20A 4ZCIA 3L3CA 4YB6A 4C11A 1NM2A 3HHNB 5HVFA 2XYGB 5KFXA 4CLFA 3IP0A 2GGPA 2KYZA 2Z2ZA 2OD4A 2UXBJ 3QGIA 4RUBA 3NMRA 4QIEA 4LSNA 1RHUB 3QLHA 1T03B 3SZ2A 1XQIA 2DGQA 1NJZA 1NK9A 4OQJA 1XMOF 5GMDA 4ECUA 2PC6A 3KNGA 3G71S 2XYPB 1RWNB 4ENOA 3KLVA 4B3OA 3QT8A 3KLIA 2A3JA 1IM4A 3M2RB 4CYSA 3CW2C 1LWFA 2HSEB 1U48A 1ZAXA 4DPXA 4F25A 4C6AA 1YBUA 3KHRA 1NZ8A 4RNOA 1Q53A 1QAIA 4Q2LA 1TFWA 2YBVA 3PJ9A 4W90B 2GZOA 2LQBA 3IO1A 1VHFA 2DGOA 1UZHA 1APSA 3MEDB 5HO4A 4F50A 2JDJA 2KZZA 3B5QA 2V4QA 4LIRA 3IGYB 2ZD1A 5L46A 2RB7A 2QIFA 4RZRA 2XY7A 4DSJA 3IRWP 3L9ZA 5HL7Q 4FXWA 2DNQA 4F26A 3SCKE 3GCWP 2ZJRQ 3SBMA 1XK8A 2WOMA 5ETNA 3FQLA 5IQ6A 2LXFA 2YNHB 3BKTA 2ZBQA 3G96A 2DNHA 4E2FB 2MQOA 1Z1ZA 5B0BA 2MYFA 1MMLA 1HMVB 3F73A 4ED8A 1EJJA 3M2UB 3D1QA 2MKCA 3K59A 4DZ6A 2D3O1 4B3MJ 1IXKA 4A8SA 3T3FA 5HJXA 4JI3F 5A2QU 4HLBA 1X4EA 3BH7B 4IOAQ 3M6XA 4NLOA 3PYGA 3CJSA 1U45A 2B4UA 1N34J 4OMFG 2LXIA 3L7OA 1QSLA 1GTHA 4P7VA 1F0XA 1SQEA 1J5EF 2HGLA 3PFEA 2G0JA 1SJQA 4MIBA 3OFEA 2HHTA 2OIHA 2BJ1A 1WDDA 3KMQA 2ZNZA 2J9EA 3AH6A 2G2OA 5ETSA 1VQOS 2DNOA 3AOBA 4H54A 2IVFB 4ECYA 3MM5B 1SKSA 4A46A 1VISA 5KFTA 3BGLA 2V8PA 4I2QB 4Y65A 2QMUB 2Q66A 2DGUA 5GMEA 3M32B 3UD4P 2VUGA 4K5SA 2DPJA 5D0GA 1NK0A 3GG1A 2MKYA 3BO3A 2I1RA 2FLOA 2UV8A 3HHKA 3R97A 2QGFB 2UUBF 3IR7B 1G1XA 3TUPA 1M0SA 4UORA 7FDRA 4LBIA 3H90A 2GSOA 2AYBA 3N01A 1K73T 4J91A 4WIQA 5I4MA 1ZS6A 1TKTA 3CC7S 1LWEA 2ZWPA 4USJC 4ZCLA 2VFUA 1YHQS 3D28A 3WX4A 2KL8A 1N33J 4ZLPA 5IV3A 1I94J 2MGZA 2CRLA 4KO0A 2CQ0A 2V2KA 4KPYA 1RT6A 4FBUA 4E0DA 4ZS6A 5M2PA 5HP1A 1WC0A 4QOTA 4KGMA 3DI6B 2Q1LA 4DR2F 1AJDA 5AXNA 4C4WA 4O3NA 5C5JA 2D9PA 1DJ0A 3MPUB 1AUSL 2IBKA 1ACMB 3IAS9 4RW8B 4DPTA 2V8VA 3W8PA 3DU6A 5L0KA 4X84A 4WK3A 3M30A 5KAKA 2NXCA 2NYHA 2C42A 4ED6A 1LXJA 3OR2B 2VPWB 3EWGA 3QAUA 3DLHA 1H2TZ 2QLBB 1RTDB 2P9GA 1CULB 1XERA 1I6JA 1ZTTA 1FI4A 2VA3A 3LP2A 2EFVA 4NLQA 1WHWA 3QGHA 2J0QD 1NK4A 5F41A 5L39A 3NGTA 2CADA 2EK6A 2BJ7A 3MK2A 2B0GA 1GX5A 4LR2A 2PIIA 5I3PA 4YB5A 3BS9A 4MT1A 4K8RA 1RAAB 4HDHA 3BPSP 2ANHA 5JUMA 3OL8A 2JVOA 1AUDA 3RW6A 1AJCA 1YZ6A 1WUUA 1PCAA 1IKXB 3VVUA 2GIQA 2CIMA 4DQRA 2RD5C 4DV4J 4NL5A 4IDKB 3FUYA 1KD1T 3TANA 2W9BB 5L0EA 1N8RT 4PAAA 3DLEB 1U0SA 3RBZA 1T03A 2WSFC 2RRNA 3I96A 1WWHA 4ZG6A 2IJFA 4W92B 5D3GA 2QMXA 2HHHF 2VHGA 3OTEA 2GJ2A 4USVA 2JEGA 1TL3B 2ZH5A 2IM3A 1WACA 7FD1A 1X5PA 3GFHA 3N9UC 1HQUA 1NJXA 1EZZB 1CS4B 5DDOC 4NXNJ 3TQ1A 3CUNA 1DHMA 1WF2A 1NHKL 1KC8T 4ZKAA 3PACA 2RAQA 1S4EA 4ZITA 3DDIA 4J9PA 4IRCA 5F3TA 2OEMA 3HT3A 1T7PA 4B02A 4QWEA 2EFNA 2YPZA 5HSPA 3QZ8A 4QWAA 2W5VA 1WC4A 2MSTA 1UMJA 4NLSA 5IC6B 4C0BA 1IBMF 2X98A 1S4FA 3DOLB 2RF2A 4P73A 3RB4A 3ZZ0A 4GO7X 4O0IA 1EIYB 4BDPA 2IDEA 4MIAA 2OPRB 4NLGA 3CMRA 2BJ8A 2QLFB 5CCMA 4LSZB 4NRTA 4RU9A 3A1YG 4EEYA 4CP5A 2DGXA 2ZDPA 3Q8QB 1EI6A 1X0PA 2BDPA 3L95X 3PM9A 4OL8A 5KFPA 1UPPA 4I69A 2IM2A 3GYNA 1UVLA 2RIJA 2E1CA 4C97A 5DETA 3BBCA 2B9XA 5DDPC 4X4NA 1VQKS 1SIWB 3JS9A 1FX4A 1REVB 2B5JA 4KAIA 3X3UA 2ALZA 4LR9A 4O0NA 5J2QA 2GX8A 2KVIA 3HI9A 3I82A 4N41A 2OGUA 4NCGA 1Y7PA 1PYOB 3T1YF 1F5CA 1IR2A 1Q5VA 3FBCA 1MW7A 2UUCF 1HFEL 2LDIA 2HNYB 4LR7A 1KH4A 1LNQA 4HEA9 2D74B 2BM0A 2AGOA 1RHKB 2HKEA 4ID8A 2AJFE 1E6VA 4K7QA 2E44A 1VIXA 2HVDA 1IKWB 2ZH8A 4M5GA 1JLAA 2FJWA 1FFWB 1Z2ZA 4R8UA 4LRFA 2WW8A 2XZDB 4TLQA 3OL6A 2KTQA 2ZITA 1TKZB 4UQGA 2RH6A 5D4LA 3THVA 2MKKA 4DV1F 4DV5J 1RBAA 3CMQA 2XO6A 1OIAA 1V6HA 1KQSR 2YNIB 1RU1A 4NWBA 4ZLJA 4X64F 2JFDA 3CDAA 1VQLS 5C2GA 4KKOB 3CIMA 5F8MA 1FEEA 3FBBA 2DH9A 5KFBA 2ACYA 4JYAF 5T14A 1VGYA 2V63A 1WEXA 1DTQA 3NEKA 4ED0A 4OX6A 1EHWA 1R8PA 2YWGA 1PAEX 2ASLA 2YX7A 2VG5B 3QWUA 2BE7D 2UXDF 2DNLA 2GV1A 1RHMB 4NLXA 1EQ0A 3AD8C 4DFPA 1S0MA 1NEEA 2FLPA 2CJKA 5KFAA 4NLYA 4LFCJ 3P4UB 3PW5A 1HBNA 2A18A 4Y34A 3LQVA 3I9ZA 1XBWA 1N32J 4LF5F 5AE2A 3AB4B 3FGVA 4CRJA 5D6GA 4XPEA 2C2ZB 1TV6B 1QTNB 1U02A 2BE9B 2KFNA 1SH0A 2CPHA 1IKYB 1A7GE 3ONQA 4U96A 3DLBA 3HFZB 1KHKA 1NRKA 4OV1A 4CZCA 1S5ZA 2I2YA 4M1KA 2M4MA 1EETB 1MWQA 4DF4A 4UPHA 2V50A 2HFZA 1T0TV 2YH0A 4ID5A 3FBFA 3EDRB 4OYPA 3OTOF 2H5JB 2JHEA 4TQRA 3M1VB 1J27A 1S9EA 2OSRA 1WEYA 1VHIA 4X66J 2RRAA 1QY7A 3JQJA 1BWEA 2IJNA 1UA1A 4CLPA 1MNEA 2CDRB 4OHWA 2W2QP 2HMIB 2Q6BA 3UR0A 3KK3B 2D9OA 3BQ1A 4NXMF 4MKBA 1WG1A 2AJQA 3T9NA 3MM6A 2XSFA 2C2EA 2FY8A 4DUYJ 3LAKA 3ENAA 4IG3B 3K5NA 1JXLA 4I67A 2LQJA 1NK5A 2KDOA 4ECRA 1S1WB 3C6UB 4NZ6A 4LF5J 3DKDA 3M8QB 4PRFA 5ETVA 4OYWA 4Q44A 3EXYA 2CQPA 3D2WA 3QGPA 3DOLA 2LECA 2E9RX 2DH8A 4ANEA 1H72C 2ZH2A 3MCOA 1QVGR 3WX8A 4NA3A 3G6XA 1HPZB 3GIJA 1NKEA 4DL0C 2P9CA 3HDSA 2D3OR 4ZP9A 3VR1A 4RNFA 2G1HA 2R3VA 2ZE2A 3E3XA 3OR1B 2FY1A 3J7Z5 1RT1A 3AY0A 2YH1A 4NEYA 1ZAVA 4R0EA 5TJ3A 3I9V9 2HHWA 2OO4A 5ETMA 2L9DA 1HW8A 4TY9A 2QYGA 5L1JA 1RAEB 2P5VA 4KFBB 1ZEBA 4LQ3A 2EFPA 3DRSA 1U8WA 2MLXA 3O44A 3CC2S 3MM7A 1RT5B 2C28A 1YJWS 5A76A 4ANCA 2V4JB 2RUGA 3NBPA 5CA5A 2MKHA 3IG1A 5DZ7A 1VQ8S 1EW2A 1CJVB 3G82A 4HYKA 2LP4A 1X5SA 1MN7A 3CCWA 3DC2A 2DGVA 2ALYB 3CE8A 2ZHOA 3U1MA 4XAKA 3NP5A 1FERA 1LXNA 2F1FA 5IFMA 1D0EA 2MY8A 3LANA 4K4TA 2CJYB 1RWKB 1H2VZ 4DJBA 1S6QB 2Z2MA 1WC5A 3K8VA 2DO4A 4IG0A 1WHXA 3JAMY 3ITHA 4EBCA 1BQMA 1VIOA 3TZWA 1MMDA 3HSGA 5KG3A 4H4MA 1EJ7L 2QLJB 4FZVA 4HL9A 1D8ZA 2YPYA 2FYXA 3CJTA 1FE0A 1H6KX 1TKZA 4ZPTR 1VC0A 1RAIB 1UW9A 1H0HB 1LK7A 3KJQB 2EFQA 4B08A 2ERRA 3ZC4A 2UU9J 3BKUA 3HVTA 4JV5J 2W25A 5AT1B 4JI8F 2IFXA 5C25B 2ATCB 2QO3A 4JI5J 2D3UA 1KLNA 2BJDA 1Y5NB 2BJEA 1K0VA 2W5XA 1RWUA 1VYAA 4BHQA 4MKVA 5LM7E 4GC6A 5DQIA 4C9DA 4RBVA 4DQQA 1B70B 4UQTA 1RXOB 2CPIA 5A8WB 3MTJA 3IS9B 3ZNJ1 1VQYA 1SCJB 4GVBA 1CJKA 2WW4A 2XCPA 3RR8A 3AB2B 2I5JA 4R0JA 2JOQA 2GNKA 4TQSA 5A6PA 3RAXA 1RT3A 4OX8A 3G4SS 2MQ8A 4QU6A 3AA8A 2HLUA 4RPFA 3BGFA 2RDJA 3CJ2A 3IWLA 4EBEA 3MWBA 2HHSA 2FD2A 1OSDA 3C66A 4CQ1A 4IKAA 2VKZG 1JLGB 1UW4A 4TY8B 4Q5VA 4CLUA 4YY3F 5FDLA 2CPDA 4EUVA 4AD6A 4A8KA 2J0XA 2Y0SD 1K1SA 3UO0A 1RWWB 2UUWA 4MIWA 3R5GA 2V67A 2DYAA 4HVZA 2NCKL 4B17A 4LF9J 5G0RA 3N6LA 1FSUA 4KV8B 1MWZA 2VFVA 1M5HA 3NS6A 2HHUA 2W9CB 4DLGA 2VQRA 1KWMA 4DF8A 5GVQA 4M5DB 3AD9C 4GTXA 3D6FB 5D15A 3QRRA 3DLKA 1ZA2B 1ZAWA 4BC9A 4I7FB 3V4IA 1IN0A 2LQ5A 8ATCB 2UXCF 5J1EB 1FRLA 1N5QA 1B7YB 1FXRA 2NUHA 4LR8A 3BN7A 1KQKA 3PKYA 2DCUB 4U95A 2QL5B 1C0TA 1T9XA 3K5PA 5ETKA 3O5TB 1GXLA 4RW6B 3FCHA 1RWPB 3NNCA 1KONA 4DN9A 2GIFA 5LL6d 4DMZA 1N6QB 1HI1A 1NO8A 4UPKA 4FDIA 5LMNF 3LP0A 4IH5A 2OAUA 1JLFA 3Q24A 3DMJB 3MM9A 1R8AA 3OD2A 2GO8A 3R7BB 3M2VB 1FESA 3J7AN 2W2NP 4RJVA 2U2FA 3GTYX 1XNRJ 2NXNA 4NWJA 4ILMA 4P2FA 4CXUA 4ZOSA 2VV5A 2DHAA 2X51A 2XBPA 1YRXA 5LJ5Y 2J6TA 4J9SA 4MFBA 4YQWA 3IXQA 1TL7B 4RW9B 4KSEB 2M8DB 1D9AA 1AFJA 3C14B 1P1TA 3S7RA 1SJFA 2W5WA 2BR0A 1URAA 3HULA 2GO9A 2N4CA 4F4XA 4OX9F 4DX8H 1X0FA 2V0NA 1RTHB 4QPTA 4KHPJ 1U4BA 1RTIA 4JI6J 2KO1A 1RWVB 1LFPA 1FCAA 5E3PA 3CWJA 5C24A 4J37A 4Z7YA 4DEZA 2K1RA 1QM9A 3M6VA 2MPUA 2POKA 4QWBA 1ITPA 1X4GA 3J7A1 4ECSA 1S6PB 4USIA 1N5YA 1PYTA 4Z37A 2VPYB 1RDRA 3H5YA 1X9WA 3V6KA 2KT5A 3HXMA 4KFBA 1SL1A 1L3KA 4TN2A 2DY9A 2AU0A 3TZZA 3G6YA 2VG7A 2H54B 2VICA 1RLDA 2YXLA 4B3SF 2KFZA 1JQGA 1SXLA 4RR5A 2BQUA 4NCBA 5C7PA 3OSNA 3UDLA 3ZTQA 1S57A 4CLZA 2HVHA 1BY9A 1U0HB 1YJTA 3FFIA 3BDPA 2FVQA 3UWTA 4F4WA 3UE2A 5ETOA 4U9RA 1U1OA 2OTJS 3HK2A 2GJFA 3AFGA 4WE1B 2DXEA 3J80Y 1ZPWX 2OPQB 1UFKA 2HFNA 4IR1A 2HAFA 2GCFA 1NPKA 4LQ9A 1AW0A 2YTCA 2HQCA 2IA0A 2ZH1A 2R7TA 1DURA 2ROPA 3A12A 1MROA 3PX4A 4CLKA 4DR1J 3BO4A 1HNZF 1HYSB 1Y10A 2H48B 4Y2KA 1PGZA 5KG5A 3JTPA 3GV7B 3FQKA 2X3DA 3Q2SC 2ROGA 1ROFA 4L74A 1RWOB 1SKUB 3EYZA 2F7VA 2J9DA 1QLNA 1RU2A 1HNVB 9ATCB 4CTAB 4EO6A 1QJHA 2DNYA 4MHXA 5H9EK 1YSJA 4GKKF 3K0JA 1F9HA 1RISA 3R7NB 1R89A 2R9LA 4FF3A 3L7PA 4F3OA 1O8BA 3IGZB 2WVEA 2V2VA 4I4BA 2Q43A 4B3SJ 4ZG7A 1UVNA 2DNMA 5EN1A 5JJBA 2OEKA 4TYBA 3WC2A 1NLKL 3MDFA 4LFAJ 4LQYA 4PQAA 4IH6A 2LQ9A 1C1BB 3DM2A 3T1HJ 4JP8A 2MB0B 2GAHC 4Q43A 4F0KA 3V2UC 3PXGa 4Y00A 4OHVA 1AT1B 1RYSA 3NRBA 4MIVA 2DVIA 2X1AA 1V3RA 4WF9Q 2Z0GA 2WBMA 5DDQC 4TVAB 2LFVA 1W26A 3HJFA 3MI7X 1GMWA 5AJ3F 4QIFA 1DTTA 4Y2AA 5KFYA 3IRXB 1T8EA 3HZGA 2X3GA 1HNZJ 3FDSA 5B7WA 2HWIA 2KU7A 4I0WA 5F0WA 2IYGA 1VQ5S 5HVHA 4P2XA 2AYEA 2EKYA 4O44A 1PAUB 3VHQA 4J90A 2MTLA 1KTVA 2VDHA 3IM9A 3M6WA 1WF1A 4WIIA 2W5SA 3RGIA 2KXFA 2QN6B 2WONA 1FHTA 3W2WA 4USUA 2VOPA 2EXUA 3DYAB 2XR9A 3HHLD 1L3VA 3ISZA 1KHLA 1VLYA 2HBRB 3DN9A 1H98A 4RNHA 2WSCC 5LMUJ 3JQKA 4CM0A 2CZVC 1Q5YA 2B56A 3MK0A 5A8RB 1OPIA 2ASDA 4HDGA 2KVQE 1SL2A 4S0MA 5FLXY 3CCES 5ETTA 1U09A 4C8NA 4NMLA 3SQGA 1HNXJ 3LA0A 3HFKA 2MJUA 2V34A 3DDNA 3LALA 1TL7A 2LA6A 3H59A 1XNQF 4Q45A 3CNQP 4P75A 3N28A 4J9LA 1PC5A 4HACB 3ZZYA 4TU9A 4NX9A 2BACA 2JVRA 5HMWA 4O4RA 1RT2A 1MLAA 4GVLA 2XS5A 1WKJA 3CCRS 3CULA 2XY5A 2AW0A 3JSYA 4FXVA 3TJAA 4M95A 2DRAA 3AJ2A 4FXDA 3IR6B 2AF6A 2YQ1A 2QLWA 2W7PA 2E66A 4ZP8A 2ZZNA 4XK8C 3MAAB 4G3IA 1LW0B 1Q8IA 2R2UA 4F4KA 3T41A 1FRJA 4HI1A 5KFWA 5J2NB 3PO4A 4MH8A 2DO0A 3PYDA 4HKQA 2OKQA 5K9FA 5F8GA 3MFHA 2MKSA 4LF7J 1KHJA 2YNGB 3MK1A 2LXUA 4H4KA 3OV7A 1S7IA 1S1UB 3A4TA 4UPLA 4GKJJ 1OYEA 3PRBA 4FYYB 2J7KA 4C8OA 2B51A 2JSXA 4G6VB 3Q89A 2JWNA 3ISNC 4JI0F 1IKVB 3W63A 2E5IA 4YUDA 2R7RA 1YX2A 1I1GA 3T5JA 1KEKA 1U0HA 1U49A 3MECB 3Q23A 1RKIA 4NYOA 2HNDB 1JXEA 3MR2A 4OYIA 1BGXT 1YK9A 1FNOA 1VRTB 1XMBA 2KYXA 2KT2A 5KG7A 3LP1B 2IIHA 4KQZA 1G2EA 4PQUB 3EE3A 3JTOA 3W66A 2J0SD 2H4YB 2F4VF 1UFLA 1E3CP 1NBEB 2H51B 4QU7A 2P6SA 2W9AA 1D8YA 3SFGA 4BWJA 4CNYA 1XMQJ 3DOKB 3AOAA 2XI2A 3AXMA 2C22A 1N2LA 3DOMA 2XQCA 3IMQJ 3V5RA 4CLSA 4IYQA 3UVJB 4QJVA 1M5VC 3GB0A 2CVEA 2XMMA 3LWLA 3W1YC 3SZYA 5CYQB 4DL2A 3DHXA 4ZCMA 4O3OA 3HSZA 4KM4A 2RVJA 2N4DA 4PWDB 2XTJP 3Q8YA 2G0IA 4JI1J 1B7FA 2C3OA 2HLTA 3JYTB 5HN0A 1JLQB 4JBCA 4CLYA 1HNIB 2G13A 2NLWA 3I87A 1HQEA 3H25A 4HR2A 2R7SA 1QAXA 1NSPA 3H5UA 5AE3A 3VAJA 2RMLA 2QTWA 3KJNB 4PWUA 3SCLE 2BANB 5IM0A 3MAQA 3R2DJ 3IWXA 1IVZA 3KD8A 4Y2CA 2NUUG 1ZM2A 5BR8F 3I5CA 2L9WA 3PR4A 1YBAA 4H4OB 4IQMA 5H9FJ 1H7WA 3QZ7A 2VDIA 4P74A 2KXNB 1K8AT 3VQSA 2RQCA 1WC1A 1ZEDA 2C2OB 4UOPA 4F0MA 1AA1B 1FRIA 5C66A 5DQGA 4RNNA 1X4DA 4OZ0A 4X62F 1LWCA 1LKZA 4ZPBA 1ZETA 5K5MA 2B8PA 1OYDA 3TA1A 2HRTA 1SJ3P 3KWMA 2BUNA 1QUVA 2VKRA 2BW7A 1Y3KA 3D66A 1NSQA 2ZH3A 3TUZC 2RSQA 3UDCA 2CXEA 3IGVA 3NG8A 4HHHA 3FKBA 3O6QA 6FD1A 1T95A 2Y9HA 2R7UA 2VH7A 4OX7A 2YX4A 4OYAA 4LMZA 3I5AA 1UTAA 5C42A 5KFGA 3H42A 3U1NA 4YB1P 2HFUA 3TUIC 2AWZA 4ETZA 4KBIA 5A8RA 3AQOA 4A48A 4NLDA 1PJ6A 4ETXA 2E5GA 3CEDA 3RB3A 2L3MA 2DGWA 4OZ1A 1KR4A 5HMXA 1ELOA 3TG0A 4YMEA 4K4UA 3E01A 2WB1D 1JLCB 1URRA 3QO9A 3C15A 4I68A 5I42A 5HMYA 4DPWA 4WJBA 3PO5A 4DR4F 4HACA 1HR0J 3JSMB 3KK1A 1RP5A 1XEZA 4NASA 4BC7A 4PG8A 2CJBA 3LAMA 1YDLA 2YVSA 5D4NA 1U1LA 3NKRA 1PKUA 3HX9A 4GC7A 5DDRC 2W01A 2J8SA 1JKHB 2M8HA 5KFMA 2PI4A 2LEBA 4G1QA 2DTJA 2Z2LA 1H2UX 4K0KF 2ZH4A 2VC0A 3KKFA 3QGGA 2AEFA 3RU0A 1S77D 3HZEA 4DV0F 3DLJA 1FKOB 2Z56B 1W25A 4OIXA 5HBMB 3GFZA 2D41A 5KG0A 3PHTA 2PA3A 3HKZD 1RKJA 3OSPA 2OP5A 1Q86T 4FN5A 4KR0B 3H5XA 3F41A 2IBOA 1O98A 5M2RA 3OXLA 1VBZA 5DLFA 4YS2A 4ECWA 5E3QA 1IBLJ 1SQGA 1I3OB 5AXLA 4DCPB 2CPZA 3BSAA 3BBFA 4V19J 1P49A 2VBZA 3MFIA 1NCLA 1TK0A 4W4MA 4B3RJ 3BREA 4NE9C 5L1KA 1YJ7A 1C4AA 1BQNA 3BEGB 4OHYA 1R6VA 1UEVA 4DR3J 2MQMA 2MZSA 3C8YA 2B9YA 2KT3A 2H5EA 2K8GA 4ZVFA 5KFRA 3CJQA 3ZZRA 4DV2J 3C2PA 4DV6F 3NKQA 2CFXA 1GMVA 2YKOA 4RNMA 4R5PB 2B4OA 2C1EB 3QATA 2YQ3A 3NNHA 4G65A 5LQQA 4RO0A 2MY7A 3B82A 1JJHA 3VQTA 1M1KT 3VGUA 3GU0A 2HWTA 2IAJB 2XSJA 1NDKA 4BWMA 3EGZA 5L1IA 2AGQA 4ZIWA 5CD4H 3GILA 2AT1B 3RBDA 1IR0A 3TARA 2DH7A 4N76A 1WI6A 2XLKA 3NGUA 2NXEA 2YNFA 4MKAA 4C11B 1N36J 2QL7B 4K0KJ 1WTBA 7AT1B 4J9QA 1FKPB 2FJBB 5A6WA 2EFOA 5CYQA 1VQ4S 3UD3P 4X4TA 2JLGA 2GGPB 4X2BA 3ICLA 1RBLA 2BE2A 2PT0A 3CDEA 4PPDA 2MZTA 2QE5A 1X60A 4LSNB 1T9UA 1HWUA 3QLHB 1T3OA 4KB7A 3CT9A 3VGTA 4ECQA 2M7SA 2UVWA 3A3PB 3GE9A 1M5SA 3AODA 5K8MA 4B3OB 1KVJA 3KLIB 4PXEA 2RRBA 1EB0A 1RWXB 4DU7A 1IBKF 4JB8B 4JI4F 1AUKA 1N5SA 1LWFB 3W2VA 4JV0A 4FBTA 4EYIB 4AQYF 2EVZA 2IM1A 1VJWA 4H4OA 2APOA 4YR3A 4IFVA 1DY3A 3VF0B 3KJVA 2DY1A 4MK7A 1TAQA 1TVRA 3HJVA 3MR3A 5GADI 2DD8S 1EX8A 5KT2A 1G3OA 3FNNA 1G6BA 1VQ9S 3PW0A 4URQU 3EGNA 2ZD1B 4YDXA 4JI7F 1QE1A 5DGBA 1VCTA 3MHYA 3LGHA 2XI3A 3C46A 3BV8A 3OFGA 1AFIA 4UOFA 3IC1A 4K4WA 2R2SA 3GSIA 3D67A 2JLEA 4DV7J 1RGVA 3OTCA 2BQRA 3K5LA 2AX0A 4NZ0A 3T5KA 1PSDA 5SUHA 4QBUA 2CPFA 2XS7A 3FSXA 4CIOA 4DN0A 2GSNA 1JLEA 4M5KA 1DBDA 3CXCR 1Q7LB 1Q81T 3BJYA 4OI2A 3M6UA 4UY8T 3PV8A 1P9QC 1Q8LA 4DOZA 1RAOA 4NCAA 5E3CA 2G2ZA 1ALKA 1QDUB 2W24A 3G8QA 5HRTA 3H7HB 3GV8B 2R7WA 1UP1A 4DCOB 2FVSA 1X7VA 2PEHA 2CZ4A 1G4CA 1DQAA 1OS5A 2QZUA 3BQ2A 3Q3QA 5K14A 3T00A 5EWFA 3DGPA 2W8DA 1RJJA 4LF4J 2FIUA 5CYMA 3QT6A 2LA4A 2W2MP 3BDFA 1VLOA 3H0PA 4HT7A 1S1TA 1YITS 2Y1IA 4ZP7A 1S1VA 4I6WA 4YHHF 2MKIA 2FLNA 3ILJA 2NPIA 3AOCA 1Y0HA 1TKDA 3I6PA 1RTZA 3HVAA 4OYZA 5DZ6A 4Q8FA 4PG7A 4JI7J 2NR0A 1NJYA 2Y8WA 1FD2A 2VQEJ 2EBGA 3P8BB 2IFYA 2LDYA 2AKWB 4B9LA 3V81A 3D1HA 4WXWA 3MUTP 4E8UA 1JKHA 2XG8A 1GMUA 3CCQS 4IH7A 3MCNA 1LW2A 3OTDA 5DM7Q 1RTJA 2PMWA 3LWMA 1X4BA 4DR7F 2D3ZA 4USHA 2MXYA 3GIMA 3GQCA 4L72B 5CZVA 2YQ0A 1TUVA 1SHNA 3G2XA 1TKTB 2HGNA 1WC3A 1LWEB 2FVPA 3UI3A 1FWPA 4B3TJ 4WKYA 4GO5X 3EGWB 5CCLA 3GIIA 4YR0A 2XB2D 4CH1A 2BJ3A 2C2KB 3CMAS 2YWWA 4K4ZA 5DM6Q 2JZ5A 4CO3A 2MGZB 4ICLA 1P27B 4KO0B 1Q79A 2V6AA 3NWGA 2XWYA 1RT6B 1KQFB 4MYUA 1HA1A 2ZM6F 2C3MA 1X5TA 2B7BB 1FDBA 5IQQA 5HP1B 1GT8A 1CJTA 3SDEA 1ELZA 1UETA 1XTZA 2VG6A 4Q8EA 3DXSX 2K7KA 3AAWB 1N5VA 4KJDA 1ED8A 1GH8A 2E5LF 1S10A 4HT5A 3M30B 4B9SA 1UKUA 2LLZA 1X4HA 5IOLA 3DLGA 2F8HA 3V6DA 4IO1A 5E0OA 4K4XA 1V3SA 3CMES 2D69A 3OL7A 2ZBCA 4K2JA 3HD2A 2V8HA 3LP2B 1Y4ZB 3VTIA 5HROA 3KJFB 2C2DA 2M52A 2ADBA 2GMJA 1RADB 3VAIA 2JH3A 4PXDA 1VRUA 2CPYA 4I2PA 1FKPA 4NRUA 2Y1LB 4MY4A 1ZTWA 1VQSA 4DFMA 3U1LA 4JUZA 2JL9A 5RUBA 3MEEA 2OTLS 4F02A 3HO1A 3OLAA 1BC6A 2K7JA 5KFOA 1VQ7S 1E33P 2FZKB 1D09B 3NCPA 4LBPA 3BR8A 2N3OA 3R7SB 4C3MA 2HPUA 2DNKA 2COLA 2ROEA 5D3GB 3C6TA 1KVKA 1HKAA 4IUFA 1WOPA 2HVEA 2RU9A 2VOOA 4DSKA 3D6MB 1NB7A 1C1CA 1A6LA 1ZM4A 2VASA 3KUEA 3GPAA 1NU4A 1YTYA 1S0NA 2PI5A 1HQUB 2Z57B 2ABYA 1SQFA 1RBOB 3NMAA 3MMBA 4OYOA 4RW4A 4MKYA 1TELA 5KG1A 2IRYA 1U1MA 2UUTA 4KGKA 2CQ1A 1F5BA 3IGNA 1KFDA 3QIPA 1CSJA 2LKZA 2HYIB 2R7OA 3ZTSA 5J2MA 3ZZTA 1E2SP 4DL7A 1CC8A 2CNLB 2LEAA 4HH1A 1XR5A 2FJDB 3TQEA 3TJ8A 4ZN1A 4O3RA 2JJ4D 4FDFA 1WI8A 2RF2B 1UVKA 3AD7C 5IWAF 2ZOGA 1JNRB 3ILOA 5BJRA 2ZUAA 3D3BJ 5HJYA 4Q0BA 1TP7A 1K7HA 1PIEA 5T41A 4OJ3A 2NREA 3DYCA 2A2DA 3GJTB 3KUGA 2QRRA 2OPPA 3K5OA 2H4WB 4X65F 4NLUA 3JSRA 3FBEA 2ZC4A 2NPFA 2W7OA 4OV6A 5IJSA 3HM9A 4OZ5A 5F8NA 1MU2A 1Q4RA 2DHXA 3CDWA 2FC9A 2OSQA 4ZG9A 4FP9A 1W7WA 3D7SB 3CCJS 2ATLA 4DU8A 3HHLA 1XMOJ 2E7WA 3N6NA 5M2UA 4NA1A 4KGZB 3H4BA 1F1BB 2XHWA 1DZ5A 4V1Ak 1O5JA 4M8LA 2YKMA 3K89A 2B5JB 2X7IA 2J7WA 4TNOA 5EWEA 2XGQA 2V94A 3W9HA 2MJNA 4ZVTB 3DPCA 5J2QB 3CCSS 4OJHA 2YKPA 2CPXA 3BBBA 3AQPA 2WTFA 2ZH9A 1DFDA 4NCGB 3MUVP 1EKRA 3PEHA 1KHWA 5K8NA 4WCEQ 3N79A 2GMLA 3MMJA 3Q0AA 5F0UA 2KXHA 2B43A 3K2YA 4KH1B 3PX6A 4OI1A 5EDWA 1E6VB 1B0VA 4ZLLA 4IFYA 4AE5A 3TX0A 4WZMA 1SC3B 3POTA 2CQ3A 1JLAB 1Q78A 2KG1A 4R8UB 3Q8UA 5DQHA 1LFWA 4NOHA 4C8LA 3TW0A 2IC3A 2QX0A 3BGUA 3OVSA 3CD0A 3G87A 1RT4A 2EG2A 1SC4B 1YI2S 1GQEA 5HLFA 4EU0A 2FZCB 3GSDA 3VGVA 4PABA 3D6TB 2EWHA 4TKTA 4B56A 3IWNC 2H65B 5KT4A 1HW9A 4CNZA 2ZBPA 1HL6A 2R7QA 1YG0A 3UN5A 4NEZA 4O3SA 2R2RA 4DV3F 1IJFB 1UJ5A 4KHMA 2PFFB 4JI3J 1DTQB 2YWHA 1FDNA 4OHZA 1HI0P 2PN6A 1NK7A 4DR6F 1ZPVA 1SKRA 1M1GA 4RL1A 1RAGB 3PEJA 4CXSA 1J5EJ 2AP6A 1U1RA 3KXDA 2XZWA 1HBNB 4ATNA 4A4JA 3RYLA 2FHMA 5JVHQ 4F8RA 1NB2A 3R6LB 1HHSA 1S59A 2ZNYA 3Q8VA 3O2IA 4M5NA 1AYEA 4Z7CA 3BH6B 4WFBQ 1GMWD 3KG1A 1U6BA 3EVOA 3A3NB 4ZVGA 3S8SA 4AXIA 5GADU 3VAMA 1KHNA 4CM2A 2ZJQQ 1WKKA 4B9MA 1LWXA 3J7YI 2X1GA 3WQPA 3WAVA 4ID5B 2KFYA 5CABA 2UUBJ 2W4DA 1P9YA 5DG9A 3EDQB 4DWIA 1S9EB 1SUQA 1Y11A 2XHCA 4ALZA 1Y9OA 6FDRA 4C8MA 1KLMA 4O3QA 4J9MA 3KNAA 3CJ5A 2XMVA 4ZA1A 1YVFA 4NI2A 4JI2F 1F2GA 4URGA 2BMBA 3MM8A 2LVWA 4RLEA 1W2BR 2C3PA 1JMTA 2LMIA 3G8SA 1G7CB 3TA2A 3O8WA 4EZ6A 1TL1A 3MEGA 2GC8A 2VC1A 2W8KA 3M8YA 3BGRA 2J7UA 2GA7A 4DUZF 4X4OA 1GEHA 2R42A 4FF1A 3LO3A 3AJ1A 1WJ9A 1JNZB 4DR2J 4QIWD 3H40A 3CC4S 3MM6B 2CQCA 3D0GE 1P8GA 2PO4A 5MAOA 1HDHA 3FCWA 4PG4A 2F40A 4IOCQ 3TWZA 2IYIA 2RS2A 3T19A 3FZBA 1B0TA 4KJGA 1U7LA 3GG0A 3LOUA 1BD6A 4ZPCA 2DGSA 2XYHB 3B78A 4LF8F 5L9NA 4OI0A 1AXQA 3MCMA 1PJ5A 5DG7A 2E9ZA 1EP4A 2GHVC 3M8PA 3NGDA 2F65A 1HBUA 2ZFHA 2KHCA 2ZE2B 1NJIT 3HKWA 4QYRA 2GLQA 1URNA 1RT1B 4EI2A 1L5UA 2WHOA 3GWCA 1R8BA 4LSLA 2V69A 3MURP 3H2VE 5CD4A 3KFWX 2B9WA 2GS8A 4Y28C 4RWXA 2IRUA 3BR9A 2DXFA 3DRSB 2HHHJ 2FHJA 5KXAA 3LUYA 3MM7B 2CJQA 1YLXA 2UVRA 2YKNA 3NBPB 4G1PA 3IG1B 4LFBF 2MZJA 3G82B 3J81Y 4USMA 5H9FK 3A8JA 4P72A 2V5HG 3M9NB 1HBOA 1NNDA 4F4ZA 2FJEB 3AHPA 4CT9A 4K4SA 2XMKA 1NHUA 2FZGB 1R0AA 1HWKA 2IMOA 2ASYA 1C4CA 1FJGF 4IG0B 5L8RC 5IT4A 1ANIA 2K06A 3JQMA 3Q2TC 2HHVA 1Q8BA 4WFYA 3ITHB 4ED4A 4F3QA 1BQMB 2ILYA 1IBMJ 1J5OA 2WK4A 1EARA 2DNPA 4H4MB 2DITA 4USKA 2R8GA 2HK3A 5IT9Y 1T94A 1E1ZP 5U47A 1HLWA 1B64A 3ENQA 4N77A 1LQ9A 3MMCA 3U02A 2AGPA 4QPXA 1V5VA 1VC6A 3HVTB 4F2SA 3ULHA 5EX0A 3PJWA 1UWBA 2OPSA 1RABB 4WFZA 2G9YA 3ZNUA 3I0RA 5KG2A 4ECXA 1ZYQA 3Q8PB 3MPWA 1OY9A 4LF6F 4ED3A 3N5FA 3QPIA 2EI5A 5B0AA 1R6YA 4UOHA 4GVBB 1CJKB 1X31C 1WSVA 4F67A 2I5JB 2RQMA 2KKHA 3MR5A 4GRSA 1HWIA 4PUOA 2BBEA 1F6TA 3QFWA 4FKXA 2HVIA 1MWYA 1RT3B 4LJMA 4RW7A 3TNVA 5A8KA 2XZTB 1S1XA 5D0HA 2GHWA 4XPCA 4K4VA 3PW2A 3RZAA 3T1YJ 4FPRA 2XNQA 2FDNA 2UUCJ 3HMJG 3TI0A 3UR3C 5FDLB 2MSSA 1UVJA 5KFSA 2LEPA 1K9MT 2FVRA 1IQTA 3KG0A 3CJKA 2RDDA 1FO1A 3T1AA 3AXKA 1RT7A 4CI0B 2P8IA 5G0RB 4QCLA 2HBYB 3I55S 5J1NA 1WDTA 1CJUA 4RKUC 1DRZA 1RUSA 3MD3A 2DPIA 2HG4A 4NLVA 5D77A 5B08A 4DV1J 3DLKB 4DR5F 3V4IB 4TU8A 5I3UA 4X64J 2VB6A 1K0TA 3TVKA 5D4PA 3DDKA 3CGIA 2BKOA 2XMTA 1RAHB 4J5OA 3SI8A 2MQQA 5J2PB 3JXOA 3OUYA 2CQ2A 4JYAJ 3RAQA 1WTFA 2YKQA 1C0TB 2GVZA 4YB7A 2XMAA 5ETLA 1SPBP 5T7LA 4DPYA 1P1LA 2VQFF 3P3DA 1N56A 2UXDJ 1KN6A 3LP0B 1HHTP 4LF1A 2YY3A 3M7VA 1JJ2R 5F8LA 1JLFB 1IQZA 3MM9B 4UT4A 1FK9A 3CJ8A 3A13A 1FDAA 3G6VA 1KH9A 3SSRA 1PJ7A 3SCIE 2CJ9A 1IR1A 2IVYA 3BGOP 1E6YA 3HFVA 4ECZA 1RHRB 4DG1A 2G9OA 2NZCA 4CYUA 2BA9A 1X8DA 4MFBB 2DEIA 1F5AA 3VZHA 1HNWF 3KUHA 1V3ZA 4DPUA 3FMBA 1FNMA 4OZ3A 3W5ZA 1GX6A 4BCAA 3GR1A 5LOQA 3PHEA 2MQLA 3C3LA 4O4GA 1BMQB 3KHHA 4DZDA 2DIUA 3CD7A 4UUXA 1RTIB 2D1GA 1SC1B 1JLBB 3R5JB 3KLGA 2UXBF 1WKLA 4OYXA 4ZHRA 5CAAA 2GVDA 3OTOJ 5C24B 2QMWA 3DRRA 3VVTA 2K1RB 3W65A 2RDIA 2DJWA 1WEZA 1N5YB 3QRQA 2X1BA 4WFNQ 1GXTA 3QBCA 3NY0A 1BXNA 3BKFA 2DK2A 1Y3JA 4X4PA 3MOZA 3QAEA 5KG6A 4PG5A 3CCVS 1FA0A 4K4YA 2VG7B 2ZWOA 4B9VA 4I56A 2O67A 1R3NA 1O99A 4U6PA 4NXMJ 1NH7A 2B6AA 1U6ZA 4GTYA 4ZVRB 1N4LA 3KHGA 2N82B 2JFKA 2MEWA 4M5HA 1TKXB 2NXUA 3FFIB 3R5CA 4U67Q 4NPOA 2FJXA 4KHRA 1NZAA 4ZGAA 3HD1A 3KLEA 5L38A 3TAMA 1QSYA 2QT7A 2CQGA 3EMTA 4XDDA 1T02A 2GFFA 2HRUA 3R27A 3MEKA 2EPIA 1S6UA 4F36A 2DR7A 4LIWA 3GR0A 1TFYA 2JRSA 2B8QA 4YEAA 3FCVA 1MROB 2HBZB 3PY8A 2OFGX 3B6BA 3KK2A 5K8OA 2IMWP 1TQLA 3KDOA 1GK8A 4OLPA 5IXUA 3H98A 4NMXA 4DUTA 4EWTA 2W1BA 1S97A 4UOCA 2QA4S 1C0UA 3DRPA 4OYBA 2ZH6A 3J7YU 2ZBRA 3ZZOA 5HAOA 4C2MA 4B3MF 3WBHA 3BDGA 1KH7A 1R0BG 1Q16B 3RRKA 5I3QA 3NKNA 3D1OA 2VF3A 4H4KC 2MHEA 3K17A 3ET6A 3GCXP 4DX6A 4I64A 4CH0S 1N34F 3VAKA 2FQQB 4KY3A 4DPOA 5F8JA 3RW7A 3EGVA 1U25A 2IDLA 5HI7A 3NXZA 3VV2B 4CO2A 5DLGA 2VIHA 1FKAF 1MSWD 1EW9A 5IZHA 1PG5B 4IRDA 2QC3A 3DM2B 2HNZA 2W4PA 1N0VC 5D0RA 2AJ2A 2XLJA 2ZVSA 1QVFR 3I56S 3NWRA 5KOXA 1PBUA 1YQHA 2J6UA 1FWLA 1U2RA 2AEJA 4ZVUB 1WNEA 5B0CA 3F44A 2V2QA 2BABA 1JJ4A 1AROP 1DTTB 4OYMA 3UQSA 2Z58B 5DO2A 5F3ZA 1F2HA 1BQXA 1B8JA 2FJAB 3HPOA 1RI7A 3D4JA 1FF2A 3IA0A 2BM1A 3EICA 2DR8A 4QYZJ 1FX2A 4JI8J 4O44B 1T9YA 4N8OA 4IQXA 2EKNA 1CEZA 5J2PA 1GNKA 1U2FA 3CJ0A 2PE8A 1N33F 1QSSA 4L6V3 2WONB 2A6OA 1N88A 3W2WB 1I94F 5H9EJ 3WAXA 4UY85 2W8SA 1LV5A 5LXRA 2G4BA 2PGCA 5EGHA 3JTNA 3SCJE 3I4PA 2A0FB 5KOWA 1VS3A 4LRBA 2FJVA 2R8JA 1FXLA 1CPZA 4LT6A 4UF4A 4B9NA 1Y6VA 1IJEB 1EQMA 5HMZA 3SQGB 2OEJA 1NAQA 4X4RA 5JXSA 2ADCA 2OH2A 3QJLA 3NVLA 1R8CA 2C2MB 2B3TB 4LVNP 3DFEA 2RQ4A 2FB0A 3KDNA 2QZ8A 4YY3J 4KTQA 2GHPA 3MPYA 2KZMA 4OHXA 1WC6A 3I0SA 2PD1A 1HBMA 3I4HX 2FGOA 2DR5A 1YJUA 1U1QA 1WD6A 3PCOB 2I6WA 1D1UA 1XC9A 5KFCA 2HQGA 3WC0A 4USWA 4A8YA 3HF5A 2XMUA 1RT2B 2QV6A 4DL3A 2VODA 1JLBA 3UNYA 1VOMA 4I6AA 4DV4F 5LSLA 1KH5A 4ZVEA 2UXCJ 1KQGB 5HK4A 5C2CA 3NOGA 5DLWA 2XNRA 5EUHA 3ZXWA 3P6YC 3D6HB 2HGMA 2UVUA 2Q3PA 3TA0A 3UFCX 1FJCA 4L75A 3M8WA 2CWXA 3MAHA 3CD5A 4P7TA 4A8OA 2ACMA 5BYSA 4DL5A 1U8SA 2BRLA 1UZDA 3BM7A 4WK1A 4YR2A 1B99A 4ZVHA 2IA6A 2DISA 1M5PC 2CNOB 5LMNJ 4NXNF 4PWWA 5A0YA 4AYBD 2F9DA 4KAYA 3S01A 3K7RA 1TKXA 1DLOA 3DGVA 2RHSB 3FK4A 3OFHA 1ICEB 3DRYA 4ZK7M 1PILA 2HFOA 5B0EA 1WOOA 4J9NA 2XY6A 1PO6A 3QWPA 5JMNA 1L3SA 1YIJS 1RAFB 3KLHA 2YKAA 3UW1A 2BX6A 1X4FA 4F4AA 5KFEA 3S1TA 4ES1A 1KKHA 2DXDA 1T05B 3BQ0A 2KH9A 4P2SA 1YBTA 2L08A 1KTQA 4KPCA 3GONA 1QAYA 4OX9J 1SHQA 4CO1A 2OHDA 1FTRA 2MLYA 3QT7A 2MQPA 1FJEB 3T5LA 4F3MA 5BXIA 3EPIA 1NUEA 4DCJB 3SZZA 4DFJA 4KGVB 2L48A 4P71A 3DOMB 3SV3A 3NGKA 5ETRA 1NK8A 3DNCA 3AA9A 3VWSA 3CDUA 3QIDA 2DR9A 2B4VA 3R2CJ 3KMSA 5HATA 2UVVA 4YOEA 3M2RA 2RH3A 3NLCA 1S9FA 1CG2A 2CYYA 1O6XA 5GAEI 4DL4A 2HQDA 1ALIA 2GQQA 2ZOFA 3SQOP 2M70A 2JLFA 2VL1A 2AZ1A 3PVXA 1HQEB 1UEUA 3U7JA 4KAVA 3QT5A 4CYRA 2W5TA 4KGXB 5AJ9A 3GMGA 4EBDA 9RUBA 2UP1A 4BLGA 2QYCA 3IFEA 4RWWA 2W4CA 3MEDA 5IM0B 2N3LA 1W2IA 4DS5A 3UDEA 3VAGA 3HLUA 2IRXA 1R0CB 3NAIA 4P52A 4F04B 3SIPB 4KYZA 5KFQA 2WVFA 2KJWA 1VBYA 1FE4A 1T9TA 2YNHA 3MMAB 4WFAQ 3R1LA 4DV5F 3MCSA 3ZFVA 3JB9k 3B4DA 5LXYA 1LWCB 1K47A 3UN3A 3IAM9 1HMVA 2AX1A 4WWSA 2OJ3A 1Q0NA 2FC8A 3ELHA 4IR9A 4Y2MA 3M2UA 4ZPWR 3TUJC 2I8EA 2VPXB 2CZ9A 4J9OA 3GFYA 3DCAA 3CTRA 4OLOA 2F8EX 3EVWA 3U27A 3TAPA 1TL5A 4GKKJ 4YN3B 5LSOA 2LU2A 2DHSA 3GYXB 3RRGA 1TR0A 4U7CA 3I31A 1XR7A 1VBXA 1VK3A 1YGYA 4KC5A 5C42B 2NSCA 2VFRA 4OZJA 1DARA 1XR6A 2OI2A 3J81j 5HQLA 2JEFA 4LFCF 3ENVA 5KFFA 3F0NA 1NJWA 1ANJA 1BE4A 4QIGA 2EEYA 1OWXA 4WFXA 3CCLS 3G9CA 1UVMA 1Y5IB 2VBYA 1N32F 3CPWR 2P2CB 1R31A 5DRKA 1UA0A 4DX5A 2Y0BB 3NL0A 1YRTA 1SV5B 1ZM9A 1Y7AA 2BKNA 3E01B 2NXJA 3ILLA 3MM5A 2KJVA 3QO9B 3AJDA 3C15B 1NSAA 4D3GA 1FDDA 3WAYA 4C8ZA 5I42B 4I2QA 2CNNB 1JXVA 5KFIA 1U26A 4P10A 4Q7AA 1VI7A 2O01C 3M32A 5DS7A 3KK1B 5AJ3J 3PX0A 2C2RA 5HQ8A 1Q8KA 4ELTA 3NGSA 3IBWA 3TEGA 2IM0A 2HWHA 5INHA 3GJRB 2YWFA 3EVMA 4ED1A 4DSEA 2DKOB 2GQCA 3BSNA 4UPIA 4B9TA 4NLRA 2KB2A 4X66F 4G1QB 2CJXB 4I1TA 4C8KA 2PFDA 2V8GA 1I5OB 2DNRA 1UWAA 4PYAA 4LF2A 2DRDA 4UUWA 2R7XA 1TUGB 1KOOA 4KT0C 2BEFA 4NYZA 2IHR1 2DRBA 1LEOA 1WG4A 3DI6A 4AL6A 3CF5Q 1HQ2A 4ED5A 4HHUA 1IBCB 4DUYF 1Q1KA 3PNIA 5E3AA 2GA3A 3Q83A 4RW8A 2JC0A 2PMHA 4ZLNA 1BQNB 4OI3A 5FJ4A 4YR1A 2R2TA 1Q7YT 1CBKA 2B4PA 3BPDA 4L76A 2V8DA 4QR1A 4M63A 3GV5B 3GYGA 4C7QA 3KLFB 4ZVOB 1FVQA 3OR2A 5E5NA 4DSIA 3MGJA 1NDLA 1RTDA 2FPHX 4AFFA 1CVJA 2FVCA 1XNQJ 3TAQA 1CULA 2AMCB 1BLUA 2ZUGA 3R6GB 3TZXA 2XULA 3LGNA 1A9NB 1RCXB 3UPFA 1T05A 5G4DA 3OHAA 3V6HA 1AJAA 3NCRA 3R1HA 4X4SA 1X4CA 3KG4A 8AT1B 1TUWA 2XSJB 2QLXA 1IKXA 2BKPA 4P2MA 2XLIA 4O23A 4QWDA 4PPZA 2J9CA 4IDKA 3PZPA 4OJGA 2W9BA 4A8FA 3P49B 3IM8A 3DLEA 3H8YA 2Z2YB 2GSUA 2HVZA 2YNFB 3W5XA 1S7HA 1N52B 3QMQA 3WZ0A 2EC0A 4AUKA 4J9RA 1VC5A 2A6MA 2RILA 4RBTA 4Y3CA 2BE2B 3TVZA 3ETOA 1TL3A 5IC4B 2FLLA 4QZVB 1QTMA 3V4MA 1F60B 1L3UA 1CS4A 4RUCA 2EW9A 3PIOQ 3P96A 2GQ2A 3FMWA 1YJVA 3TRGA 5AXKA 3LF0A 4J9KA 4JI0J 3FJ2A 1PBAA 4DI6A 2EBEA 1SB6A 2NYIA 5L9XA 1UL3A 3W2VB 3PG9A 1URBA 2IY5B 2JNJA 5AE1A 1JK9B 1B3TA 4MK8A 5ADZA 3OXFA 4IFVB 3FSYA 5FD1A 1WELA 2GIRA 3KJVB 4U8VA 3ZZUA 1TVRB 1X4AA 2OPRA 3PDNA 2IJRA 1SJ4P 1OSCA 5GAHI 3MMAA 4N5SA 2F4VJ 2HFSA 3PKMA 3WBZA 2J0WA 1QE1B 3CCUS 2UU9F 5LRNA 2QFJA 4PKDB 5EWGA 3MF5A 2VBXA 4JV5F 2HZAA 1KP6A 4PXCA 3J81U 3OJSA 4ES3A 2XMJA 3OVBA 3NKOA 4JI5F 1TK8A 1AB8A 2AJ1A 4FNIA 1SKWA 4FYDA 4UZBA 1RHQB 3SXLA 3Q86A 4J9UE 1GTEA 3BSOA 4ZCKA 4EGLA 1H7XA 2MDAA 1JLEB 1KOHA 1U1NA 2Q79A 4ECTA 3CCMS 3M8SA 2ILZA 2VBWA 3NS7B 4HI2A 1REVA 3RG6A 2FHJD 3KTQA 3E51A 2WRMA 4QR0A 4UZCA 3TZYA 4CO0A 1VBKA 4U7UK 1OQ6A 5IT9U 5CYJA 3WIUA 4OZLA 3BYRA 2CQIA 4DQSA 2MZQA 5K14B 2XM3A 3DGPB 2HNYA 1SV5A 4CLWA 5CYMB 5BR8J 5KT6A 3DHWC 1NKBA 1S1TB 1S48A 3N4WA 1IKWA 3HHEA 4LF9F 1S1VB 1KDNA 1RAJA 2EC2A 1FRHA 2NZ4A 3ZTPA 1VDHA 2CG8A 2G1DA 3K57A 4FVCA 1EW8A 4X62J 4A8XA 2YNIA 3ZTOA 3VZIA 3V81B 4C48A 2Y3YA 3ZZZA 2PDAA 2I0XA 3DLLQ 4ES2A 1HARA 1LW2B 3DRXA 3GLJA 3HSDA 1RTJB 4KKOA 2V4RA 1ALHA 4EZ9A 2HZVA 1BUXA 2LCWA 3EZOA 1HQAA 1KBRA 3T6BA 2ASJA 3N6MA 4FF2A 4DBQA 5HVGA 1NDPA 3GIKA 3FRYA 2EFGA 4K2XA 5DJBA 2BVZA 2MZ1A 1NKCA 2CNKB 3HHLC 1K1QA 2VG5A 3THTA 1EQJA 3CDBA 2QEXS 3CJ3A 3UCUP 4AL7A 4FYXB 4XTTA 4M5LA 1SVDA 1SH2A 2FHKA 3QJJA 1UPMB 4FVMA 4CO5A 4EO8A 1U24A 1N2KA 4C8YA 1XNRF 4ICLB 3NNAA 2AHOB 3QSIA 2ZHBA 1TV6A 1H73A 1CJTB 5GAEU 4WU3A 3KLFA 3BN4A 3SDEB 4LRCA 4WP9A 2VG6B 1WHYA 2E7XA 4AL5A 1IKYA 4K5RA 4LVOP 3TP2A 3BB5A 1K44A 5DGAA 4FKYA 2RJZA 4DR4J 3SSSA 1CQMA 4K50A 3PW7A 1XJWB 1EETA 4RBUA 4C3LA 4JV2A 2A10A 3CD6S 4WXOA 3DLGB 4KHPF 2AQ4A 4TN0A 2DR6A 3O3LA 3V6DB 2DT9A 2VZ9A 4JI6F 1UJ4A 1UAWA 3CIZA 2HW3A 1OPZA 4GMKA 3TO8A 4ELUA 3M1VA 2GJIA 3QSYB 2UZAA 5HROB 1XIQA 2O3DA 3E2EA 2O66A 3W60A 4A8QA 5LRMA 2F4FA 3LPEA 3LXQA 5D78A 3QYYA 1SIZA 2PMZD 4RU2A 1VRUB 4I2PB 5EGYA 1ULRA 2AYGA 2RE1A 5L1LA 4DV0J 3W7BA 3W9IA 3KYLA 3NOCA 3LW5C 3MEEB 2OMOA 1HD0A 3FZ2A 4ZJLA 1TL4A 5L0BA 2HMIA 3NKYA 1RA7A 2OD6A 4PR6A 1NPPA 3KK3A 1N5TA 2ZKUA 4U8YA 3NS5A 3LH2S 2Y8YA 2M3DA 4N47A 3ISND 1FD8A 3MUMP 2ZZMA 2VONA 3C6TB 2MZRA 2BOPA 2UV8G 2XRGA 1OMSA 4IG3A 5THWA 5F9LA 1N0UA 1S1WA 3C6UA 5GAGI 4DQPA 2QG9B 1C1CB 2OFHX 1RHJB 3M8QA 1M5OC 1RA6A 2DBBA 4J7CA 1O0PA 3MXHP 2F9JA 4OFZA 4DV6J 3MMBB 1FRKA 3LTOA 4RW4B 3LPYA 1RK8A 5F9NA 2X1FA 1OJ4A 2BYCA 3EUNA 4WTYA 2M5YA 2Z8QA 5B09A 1OO0B 3QIPB 5ETPA 5B0DA 2RNEA 4DXLA 4DR1F 1HI8A 5J2MB 1HPZA 2FUG9 4WYWA 4NYPA 1QD1A 5E2QA 1SBRA 1RE1B 3FEYB 3OR1A 1RB0A 4F2RA 2F8MA 3BZQA 4Q0BB 2V9KA 4K59A 2E1MC 2CQBA 2E1PA 3NGRA 4BBYA 3GP9A 1EAYC 3ZTRA 5IT0A 4F4YA 2I9SA 4QR2A 2OPPB 2ZBIA 3B54A 3SEOA 1VQNS 1RT5A 2K3IA 2Z30B 1I51B 4ILLA 2V4JA 1MN9A 3JAMU 1MU2B 2LYVA 3CJRA 3H2UB 3EX7B 4ZIVA 2OLWA 5CHCB 1CJVA 2HHPA 4J9VA 2RKIB 3HHLB 3RBXA 1D9FA 1TU0B 4LFAF 2C2NA 3K58A 4HHJA 2VJVA 1KFSA 3T1HF 3H2LA 1VFJA 2QL9B 2VPZB 1IBKJ 3GZ7A 2YKMB 6AT1B 4WP3A 3H4DA 1U47A 2R4FA 4JI4J 1S6QA 3QFHA 1R7IA 5MLCV 4AQYJ 1HWJA 1P6TA 5BYQA 5B0FA 2G2YA 1ZZFA 4D3HA 3OPKA 1UEKA 3G6ES 1F9EB 2UUAF 2CA9A 8RUCA 2XO7A 2HBQB 5A2QY 2GMHA 2WVCA 4ITSA 4QYZK 2M88A 2KM8C 3FVYA 3R5AA 4IFYB 3RAMA 3NCQA 2XMWA 3BDEA 5KT7A 1VMBA 3POTB 3SV4A 2HS4A 2DHHA 4HH0A 5C25A 2HQIA 1Y5LB 3D54A 2IC3B 3A3OB 4FPIA 3OJUA 4KIAA 1RT4B 1LOUA 3RUBL 4E98A 1Z2LA 4DSLA 5HLFB 4ZJQA 5A8WA 3IS9A 1EKSA 2NSBA 2FHOB 2DCLA 3W5YA 5LMUF 4DX7A 1S99A 3OW2R 2WAQD 5KT5A 3W9JA 5GMKa 2XEXA 3MTKA 4LREA 4DL6A 3C16B 4ANDA 3OTBA 3PTWA 4FS2A 5LSRA 5D0EA 4W98A 2W2PP 2VA2A 2CQDA 1HNXF 4M94A 2ZJPQ 1SC6A 2ZZTA 5B0GA 1S0OA 4KRWA 4IRKA 1JLGA 4JV1A
chains in the Genus database with same CATH topology
4NWJA 1FSUA 3DPCA 4GTWA 5C66A 4MY4A 4CXUA 4KJGA 1P49A 4UORA 3BDFA 5DLVA 4LRAA 2W5XA 4LRCA 1EW2A 4UPLA 4MHXA 3SZYA 2VQRA 2GSOA 1ELXA 3MK2A 3T01A 1EW8A 4GTXA 4LR2A 1ALIA 2W5VA 4N7TA 4UPHA 5INHA 3E2DA 5IJQA 2XRGA 4KM4A 1K7HA 4LR9A 4ZGAA 5K4PA 1ALJA 2ANHA 3B5QA 3IGYB 4KAVA 3UNYA 1E33P 3IGZB 1AJCA 3T02A 1ANIA 2D1GA 2W5WA 3DYCA 2X98A 1EW9A 1KH5A 4UPIA 3WAXA 1AJBA 4CYRA 2W8SA 1URAA 1ELZA 4CXSA 4LRDA 2W5TA 5EGHA 5AJ9A 1ALHA 4NWXA 4ZG7A 1HJKA 3NKQA 5EGEA 1AJAA 3NKRA 4LR8A 2IFYA 3IDDA 4TN0A 5L0EA 5DLWA 3UN2A 2GSNA 3BDHA 3TX0A 1URBA 1ED9A 2W5SA 2GLQA 1HQAA 2IUCA 4KJDA 1SHQA 3CMRA 1ED8A 5IJSA 2IUCB 4LRBA 3NKPA 4LR7A 1KH4A 3M8YA 5DLTA 3WAWA 2XR9A 1E1ZP 3NKMA 4FDJA 5GOVA 4ZG6A 4ZG9A 1KHLA 3M7VA 1Y6VA 4GTZA 3M8WA 5LQQA 4LQYA 1AJDA 1ANJA 1AUKA 5LIAA 3SZZA 2W5QA 1ALKA 3BDGB 1EI6A 1EQJA 5LRMA 4QAXA 5HRTA 4LREA 2GSUA 1ELYA 1KH9A 3KD8A 3LXQA 5KXAA 5L0KA 4LRFA 4UPKA 1E3CP 3NVLA 5TJ3A 4FDIA 3MK0A 3OT9A 1HDHA 2G9YA 3M8ZA 1Y7AA 3A52A 4MIVA 2RH6A 2W5RA 1EJJA 1ZEFA 4CYSA 5LRNA 4B56A 1KHNA 3WAYA 3UO0A 1SHNA 3WBHA 1B8JA 1O99A 3BDGA 1KH7A 2QZUA 1N2LA 1ZEBA 5GRRA 3TWZA 2GA3A 4CXKA 1N2KA 3Q3QA 3UN3A 3ED4A 1ZEDA 3UN5A 1O98A 3T00A 4GTYA 2ZKTA 4UOPA 5L0BA 4KAYA 1KHJA 3NKNA 1KHKA 3NKOA 3MK1A 3WAVA 2W8DA 4YR1A 3TG0A 1E2SP 4UOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NWJ A;  1FSU A;  3DPC A;  4GTW A;  5C66 A;  4MY4 A;  4CXU A;  4KJG A;  1P49 A;  4UOR A;  3BDF A;  5DLV A;  4LRA A;  2W5X A;  4LRC A;  1EW2 A;  4UPL A;  4MHX A;  3SZY A;  2VQR A;  2GSO A;  1ELX A;  3MK2 A;  3T01 A;  1EW8 A;  4GTX A;  4LR2 A;  1ALI A;  2W5V A;  4N7T A;  4UPH A;  5INH A;  3E2D A;  5IJQ A;  2XRG A;  4KM4 A;  1K7H A;  4LR9 A;  4ZGA A;  5K4P A;  1ALJ A;  2ANH A;  3B5Q A;  3IGY B;  4KAV A;  3UNY A;  1E33 P;  3IGZ B;  1AJC A;  3T02 A;  1ANI A;  2D1G A;  2W5W A;  3DYC A;  2X98 A;  1EW9 A;  1KH5 A;  4UPI A;  3WAX A;  1AJB A;  4CYR A;  2W8S A;  1URA A;  1ELZ A;  4CXS A;  4LRD A;  2W5T A;  5EGH A;  5AJ9 A;  1ALH A;  4NWX A;  4ZG7 A;  1HJK A;  3NKQ A;  5EGE A;  1AJA A;  3NKR A;  4LR8 A;  2IFY A;  3IDD A;  4TN0 A;  5L0E A;  5DLW A;  3UN2 A;  2GSN A;  3BDH A;  3TX0 A;  1URB A;  1ED9 A;  2W5S A;  2GLQ A;  1HQA A;  2IUC A;  4KJD A;  1SHQ A;  3CMR A;  1ED8 A;  5IJS A;  2IUC B;  4LRB A;  3NKP A;  4LR7 A;  1KH4 A;  3M8Y A;  5DLT A;  3WAW A;  2XR9 A;  1E1Z P;  3NKM A;  4FDJ A;  5GOV A;  4ZG6 A;  4ZG9 A;  1KHL A;  3M7V A;  1Y6V A;  4GTZ A;  3M8W A;  5LQQ A;  4LQY A;  1AJD A;  1ANJ A;  1AUK A;  5LIA A;  3SZZ A;  2W5Q A;  1ALK A;  3BDG B;  1EI6 A;  1EQJ A;  5LRM A;  4QAX A;  5HRT A;  4LRE A;  2GSU A;  1ELY A;  1KH9 A;  3KD8 A;  3LXQ A;  5KXA A;  5L0K A;  4LRF A;  4UPK A;  1E3C P;  3NVL A;  5TJ3 A;  4FDI A;  3MK0 A;  3OT9 A;  1HDH A;  2G9Y A;  3M8Z A;  1Y7A A;  3A52 A;  4MIV A;  2RH6 A;  2W5R A;  1EJJ A;  1ZEF A;  4CYS A;  5LRN A;  4B56 A;  1KHN A;  3WAY A;  3UO0 A;  1SHN A;  3WBH A;  1B8J A;  1O99 A;  3BDG A;  1KH7 A;  2QZU A;  1N2L A;  1ZEB A;  5GRR A;  3TWZ A;  2GA3 A;  4CXK A;  1N2K A;  3Q3Q A;  3UN3 A;  3ED4 A;  1ZED A;  3UN5 A;  1O98 A;  3T00 A;  4GTY A;  2ZKT A;  4UOP A;  5L0B A;  4KAY A;  1KHJ A;  3NKN A;  1KHK A;  3NKO A;  3MK1 A;  3WAV A;  2W8D A;  4YR1 A;  3TG0 A;  1E2S P;  4UOO A; 
#chains in the Genus database with same CATH topology
 4UST A;  3VCD A;  4TY8 A;  4C3K A;  2DIV A;  2JEI A;  2JEJ A;  1NDC A;  3BSC A;  4LRA A;  1UFW A;  4OJ1 A;  3TOQ A;  2RUS A;  3IBF B;  1U2C A;  3SSQ A;  1SJ1 A;  4YHH J;  2YX1 A;  2UUA J;  1FVS A;  4X4U A;  4KV8 A;  5LT5 A;  4ERD A;  2W9C A;  4QW8 A;  2Y1R I;  1KSP A;  4NWX A;  2IPO B;  4M5D A;  3CO0 P;  2Q6C A;  3AT1 B;  1FXD A;  5BYR A;  4G1I A;  1MG7 A;  4I7F A;  3EXC X;  3V6J A;  5J1E A;  4FDJ A;  1IUJ A;  2EG1 A;  2IVM A;  3BYP A;  2BRK A;  4LUB A;  1NK6 A;  1FTC A;  2E9T A;  5DG8 A;  5GAH U;  4DR7 J;  3SYZ A;  3UCZ P;  2ZHA A;  1YWX A;  3RJM B;  4CDI A;  4RW6 A;  1F9F A;  1JX4 A;  1VJQ A;  1SUQ B;  4LF7 F;  1N6Q A;  2ZKT A;  3ILI A;  1KLM B;  3K8W A;  1YJR A;  2F63 A;  5KFU A;  2RT3 A;  4GKJ F;  3P5T L;  3CJ4 A;  3A8E A;  3DMJ A;  2HAI A;  3TJ9 A;  4NI2 B;  2H1Y A;  3RB0 A;  1ELX A;  3M2V A;  2CVI A;  1XN9 A;  3MM8 B;  2HQF A;  4QW9 A;  4R25 A;  1IWG A;  1TL1 B;  3MEG B;  2AEM A;  1CQN A;  2ZM6 J;  1U1P A;  3BGR B;  1ZOT A;  1REG X;  3H5S A;  3UDV A;  1RLC L;  4ZMM A;  4RW9 A;  2ZOM A;  1FWK A;  3M8R A;  4DLE A;  2HIY A;  1ED9 A;  3C14 A;  3PYE A;  4C98 A;  3MPD A;  1S76 D;  1NPR A;  2E5L J;  1Q95 G;  2OUG A;  1CC7 A;  5E41 A;  3HHD A;  2A2C A;  2W5Q A;  3UCG A;  4ZJO A;  4O3P A;  1RZM A;  1RTH A;  2BQ3 A;  1JIH A;  5J1P A;  4ZP6 A;  2JX2 A;  1XMQ F;  2W5R A;  1ZM3 A;  2N7C A;  1X9M A;  3TVY A;  3CB4 A;  2KM8 B;  2K3K A;  5GRR A;  3PRD A;  2MMY A;  1KRP A;  4RUH A;  1S6P A;  2HRY A;  5KFK A;  2PA8 D;  1N48 A;  1BHN A;  2XWX A;  2XS2 A;  1F3F A;  5DLV A;  1EP4 B;  3M8P B;  4EFA C;  1WOS A;  2O5D A;  1WOR A;  4N8N A;  1HBU B;  2YWE A;  1QUP A;  5IJQ A;  3PR5 B;  1T3N A;  3J80 U;  3Q8R B;  4JI1 F;  1TK5 A;  4LSL B;  1OY8 A;  4OZN A;  4LRD A;  2RKI A;  3FSI A;  3M9M B;  2XCA A;  5EGE A;  4MAK A;  3MD1 A;  1SL0 A;  3PFO A;  3EM1 A;  5F8I A;  4AXJ A;  3QNW B;  2YKN B;  1B0P A;  4ELV A;  4UTG A;  4CLL A;  4ZPA A;  2B7C B;  3R5B A;  1R8H A;  4WE1 A;  4NZ7 A;  2WSE C;  2OPQ A;  2CPE A;  4N56 A;  1S9G B;  1HBO B;  2BV3 A;  2E1A A;  3O1L A;  1RSC A;  4ZVS B;  4BS2 A;  3FC9 A;  2KRB A;  1R0A B;  2L41 A;  2WVB A;  3GIR A;  3L7U A;  1R27 B;  4GTW A;  1HYS A;  2CAJ A;  2PEB A;  2QFI A;  4DSF A;  2XGP A;  2QA1 A;  2D7S A;  2RS8 A;  3T6J A;  2NQP A;  4Y2I A;  1IWA A;  1J5O B;  2U1A A;  4DQI A;  2BXJ A;  1KNZ A;  5IWA J;  4IO9 Q;  5EHH A;  1FEH A;  1O51 A;  1HNV A;  4WPA A;  5E33 A;  2WZ1 A;  4CTA A;  5E7O B;  1TAU A;  1FRM A;  1WG5 A;  2J8A A;  4U7U D;  3W61 A;  1RCO B;  5E3R A;  3MMC B;  2QSF A;  3MR7 A;  3BO2 A;  4TU7 A;  5FII A;  1KHV A;  4AT1 B;  4X65 J;  3PYF A;  3JSB A;  5HAN A;  1NH8 A;  4I6Y A;  1UWB B;  2OPS B;  2AJ0 A;  3QJP A;  2HS0 A;  5GOV A;  1ZZN A;  5KFV A;  3I0R B;  3B4M A;  3GJQ B;  4URS A;  1R43 A;  2ZDO A;  4LBH A;  2R8K A;  3C16 A;  4RUA A;  3D5M A;  4PG6 A;  3WDO A;  5KFZ A;  3M9O B;  3FEZ A;  5IV4 A;  3M8Z A;  3ZO7 A;  5KFJ A;  1YRU A;  2Y1J A;  1A0O B;  1ZEF A;  1C1B A;  2VJU A;  1YZ7 A;  2DB1 A;  4CXK A;  2PSZ A;  4Y6I A;  1VQM S;  1RAC B;  2AV5 A;  1SH3 A;  4PUO B;  4ZPV R;  4RW7 B;  3G8T A;  5A8K B;  3F56 A;  1S1X B;  3BF4 A;  4EK2 A;  1YJ9 S;  4XO0 A;  2M9K A;  5K20 B;  3US5 A;  1TZ0 A;  4HTJ A;  4ZVQ B;  2HHX A;  4N7T A;  3E2D A;  5GAG U;  1HR0 F;  1PC4 A;  3OVA A;  3A8K A;  1S79 A;  3HCX A;  5CZX A;  1S6O A;  4TYA A;  1KVI A;  3IRX A;  4MTP A;  4L3K A;  4CT8 A;  3FEX B;  2P6T A;  3CJK B;  1RT7 B;  2EK1 A;  2E29 A;  2VU5 A;  2HS3 A;  4IOB A;  2W7A A;  1CJU B;  3KOA A;  3UD5 A;  1NXI A;  3T9Z A;  5FLX U;  1JB0 C;  1NME B;  1T9V A;  3HVW A;  3FRZ A;  1SI9 A;  4QIV A;  4A47 A;  3DYA A;  4MK9 A;  2J6S A;  5KFH A;  5I3U B;  3X1L B;  2H5I B;  1RWM B;  1VR6 A;  4FYW B;  2AIR B;  4ZVP B;  3VAF A;  3IR5 B;  2J5A A;  1IBL F;  2HK2 A;  1RQ0 A;  3UNG C;  1AZS B;  3P5B P;  5KFL A;  3OUY B;  2H9Z A;  2QA2 A;  4DV3 J;  1X5O A;  4WKR A;  4B3R F;  2FTR A;  1FT8 A;  5IS2 A;  2GVZ B;  2V9W A;  4ED2 A;  2OEL A;  5T7L B;  1TMJ A;  3NAH A;  1CLF A;  4DR3 F;  1X9S A;  1M1H A;  3R5D A;  2NS1 B;  4DR6 J;  4DV2 F;  3C19 A;  1AJB A;  2AZ3 A;  2MLZ A;  1T9W A;  2B9E A;  1FK9 B;  3ETM A;  1DQ9 A;  5CQG A;  1HHQ A;  2KRR A;  3D9B A;  1V9O A;  4QQB A;  3I32 A;  1E6Y B;  3GJS B;  4L73 A;  4CH7 A;  4DG1 B;  4WP8 A;  4CYU B;  2AJ4 A;  3R3T A;  1M5K C;  4A8W A;  2RHQ B;  3OT9 A;  4P6Q A;  2DNG A;  2E7V A;  3RB6 A;  3P45 B;  2BW2 A;  1TTH B;  2DEJ A;  1M90 T;  2F3J A;  3VAL A;  2L9N A;  3J7Z T;  4V19 X;  2GW8 A;  1BWV A;  2OML A;  1N36 F;  4O4G B;  3MAA A;  1LW0 A;  3Q22 A;  2CPJ A;  2C3U A;  5J2N A;  2R7V A;  3TYT A;  4KH0 B;  3KLG B;  4ZHR B;  4JOU A;  2GVD B;  4MJK A;  2DNN A;  3SMZ A;  1U6F A;  3D0H E;  2DGT A;  4YP3 A;  3DRR B;  5KFN A;  3ZZP A;  2YNG A;  3CCT A;  3B8H A;  1ZBT A;  1QAJ A;  1ALJ A;  1S1U A;  2ZC3 A;  4KE5 A;  1D3W A;  1UJ6 A;  1YKW A;  4EYH B;  4ECV A;  4TLR A;  3KHL A;  4JI2 J;  5D4O A;  1IKV A;  3W8G A;  2IUC B;  4DHV A;  3MEC A;  4HTI A;  4MMO A;  3NKM A;  1FJ7 A;  2HND A;  2XC9 A;  4FS1 A;  4WYL A;  3W3S A;  5KFD A;  3THP A;  4DUZ J;  4UOG A;  3ENW A;  3PIP Q;  1KS2 A;  2CWK A;  2H3E B;  5LIA A;  5D8H B;  3OL9 A;  1NSK L;  2B6A B;  1S9G A;  1VRQ C;  3G86 A;  2LU1 A;  3OHB A;  1VRT A;  1U1K A;  1FRX A;  3LP1 A;  2YWK A;  4WTO B;  2K2P A;  2N7Y A;  3E8O A;  4PQU A;  2W8L A;  1TMM A;  3ED4 A;  3T5H A;  2KN4 A;  1Y00 A;  3KLE B;  4P9S A;  4CCH A;  4OI4 A;  3TAM B;  4NLW A;  5KTQ A;  3PRV A;  3DOK A;  2D1C A;  1S72 S;  2WCX A;  1VQP S;  3MPV A;  2GAG C;  2LQ8 A;  1VQ6 S;  4DV7 F;  2HUR A;  3QQC D;  4YDD B;  3UVJ A;  1WSR A;  4LF8 J;  3T02 A;  4C0H A;  3KK2 B;  1OQ3 A;  4CO4 A;  3EZU A;  1Q82 T;  2I38 A;  3UN2 A;  1HWL A;  5JVG Q;  4WBF A;  4NLT A;  3Q8S B;  4PWD A;  3D68 A;  4M5J A;  2HIQ A;  4ILR A;  4FF4 A;  1FNX H;  1C0U B;  1HD1 A;  3DRP B;  3SFU A;  3W64 A;  3EPG A;  1Z4U A;  3JYT A;  4FYV B;  1JLQ A;  2VD3 A;  2BJ9 A;  3GFX A;  3R9L A;  2BZ2 A;  1HNI A;  1T11 A;  3BDG B;  1PYS B;  3ADA C;  2MQN A;  4XDC A;  4PCQ A;  3S6E A;  5ETQ A;  3ET6 B;  2E5J A;  3L09 A;  4NLP A;  2BAN A;  2C3Y A;  3OXG A;  4Z2X A;  2MKJ A;  2P9E A;  2CKW A;  4LFB J;  4LF4 F;  3DU5 A;  1JWW A;  1FFS B;  2R8I A;  1RYR A;  3D0I E;  3RRH A;  2JC1 A;  4OZ2 A;  3CSK A;  1H74 A;  3M4X A;  3HP6 A;  2VFS A;  2CQ4 A;  3DXB A;  2HNZ B;  4MYT A;  2QJ3 A;  1S0V A;  2CG4 A;  3RBE A;  3I5B A;  4X4Q A;  1FJG J;  5KG4 A;  2VQE F;  1IM6 A;  2ZH7 A;  1UCN A;  3IDD A;  2R8H A;  1F3V A;  3R8Y A;  5CXT A;  3BDH A;  4ER8 A;  2G0C A;  2WOM B;  4Q2M A;  3NKP A;  3WAW A;  3IN5 A;  2HFV A;  3OLB A;  2VFT A;  1SJR A;  1D9D A;  5LJ3 Y;  3LGM A;  1ZA1 B;  2MHN A;  4UW2 A;  3CCZ A;  2ZVI A;  1DQ8 A;  1ELY A;  2O1P A;  4RX6 A;  1J2V A;  2RQK A;  4ZPD A;  3N5B A;  2J9D E;  1C2P A;  2WVD A;  3WIV A;  1GFW B;  3HVR A;  4A8M P;  4DFK A;  1GXU A;  4Y0F A;  1AZS A;  4B3T F;  2CQH A;  3K5M A;  4LF6 J;  2E1R A;  4DS4 A;  1H38 A;  1UVI A;  2HHQ A;  4CLT A;  2BOA A;  4PZV A;  5K8P A;  3D3C J;  4F7V A;  2HZC A;  4L3N A;  2HEK A;  5K4P A;  2J76 E;  4CWB A;  2SXL A;  3EJM A;  1S49 A;  2E5H A;  1XWL A;  3A8I A;  1JLC A;  1S12 A;  3IBC B;  4PYD A;  1DAX A;  1HIY A;  1YJN S;  1HJK A;  3RR7 A;  2KI2 A;  3L4B C;  3N0V A;  4FNH A;  3JSM A;  3MOJ B;  2KHD A;  2A1B A;  3PW4 A;  3TEH B;  3M05 A;  1V5I B;  4B9U A;  2CUY A;  3PJX A;  1MMN A;  2M0G B;  4WU2 A;  4QAX A;  2M2B A;  3I0S B;  2AD9 A;  5SZT A;  3W62 A;  1HBM B;  4EMD A;  2QSW A;  3A52 A;  1NHV A;  1FFG B;  3OBI A;  4X4V A;  4ED7 A;  3EZ5 A;  3MZI A;  5HQM A;  1FKO A;  5HBM A;  4XIU A;  2CJA A;  4DR5 J;  2RU3 A;  2QA4 G;  4M5I A;  4DDF A;  2F5G A;  2AYM A;  1LK5 A;  4ZDN A;  2KG0 A;  4PEO A;  1GAO A;  1JJC B;  1ZH5 A;  5H1S V;  2V68 A;  3CO9 A;  4PXB A;  2ZEJ A;  3CVK A;  1H3D A;  4C0O C;  4M5M A;  2DNZ A;  2CDQ A;  2IUC A;  3OFF A;  5EX3 A;  2VQF J;  5DLT A;  3TX8 A;  1VK8 A;  5ITH A;  2W2O P;  4WZQ A;  4GTZ A;  1B4S A;  1N54 B;  5F8H A;  4OI6 A;  4NA2 A;  5A0Y B;  2WB4 A;  1WF0 A;  4R5P A;  3OQ2 A;  4ZN3 A;  2V2Z A;  1L3T A;  2HQ3 A;  3TR5 A;  1DLO B;  3WHI A;  4F0H A;  2FGC A;  3MR6 A;  3VAH A;  3QRP A;  4KJI A;  5KT3 A;  2WBR A;  5CH7 B;  1WHV A;  3RTV A;  5AXM A;  3VGS A;  1OY6 A;  2IAJ A;  3KLH B;  2Z4P A;  4UOO A;  3HT0 A;  4QWC A;  2DHG A;  3HSJ A;  1HNW J;  4TXS A;  4YFU A;  3T01 A;  3H20 A;  4ZCI A;  3L3C A;  4YB6 A;  4C11 A;  1NM2 A;  3HHN B;  5HVF A;  2XYG B;  5KFX A;  4CLF A;  3IP0 A;  2GGP A;  2KYZ A;  2Z2Z A;  2OD4 A;  2UXB J;  3QGI A;  4RUB A;  3NMR A;  4QIE A;  4LSN A;  1RHU B;  3QLH A;  1T03 B;  3SZ2 A;  1XQI A;  2DGQ A;  1NJZ A;  1NK9 A;  4OQJ A;  1XMO F;  5GMD A;  4ECU A;  2PC6 A;  3KNG A;  3G71 S;  2XYP B;  1RWN B;  4ENO A;  3KLV A;  4B3O A;  3QT8 A;  3KLI A;  2A3J A;  1IM4 A;  3M2R B;  4CYS A;  3CW2 C;  1LWF A;  2HSE B;  1U48 A;  1ZAX A;  4DPX A;  4F25 A;  4C6A A;  1YBU A;  3KHR A;  1NZ8 A;  4RNO A;  1Q53 A;  1QAI A;  4Q2L A;  1TFW A;  2YBV A;  3PJ9 A;  4W90 B;  2GZO A;  2LQB A;  3IO1 A;  1VHF A;  2DGO A;  1UZH A;  1APS A;  3MED B;  5HO4 A;  4F50 A;  2JDJ A;  2KZZ A;  3B5Q A;  2V4Q A;  4LIR A;  3IGY B;  2ZD1 A;  5L46 A;  2RB7 A;  2QIF A;  4RZR A;  2XY7 A;  4DSJ A;  3IRW P;  3L9Z A;  5HL7 Q;  4FXW A;  2DNQ A;  4F26 A;  3SCK E;  3GCW P;  2ZJR Q;  3SBM A;  1XK8 A;  2WOM A;  5ETN A;  3FQL A;  5IQ6 A;  2LXF A;  2YNH B;  3BKT A;  2ZBQ A;  3G96 A;  2DNH A;  4E2F B;  2MQO A;  1Z1Z A;  5B0B A;  2MYF A;  1MML A;  1HMV B;  3F73 A;  4ED8 A;  1EJJ A;  3M2U B;  3D1Q A;  2MKC A;  3K59 A;  4DZ6 A;  2D3O 1;  4B3M J;  1IXK A;  4A8S A;  3T3F A;  5HJX A;  4JI3 F;  5A2Q U;  4HLB A;  1X4E A;  3BH7 B;  4IOA Q;  3M6X A;  4NLO A;  3PYG A;  3CJS A;  1U45 A;  2B4U A;  1N34 J;  4OMF G;  2LXI A;  3L7O A;  1QSL A;  1GTH A;  4P7V A;  1F0X A;  1SQE A;  1J5E F;  2HGL A;  3PFE A;  2G0J A;  1SJQ A;  4MIB A;  3OFE A;  2HHT A;  2OIH A;  2BJ1 A;  1WDD A;  3KMQ A;  2ZNZ A;  2J9E A;  3AH6 A;  2G2O A;  5ETS A;  1VQO S;  2DNO A;  3AOB A;  4H54 A;  2IVF B;  4ECY A;  3MM5 B;  1SKS A;  4A46 A;  1VIS A;  5KFT A;  3BGL A;  2V8P A;  4I2Q B;  4Y65 A;  2QMU B;  2Q66 A;  2DGU A;  5GME A;  3M32 B;  3UD4 P;  2VUG A;  4K5S A;  2DPJ A;  5D0G A;  1NK0 A;  3GG1 A;  2MKY A;  3BO3 A;  2I1R A;  2FLO A;  2UV8 A;  3HHK A;  3R97 A;  2QGF B;  2UUB F;  3IR7 B;  1G1X A;  3TUP A;  1M0S A;  4UOR A;  7FDR A;  4LBI A;  3H90 A;  2GSO A;  2AYB A;  3N01 A;  1K73 T;  4J91 A;  4WIQ A;  5I4M A;  1ZS6 A;  1TKT A;  3CC7 S;  1LWE A;  2ZWP A;  4USJ C;  4ZCL A;  2VFU A;  1YHQ S;  3D28 A;  3WX4 A;  2KL8 A;  1N33 J;  4ZLP A;  5IV3 A;  1I94 J;  2MGZ A;  2CRL A;  4KO0 A;  2CQ0 A;  2V2K A;  4KPY A;  1RT6 A;  4FBU A;  4E0D A;  4ZS6 A;  5M2P A;  5HP1 A;  1WC0 A;  4QOT A;  4KGM A;  3DI6 B;  2Q1L A;  4DR2 F;  1AJD A;  5AXN A;  4C4W A;  4O3N A;  5C5J A;  2D9P A;  1DJ0 A;  3MPU B;  1AUS L;  2IBK A;  1ACM B;  3IAS 9;  4RW8 B;  4DPT A;  2V8V A;  3W8P A;  3DU6 A;  5L0K A;  4X84 A;  4WK3 A;  3M30 A;  5KAK A;  2NXC A;  2NYH A;  2C42 A;  4ED6 A;  1LXJ A;  3OR2 B;  2VPW B;  3EWG A;  3QAU A;  3DLH A;  1H2T Z;  2QLB B;  1RTD B;  2P9G A;  1CUL B;  1XER A;  1I6J A;  1ZTT A;  1FI4 A;  2VA3 A;  3LP2 A;  2EFV A;  4NLQ A;  1WHW A;  3QGH A;  2J0Q D;  1NK4 A;  5F41 A;  5L39 A;  3NGT A;  2CAD A;  2EK6 A;  2BJ7 A;  3MK2 A;  2B0G A;  1GX5 A;  4LR2 A;  2PII A;  5I3P A;  4YB5 A;  3BS9 A;  4MT1 A;  4K8R A;  1RAA B;  4HDH A;  3BPS P;  2ANH A;  5JUM A;  3OL8 A;  2JVO A;  1AUD A;  3RW6 A;  1AJC A;  1YZ6 A;  1WUU A;  1PCA A;  1IKX B;  3VVU A;  2GIQ A;  2CIM A;  4DQR A;  2RD5 C;  4DV4 J;  4NL5 A;  4IDK B;  3FUY A;  1KD1 T;  3TAN A;  2W9B B;  5L0E A;  1N8R T;  4PAA A;  3DLE B;  1U0S A;  3RBZ A;  1T03 A;  2WSF C;  2RRN A;  3I96 A;  1WWH A;  4ZG6 A;  2IJF A;  4W92 B;  5D3G A;  2QMX A;  2HHH F;  2VHG A;  3OTE A;  2GJ2 A;  4USV A;  2JEG A;  1TL3 B;  2ZH5 A;  2IM3 A;  1WAC A;  7FD1 A;  1X5P A;  3GFH A;  3N9U C;  1HQU A;  1NJX A;  1EZZ B;  1CS4 B;  5DDO C;  4NXN J;  3TQ1 A;  3CUN A;  1DHM A;  1WF2 A;  1NHK L;  1KC8 T;  4ZKA A;  3PAC A;  2RAQ A;  1S4E A;  4ZIT A;  3DDI A;  4J9P A;  4IRC A;  5F3T A;  2OEM A;  3HT3 A;  1T7P A;  4B02 A;  4QWE A;  2EFN A;  2YPZ A;  5HSP A;  3QZ8 A;  4QWA A;  2W5V A;  1WC4 A;  2MST A;  1UMJ A;  4NLS A;  5IC6 B;  4C0B A;  1IBM F;  2X98 A;  1S4F A;  3DOL B;  2RF2 A;  4P73 A;  3RB4 A;  3ZZ0 A;  4GO7 X;  4O0I A;  1EIY B;  4BDP A;  2IDE A;  4MIA A;  2OPR B;  4NLG A;  3CMR A;  2BJ8 A;  2QLF B;  5CCM A;  4LSZ B;  4NRT A;  4RU9 A;  3A1Y G;  4EEY A;  4CP5 A;  2DGX A;  2ZDP A;  3Q8Q B;  1EI6 A;  1X0P A;  2BDP A;  3L95 X;  3PM9 A;  4OL8 A;  5KFP A;  1UPP A;  4I69 A;  2IM2 A;  3GYN A;  1UVL A;  2RIJ A;  2E1C A;  4C97 A;  5DET A;  3BBC A;  2B9X A;  5DDP C;  4X4N A;  1VQK S;  1SIW B;  3JS9 A;  1FX4 A;  1REV B;  2B5J A;  4KAI A;  3X3U A;  2ALZ A;  4LR9 A;  4O0N A;  5J2Q A;  2GX8 A;  2KVI A;  3HI9 A;  3I82 A;  4N41 A;  2OGU A;  4NCG A;  1Y7P A;  1PYO B;  3T1Y F;  1F5C A;  1IR2 A;  1Q5V A;  3FBC A;  1MW7 A;  2UUC F;  1HFE L;  2LDI A;  2HNY B;  4LR7 A;  1KH4 A;  1LNQ A;  4HEA 9;  2D74 B;  2BM0 A;  2AGO A;  1RHK B;  2HKE A;  4ID8 A;  2AJF E;  1E6V A;  4K7Q A;  2E44 A;  1VIX A;  2HVD A;  1IKW B;  2ZH8 A;  4M5G A;  1JLA A;  2FJW A;  1FFW B;  1Z2Z A;  4R8U A;  4LRF A;  2WW8 A;  2XZD B;  4TLQ A;  3OL6 A;  2KTQ A;  2ZIT A;  1TKZ B;  4UQG A;  2RH6 A;  5D4L A;  3THV A;  2MKK A;  4DV1 F;  4DV5 J;  1RBA A;  3CMQ A;  2XO6 A;  1OIA A;  1V6H A;  1KQS R;  2YNI B;  1RU1 A;  4NWB A;  4ZLJ A;  4X64 F;  2JFD A;  3CDA A;  1VQL S;  5C2G A;  4KKO B;  3CIM A;  5F8M A;  1FEE A;  3FBB A;  2DH9 A;  5KFB A;  2ACY A;  4JYA F;  5T14 A;  1VGY A;  2V63 A;  1WEX A;  1DTQ A;  3NEK A;  4ED0 A;  4OX6 A;  1EHW A;  1R8P A;  2YWG A;  1PAE X;  2ASL A;  2YX7 A;  2VG5 B;  3QWU A;  2BE7 D;  2UXD F;  2DNL A;  2GV1 A;  1RHM B;  4NLX A;  1EQ0 A;  3AD8 C;  4DFP A;  1S0M A;  1NEE A;  2FLP A;  2CJK A;  5KFA A;  4NLY A;  4LFC J;  3P4U B;  3PW5 A;  1HBN A;  2A18 A;  4Y34 A;  3LQV A;  3I9Z A;  1XBW A;  1N32 J;  4LF5 F;  5AE2 A;  3AB4 B;  3FGV A;  4CRJ A;  5D6G A;  4XPE A;  2C2Z B;  1TV6 B;  1QTN B;  1U02 A;  2BE9 B;  2KFN A;  1SH0 A;  2CPH A;  1IKY B;  1A7G E;  3ONQ A;  4U96 A;  3DLB A;  3HFZ B;  1KHK A;  1NRK A;  4OV1 A;  4CZC A;  1S5Z A;  2I2Y A;  4M1K A;  2M4M A;  1EET B;  1MWQ A;  4DF4 A;  4UPH A;  2V50 A;  2HFZ A;  1T0T V;  2YH0 A;  4ID5 A;  3FBF A;  3EDR B;  4OYP A;  3OTO F;  2H5J B;  2JHE A;  4TQR A;  3M1V B;  1J27 A;  1S9E A;  2OSR A;  1WEY A;  1VHI A;  4X66 J;  2RRA A;  1QY7 A;  3JQJ A;  1BWE A;  2IJN A;  1UA1 A;  4CLP A;  1MNE A;  2CDR B;  4OHW A;  2W2Q P;  2HMI B;  2Q6B A;  3UR0 A;  3KK3 B;  2D9O A;  3BQ1 A;  4NXM F;  4MKB A;  1WG1 A;  2AJQ A;  3T9N A;  3MM6 A;  2XSF A;  2C2E A;  2FY8 A;  4DUY J;  3LAK A;  3ENA A;  4IG3 B;  3K5N A;  1JXL A;  4I67 A;  2LQJ A;  1NK5 A;  2KDO A;  4ECR A;  1S1W B;  3C6U B;  4NZ6 A;  4LF5 J;  3DKD A;  3M8Q B;  4PRF A;  5ETV A;  4OYW A;  4Q44 A;  3EXY A;  2CQP A;  3D2W A;  3QGP A;  3DOL A;  2LEC A;  2E9R X;  2DH8 A;  4ANE A;  1H72 C;  2ZH2 A;  3MCO A;  1QVG R;  3WX8 A;  4NA3 A;  3G6X A;  1HPZ B;  3GIJ A;  1NKE A;  4DL0 C;  2P9C A;  3HDS A;  2D3O R;  4ZP9 A;  3VR1 A;  4RNF A;  2G1H A;  2R3V A;  2ZE2 A;  3E3X A;  3OR1 B;  2FY1 A;  3J7Z 5;  1RT1 A;  3AY0 A;  2YH1 A;  4NEY A;  1ZAV A;  4R0E A;  5TJ3 A;  3I9V 9;  2HHW A;  2OO4 A;  5ETM A;  2L9D A;  1HW8 A;  4TY9 A;  2QYG A;  5L1J A;  1RAE B;  2P5V A;  4KFB B;  1ZEB A;  4LQ3 A;  2EFP A;  3DRS A;  1U8W A;  2MLX A;  3O44 A;  3CC2 S;  3MM7 A;  1RT5 B;  2C28 A;  1YJW S;  5A76 A;  4ANC A;  2V4J B;  2RUG A;  3NBP A;  5CA5 A;  2MKH A;  3IG1 A;  5DZ7 A;  1VQ8 S;  1EW2 A;  1CJV B;  3G82 A;  4HYK A;  2LP4 A;  1X5S A;  1MN7 A;  3CCW A;  3DC2 A;  2DGV A;  2ALY B;  3CE8 A;  2ZHO A;  3U1M A;  4XAK A;  3NP5 A;  1FER A;  1LXN A;  2F1F A;  5IFM A;  1D0E A;  2MY8 A;  3LAN A;  4K4T A;  2CJY B;  1RWK B;  1H2V Z;  4DJB A;  1S6Q B;  2Z2M A;  1WC5 A;  3K8V A;  2DO4 A;  4IG0 A;  1WHX A;  3JAM Y;  3ITH A;  4EBC A;  1BQM A;  1VIO A;  3TZW A;  1MMD A;  3HSG A;  5KG3 A;  4H4M A;  1EJ7 L;  2QLJ B;  4FZV A;  4HL9 A;  1D8Z A;  2YPY A;  2FYX A;  3CJT A;  1FE0 A;  1H6K X;  1TKZ A;  4ZPT R;  1VC0 A;  1RAI B;  1UW9 A;  1H0H B;  1LK7 A;  3KJQ B;  2EFQ A;  4B08 A;  2ERR A;  3ZC4 A;  2UU9 J;  3BKU A;  3HVT A;  4JV5 J;  2W25 A;  5AT1 B;  4JI8 F;  2IFX A;  5C25 B;  2ATC B;  2QO3 A;  4JI5 J;  2D3U A;  1KLN A;  2BJD A;  1Y5N B;  2BJE A;  1K0V A;  2W5X A;  1RWU A;  1VYA A;  4BHQ A;  4MKV A;  5LM7 E;  4GC6 A;  5DQI A;  4C9D A;  4RBV A;  4DQQ A;  1B70 B;  4UQT A;  1RXO B;  2CPI A;  5A8W B;  3MTJ A;  3IS9 B;  3ZNJ 1;  1VQY A;  1SCJ B;  4GVB A;  1CJK A;  2WW4 A;  2XCP A;  3RR8 A;  3AB2 B;  2I5J A;  4R0J A;  2JOQ A;  2GNK A;  4TQS A;  5A6P A;  3RAX A;  1RT3 A;  4OX8 A;  3G4S S;  2MQ8 A;  4QU6 A;  3AA8 A;  2HLU A;  4RPF A;  3BGF A;  2RDJ A;  3CJ2 A;  3IWL A;  4EBE A;  3MWB A;  2HHS A;  2FD2 A;  1OSD A;  3C66 A;  4CQ1 A;  4IKA A;  2VKZ G;  1JLG B;  1UW4 A;  4TY8 B;  4Q5V A;  4CLU A;  4YY3 F;  5FDL A;  2CPD A;  4EUV A;  4AD6 A;  4A8K A;  2J0X A;  2Y0S D;  1K1S A;  3UO0 A;  1RWW B;  2UUW A;  4MIW A;  3R5G A;  2V67 A;  2DYA A;  4HVZ A;  2NCK L;  4B17 A;  4LF9 J;  5G0R A;  3N6L A;  1FSU A;  4KV8 B;  1MWZ A;  2VFV A;  1M5H A;  3NS6 A;  2HHU A;  2W9C B;  4DLG A;  2VQR A;  1KWM A;  4DF8 A;  5GVQ A;  4M5D B;  3AD9 C;  4GTX A;  3D6F B;  5D15 A;  3QRR A;  3DLK A;  1ZA2 B;  1ZAW A;  4BC9 A;  4I7F B;  3V4I A;  1IN0 A;  2LQ5 A;  8ATC B;  2UXC F;  5J1E B;  1FRL A;  1N5Q A;  1B7Y B;  1FXR A;  2NUH A;  4LR8 A;  3BN7 A;  1KQK A;  3PKY A;  2DCU B;  4U95 A;  2QL5 B;  1C0T A;  1T9X A;  3K5P A;  5ETK A;  3O5T B;  1GXL A;  4RW6 B;  3FCH A;  1RWP B;  3NNC A;  1KON A;  4DN9 A;  2GIF A;  5LL6 d;  4DMZ A;  1N6Q B;  1HI1 A;  1NO8 A;  4UPK A;  4FDI A;  5LMN F;  3LP0 A;  4IH5 A;  2OAU A;  1JLF A;  3Q24 A;  3DMJ B;  3MM9 A;  1R8A A;  3OD2 A;  2GO8 A;  3R7B B;  3M2V B;  1FES A;  3J7A N;  2W2N P;  4RJV A;  2U2F A;  3GTY X;  1XNR J;  2NXN A;  4NWJ A;  4ILM A;  4P2F A;  4CXU A;  4ZOS A;  2VV5 A;  2DHA A;  2X51 A;  2XBP A;  1YRX A;  5LJ5 Y;  2J6T A;  4J9S A;  4MFB A;  4YQW A;  3IXQ A;  1TL7 B;  4RW9 B;  4KSE B;  2M8D B;  1D9A A;  1AFJ A;  3C14 B;  1P1T A;  3S7R A;  1SJF A;  2W5W A;  2BR0 A;  1URA A;  3HUL A;  2GO9 A;  2N4C A;  4F4X A;  4OX9 F;  4DX8 H;  1X0F A;  2V0N A;  1RTH B;  4QPT A;  4KHP J;  1U4B A;  1RTI A;  4JI6 J;  2KO1 A;  1RWV B;  1LFP A;  1FCA A;  5E3P A;  3CWJ A;  5C24 A;  4J37 A;  4Z7Y A;  4DEZ A;  2K1R A;  1QM9 A;  3M6V A;  2MPU A;  2POK A;  4QWB A;  1ITP A;  1X4G A;  3J7A 1;  4ECS A;  1S6P B;  4USI A;  1N5Y A;  1PYT A;  4Z37 A;  2VPY B;  1RDR A;  3H5Y A;  1X9W A;  3V6K A;  2KT5 A;  3HXM A;  4KFB A;  1SL1 A;  1L3K A;  4TN2 A;  2DY9 A;  2AU0 A;  3TZZ A;  3G6Y A;  2VG7 A;  2H54 B;  2VIC A;  1RLD A;  2YXL A;  4B3S F;  2KFZ A;  1JQG A;  1SXL A;  4RR5 A;  2BQU A;  4NCB A;  5C7P A;  3OSN A;  3UDL A;  3ZTQ A;  1S57 A;  4CLZ A;  2HVH A;  1BY9 A;  1U0H B;  1YJT A;  3FFI A;  3BDP A;  2FVQ A;  3UWT A;  4F4W A;  3UE2 A;  5ETO A;  4U9R A;  1U1O A;  2OTJ S;  3HK2 A;  2GJF A;  3AFG A;  4WE1 B;  2DXE A;  3J80 Y;  1ZPW X;  2OPQ B;  1UFK A;  2HFN A;  4IR1 A;  2HAF A;  2GCF A;  1NPK A;  4LQ9 A;  1AW0 A;  2YTC A;  2HQC A;  2IA0 A;  2ZH1 A;  2R7T A;  1DUR A;  2ROP A;  3A12 A;  1MRO A;  3PX4 A;  4CLK A;  4DR1 J;  3BO4 A;  1HNZ F;  1HYS B;  1Y10 A;  2H48 B;  4Y2K A;  1PGZ A;  5KG5 A;  3JTP A;  3GV7 B;  3FQK A;  2X3D A;  3Q2S C;  2ROG A;  1ROF A;  4L74 A;  1RWO B;  1SKU B;  3EYZ A;  2F7V A;  2J9D A;  1QLN A;  1RU2 A;  1HNV B;  9ATC B;  4CTA B;  4EO6 A;  1QJH A;  2DNY A;  4MHX A;  5H9E K;  1YSJ A;  4GKK F;  3K0J A;  1F9H A;  1RIS A;  3R7N B;  1R89 A;  2R9L A;  4FF3 A;  3L7P A;  4F3O A;  1O8B A;  3IGZ B;  2WVE A;  2V2V A;  4I4B A;  2Q43 A;  4B3S J;  4ZG7 A;  1UVN A;  2DNM A;  5EN1 A;  5JJB A;  2OEK A;  4TYB A;  3WC2 A;  1NLK L;  3MDF A;  4LFA J;  4LQY A;  4PQA A;  4IH6 A;  2LQ9 A;  1C1B B;  3DM2 A;  3T1H J;  4JP8 A;  2MB0 B;  2GAH C;  4Q43 A;  4F0K A;  3V2U C;  3PXG a;  4Y00 A;  4OHV A;  1AT1 B;  1RYS A;  3NRB A;  4MIV A;  2DVI A;  2X1A A;  1V3R A;  4WF9 Q;  2Z0G A;  2WBM A;  5DDQ C;  4TVA B;  2LFV A;  1W26 A;  3HJF A;  3MI7 X;  1GMW A;  5AJ3 F;  4QIF A;  1DTT A;  4Y2A A;  5KFY A;  3IRX B;  1T8E A;  3HZG A;  2X3G A;  1HNZ J;  3FDS A;  5B7W A;  2HWI A;  2KU7 A;  4I0W A;  5F0W A;  2IYG A;  1VQ5 S;  5HVH A;  4P2X A;  2AYE A;  2EKY A;  4O44 A;  1PAU B;  3VHQ A;  4J90 A;  2MTL A;  1KTV A;  2VDH A;  3IM9 A;  3M6W A;  1WF1 A;  4WII A;  2W5S A;  3RGI A;  2KXF A;  2QN6 B;  2WON A;  1FHT A;  3W2W A;  4USU A;  2VOP A;  2EXU A;  3DYA B;  2XR9 A;  3HHL D;  1L3V A;  3ISZ A;  1KHL A;  1VLY A;  2HBR B;  3DN9 A;  1H98 A;  4RNH A;  2WSC C;  5LMU J;  3JQK A;  4CM0 A;  2CZV C;  1Q5Y A;  2B56 A;  3MK0 A;  5A8R B;  1OPI A;  2ASD A;  4HDG A;  2KVQ E;  1SL2 A;  4S0M A;  5FLX Y;  3CCE S;  5ETT A;  1U09 A;  4C8N A;  4NML A;  3SQG A;  1HNX J;  3LA0 A;  3HFK A;  2MJU A;  2V34 A;  3DDN A;  3LAL A;  1TL7 A;  2LA6 A;  3H59 A;  1XNQ F;  4Q45 A;  3CNQ P;  4P75 A;  3N28 A;  4J9L A;  1PC5 A;  4HAC B;  3ZZY A;  4TU9 A;  4NX9 A;  2BAC A;  2JVR A;  5HMW A;  4O4R A;  1RT2 A;  1MLA A;  4GVL A;  2XS5 A;  1WKJ A;  3CCR S;  3CUL A;  2XY5 A;  2AW0 A;  3JSY A;  4FXV A;  3TJA A;  4M95 A;  2DRA A;  3AJ2 A;  4FXD A;  3IR6 B;  2AF6 A;  2YQ1 A;  2QLW A;  2W7P A;  2E66 A;  4ZP8 A;  2ZZN A;  4XK8 C;  3MAA B;  4G3I A;  1LW0 B;  1Q8I A;  2R2U A;  4F4K A;  3T41 A;  1FRJ A;  4HI1 A;  5KFW A;  5J2N B;  3PO4 A;  4MH8 A;  2DO0 A;  3PYD A;  4HKQ A;  2OKQ A;  5K9F A;  5F8G A;  3MFH A;  2MKS A;  4LF7 J;  1KHJ A;  2YNG B;  3MK1 A;  2LXU A;  4H4K A;  3OV7 A;  1S7I A;  1S1U B;  3A4T A;  4UPL A;  4GKJ J;  1OYE A;  3PRB A;  4FYY B;  2J7K A;  4C8O A;  2B51 A;  2JSX A;  4G6V B;  3Q89 A;  2JWN A;  3ISN C;  4JI0 F;  1IKV B;  3W63 A;  2E5I A;  4YUD A;  2R7R A;  1YX2 A;  1I1G A;  3T5J A;  1KEK A;  1U0H A;  1U49 A;  3MEC B;  3Q23 A;  1RKI A;  4NYO A;  2HND B;  1JXE A;  3MR2 A;  4OYI A;  1BGX T;  1YK9 A;  1FNO A;  1VRT B;  1XMB A;  2KYX A;  2KT2 A;  5KG7 A;  3LP1 B;  2IIH A;  4KQZ A;  1G2E A;  4PQU B;  3EE3 A;  3JTO A;  3W66 A;  2J0S D;  2H4Y B;  2F4V F;  1UFL A;  1E3C P;  1NBE B;  2H51 B;  4QU7 A;  2P6S A;  2W9A A;  1D8Y A;  3SFG A;  4BWJ A;  4CNY A;  1XMQ J;  3DOK B;  3AOA A;  2XI2 A;  3AXM A;  2C22 A;  1N2L A;  3DOM A;  2XQC A;  3IMQ J;  3V5R A;  4CLS A;  4IYQ A;  3UVJ B;  4QJV A;  1M5V C;  3GB0 A;  2CVE A;  2XMM A;  3LWL A;  3W1Y C;  3SZY A;  5CYQ B;  4DL2 A;  3DHX A;  4ZCM A;  4O3O A;  3HSZ A;  4KM4 A;  2RVJ A;  2N4D A;  4PWD B;  2XTJ P;  3Q8Y A;  2G0I A;  4JI1 J;  1B7F A;  2C3O A;  2HLT A;  3JYT B;  5HN0 A;  1JLQ B;  4JBC A;  4CLY A;  1HNI B;  2G13 A;  2NLW A;  3I87 A;  1HQE A;  3H25 A;  4HR2 A;  2R7S A;  1QAX A;  1NSP A;  3H5U A;  5AE3 A;  3VAJ A;  2RML A;  2QTW A;  3KJN B;  4PWU A;  3SCL E;  2BAN B;  5IM0 A;  3MAQ A;  3R2D J;  3IWX A;  1IVZ A;  3KD8 A;  4Y2C A;  2NUU G;  1ZM2 A;  5BR8 F;  3I5C A;  2L9W A;  3PR4 A;  1YBA A;  4H4O B;  4IQM A;  5H9F J;  1H7W A;  3QZ7 A;  2VDI A;  4P74 A;  2KXN B;  1K8A T;  3VQS A;  2RQC A;  1WC1 A;  1ZED A;  2C2O B;  4UOP A;  4F0M A;  1AA1 B;  1FRI A;  5C66 A;  5DQG A;  4RNN A;  1X4D A;  4OZ0 A;  4X62 F;  1LWC A;  1LKZ A;  4ZPB A;  1ZET A;  5K5M A;  2B8P A;  1OYD A;  3TA1 A;  2HRT A;  1SJ3 P;  3KWM A;  2BUN A;  1QUV A;  2VKR A;  2BW7 A;  1Y3K A;  3D66 A;  1NSQ A;  2ZH3 A;  3TUZ C;  2RSQ A;  3UDC A;  2CXE A;  3IGV A;  3NG8 A;  4HHH A;  3FKB A;  3O6Q A;  6FD1 A;  1T95 A;  2Y9H A;  2R7U A;  2VH7 A;  4OX7 A;  2YX4 A;  4OYA A;  4LMZ A;  3I5A A;  1UTA A;  5C42 A;  5KFG A;  3H42 A;  3U1N A;  4YB1 P;  2HFU A;  3TUI C;  2AWZ A;  4ETZ A;  4KBI A;  5A8R A;  3AQO A;  4A48 A;  4NLD A;  1PJ6 A;  4ETX A;  2E5G A;  3CED A;  3RB3 A;  2L3M A;  2DGW A;  4OZ1 A;  1KR4 A;  5HMX A;  1ELO A;  3TG0 A;  4YME A;  4K4U A;  3E01 A;  2WB1 D;  1JLC B;  1URR A;  3QO9 A;  3C15 A;  4I68 A;  5I42 A;  5HMY A;  4DPW A;  4WJB A;  3PO5 A;  4DR4 F;  4HAC A;  1HR0 J;  3JSM B;  3KK1 A;  1RP5 A;  1XEZ A;  4NAS A;  4BC7 A;  4PG8 A;  2CJB A;  3LAM A;  1YDL A;  2YVS A;  5D4N A;  1U1L A;  3NKR A;  1PKU A;  3HX9 A;  4GC7 A;  5DDR C;  2W01 A;  2J8S A;  1JKH B;  2M8H A;  5KFM A;  2PI4 A;  2LEB A;  4G1Q A;  2DTJ A;  2Z2L A;  1H2U X;  4K0K F;  2ZH4 A;  2VC0 A;  3KKF A;  3QGG A;  2AEF A;  3RU0 A;  1S77 D;  3HZE A;  4DV0 F;  3DLJ A;  1FKO B;  2Z56 B;  1W25 A;  4OIX A;  5HBM B;  3GFZ A;  2D41 A;  5KG0 A;  3PHT A;  2PA3 A;  3HKZ D;  1RKJ A;  3OSP A;  2OP5 A;  1Q86 T;  4FN5 A;  4KR0 B;  3H5X A;  3F41 A;  2IBO A;  1O98 A;  5M2R A;  3OXL A;  1VBZ A;  5DLF A;  4YS2 A;  4ECW A;  5E3Q A;  1IBL J;  1SQG A;  1I3O B;  5AXL A;  4DCP B;  2CPZ A;  3BSA A;  3BBF A;  4V19 J;  1P49 A;  2VBZ A;  3MFI A;  1NCL A;  1TK0 A;  4W4M A;  4B3R J;  3BRE A;  4NE9 C;  5L1K A;  1YJ7 A;  1C4A A;  1BQN A;  3BEG B;  4OHY A;  1R6V A;  1UEV A;  4DR3 J;  2MQM A;  2MZS A;  3C8Y A;  2B9Y A;  2KT3 A;  2H5E A;  2K8G A;  4ZVF A;  5KFR A;  3CJQ A;  3ZZR A;  4DV2 J;  3C2P A;  4DV6 F;  3NKQ A;  2CFX A;  1GMV A;  2YKO A;  4RNM A;  4R5P B;  2B4O A;  2C1E B;  3QAT A;  2YQ3 A;  3NNH A;  4G65 A;  5LQQ A;  4RO0 A;  2MY7 A;  3B82 A;  1JJH A;  3VQT A;  1M1K T;  3VGU A;  3GU0 A;  2HWT A;  2IAJ B;  2XSJ A;  1NDK A;  4BWM A;  3EGZ A;  5L1I A;  2AGQ A;  4ZIW A;  5CD4 H;  3GIL A;  2AT1 B;  3RBD A;  1IR0 A;  3TAR A;  2DH7 A;  4N76 A;  1WI6 A;  2XLK A;  3NGU A;  2NXE A;  2YNF A;  4MKA A;  4C11 B;  1N36 J;  2QL7 B;  4K0K J;  1WTB A;  7AT1 B;  4J9Q A;  1FKP B;  2FJB B;  5A6W A;  2EFO A;  5CYQ A;  1VQ4 S;  3UD3 P;  4X4T A;  2JLG A;  2GGP B;  4X2B A;  3ICL A;  1RBL A;  2BE2 A;  2PT0 A;  3CDE A;  4PPD A;  2MZT A;  2QE5 A;  1X60 A;  4LSN B;  1T9U A;  1HWU A;  3QLH B;  1T3O A;  4KB7 A;  3CT9 A;  3VGT A;  4ECQ A;  2M7S A;  2UVW A;  3A3P B;  3GE9 A;  1M5S A;  3AOD A;  5K8M A;  4B3O B;  1KVJ A;  3KLI B;  4PXE A;  2RRB A;  1EB0 A;  1RWX B;  4DU7 A;  1IBK F;  4JB8 B;  4JI4 F;  1AUK A;  1N5S A;  1LWF B;  3W2V A;  4JV0 A;  4FBT A;  4EYI B;  4AQY F;  2EVZ A;  2IM1 A;  1VJW A;  4H4O A;  2APO A;  4YR3 A;  4IFV A;  1DY3 A;  3VF0 B;  3KJV A;  2DY1 A;  4MK7 A;  1TAQ A;  1TVR A;  3HJV A;  3MR3 A;  5GAD I;  2DD8 S;  1EX8 A;  5KT2 A;  1G3O A;  3FNN A;  1G6B A;  1VQ9 S;  3PW0 A;  4URQ U;  3EGN A;  2ZD1 B;  4YDX A;  4JI7 F;  1QE1 A;  5DGB A;  1VCT A;  3MHY A;  3LGH A;  2XI3 A;  3C46 A;  3BV8 A;  3OFG A;  1AFI A;  4UOF A;  3IC1 A;  4K4W A;  2R2S A;  3GSI A;  3D67 A;  2JLE A;  4DV7 J;  1RGV A;  3OTC A;  2BQR A;  3K5L A;  2AX0 A;  4NZ0 A;  3T5K A;  1PSD A;  5SUH A;  4QBU A;  2CPF A;  2XS7 A;  3FSX A;  4CIO A;  4DN0 A;  2GSN A;  1JLE A;  4M5K A;  1DBD A;  3CXC R;  1Q7L B;  1Q81 T;  3BJY A;  4OI2 A;  3M6U A;  4UY8 T;  3PV8 A;  1P9Q C;  1Q8L A;  4DOZ A;  1RAO A;  4NCA A;  5E3C A;  2G2Z A;  1ALK A;  1QDU B;  2W24 A;  3G8Q A;  5HRT A;  3H7H B;  3GV8 B;  2R7W A;  1UP1 A;  4DCO B;  2FVS A;  1X7V A;  2PEH A;  2CZ4 A;  1G4C A;  1DQA A;  1OS5 A;  2QZU A;  3BQ2 A;  3Q3Q A;  5K14 A;  3T00 A;  5EWF A;  3DGP A;  2W8D A;  1RJJ A;  4LF4 J;  2FIU A;  5CYM A;  3QT6 A;  2LA4 A;  2W2M P;  3BDF A;  1VLO A;  3H0P A;  4HT7 A;  1S1T A;  1YIT S;  2Y1I A;  4ZP7 A;  1S1V A;  4I6W A;  4YHH F;  2MKI A;  2FLN A;  3ILJ A;  2NPI A;  3AOC A;  1Y0H A;  1TKD A;  3I6P A;  1RTZ A;  3HVA A;  4OYZ A;  5DZ6 A;  4Q8F A;  4PG7 A;  4JI7 J;  2NR0 A;  1NJY A;  2Y8W A;  1FD2 A;  2VQE J;  2EBG A;  3P8B B;  2IFY A;  2LDY A;  2AKW B;  4B9L A;  3V81 A;  3D1H A;  4WXW A;  3MUT P;  4E8U A;  1JKH A;  2XG8 A;  1GMU A;  3CCQ S;  4IH7 A;  3MCN A;  1LW2 A;  3OTD A;  5DM7 Q;  1RTJ A;  2PMW A;  3LWM A;  1X4B A;  4DR7 F;  2D3Z A;  4USH A;  2MXY A;  3GIM A;  3GQC A;  4L72 B;  5CZV A;  2YQ0 A;  1TUV A;  1SHN A;  3G2X A;  1TKT B;  2HGN A;  1WC3 A;  1LWE B;  2FVP A;  3UI3 A;  1FWP A;  4B3T J;  4WKY A;  4GO5 X;  3EGW B;  5CCL A;  3GII A;  4YR0 A;  2XB2 D;  4CH1 A;  2BJ3 A;  2C2K B;  3CMA S;  2YWW A;  4K4Z A;  5DM6 Q;  2JZ5 A;  4CO3 A;  2MGZ B;  4ICL A;  1P27 B;  4KO0 B;  1Q79 A;  2V6A A;  3NWG A;  2XWY A;  1RT6 B;  1KQF B;  4MYU A;  1HA1 A;  2ZM6 F;  2C3M A;  1X5T A;  2B7B B;  1FDB A;  5IQQ A;  5HP1 B;  1GT8 A;  1CJT A;  3SDE A;  1ELZ A;  1UET A;  1XTZ A;  2VG6 A;  4Q8E A;  3DXS X;  2K7K A;  3AAW B;  1N5V A;  4KJD A;  1ED8 A;  1GH8 A;  2E5L F;  1S10 A;  4HT5 A;  3M30 B;  4B9S A;  1UKU A;  2LLZ A;  1X4H A;  5IOL A;  3DLG A;  2F8H A;  3V6D A;  4IO1 A;  5E0O A;  4K4X A;  1V3S A;  3CME S;  2D69 A;  3OL7 A;  2ZBC A;  4K2J A;  3HD2 A;  2V8H A;  3LP2 B;  1Y4Z B;  3VTI A;  5HRO A;  3KJF B;  2C2D A;  2M52 A;  2ADB A;  2GMJ A;  1RAD B;  3VAI A;  2JH3 A;  4PXD A;  1VRU A;  2CPY A;  4I2P A;  1FKP A;  4NRU A;  2Y1L B;  4MY4 A;  1ZTW A;  1VQS A;  4DFM A;  3U1L A;  4JUZ A;  2JL9 A;  5RUB A;  3MEE A;  2OTL S;  4F02 A;  3HO1 A;  3OLA A;  1BC6 A;  2K7J A;  5KFO A;  1VQ7 S;  1E33 P;  2FZK B;  1D09 B;  3NCP A;  4LBP A;  3BR8 A;  2N3O A;  3R7S B;  4C3M A;  2HPU A;  2DNK A;  2COL A;  2ROE A;  5D3G B;  3C6T A;  1KVK A;  1HKA A;  4IUF A;  1WOP A;  2HVE A;  2RU9 A;  2VOO A;  4DSK A;  3D6M B;  1NB7 A;  1C1C A;  1A6L A;  1ZM4 A;  2VAS A;  3KUE A;  3GPA A;  1NU4 A;  1YTY A;  1S0N A;  2PI5 A;  1HQU B;  2Z57 B;  2ABY A;  1SQF A;  1RBO B;  3NMA A;  3MMB A;  4OYO A;  4RW4 A;  4MKY A;  1TEL A;  5KG1 A;  2IRY A;  1U1M A;  2UUT A;  4KGK A;  2CQ1 A;  1F5B A;  3IGN A;  1KFD A;  3QIP A;  1CSJ A;  2LKZ A;  2HYI B;  2R7O A;  3ZTS A;  5J2M A;  3ZZT A;  1E2S P;  4DL7 A;  1CC8 A;  2CNL B;  2LEA A;  4HH1 A;  1XR5 A;  2FJD B;  3TQE A;  3TJ8 A;  4ZN1 A;  4O3R A;  2JJ4 D;  4FDF A;  1WI8 A;  2RF2 B;  1UVK A;  3AD7 C;  5IWA F;  2ZOG A;  1JNR B;  3ILO A;  5BJR A;  2ZUA A;  3D3B J;  5HJY A;  4Q0B A;  1TP7 A;  1K7H A;  1PIE A;  5T41 A;  4OJ3 A;  2NRE A;  3DYC A;  2A2D A;  3GJT B;  3KUG A;  2QRR A;  2OPP A;  3K5O A;  2H4W B;  4X65 F;  4NLU A;  3JSR A;  3FBE A;  2ZC4 A;  2NPF A;  2W7O A;  4OV6 A;  5IJS A;  3HM9 A;  4OZ5 A;  5F8N A;  1MU2 A;  1Q4R A;  2DHX A;  3CDW A;  2FC9 A;  2OSQ A;  4ZG9 A;  4FP9 A;  1W7W A;  3D7S B;  3CCJ S;  2ATL A;  4DU8 A;  3HHL A;  1XMO J;  2E7W A;  3N6N A;  5M2U A;  4NA1 A;  4KGZ B;  3H4B A;  1F1B B;  2XHW A;  1DZ5 A;  4V1A k;  1O5J A;  4M8L A;  2YKM A;  3K89 A;  2B5J B;  2X7I A;  2J7W A;  4TNO A;  5EWE A;  2XGQ A;  2V94 A;  3W9H A;  2MJN A;  4ZVT B;  3DPC A;  5J2Q B;  3CCS S;  4OJH A;  2YKP A;  2CPX A;  3BBB A;  3AQP A;  2WTF A;  2ZH9 A;  1DFD A;  4NCG B;  3MUV P;  1EKR A;  3PEH A;  1KHW A;  5K8N A;  4WCE Q;  3N79 A;  2GML A;  3MMJ A;  3Q0A A;  5F0U A;  2KXH A;  2B43 A;  3K2Y A;  4KH1 B;  3PX6 A;  4OI1 A;  5EDW A;  1E6V B;  1B0V A;  4ZLL A;  4IFY A;  4AE5 A;  3TX0 A;  4WZM A;  1SC3 B;  3POT A;  2CQ3 A;  1JLA B;  1Q78 A;  2KG1 A;  4R8U B;  3Q8U A;  5DQH A;  1LFW A;  4NOH A;  4C8L A;  3TW0 A;  2IC3 A;  2QX0 A;  3BGU A;  3OVS A;  3CD0 A;  3G87 A;  1RT4 A;  2EG2 A;  1SC4 B;  1YI2 S;  1GQE A;  5HLF A;  4EU0 A;  2FZC B;  3GSD A;  3VGV A;  4PAB A;  3D6T B;  2EWH A;  4TKT A;  4B56 A;  3IWN C;  2H65 B;  5KT4 A;  1HW9 A;  4CNZ A;  2ZBP A;  1HL6 A;  2R7Q A;  1YG0 A;  3UN5 A;  4NEZ A;  4O3S A;  2R2R A;  4DV3 F;  1IJF B;  1UJ5 A;  4KHM A;  2PFF B;  4JI3 J;  1DTQ B;  2YWH A;  1FDN A;  4OHZ A;  1HI0 P;  2PN6 A;  1NK7 A;  4DR6 F;  1ZPV A;  1SKR A;  1M1G A;  4RL1 A;  1RAG B;  3PEJ A;  4CXS A;  1J5E J;  2AP6 A;  1U1R A;  3KXD A;  2XZW A;  1HBN B;  4ATN A;  4A4J A;  3RYL A;  2FHM A;  5JVH Q;  4F8R A;  1NB2 A;  3R6L B;  1HHS A;  1S59 A;  2ZNY A;  3Q8V A;  3O2I A;  4M5N A;  1AYE A;  4Z7C A;  3BH6 B;  4WFB Q;  1GMW D;  3KG1 A;  1U6B A;  3EVO A;  3A3N B;  4ZVG A;  3S8S A;  4AXI A;  5GAD U;  3VAM A;  1KHN A;  4CM2 A;  2ZJQ Q;  1WKK A;  4B9M A;  1LWX A;  3J7Y I;  2X1G A;  3WQP A;  3WAV A;  4ID5 B;  2KFY A;  5CAB A;  2UUB J;  2W4D A;  1P9Y A;  5DG9 A;  3EDQ B;  4DWI A;  1S9E B;  1SUQ A;  1Y11 A;  2XHC A;  4ALZ A;  1Y9O A;  6FDR A;  4C8M A;  1KLM A;  4O3Q A;  4J9M A;  3KNA A;  3CJ5 A;  2XMV A;  4ZA1 A;  1YVF A;  4NI2 A;  4JI2 F;  1F2G A;  4URG A;  2BMB A;  3MM8 A;  2LVW A;  4RLE A;  1W2B R;  2C3P A;  1JMT A;  2LMI A;  3G8S A;  1G7C B;  3TA2 A;  3O8W A;  4EZ6 A;  1TL1 A;  3MEG A;  2GC8 A;  2VC1 A;  2W8K A;  3M8Y A;  3BGR A;  2J7U A;  2GA7 A;  4DUZ F;  4X4O A;  1GEH A;  2R42 A;  4FF1 A;  3LO3 A;  3AJ1 A;  1WJ9 A;  1JNZ B;  4DR2 J;  4QIW D;  3H40 A;  3CC4 S;  3MM6 B;  2CQC A;  3D0G E;  1P8G A;  2PO4 A;  5MAO A;  1HDH A;  3FCW A;  4PG4 A;  2F40 A;  4IOC Q;  3TWZ A;  2IYI A;  2RS2 A;  3T19 A;  3FZB A;  1B0T A;  4KJG A;  1U7L A;  3GG0 A;  3LOU A;  1BD6 A;  4ZPC A;  2DGS A;  2XYH B;  3B78 A;  4LF8 F;  5L9N A;  4OI0 A;  1AXQ A;  3MCM A;  1PJ5 A;  5DG7 A;  2E9Z A;  1EP4 A;  2GHV C;  3M8P A;  3NGD A;  2F65 A;  1HBU A;  2ZFH A;  2KHC A;  2ZE2 B;  1NJI T;  3HKW A;  4QYR A;  2GLQ A;  1URN A;  1RT1 B;  4EI2 A;  1L5U A;  2WHO A;  3GWC A;  1R8B A;  4LSL A;  2V69 A;  3MUR P;  3H2V E;  5CD4 A;  3KFW X;  2B9W A;  2GS8 A;  4Y28 C;  4RWX A;  2IRU A;  3BR9 A;  2DXF A;  3DRS B;  2HHH J;  2FHJ A;  5KXA A;  3LUY A;  3MM7 B;  2CJQ A;  1YLX A;  2UVR A;  2YKN A;  3NBP B;  4G1P A;  3IG1 B;  4LFB F;  2MZJ A;  3G82 B;  3J81 Y;  4USM A;  5H9F K;  3A8J A;  4P72 A;  2V5H G;  3M9N B;  1HBO A;  1NND A;  4F4Z A;  2FJE B;  3AHP A;  4CT9 A;  4K4S A;  2XMK A;  1NHU A;  2FZG B;  1R0A A;  1HWK A;  2IMO A;  2ASY A;  1C4C A;  1FJG F;  4IG0 B;  5L8R C;  5IT4 A;  1ANI A;  2K06 A;  3JQM A;  3Q2T C;  2HHV A;  1Q8B A;  4WFY A;  3ITH B;  4ED4 A;  4F3Q A;  1BQM B;  2ILY A;  1IBM J;  1J5O A;  2WK4 A;  1EAR A;  2DNP A;  4H4M B;  2DIT A;  4USK A;  2R8G A;  2HK3 A;  5IT9 Y;  1T94 A;  1E1Z P;  5U47 A;  1HLW A;  1B64 A;  3ENQ A;  4N77 A;  1LQ9 A;  3MMC A;  3U02 A;  2AGP A;  4QPX A;  1V5V A;  1VC6 A;  3HVT B;  4F2S A;  3ULH A;  5EX0 A;  3PJW A;  1UWB A;  2OPS A;  1RAB B;  4WFZ A;  2G9Y A;  3ZNU A;  3I0R A;  5KG2 A;  4ECX A;  1ZYQ A;  3Q8P B;  3MPW A;  1OY9 A;  4LF6 F;  4ED3 A;  3N5F A;  3QPI A;  2EI5 A;  5B0A A;  1R6Y A;  4UOH A;  4GVB B;  1CJK B;  1X31 C;  1WSV A;  4F67 A;  2I5J B;  2RQM A;  2KKH A;  3MR5 A;  4GRS A;  1HWI A;  4PUO A;  2BBE A;  1F6T A;  3QFW A;  4FKX A;  2HVI A;  1MWY A;  1RT3 B;  4LJM A;  4RW7 A;  3TNV A;  5A8K A;  2XZT B;  1S1X A;  5D0H A;  2GHW A;  4XPC A;  4K4V A;  3PW2 A;  3RZA A;  3T1Y J;  4FPR A;  2XNQ A;  2FDN A;  2UUC J;  3HMJ G;  3TI0 A;  3UR3 C;  5FDL B;  2MSS A;  1UVJ A;  5KFS A;  2LEP A;  1K9M T;  2FVR A;  1IQT A;  3KG0 A;  3CJK A;  2RDD A;  1FO1 A;  3T1A A;  3AXK A;  1RT7 A;  4CI0 B;  2P8I A;  5G0R B;  4QCL A;  2HBY B;  3I55 S;  5J1N A;  1WDT A;  1CJU A;  4RKU C;  1DRZ A;  1RUS A;  3MD3 A;  2DPI A;  2HG4 A;  4NLV A;  5D77 A;  5B08 A;  4DV1 J;  3DLK B;  4DR5 F;  3V4I B;  4TU8 A;  5I3U A;  4X64 J;  2VB6 A;  1K0T A;  3TVK A;  5D4P A;  3DDK A;  3CGI A;  2BKO A;  2XMT A;  1RAH B;  4J5O A;  3SI8 A;  2MQQ A;  5J2P B;  3JXO A;  3OUY A;  2CQ2 A;  4JYA J;  3RAQ A;  1WTF A;  2YKQ A;  1C0T B;  2GVZ A;  4YB7 A;  2XMA A;  5ETL A;  1SPB P;  5T7L A;  4DPY A;  1P1L A;  2VQF F;  3P3D A;  1N56 A;  2UXD J;  1KN6 A;  3LP0 B;  1HHT P;  4LF1 A;  2YY3 A;  3M7V A;  1JJ2 R;  5F8L A;  1JLF B;  1IQZ A;  3MM9 B;  4UT4 A;  1FK9 A;  3CJ8 A;  3A13 A;  1FDA A;  3G6V A;  1KH9 A;  3SSR A;  1PJ7 A;  3SCI E;  2CJ9 A;  1IR1 A;  2IVY A;  3BGO P;  1E6Y A;  3HFV A;  4ECZ A;  1RHR B;  4DG1 A;  2G9O A;  2NZC A;  4CYU A;  2BA9 A;  1X8D A;  4MFB B;  2DEI A;  1F5A A;  3VZH A;  1HNW F;  3KUH A;  1V3Z A;  4DPU A;  3FMB A;  1FNM A;  4OZ3 A;  3W5Z A;  1GX6 A;  4BCA A;  3GR1 A;  5LOQ A;  3PHE A;  2MQL A;  3C3L A;  4O4G A;  1BMQ B;  3KHH A;  4DZD A;  2DIU A;  3CD7 A;  4UUX A;  1RTI B;  2D1G A;  1SC1 B;  1JLB B;  3R5J B;  3KLG A;  2UXB F;  1WKL A;  4OYX A;  4ZHR A;  5CAA A;  2GVD A;  3OTO J;  5C24 B;  2QMW A;  3DRR A;  3VVT A;  2K1R B;  3W65 A;  2RDI A;  2DJW A;  1WEZ A;  1N5Y B;  3QRQ A;  2X1B A;  4WFN Q;  1GXT A;  3QBC A;  3NY0 A;  1BXN A;  3BKF A;  2DK2 A;  1Y3J A;  4X4P A;  3MOZ A;  3QAE A;  5KG6 A;  4PG5 A;  3CCV S;  1FA0 A;  4K4Y A;  2VG7 B;  2ZWO A;  4B9V A;  4I56 A;  2O67 A;  1R3N A;  1O99 A;  4U6P A;  4NXM J;  1NH7 A;  2B6A A;  1U6Z A;  4GTY A;  4ZVR B;  1N4L A;  3KHG A;  2N82 B;  2JFK A;  2MEW A;  4M5H A;  1TKX B;  2NXU A;  3FFI B;  3R5C A;  4U67 Q;  4NPO A;  2FJX A;  4KHR A;  1NZA A;  4ZGA A;  3HD1 A;  3KLE A;  5L38 A;  3TAM A;  1QSY A;  2QT7 A;  2CQG A;  3EMT A;  4XDD A;  1T02 A;  2GFF A;  2HRU A;  3R27 A;  3MEK A;  2EPI A;  1S6U A;  4F36 A;  2DR7 A;  4LIW A;  3GR0 A;  1TFY A;  2JRS A;  2B8Q A;  4YEA A;  3FCV A;  1MRO B;  2HBZ B;  3PY8 A;  2OFG X;  3B6B A;  3KK2 A;  5K8O A;  2IMW P;  1TQL A;  3KDO A;  1GK8 A;  4OLP A;  5IXU A;  3H98 A;  4NMX A;  4DUT A;  4EWT A;  2W1B A;  1S97 A;  4UOC A;  2QA4 S;  1C0U A;  3DRP A;  4OYB A;  2ZH6 A;  3J7Y U;  2ZBR A;  3ZZO A;  5HAO A;  4C2M A;  4B3M F;  3WBH A;  3BDG A;  1KH7 A;  1R0B G;  1Q16 B;  3RRK A;  5I3Q A;  3NKN A;  3D1O A;  2VF3 A;  4H4K C;  2MHE A;  3K17 A;  3ET6 A;  3GCX P;  4DX6 A;  4I64 A;  4CH0 S;  1N34 F;  3VAK A;  2FQQ B;  4KY3 A;  4DPO A;  5F8J A;  3RW7 A;  3EGV A;  1U25 A;  2IDL A;  5HI7 A;  3NXZ A;  3VV2 B;  4CO2 A;  5DLG A;  2VIH A;  1FKA F;  1MSW D;  1EW9 A;  5IZH A;  1PG5 B;  4IRD A;  2QC3 A;  3DM2 B;  2HNZ A;  2W4P A;  1N0V C;  5D0R A;  2AJ2 A;  2XLJ A;  2ZVS A;  1QVF R;  3I56 S;  3NWR A;  5KOX A;  1PBU A;  1YQH A;  2J6U A;  1FWL A;  1U2R A;  2AEJ A;  4ZVU B;  1WNE A;  5B0C A;  3F44 A;  2V2Q A;  2BAB A;  1JJ4 A;  1ARO P;  1DTT B;  4OYM A;  3UQS A;  2Z58 B;  5DO2 A;  5F3Z A;  1F2H A;  1BQX A;  1B8J A;  2FJA B;  3HPO A;  1RI7 A;  3D4J A;  1FF2 A;  3IA0 A;  2BM1 A;  3EIC A;  2DR8 A;  4QYZ J;  1FX2 A;  4JI8 J;  4O44 B;  1T9Y A;  4N8O A;  4IQX A;  2EKN A;  1CEZ A;  5J2P A;  1GNK A;  1U2F A;  3CJ0 A;  2PE8 A;  1N33 F;  1QSS A;  4L6V 3;  2WON B;  2A6O A;  1N88 A;  3W2W B;  1I94 F;  5H9E J;  3WAX A;  4UY8 5;  2W8S A;  1LV5 A;  5LXR A;  2G4B A;  2PGC A;  5EGH A;  3JTN A;  3SCJ E;  3I4P A;  2A0F B;  5KOW A;  1VS3 A;  4LRB A;  2FJV A;  2R8J A;  1FXL A;  1CPZ A;  4LT6 A;  4UF4 A;  4B9N A;  1Y6V A;  1IJE B;  1EQM A;  5HMZ A;  3SQG B;  2OEJ A;  1NAQ A;  4X4R A;  5JXS A;  2ADC A;  2OH2 A;  3QJL A;  3NVL A;  1R8C A;  2C2M B;  2B3T B;  4LVN P;  3DFE A;  2RQ4 A;  2FB0 A;  3KDN A;  2QZ8 A;  4YY3 J;  4KTQ A;  2GHP A;  3MPY A;  2KZM A;  4OHX A;  1WC6 A;  3I0S A;  2PD1 A;  1HBM A;  3I4H X;  2FGO A;  2DR5 A;  1YJU A;  1U1Q A;  1WD6 A;  3PCO B;  2I6W A;  1D1U A;  1XC9 A;  5KFC A;  2HQG A;  3WC0 A;  4USW A;  4A8Y A;  3HF5 A;  2XMU A;  1RT2 B;  2QV6 A;  4DL3 A;  2VOD A;  1JLB A;  3UNY A;  1VOM A;  4I6A A;  4DV4 F;  5LSL A;  1KH5 A;  4ZVE A;  2UXC J;  1KQG B;  5HK4 A;  5C2C A;  3NOG A;  5DLW A;  2XNR A;  5EUH A;  3ZXW A;  3P6Y C;  3D6H B;  2HGM A;  2UVU A;  2Q3P A;  3TA0 A;  3UFC X;  1FJC A;  4L75 A;  3M8W A;  2CWX A;  3MAH A;  3CD5 A;  4P7T A;  4A8O A;  2ACM A;  5BYS A;  4DL5 A;  1U8S A;  2BRL A;  1UZD A;  3BM7 A;  4WK1 A;  4YR2 A;  1B99 A;  4ZVH A;  2IA6 A;  2DIS A;  1M5P C;  2CNO B;  5LMN J;  4NXN F;  4PWW A;  5A0Y A;  4AYB D;  2F9D A;  4KAY A;  3S01 A;  3K7R A;  1TKX A;  1DLO A;  3DGV A;  2RHS B;  3FK4 A;  3OFH A;  1ICE B;  3DRY A;  4ZK7 M;  1PIL A;  2HFO A;  5B0E A;  1WOO A;  4J9N A;  2XY6 A;  1PO6 A;  3QWP A;  5JMN A;  1L3S A;  1YIJ S;  1RAF B;  3KLH A;  2YKA A;  3UW1 A;  2BX6 A;  1X4F A;  4F4A A;  5KFE A;  3S1T A;  4ES1 A;  1KKH A;  2DXD A;  1T05 B;  3BQ0 A;  2KH9 A;  4P2S A;  1YBT A;  2L08 A;  1KTQ A;  4KPC A;  3GON A;  1QAY A;  4OX9 J;  1SHQ A;  4CO1 A;  2OHD A;  1FTR A;  2MLY A;  3QT7 A;  2MQP A;  1FJE B;  3T5L A;  4F3M A;  5BXI A;  3EPI A;  1NUE A;  4DCJ B;  3SZZ A;  4DFJ A;  4KGV B;  2L48 A;  4P71 A;  3DOM B;  3SV3 A;  3NGK A;  5ETR A;  1NK8 A;  3DNC A;  3AA9 A;  3VWS A;  3CDU A;  3QID A;  2DR9 A;  2B4V A;  3R2C J;  3KMS A;  5HAT A;  2UVV A;  4YOE A;  3M2R A;  2RH3 A;  3NLC A;  1S9F A;  1CG2 A;  2CYY A;  1O6X A;  5GAE I;  4DL4 A;  2HQD A;  1ALI A;  2GQQ A;  2ZOF A;  3SQO P;  2M70 A;  2JLF A;  2VL1 A;  2AZ1 A;  3PVX A;  1HQE B;  1UEU A;  3U7J A;  4KAV A;  3QT5 A;  4CYR A;  2W5T A;  4KGX B;  5AJ9 A;  3GMG A;  4EBD A;  9RUB A;  2UP1 A;  4BLG A;  2QYC A;  3IFE A;  4RWW A;  2W4C A;  3MED A;  5IM0 B;  2N3L A;  1W2I A;  4DS5 A;  3UDE A;  3VAG A;  3HLU A;  2IRX A;  1R0C B;  3NAI A;  4P52 A;  4F04 B;  3SIP B;  4KYZ A;  5KFQ A;  2WVF A;  2KJW A;  1VBY A;  1FE4 A;  1T9T A;  2YNH A;  3MMA B;  4WFA Q;  3R1L A;  4DV5 F;  3MCS A;  3ZFV A;  3JB9 k;  3B4D A;  5LXY A;  1LWC B;  1K47 A;  3UN3 A;  3IAM 9;  1HMV A;  2AX1 A;  4WWS A;  2OJ3 A;  1Q0N A;  2FC8 A;  3ELH A;  4IR9 A;  4Y2M A;  3M2U A;  4ZPW R;  3TUJ C;  2I8E A;  2VPX B;  2CZ9 A;  4J9O A;  3GFY A;  3DCA A;  3CTR A;  4OLO A;  2F8E X;  3EVW A;  3U27 A;  3TAP A;  1TL5 A;  4GKK J;  4YN3 B;  5LSO A;  2LU2 A;  2DHS A;  3GYX B;  3RRG A;  1TR0 A;  4U7C A;  3I31 A;  1XR7 A;  1VBX A;  1VK3 A;  1YGY A;  4KC5 A;  5C42 B;  2NSC A;  2VFR A;  4OZJ A;  1DAR A;  1XR6 A;  2OI2 A;  3J81 j;  5HQL A;  2JEF A;  4LFC F;  3ENV A;  5KFF A;  3F0N A;  1NJW A;  1ANJ A;  1BE4 A;  4QIG A;  2EEY A;  1OWX A;  4WFX A;  3CCL S;  3G9C A;  1UVM A;  1Y5I B;  2VBY A;  1N32 F;  3CPW R;  2P2C B;  1R31 A;  5DRK A;  1UA0 A;  4DX5 A;  2Y0B B;  3NL0 A;  1YRT A;  1SV5 B;  1ZM9 A;  1Y7A A;  2BKN A;  3E01 B;  2NXJ A;  3ILL A;  3MM5 A;  2KJV A;  3QO9 B;  3AJD A;  3C15 B;  1NSA A;  4D3G A;  1FDD A;  3WAY A;  4C8Z A;  5I42 B;  4I2Q A;  2CNN B;  1JXV A;  5KFI A;  1U26 A;  4P10 A;  4Q7A A;  1VI7 A;  2O01 C;  3M32 A;  5DS7 A;  3KK1 B;  5AJ3 J;  3PX0 A;  2C2R A;  5HQ8 A;  1Q8K A;  4ELT A;  3NGS A;  3IBW A;  3TEG A;  2IM0 A;  2HWH A;  5INH A;  3GJR B;  2YWF A;  3EVM A;  4ED1 A;  4DSE A;  2DKO B;  2GQC A;  3BSN A;  4UPI A;  4B9T A;  4NLR A;  2KB2 A;  4X66 F;  4G1Q B;  2CJX B;  4I1T A;  4C8K A;  2PFD A;  2V8G A;  1I5O B;  2DNR A;  1UWA A;  4PYA A;  4LF2 A;  2DRD A;  4UUW A;  2R7X A;  1TUG B;  1KOO A;  4KT0 C;  2BEF A;  4NYZ A;  2IHR 1;  2DRB A;  1LEO A;  1WG4 A;  3DI6 A;  4AL6 A;  3CF5 Q;  1HQ2 A;  4ED5 A;  4HHU A;  1IBC B;  4DUY F;  1Q1K A;  3PNI A;  5E3A A;  2GA3 A;  3Q83 A;  4RW8 A;  2JC0 A;  2PMH A;  4ZLN A;  1BQN B;  4OI3 A;  5FJ4 A;  4YR1 A;  2R2T A;  1Q7Y T;  1CBK A;  2B4P A;  3BPD A;  4L76 A;  2V8D A;  4QR1 A;  4M63 A;  3GV5 B;  3GYG A;  4C7Q A;  3KLF B;  4ZVO B;  1FVQ A;  3OR2 A;  5E5N A;  4DSI A;  3MGJ A;  1NDL A;  1RTD A;  2FPH X;  4AFF A;  1CVJ A;  2FVC A;  1XNQ J;  3TAQ A;  1CUL A;  2AMC B;  1BLU A;  2ZUG A;  3R6G B;  3TZX A;  2XUL A;  3LGN A;  1A9N B;  1RCX B;  3UPF A;  1T05 A;  5G4D A;  3OHA A;  3V6H A;  1AJA A;  3NCR A;  3R1H A;  4X4S A;  1X4C A;  3KG4 A;  8AT1 B;  1TUW A;  2XSJ B;  2QLX A;  1IKX A;  2BKP A;  4P2M A;  2XLI A;  4O23 A;  4QWD A;  4PPZ A;  2J9C A;  4IDK A;  3PZP A;  4OJG A;  2W9B A;  4A8F A;  3P49 B;  3IM8 A;  3DLE A;  3H8Y A;  2Z2Y B;  2GSU A;  2HVZ A;  2YNF B;  3W5X A;  1S7H A;  1N52 B;  3QMQ A;  3WZ0 A;  2EC0 A;  4AUK A;  4J9R A;  1VC5 A;  2A6M A;  2RIL A;  4RBT A;  4Y3C A;  2BE2 B;  3TVZ A;  3ETO A;  1TL3 A;  5IC4 B;  2FLL A;  4QZV B;  1QTM A;  3V4M A;  1F60 B;  1L3U A;  1CS4 A;  4RUC A;  2EW9 A;  3PIO Q;  3P96 A;  2GQ2 A;  3FMW A;  1YJV A;  3TRG A;  5AXK A;  3LF0 A;  4J9K A;  4JI0 J;  3FJ2 A;  1PBA A;  4DI6 A;  2EBE A;  1SB6 A;  2NYI A;  5L9X A;  1UL3 A;  3W2V B;  3PG9 A;  1URB A;  2IY5 B;  2JNJ A;  5AE1 A;  1JK9 B;  1B3T A;  4MK8 A;  5ADZ A;  3OXF A;  4IFV B;  3FSY A;  5FD1 A;  1WEL A;  2GIR A;  3KJV B;  4U8V A;  3ZZU A;  1TVR B;  1X4A A;  2OPR A;  3PDN A;  2IJR A;  1SJ4 P;  1OSC A;  5GAH I;  3MMA A;  4N5S A;  2F4V J;  2HFS A;  3PKM A;  3WBZ A;  2J0W A;  1QE1 B;  3CCU S;  2UU9 F;  5LRN A;  2QFJ A;  4PKD B;  5EWG A;  3MF5 A;  2VBX A;  4JV5 F;  2HZA A;  1KP6 A;  4PXC A;  3J81 U;  3OJS A;  4ES3 A;  2XMJ A;  3OVB A;  3NKO A;  4JI5 F;  1TK8 A;  1AB8 A;  2AJ1 A;  4FNI A;  1SKW A;  4FYD A;  4UZB A;  1RHQ B;  3SXL A;  3Q86 A;  4J9U E;  1GTE A;  3BSO A;  4ZCK A;  4EGL A;  1H7X A;  2MDA A;  1JLE B;  1KOH A;  1U1N A;  2Q79 A;  4ECT A;  3CCM S;  3M8S A;  2ILZ A;  2VBW A;  3NS7 B;  4HI2 A;  1REV A;  3RG6 A;  2FHJ D;  3KTQ A;  3E51 A;  2WRM A;  4QR0 A;  4UZC A;  3TZY A;  4CO0 A;  1VBK A;  4U7U K;  1OQ6 A;  5IT9 U;  5CYJ A;  3WIU A;  4OZL A;  3BYR A;  2CQI A;  4DQS A;  2MZQ A;  5K14 B;  2XM3 A;  3DGP B;  2HNY A;  1SV5 A;  4CLW A;  5CYM B;  5BR8 J;  5KT6 A;  3DHW C;  1NKB A;  1S1T B;  1S48 A;  3N4W A;  1IKW A;  3HHE A;  4LF9 F;  1S1V B;  1KDN A;  1RAJ A;  2EC2 A;  1FRH A;  2NZ4 A;  3ZTP A;  1VDH A;  2CG8 A;  2G1D A;  3K57 A;  4FVC A;  1EW8 A;  4X62 J;  4A8X A;  2YNI A;  3ZTO A;  3VZI A;  3V81 B;  4C48 A;  2Y3Y A;  3ZZZ A;  2PDA A;  2I0X A;  3DLL Q;  4ES2 A;  1HAR A;  1LW2 B;  3DRX A;  3GLJ A;  3HSD A;  1RTJ B;  4KKO A;  2V4R A;  1ALH A;  4EZ9 A;  2HZV A;  1BUX A;  2LCW A;  3EZO A;  1HQA A;  1KBR A;  3T6B A;  2ASJ A;  3N6M A;  4FF2 A;  4DBQ A;  5HVG A;  1NDP A;  3GIK A;  3FRY A;  2EFG A;  4K2X A;  5DJB A;  2BVZ A;  2MZ1 A;  1NKC A;  2CNK B;  3HHL C;  1K1Q A;  2VG5 A;  3THT A;  1EQJ A;  3CDB A;  2QEX S;  3CJ3 A;  3UCU P;  4AL7 A;  4FYX B;  4XTT A;  4M5L A;  1SVD A;  1SH2 A;  2FHK A;  3QJJ A;  1UPM B;  4FVM A;  4CO5 A;  4EO8 A;  1U24 A;  1N2K A;  4C8Y A;  1XNR F;  4ICL B;  3NNA A;  2AHO B;  3QSI A;  2ZHB A;  1TV6 A;  1H73 A;  1CJT B;  5GAE U;  4WU3 A;  3KLF A;  3BN4 A;  3SDE B;  4LRC A;  4WP9 A;  2VG6 B;  1WHY A;  2E7X A;  4AL5 A;  1IKY A;  4K5R A;  4LVO P;  3TP2 A;  3BB5 A;  1K44 A;  5DGA A;  4FKY A;  2RJZ A;  4DR4 J;  3SSS A;  1CQM A;  4K50 A;  3PW7 A;  1XJW B;  1EET A;  4RBU A;  4C3L A;  4JV2 A;  2A10 A;  3CD6 S;  4WXO A;  3DLG B;  4KHP F;  2AQ4 A;  4TN0 A;  2DR6 A;  3O3L A;  3V6D B;  2DT9 A;  2VZ9 A;  4JI6 F;  1UJ4 A;  1UAW A;  3CIZ A;  2HW3 A;  1OPZ A;  4GMK A;  3TO8 A;  4ELU A;  3M1V A;  2GJI A;  3QSY B;  2UZA A;  5HRO B;  1XIQ A;  2O3D A;  3E2E A;  2O66 A;  3W60 A;  4A8Q A;  5LRM A;  2F4F A;  3LPE A;  3LXQ A;  5D78 A;  3QYY A;  1SIZ A;  2PMZ D;  4RU2 A;  1VRU B;  4I2P B;  5EGY A;  1ULR A;  2AYG A;  2RE1 A;  5L1L A;  4DV0 J;  3W7B A;  3W9I A;  3KYL A;  3NOC A;  3LW5 C;  3MEE B;  2OMO A;  1HD0 A;  3FZ2 A;  4ZJL A;  1TL4 A;  5L0B A;  2HMI A;  3NKY A;  1RA7 A;  2OD6 A;  4PR6 A;  1NPP A;  3KK3 A;  1N5T A;  2ZKU A;  4U8Y A;  3NS5 A;  3LH2 S;  2Y8Y A;  2M3D A;  4N47 A;  3ISN D;  1FD8 A;  3MUM P;  2ZZM A;  2VON A;  3C6T B;  2MZR A;  2BOP A;  2UV8 G;  2XRG A;  1OMS A;  4IG3 A;  5THW A;  5F9L A;  1N0U A;  1S1W A;  3C6U A;  5GAG I;  4DQP A;  2QG9 B;  1C1C B;  2OFH X;  1RHJ B;  3M8Q A;  1M5O C;  1RA6 A;  2DBB A;  4J7C A;  1O0P A;  3MXH P;  2F9J A;  4OFZ A;  4DV6 J;  3MMB B;  1FRK A;  3LTO A;  4RW4 B;  3LPY A;  1RK8 A;  5F9N A;  2X1F A;  1OJ4 A;  2BYC A;  3EUN A;  4WTY A;  2M5Y A;  2Z8Q A;  5B09 A;  1OO0 B;  3QIP B;  5ETP A;  5B0D A;  2RNE A;  4DXL A;  4DR1 F;  1HI8 A;  5J2M B;  1HPZ A;  2FUG 9;  4WYW A;  4NYP A;  1QD1 A;  5E2Q A;  1SBR A;  1RE1 B;  3FEY B;  3OR1 A;  1RB0 A;  4F2R A;  2F8M A;  3BZQ A;  4Q0B B;  2V9K A;  4K59 A;  2E1M C;  2CQB A;  2E1P A;  3NGR A;  4BBY A;  3GP9 A;  1EAY C;  3ZTR A;  5IT0 A;  4F4Y A;  2I9S A;  4QR2 A;  2OPP B;  2ZBI A;  3B54 A;  3SEO A;  1VQN S;  1RT5 A;  2K3I A;  2Z30 B;  1I51 B;  4ILL A;  2V4J A;  1MN9 A;  3JAM U;  1MU2 B;  2LYV A;  3CJR A;  3H2U B;  3EX7 B;  4ZIV A;  2OLW A;  5CHC B;  1CJV A;  2HHP A;  4J9V A;  2RKI B;  3HHL B;  3RBX A;  1D9F A;  1TU0 B;  4LFA F;  2C2N A;  3K58 A;  4HHJ A;  2VJV A;  1KFS A;  3T1H F;  3H2L A;  1VFJ A;  2QL9 B;  2VPZ B;  1IBK J;  3GZ7 A;  2YKM B;  6AT1 B;  4WP3 A;  3H4D A;  1U47 A;  2R4F A;  4JI4 J;  1S6Q A;  3QFH A;  1R7I A;  5MLC V;  4AQY J;  1HWJ A;  1P6T A;  5BYQ A;  5B0F A;  2G2Y A;  1ZZF A;  4D3H A;  3OPK A;  1UEK A;  3G6E S;  1F9E B;  2UUA F;  2CA9 A;  8RUC A;  2XO7 A;  2HBQ B;  5A2Q Y;  2GMH A;  2WVC A;  4ITS A;  4QYZ K;  2M88 A;  2KM8 C;  3FVY A;  3R5A A;  4IFY B;  3RAM A;  3NCQ A;  2XMW A;  3BDE A;  5KT7 A;  1VMB A;  3POT B;  3SV4 A;  2HS4 A;  2DHH A;  4HH0 A;  5C25 A;  2HQI A;  1Y5L B;  3D54 A;  2IC3 B;  3A3O B;  4FPI A;  3OJU A;  4KIA A;  1RT4 B;  1LOU A;  3RUB L;  4E98 A;  1Z2L A;  4DSL A;  5HLF B;  4ZJQ A;  5A8W A;  3IS9 A;  1EKS A;  2NSB A;  2FHO B;  2DCL A;  3W5Y A;  5LMU F;  4DX7 A;  1S99 A;  3OW2 R;  2WAQ D;  5KT5 A;  3W9J A;  5GMK a;  2XEX A;  3MTK A;  4LRE A;  4DL6 A;  3C16 B;  4AND A;  3OTB A;  3PTW A;  4FS2 A;  5LSR A;  5D0E A;  4W98 A;  2W2P P;  2VA2 A;  2CQD A;  1HNX F;  4M94 A;  2ZJP Q;  1SC6 A;  2ZZT A;  5B0G A;  1S0O A;  4KRW A;  4IRK A;  1JLG A;  4JV1 A; 
#chains in the Genus database with same CATH homology
 4NWJ A;  1FSU A;  3DPC A;  4GTW A;  5C66 A;  4MY4 A;  4CXU A;  4KJG A;  1P49 A;  4UOR A;  3BDF A;  5DLV A;  4LRA A;  2W5X A;  4LRC A;  1EW2 A;  4UPL A;  4MHX A;  3SZY A;  2VQR A;  2GSO A;  1ELX A;  3MK2 A;  3T01 A;  1EW8 A;  4GTX A;  4LR2 A;  1ALI A;  2W5V A;  4N7T A;  4UPH A;  5INH A;  3E2D A;  5IJQ A;  2XRG A;  4KM4 A;  1K7H A;  4LR9 A;  4ZGA A;  5K4P A;  1ALJ A;  2ANH A;  3B5Q A;  3IGY B;  4KAV A;  3UNY A;  1E33 P;  3IGZ B;  1AJC A;  3T02 A;  1ANI A;  2D1G A;  2W5W A;  3DYC A;  2X98 A;  1EW9 A;  1KH5 A;  4UPI A;  3WAX A;  1AJB A;  4CYR A;  2W8S A;  1URA A;  1ELZ A;  4CXS A;  4LRD A;  2W5T A;  5EGH A;  5AJ9 A;  1ALH A;  4NWX A;  4ZG7 A;  1HJK A;  3NKQ A;  5EGE A;  1AJA A;  3NKR A;  4LR8 A;  2IFY A;  3IDD A;  4TN0 A;  5L0E A;  5DLW A;  3UN2 A;  2GSN A;  3BDH A;  3TX0 A;  1URB A;  1ED9 A;  2W5S A;  2GLQ A;  1HQA A;  2IUC A;  4KJD A;  1SHQ A;  3CMR A;  1ED8 A;  5IJS A;  2IUC B;  4LRB A;  3NKP A;  4LR7 A;  1KH4 A;  3M8Y A;  5DLT A;  3WAW A;  2XR9 A;  1E1Z P;  3NKM A;  4FDJ A;  5GOV A;  4ZG6 A;  4ZG9 A;  1KHL A;  3M7V A;  1Y6V A;  4GTZ A;  3M8W A;  5LQQ A;  4LQY A;  1AJD A;  1ANJ A;  1AUK A;  5LIA A;  3SZZ A;  2W5Q A;  1ALK A;  3BDG B;  1EI6 A;  1EQJ A;  5LRM A;  4QAX A;  5HRT A;  4LRE A;  2GSU A;  1ELY A;  1KH9 A;  3KD8 A;  3LXQ A;  5KXA A;  5L0K A;  4LRF A;  4UPK A;  1E3C P;  3NVL A;  5TJ3 A;  4FDI A;  3MK0 A;  3OT9 A;  1HDH A;  2G9Y A;  3M8Z A;  1Y7A A;  3A52 A;  4MIV A;  2RH6 A;  2W5R A;  1EJJ A;  1ZEF A;  4CYS A;  5LRN A;  4B56 A;  1KHN A;  3WAY A;  3UO0 A;  1SHN A;  3WBH A;  1B8J A;  1O99 A;  3BDG A;  1KH7 A;  2QZU A;  1N2L A;  1ZEB A;  5GRR A;  3TWZ A;  2GA3 A;  4CXK A;  1N2K A;  3Q3Q A;  3UN3 A;  3ED4 A;  1ZED A;  3UN5 A;  1O98 A;  3T00 A;  4GTY A;  2ZKT A;  4UOP A;  5L0B A;  4KAY A;  1KHJ A;  3NKN A;  1KHK A;  3NKO A;  3MK1 A;  3WAV A;  2W8D A;  4YR1 A;  3TG0 A;  1E2S P;  4UOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...