3M8ZA

Phosphopentomutase from bacillus cereus bound with ribose-5-phosphate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus (strain atcc 14579 / dsm 31 / jcm 2152 / nbrc 15305 / ncimb 9373
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8zA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8zA01
4CYSA 1N2LA 1KH7A 3MK0A 4LR9A 1AJDA 1KH5A 3MK1A 3SZYA 2VQRA 3WAWA 1KHKA 1KHLA 1ANIA 5C66A 4YR1A 3M8YA 3BDFA 4GTWA 4UORA 1E1ZP 5KXAA 1E3CP 4GTXA 3UN2A 2W5WA 3NKPA 5IJQA 4FDIA 3WAYA 5LIAA 5L0KA 2ANHA 1FSUA 1AJBA 3NKMA 1SHNA 1Y7AA 4MY4A 4CXUA 5GOVA 4KM4A 3WAVA 3T00A 1E33P 4LR8A 4LREA 1KH4A 2W5SA 4LR2A 1O99A 3LXQA 3DYCA 4CYRA 1ZEBA 2W8DA 4KAVA 3UO0A 3BDGA 4FDJA 3IDDA 1ZEFA 4TN0A 4CXSA 4LRCA 3NKOA 1P49A 5INHA 2W5QA 2QZUA 1ED9A 3M7VA 2W5RA 3IGZB 1B8JA 2W5VA 4UPIA 1ALKA 3NVLA 3NKRA 4LRBA 1K7HA 4CXKA 5HRTA 5TJ3A 5EGHA 3BDGB 1ALJA 3UNYA 3BDHA 4KAYA 4LR7A 1ELZA 4LRDA 3TWZA 1KH9A 3A52A 3E2DA 3ED4A 4KJDA 1EW9A 1Y6VA 3T02A 1HQAA 5LRMA 4N7TA 5AJ9A 3OT9A 2IFYA 4UPLA 1KHJA 1HJKA 5DLVA 5DLTA 5IJSA 2W5TA 5GRRA 1ALIA 1URAA 3SZZA 2W5XA 5K4PA 4UOOA 1ELYA 1EW8A 3T01A 5L0EA 3IGYB 1AJAA 4UOPA 3NKNA 1ALHA 1HDHA 1SHQA 5DLWA 3Q3QA 1EI6A 5LQQA 2GSOA 1EW2A 2D1GA 2XRGA 4GTZA 4ZG9A 3M8ZA 2XR9A 3TX0A 3DPCA 3MK2A 2G9YA 1ELXA 2GSNA 2GLQA 2GA3A 4MIVA 3UN5A 4ZG6A 3TG0A 1ED8A 1EJJA 2IUCA 1AUKA 1O98A 4B56A 3WBHA 5L0BA 4GTYA 3CMRA 4UPHA 2X98A 4QAXA 3NKQA 4NWJA 4ZG7A 4KJGA 5EGEA 4ZGAA 3KD8A 4UPKA 1E2SP 4LRFA 2RH6A 2GSUA 1ANJA 1EQJA 1AJCA 3UN3A 1ZEDA 5LRNA 1KHNA 2IUCB 4LQYA 3WAXA 3M8WA 4MHXA 1URBA 3B5QA 1N2KA 2W8SA 4LRAA 4NWXA 2ZKTA
chains in the Genus database with same CATH superfamily
4Q45A 3CCLS 1FDBA 3AJDA 2RU3A 1D9AA 4ATNA 1ELOA 3MEGB 2XSFA 3TZYA 1VQYA 2CPYA 2DNOA 4C48A 2W5VA 1OSDA 3MHYA 4DQRA 2HBRB 3UD4P 5C66A 2BM0A 2JH3A 3MF5A 4TYBA 4D3HA 1R31A 2GFFA 1JLAA 1SC4B 3VCDA 2W8LA 1HR0J 2FTRA 3FCVA 5KFNA 3DGPA 3ZNUA 3CJ4A 3ILJA 5I42A 2UUCF 4OYMA 2AD9A 4XPEA 1TUWA 2KI2A 5BJRA 1TMMA 4GO7X 3EX7B 4DFPA 4P2XA 2OKQA 4FZVA 3RTVA 1PKUA 5KFYA 1HNVB 1FNOA 5ETNA 4ZN1A 3PR4A 3SYZA 2F3JA 2OAUA 1Y7AA 3GYGA 4DL7A 1T03A 4K5RA 2VOPA 2IDEA 2EWHA 1X4HA 2UVRA 2ADBA 4LF5F 2GNKA 1N6QB 1RKIA 3M1VA 3VAJA 1RP5A 4RW9B 4EBEA 1FKOA 1IXKA 1XMOJ 1NPKA 3GV5B 4HKQA 3PHEA 4QOTA 3W5YA 2H5IB 2XEXA 2R2UA 1FDAA 3SSQA 3FKBA 2E5IA 4N8OA 2UVWA 1FE0A 2HVHA 1FFWB 2VPZB 2Z2MA 2RVJA 4H4MB 4KB7A 2IVFB 3VVTA 1HNZJ 4FVMA 5J2NB 3HSGA 2BE9B 1NJYA 2LQJA 2E1PA 1KP6A 1KQKA 3AQOA 3EXCX 3ZO7A 4DOZA 2YVSA 1S7IA 4RW7B 5LJ3Y 3Q2TC 3DRSB 5EGHA 2QA2A 2ZBRA 3R5DA 1B7FA 1P8GA 3SCIE 3SV4A 2J7UA 1FRJA 1OIAA 3ED4A 1SH3A 2DY9A 1HD0A 2JWNA 1HQUB 2L3MA 1EW9A 3Q8PB 4ECYA 2OSQA 5I4MA 2CQ0A 4U7UD 1U0HB 4K4XA 2VC1A 5RUBA 3JXOA 2GQCA 4DR2F 2IFYA 1TL7A 4ECSA 1WG5A 1RT5B 3LP0B 1WC3A 1GMWD 2DGTA 2WSEC 4Q7AA 1N54B 1NB2A 7FDRA 1AW0A 3M30A 4WU3A 5HQLA 1VR6A 2OEJA 1SC6A 1X31C 1WSRA 2WONB 3AHPA 1LK7A 1KWMA 2Y0SD 4WFXA 4CWBA 1GEHA 3NBPB 1TK5A 4TKTA 3DOMB 4DPUA 2XNQA 2QLXA 1SKSA 4ZVHA 4K0KF 2ZH9A 1CJUB 3AXKA 4FYYB 3A13A 5DZ6A 3CE8A 4CTAA 1YG0A 4DPTA 2ZH1A 2N3LA 3FBFA 2PI4A 2QA1A 5H1SV 3V4IB 3W9IA 1MWZA 2AF6A 5M2UA 2IBKA 3H90A 3NNAA 4X4NA 1HHQA 3HFZB 4ZCKA 1RBAA 4A8WA 2YKAA 1DTTB 3UN5A 2YWEA 2C2RA 2MKIA 5GADI 2EBEA 4KPCA 4CRJA 1JK9B 5AXMA 4AL6A 1SV5B 2K8GA 1FVQA 2BRLA 3MEEA 2KG1A 2ILZA 3CCUS 1S1VB 4GTYA 1FX2A 2Y9HA 1HI1A 1NK5A 1LNQA 1HIYA 2I38A 1HQEA 1YQHA 3S6EA 1P6TA 3D67A 4NLXA 1APSA 4NLYA 5HJYA 2OLWA 1TUGB 3FJ2A 5F9NA 5KT4A 2D3ZA 2MDAA 3V81B 2XLJA 2D3O1 4HDHA 4GVBA 2CQHA 3GLJA 1TR0A 1KRPA 2IRXA 4JI8F 3C6TB 2HHUA 3BGFA 3IA0A 2D1CA 1F60B 4LF7F 4EFAC 3QFWA 3GFHA 5G0RA 5A0YB 2AYMA 1OYDA 1TV6B 2M3DA 3ILIA 1BC6A 2EG1A 1AXQA 2XMWA 2MQ8A 3A3NB 4NWXA 4IDKA 4OV1A 4GO5X 3OTDA 5AXKA 4P71A 4KHMA 4R8UA 3VGSA 2BJEA 1X7VA 3PX4A 2FUG9 1F6TA 3FFIA 3FSIA 4EBCA 4DBQA 2V6AA 3DHWC 3OJSA 1KLNA 3GIKA 4DWIA 5HLFB 4B9SA 1M1GA 4ECQA 1P9QC 5D4LA 3MAAA 1NJZA 2BUNA 1HI8A 1XERA 3LOUA 4GTXA 2KRRA 4NA1A 1YGYA 2MKHA 3EE3A 3KUEA 4P10A 5LXRA 3NKPA 3CMAS 1RHMB 1S79A 1ZM3A 2HBZB 4IRCA 2HQ3A 1CJKB 1RHQB 2B56A 1IKVA 3GSDA 4ZA1A 5K20B 3H0PA 2H48B 3I96A 4NEYA 1AUDA 1WACA 1TMJA 4F4WA 3G8SA 4N41A 3THVA 1HYSB 1ZM4A 1S0MA 1IQTA 1UFWA 3W63A 1T95A 2C2OB 3N6NA 4I2QA 4L76A 3W5ZA 3VAFA 1WWHA 3BN4A 4RL1A 2EFNA 1WUUA 2BM1A 3P96A 1PILA 2AEFA 3KLGB 4ZJQA 1CJTA 3BDEA 1PGZA 3WX4A 1FEEA 4WK3A 1CULA 1RT2B 3DLKB 4ANEA 4DUTA 4U67Q 3OV7A 3V5RA 2VQFJ 5FDLA 2WTFA 1Q86T 3WC2A 1M1HA 2KJWA 2MJUA 5KFSA 2IA0A 2MZQA 2QIFA 4DL4A 1FVSA 2QLFB 1ITPA 1P49A 1UPPA 4J37A 4O4GA 1TAUA 4YMEA 4NXMF 4IRKA 2G0JA 1H2TZ 3TP2A 5AJ3J 3FZBA 4E0DA 1FKOB 4FBTA 1S9EA 2ABYA 4Q2MA 3TEGA 1Q53A 2Q1LA 3J80U 1K73T 2DISA 2O3DA 3KG4A 3K57A 4ED5A 2KVIA 3FK4A 3JTOA 3ZTOA 3Q8RB 2DR7A 2OPPA 2ZJPQ 4KAYA 2FZGB 3GFXA 4LRDA 1X4CA 2QMXA 5ETKA 1EAYC 3TJAA 1Q5VA 3N01A 3RAMA 4WBFA 2BMBA 3W2WA 3CC2S 3QFHA 4IG0A 5DG7A 3NL0A 4JV5J 2UUWA 2UXBF 4OYOA 4DCJB 4NPOA 3FDSA 3AA8A 1RTHB 4DV6J 3N6MA 3CB4A 1P9YA 2CQDA 2MY8A 2VPXB 4USTA 1F0XA 1VHFA 3DXSX 3R3TA 4NLVA 3ZZOA 3DRPA 1QTMA 4FKXA 4YDDB 2RF2B 2CKWA 1HLWA 2CG4A 3NMAA 1LXNA 5J2PB 3LGHA 3G96A 2GMJA 3LUYA 2Y8YA 1JLQA 2YKNA 3K5PA 5KAKA 4PUOB 1RTDA 1MG7A 3R97A 4NYPA 3SFUA 3CUNA 1S97A 5T14A 1U1RA 3Q8QB 2QGFB 2RKIB 4F0MA 2NREA 2N3OA 1T9VA 1U02A 1OY6A 1VQ8S 4PWDA 1F3FA 4WE1A 1EI6A 2F63A 5KG5A 2YPZA 4WTOB 2WB4A 1P1TA 2D3UA 2XR9A 3QT8A 4G6VB 2AHOB 5LMNF 2G9YA 3W9JA 1SJ1A 4GVLA 4OYBA 2HHVA 2PE8A 2VBXA 3MM5A 4Y2KA 1ZM9A 4M8LA 3T1YJ 3HVWA 2GA3A 4KPYA 3TG0A 2RB7A 2K1RB 1EHWA 2AMCB 1HBUA 1SXLA 2QRRA 3OVSA 2IUCA 5HO4A 3OFEA 2J9CA 1LWFB 1L3SA 1NSKL 3H5XA 2QJ3A 3QO9B 4DSJA 2C3UA 2QSWA 2W2MP 4K4SA 2UXCJ 4ZG7A 2X51A 2HHWA 2FHJA 1H74A 4E8UA 1HNXF 4R25A 1IKYB 1RGVA 4LRFA 4PR6A 1XIQA 2P9CA 5AJ3F 3MCOA 1AJCA 2LDYA 4V19X 1W2IA 2FYXA 1GTEA 3T5HA 3ZZTA 1HQEB 1F3VA 1CJVB 2W4PA 5ETRA 4EO6A 3N28A 3OUYB 5I3UA 1URBA 2AJ1A 1A6LA 3C16B 1U1PA 4JI5J 3LW5C 2HNYA 1SH0A 1WC1A 4GKKJ 1XTZA 5C25B 2MZTA 2DHAA 3BBCA 3W62A 1UVNA 1WSVA 3BQ1A 3HT0A 3IS9B 4YDXA 2RMLA 4IG3A 4ETXA 1DURA 5F41A 2HGMA 4XIUA 1HW9A 4L74A 4K5SA 1UAWA 2EFPA 2MSTA 2DRBA 2WSCC 2HQCA 2DPIA 4JI2J 2DEIA 1AA1B 3TQ1A 5CHCB 4G1QB 4ZOSA 4ZP8A 1VYAA 1S6PB 3N9UC 2EFVA 2QE5A 3OL9A 4KHRA 4J9VA 4LVNP 4DR7J 1RK8A 4J9MA 4I6YA 3MURP 1ZH5A 3PJXA 1VOMA 3RAQA 2R8KA 1RZMA 3DLEA 2DNHA 1NK6A 3IXQA 2ZJQQ 2CQCA 1FJ7A 3FEZA 1EJ7L 1X4DA 5I3QA 4DF8A 1VFJA 4IFVA 2J0XA 3CJ0A 3CMQA 4QW8A 4NZ0A 3D3BJ 5IV4A 3KYLA 2W9BA 4FDJA 4WK1A 1EARA 2VPWB 3BSOA 4UF4A 4C8MA 5CYMA 4MH8A 4X64J 4K4WA 1UEUA 3TAPA 4AD6A 3Q24A 3T5LA 4WKRA 4YFUA 5ETVA 2KJVA 2QLBB 3VGUA 2F8HA 3W1YC 5HVHA 4FF3A 1O5JA 3ITHA 3NGUA 3MAHA 1KFSA 2AJ4A 4C8KA 2EC2A 4M5IA 3NGDA 2IBOA 1K0VA 5KXAA 2FC9A 4CI0B 4LF7J 2G0IA 1W25A 1MLAA 4X66F 2J9DE 3I56S 3FBBA 3P5TL 4OX8A 4UPIA 4UOCA 4PQUA 1I6JA 3VZHA 5CYQB 3M8QA 1S6QB 2VG6A 2CFXA 1I94J 3HSZA 4A8SA 4X65J 1S10A 4LQ3A 4LR7A 2ROEA 2CDQA 2YNIB 1T11A 2DGQA 5CABA 2BYCA 5DGAA 2DR9A 2R7TA 2CPZA 4Q5VA 4QWAA 2GO8A 4CQ1A 1YI2S 4B3MF 1KONA 2BE7D 2KU7A 5HQ8A 3OSPA 1UW9A 2NSCA 1YWXA 2ZBPA 2RQMA 3EGNA 5E3RA 2BEFA 4C0OC 1N8RT 2V8DA 3MMBB 4FNIA 1T0TV 2V63A 3MECA 3R6GB 5CCMA 5LXYA 5DG9A 3QATA 2Y8WA 2B51A 2OD4A 1PJ6A 2NXNA 1K1QA 3NWRA 2W25A 4B3RJ 1HBOA 1JJHA 2VG7B 4DR3F 3F56A 5L1LA 2KVQE 2MYFA 1VMBA 1XK8A 3CCZA 3UVJB 3ZTSA 2BJ8A 4DG1A 4DMZA 4XO0A 4BS2A 3OL8A 4YHHF 1HD1A 4C98A 1IBKJ 1UJ5A 3TA2A 3TAQA 4DR6F 2OPRB 2ZVSA 2GSOA 3HVTB 4ILLA 3KTQA 5ETSA 2GHVC 3W8GA 3HPOA 2QL7B 3C2PA 1ELXA 1OY9A 2IA6A 1U49A 2RD5C 5C2CA 1AB8A 1YZ6A 2R7XA 4PPDA 4ICLB 4Y28C 1KLMA 2DNYA 3U1NA 1B3TA 3WBHA 3ZZZA 4KFBB 1OJ4A 1BQNB 4CYUB 1REVA 4PYAA 1F5BA 3R6LB 1JLBA 4NEZA 5ETLA 3M32A 4ZK7M 5KFKA 1JJ4A 1WDTA 3EGVA 4BDPA 5EGEA 1ZPWX 4ZGAA 3B4MA 2QSFA 3IP0A 2XMKA 1VQMS 3GR1A 1WEXA 4OYZA 1E3CP 2HNZB 1S4EA 4CLLA 3UPFA 4TU8A 5IC4B 3GV7B 2AU0A 5HANA 3U1LA 4L75A 1PYOB 2HWTA 2JSXA 2Z2LA 2GA7A 2BBEA 2YNGB 5FLXU 3C3LA 2MPUA 2G2YA 4RNMA 1H7XA 4ZLPA 1Y5LB 3HZGA 2PA8D 1JLFB 2MLZA 2FLOA 3L95X 4O3SA 1NRKA 1ZA2B 1G6BA 4PG6A 3IBFB 5ADZA 5KFAA 2CQBA 3MCMA 5I42B 1DTQA 5C2GA 4PG8A 3V4IA 2QYGA 1B0PA 1FI4A 2JEGA 3NGKA 3WAWA 1MROA 2GO9A 2HGLA 3D1HA 2A0FB 3E8OA 4BC9A 1HI0P 2OO4A 2VUGA 3KK3A 4DR2J 2V9WA 1N33F 1HNVA 1E1ZP 5HVFA 4Y00A 1VIXA 2JL9A 3DRYA 5GMEA 1S6OA 4PZVA 3T9ZA 5KFLA 1VQ4S 4QW9A 3DKDA 3QLHA 1NK7A 2MLXA 4HEA9 3IGNA 3OR1B 4C8NA 4PYDA 4B3SF 4CLFA 1C4AA 1VIOA 1U09A 4KBIA 4USWA 1BY9A 2FVPA 4OI0A 4A8YA 1VGYA 2H5JB 4X62F 3CTRA 4Y34A 3NCQA 3OL7A 1QE1B 3R2DJ 3HHEA 4K4VA 4YB1P 5L1IA 1WF2A 2FZKB 4V19J 4MIBA 4Y6IA 2ZH8A 4FF2A 3L7PA 1CVJA 2MQOA 5U47A 5HMYA 3M2UB 2KN4A 4KTQA 2HSEB 1NNDA 3CULA 2WHOA 3WDOA 2AEMA 2R7RA 3GFZA 2LEBA 4IOBA 3ICLA 1ALKA 3FC9A 3TUJC 2ZJRQ 4O3PA 3MGJA 4CM0A 2RILA 2HLUA 4RKUC 1DRZA 3ZTQA 1C1BA 4IKAA 1MWQA 4GKKF 1JLQB 2YKNB 3HI9A 3DXBA 3MM9B 4URGA 3D3CJ 3EDRB 2PMHA 2X1BA 1OQ6A 3ZZYA 2R2SA 1X9SA 4F36A 5BR8F 3TQEA 2Z8QA 3BKTA 4HYKA 3V6DB 3DHXA 1BQMA 1AUSL 2HYIB 1ZTWA 1IJEB 3OT9A 5L8RC 1UEKA 2ZEJA 4I2QB 2Z58B 2ZVIA 4DQQA 3NRBA 1UCNA 2C42A 2HFSA 3GG0A 3KK2A 1T05B 1TK8A 5KT7A 4DZDA 3QSIA 1U0HA 4A8QA 3DLLQ 5B0FA 5K14A 4ZN3A 2V2ZA 5C24A 5T7LA 3CJQA 4OX6A 3MUMP 3KHHA 2B4VA 1PBAA 2J0WA 3VR1A 2COLA 2QV6A 4KC5A 5DM6Q 2MKSA 3PW7A 3PFOA 4F0KA 1KNZA 4QYZJ 2KHDA 4DLGA 2IC3A 2KZZA 2OEMA 3SDEA 2HBYB 2ZKUA 1S1XB 3UNGC 3I4PA 3TRGA 3FSXA 4LF5J 4DR1J 2WVFA 3T41A 1S9EB 5GMDA 2ALYB 1J5EF 3C15B 2YNFA 3ZFVA 3AD9C 3TAMA 1K47A 3QAEA 5GAGU 3T1HF 1YKWA 5L38A 3I0SB 4X4SA 1S6UA 4R0EA 4ZLJA 3OPKA 1F5CA 4G3IA 3FCWA 5K5MA 1TQLA 4MYUA 1DAXA 4X62J 2CAJA 5GAHI 1T9WA 1Y10A 4NZ7A 3I5CA 2E1CA 2HRUA 4KJGA 4MKVA 2R7WA 4DL3A 2CRLA 3E3XA 5MLCV 4EO8A 2N4CA 4FDFA 2EK1A 4Y3CA 4HTJA 3J81Y 3PW0A 4LF9F 1UJ6A 1Y0HA 3OQ2A 4P6QA 1SBRA 1CQNA 4RW8B 2JC1A 1QSSA 5AXNA 2CJKA 3R5CA 2RH6A 2XBPA 1ANJA 1S72S 4NCAA 1JLBB 2KYZA 2NUHA 2YKQA 1RA7A 5HP1A 2IRYA 1H0HB 1WI8A 1KQFB 3C46A 1LKZA 4DHVA 3GB0A 4URQU 2QFJA 5KG0A 4K8RA 1MU2A 4NLSA 3H7HB 3OXFA 1WKJA 4OHVA 4UQTA 4O3QA 2B5JA 4ZP6A 4MKBA 1B64A 1VRUB 3PRBA 1RT7A 3CJ8A 3H4BA 3NCRA 2UXBJ 4KJIA 3LF0A 4NXNJ 1FRXA 1WD6A 3PIOQ 3OVAA 5IM0B 2XI2A 2LLZA 4KRWA 4IH7A 1Q8LA 1VBZA 4FPRA 3W5XA 2R8JA 4OI1A 4OZ3A 1S0OA 3PYGA 3PVXA 5LIAA 5IZHA 1VJQA 4KY3A 1EKSA 1WORA 2E5LF 2RHSB 2VFTA 2PC6A 1R89A 4H4KA 2PA3A 3KK3B 5KFFA 4RZRA 4KH1B 2W4DA 5EDWA 3EUNA 3IMQJ 1GMVA 2CPEA 4LSNB 2W9AA 2QA4S 2KFZA 3WAVA 4QZVB 2VIHA 3NGRA 2LQBA 4C2MA 1N36F 3CDEA 2RUGA 3K59A 2MZSA 3DI6A 1TVRA 1RU2A 1S1UB 4UW2A 2LKZA 4ZMMA 1J5OB 4CYRA 2AJFE 2KO1A 5K8PA 5MAOA 1IVZA 2X7IA 2CQ1A 2J6TA 1VQNS 4RW6B 4EEYA 3JQKA 1FWPA 1SB6A 2UXDF 2DK2A 1ZEFA 2YNIA 2ZC4A 4JI3J 3C19A 1UA1A 4C7QA 4ZVGA 5F0WA 4LF6F 3FQKA 1F1BB 3QNWB 3IBCB 2EK6A 3NG8A 1FXDA 2GW8A 2WCXA 1NH7A 3SBMA 5J1EA 3MPDA 4Z7YA 5KFIA 5HROB 5DDRC 2C28A 1YJUA 2G1HA 1RDRA 2F8EX 3RRHA 3OXLA 3O2IA 3PYEA 4LRBA 3RB0A 2J6SA 2O1PA 2AKWB 2GMHA 3SCJE 1JWWA 1FD8A 3Q83A 2MXYA 2NZ4A 2F5GA 2NXEA 1C0UB 1XMBA 2KKHA 2Y3YA 2WVBA 2BACA 4DR7F 1ZZFA 1XQIA 4CZCA 2CPDA 3G6XA 3A8EA 4ANDA 1QSYA 2FJWA 3ADAC 3EXYA 4IH5A 4PXBA 3WIUA 3MR2A 2HNDB 1EETB 2ASJA 1SQGA 2XSJB 3GIJA 4CNZA 2W9BB 2KDOA 2FHOB 4UUWA 1SJ3P 2XMAA 4FPIA 4RUHA 1VRTB 4QWBA 1IBCB 4O4RA 2BJ1A 4ZDNA 1B0VA 5KFMA 1E6VA 1FE4A 5DJBA 4PEOA 2M88A 1YTYA 1SKWA 3ENQA 1EW8A 3SEOA 3W64A 1OPIA 4Y2CA 5ETOA 3SQGA 3DRPB 2MZRA 1O6XA 2XCPA 1REVB 2OPSB 5D77A 1C2PA 1BXNA 3NNCA 1U1NA 1HHTP 1HMVA 1LFWA 1FXLA 1RAGB 4ZG9A 2VJUA 3MOJB 3AQPA 3D5MA 1CQMA 4ZP7A 2Q6BA 2AV5A 4OZJA 5CYQA 1DBDA 3TNVA 5KOXA 1LQ9A 2C3OA 4JI6F 4ELVA 1SC1B 1KTVA 1RWWB 3A8IA 3J7YU 2YWKA 1FD2A 3HHLB 3OTCA 1S9GB 4X64F 3I0RA 3A12A 4IYQA 3DMJB 3CIMA 4C0BA 2HZCA 4QAXA 1F9HA 1KHWA 2C2KB 3FUYA 4F7VA 1GMWA 5LMUF 3MM8B 2VG5B 2ZH2A 1RE1B 2B6AA 3M8RA 4DL5A 1H2VZ 2PFDA 2HVIA 1JLGA 1NDLA 4O3RA 1TU0B 2HZAA 4OJ3A 4WCEQ 2BANB 2IMOA 3W7BA 1IBKF 2GSUA 1U25A 2ZD1A 3WAXA 3AOBA 4DUZF 2YH1A 3HT3A 2XMUA 1URNA 3D6HB 3IN5A 4DR3J 4HH1A 4P73A 1QLNA 1SL2A 3POTB 2DITA 3BREA 4G1PA 4YY3J 3J7YI 3JSMB 3MK0A 1X4GA 2VDIA 1FFGB 1Q81T 1HYSA 4P2MA 1J2VA 2HFVA 3MFHA 5HP1B 1KHLA 2UV8A 4ZCIA 5KFJA 2V4QA 2C3PA 2NZCA 1UTAA 1WHYA 5D0RA 2ZM6J 1DHMA 2GIFA 3M8YA 4NLOA 4ELTA 2I1RA 1I51B 3HHNB 1ZZNA 2V69A 2GJIA 2FLLA 1VQKS 1BWVA 4L3KA 2C2ZB 3U1MA 5IQ6A 5ETTA 2YKMA 1DQ9A 2IYIA 3OR2A 2AJQA 2DYAA 1WHXA 3BSAA 2FVRA 5E41A 5LMNJ 4IQXA 3QYYA 1KOOA 1NBEB 1RTJA 5L1JA 3NGTA 4B3OB 1RU1A 4LFBJ 4FN5A 2ZH4A 3WIVA 1WC6A 2HAFA 1HBMB 4D3GA 3BO4A 4RU2A 1NJWA 4H4MA 4EYIB 3O8WA 5E7OB 4LSLB 2OPQB 1U24A 2WB1D 3EGWB 4UQGA 4ECUA 1CLFA 5J2NA 3ET6A 3PCOB 3OTEA 3VZIA 1ZAVA 1LWXA 3NS5A 4JI3F 2R7SA 4YQWA 1GK8A 4JI6J 3R7BB 2HGNA 3GONA 4RW7A 4CXSA 2CNOB 3H42A 3M6UA 4OYIA 2BV3A 3UW1A 3QRQA 4LF9J 2HFZA 4OHWA 3SCLE 1U1LA 2KXFA 1ED9A 2QZUA 4YR0A 3DI6B 1VQPS 2YWFA 3QGGA 2LECA 1X9WA 4DX8H 2KB2A 4ZIVA 1PCAA 2YPYA 3M8PA 2XMTA 3VAMA 2ZBQA 3M8SA 3BDGB 1Q7LB 2GJ2A 2AZ1A 3LP0A 4ZVOB 2VONA 2BJ9A 3A52A 2BRKA 4KT0C 1SUQA 4Z7CA 3BF4A 3Q89A 2PT0A 4L3NA 4CT9A 3OTOF 1XNRF 2RKIA 1NSAA 3K89A 2HPUA 2VKRA 4FYXB 4W92B 1XR6A 3LTOA 1RAIB 3EPIA 4ANCA 3KLEB 1PC4A 1K8AT 1NU4A 1UP1A 2YWHA 4OJHA 1T3NA 1TL5A 2BXJA 3G82A 3MI7X 5D4PA 5J1PA 5EWGA 1YJ9S 4LQYA 5HJXA 3AD8C 3BBBA 5KFOA 1U6ZA 2R7OA 2VQFF 4IRDA 2IMWP 1R8PA 4UT4A 4CLWA 1X60A 3BKFA 4P7TA 3R9LA 1ZAXA 3QO9A 3UDLA 3RBXA 3GIIA 1NM2A 4GC7A 1EQ0A 3KWMA 1D9FA 2B9EA 1OS5A 5B0CA 2ROPA 4RR5A 1EW2A 5KFXA 1UVJA 3ZZPA 3QIPB 4CO0A 1S5ZA 3NCPA 4AE5A 4OX9J 3PJ9A 1RWPB 1FJCA 2GSNA 2CZ4A 1TKTB 2CYYA 3I82A 4PAAA 5KFEA 2B9WA 1U1QA 1MWYA 3AJ2A 4Y65A 2OPPB 1HFEL 3J7Z5 3VVUA 4CXUA 2AIRB 2DJWA 1AUKA 4B3OA 3I5AA 1CJVA 3OUYA 1X5PA 3C14A 3HLUA 3RUBL 5G0RB 4DL2A 1VQ7S 1N32F 2ZBIA 4NCBA 1KR4A 5A0YA 2J8SA 2W01A 3B8HA 4UPKA 1XC9A 4FYVB 3SXLA 1W26A 1RT3B 2OGUA 4ZVRB 1BQNA 3GQCA 4LFCF 3IAM9 2BKPA 2JJ4D 1RWVB 3M32B 8ATCB 3HP6A 5J2PA 4M5DB 5IM0A 2VV5A 2IUCB 2JNJA 2LXFA 4DFJA 2CPJA 2LMIA 2IIHA 2C3YA 3D6TB 1LWFA 2QG9B 2ZUGA 3F0NA 3PFEA 2RE1A 4OJGA 3DFEA 5HK4A 3G71S 4HT5A 4RNHA 2M0GB 1RAOA 2FLPA 4MK8A 3NEKA 3SDEB 4F2RA 5A8RA 4BWMA 4NLGA 2NUUG 2WOMA 2ZBCA 2WBMA 3TJ8A 2HHXA 4LFAF 5KTQA 2OTJS 4LSNA 3Q86A 1FX4A 1N5SA 1UZDA 1ANIA 3BQ2A 1S1TA 2AJ0A 4MAKA 4K4YA 4F4YA 1FJGF 1UPMB 2JEJA 1TKXA 4UOHA 3QPIA 4F0HA 1JKHA 1YK9A 4TXSA 1H2UX 4ECXA 4QU7A 2W5WA 1M0SA 3EICA 2DNNA 3QMQA 4FDIA 3JTPA 1X0FA 3WHIA 5J2QA 1H98A 1FDDA 4ETZA 4DV5F 4CDIA 1R3NA 4DR6J 5IT0A 1YBAA 3H20A 1N0UA 4DCOB 2MB0B 1N5YA 1M5VC 1TL7B 2C3MA 2P6TA 3FMBA 4I1TA 4KE5A 3VGVA 1RT5A 3GILA 3SV3A 4LBIA 3R7NB 2GIRA 2RAQA 2ZNZA 4A48A 3OSNA 3KJVB 4ZJOA 4A46A 4TQSA 2AQ4A 4MMOA 1O99A 1S6QA 2VG6B 3TYTA 3K0JA 3A8KA 3TA0A 2YX4A 3KK1B 1RSCA 3LH2S 4KH0B 5HLFA 3L7OA 1AZSB 5CH7B 5LMUJ 3I31A 5H9FK 2K2PA 1EP4A 4YS2A 1UW4A 2SXLA 3KG0A 4MTPA 2W5QA 2FJVA 8RUCA 3IS9A 1HA1A 1Q4RA 2UP1A 4X4VA 3DOKA 1NK8A 2AWZA 1GTHA 2GJFA 1BE4A 2OMOA 3M05A 4C3LA 4DUZJ 1QAJA 2VODA 4M5JA 2P9EA 1K7HA 3U02A 4DV1J 1DTTA 1HL6A 2XMMA 3CC7S 2D7SA 4ID5B 2Q43A 4U8YA 2DPJA 4C8ZA 4FS1A 4WWSA 1SV5A 4NI2B 3R5GA 4YR2A 1HR0F 4CO3A 4X4UA 2LU1A 1O0PA 5E33A 4DS4A 4PUOA 1QTNB 1YVFA 3D28A 2AGOA 3C66A 3PDNA 4NLPA 3RBEA 4K4UA 1B4SA 1CG2A 4X4PA 4MJKA 5JUMA 1L5UA 4CM2A 2ATLA 4WF9Q 3CMES 2VDHA 3PRVA 1NKCA 3EM1A 2MZ1A 3MR5A 3PW5A 2W5TA 4QWEA 4UORA 1C4CA 3M2RB 2HW3A 1OQ3A 4EWTA 3M9MB 1PIEA 2OSRA 2P2CB 3GPAA 2K7JA 2VBZA 3H8YA 3MMCA 5K4PA 1JJCB 4USMA 5DGBA 2E7XA 3MM5B 2ASLA 4LFBF 4YY3F 3GSIA 4PWUA 5H9EJ 5T41A 1VQ9S 3MECB 1FRIA 3VALA 4DI6A 2N7CA 3KHRA 3VQSA 1PAUB 1HNZF 4GTZA 1UFLA 3OFHA 1X4AA 3CF5Q 3G9CA 3MFIA 2VC0A 5EUHA 2WVEA 3DPCA 4JI7J 1TAQA 4FVCA 4KR0B 1JLEA 1KQGB 2B7CB 1QAIA 2BANA 2UV8G 4ECRA 1KHVA 5CZVA 2HHHJ 2PMZD 2XYPB 1QUPA 3MMJA 1NKBA 1DFDA 1XMOF 2Y1JA 3H2LA 1OO0B 2HEKA 3HJFA 3P45B 1V3ZA 1FERA 1HNIB 1M5SA 4RO0A 4ES2A 2UXDJ 4ZCMA 4QWCA 1S4FA 4ECWA 3UDCA 3P49B 2BW7A 4B9NA 5DZ7A 4X4OA 4DSFA 2POKA 3Q8UA 2ZH3A 1IKWB 1VBXA 1FEHA 2BKOA 2OEKA 4TLQA 5JMNA 1Y5IB 1QE1A 3P6YC 3B5QA 2RUSA 4ZPBA 2V8GA 1YBUA 4K7QA 1DLOB 2CPIA 2GVZA 4LRAA 3GJQB 4S0MA 4N56A 4DQIA 1FT8A 2L9DA 1Z2ZA 2OPRA 4AFFA 4IO9Q 1RQ0A 4DPOA 4CIOA 4GRSA 2J9EA 4NLUA 3EDQB 5KFPA 1ACMB 1V3RA 4PG4A 3TVKA 1E6YA 2JLGA 1WHWA 4YUDA 3ZZ0A 4OX7A 1C1BB 1HWIA 2YX1A 1T9UA 3PEJA 2CPFA 3NOGA 1MNEA 3HVAA 3NAIA 4IFVB 4KO0B 1RB0A 1VRUA 4DX5A 1RT7B 3BGRB 2IM3A 4R8UB 3JQJA 4XK8C 4CT8A 3JYTA 1S6PA 1DTQB 2BX6A 1DQ8A 3MPYA 3I6PA 5IXUA 2B4UA 3M9NB 1N5YB 3DLBA 4DR4F 2YKOA 3JSYA 5KG2A 5F8IA 1LK5A 1ICEB 1D8ZA 3WQPA 1JLGB 3MEKA 4U96A 1YDLA 4OYXA 3QQCD 4DN0A 4DLEA 4DQPA 1WF1A 2WW4A 4TLRA 2W5SA 2CG8A 4XTTA 2KXHA 2F4VJ 4M5NA 2YNGA 3QJLA 4RU9A 2W8DA 4KAVA 1N52B 3K5NA 2KZMA 3O3LA 3M8QB 1U8WA 3MM9A 4OHXA 1NDKA 3WX8A 2G13A 5ETPA 4PQUB 1RBLA 4I0WA 3RGIA 2BOPA 4K2XA 5INHA 2CQPA 4ES3A 2VFUA 1X9MA 3SMZA 1F2GA 1D09B 1RT6B 2V68A 3EVMA 1BHNA 1BQMB 1TZ0A 2G2OA 2RQKA 2V2QA 4J9UE 3HFKA 4LBHA 4OI3A 4U8VA 3G6VA 3BO2A 3T3FA 3T1HJ 5DETA 1JXVA 2FY8A 3RW6A 2R4FA 3CJSA 1A7GE 2CWKA 4ED3A 2BQRA 4P52A 2BQUA 5FDLB 2E9RX 3UNYA 1UA0A 1D9DA 1NK9A 2K1RA 4RWXA 2MQLA 3QT6A 2F65A 3Q2SC 1Q82T 1SJRA 2B3TB 2IM1A 3RJMB 3ZZRA 2VA3A 1RYRA 2WVDA 1NPRA 4LBPA 3CCTA 2YWGA 2C22A 2LVWA 4ECZA 2BJ3A 4ENOA 2VZ9A 4OZ1A 3US5A 4USUA 3PW2A 1TL3A 1PJ5A 2ILYA 2NYIA 2W24A 3WC0A 3C6UA 4DG1B 4HHUA 4WIIA 2XZTB 2OI2A 3R5JB 6FDRA 1G7CB 2U1AA 4OYAA 2HNDA 3U27A 4I2PA 1H7WA 2ZC3A 4QR2A 1YZ7A 2ZHAA 5F3ZA 4J9QA 1ULRA 1D1UA 4B3SJ 2NPFA 4BHQA 2XY5A 4QYZK 1ELYA 3OJUA 1NEEA 2EVZA 4EU0A 1HBNB 2WK4A 3V6DA 4DXLA 2K06A 1KKHA 2RH3A 4F4AA 2E9TA 2W2NP 5DLWA 3OD2A 2IY5B 1RHUB 2RDDA 2CJBA 2D1GA 2V8PA 1KLMB 1FJGJ 4OHYA 4K59A 1HKAA 4PCQA 2YKPA 4KFBA 4CYUA 5F8GA 1RT3A 4NE9C 1UVKA 3AB4B 2E44A 4ED0A 1U4BA 2HHTA 4Q44A 3MM8A 4FXVA 4ZLNA 3GV8B 2B6AB 5IT4A 3J7A1 1SUQB 3HO1A 4J7CA 4X66J 1C0TB 2J6UA 1EKRA 1R8BA 2IRUA 3MPUB 1M5HA 4ZVPB 4BLGA 5A8WA 5FLXY 2RRBA 3W9HA 5SZTA 2PDAA 4I67A 2WOMB 1WOSA 2NXCA 3FCHA 4HHJA 1S77D 1V5IB 2XS7A 4HHHA 4QPXA 1JLFA 2KRBA 4ZPWR 1R0BG 3I0RB 3I0SA 1YITS 1SJ4P 3IC1A 5CYMB 3DYAA 4RNFA 1HBUB 4TU9A 4DV7J 1XEZA 2VJVA 1IM4A 4HI1A 2DCUB 1HNIA 4EMDA 4IFYB 3BPDA 1SQEA 3GU0A 2F9DA 1DJ0A 3D1OA 3HHDA 2FIUA 4WFAQ 2OH2A 5KFWA 4B3TF 3NLCA 5CD4H 2JVRA 3B6BA 1LW0B 1PYTA 3LGMA 3K7RA 1R0CB 1U0SA 1L3VA 3MK1A 5LSOA 5IS2A 2VQRA 2VD3A 1TP7A 3J81j 3W60A 1UWAA 2YNFB 3Q0AA 4FYWB 1NLKL 2O5DA 2IDLA 1IN0A 2Q66A 1N88A 4Q8FA 1PSDA 1RTJB 1SIWB 2V8HA 1FJEB 4JV1A 2Y1IA 3AH6A 3RZAA 3TJ9A 3GFYA 4OZLA 2XZWA 3AXMA 2ZZNA 3N4WA 2V4JB 4DUYF 3QRPA 2EFOA 3AAWB 2Q6CA 4LIWA 3LWMA 1SL1A 1AJBA 1SHNA 3SI8A 2JDJA 4B9VA 3J7ZT 1HNXJ 1CPZA 1E33P 2KHCA 2HRYA 4N8NA 3FRYA 2XB2D 1X4FA 1HHSA 1VLOA 3MD3A 1JQGA 4FXDA 2RRNA 1LV5A 1X5SA 4KGVB 2BKNA 5KG1A 1TKZA 4F3QA 5LRMA 1FFSB 2WZ1A 3L09A 2MTLA 1HBOB 3FVYA 1ZETA 2Z2YB 2Q79A 2ROGA 2FJAB 2EW9A 4RWWA 2E1MC 3AJ1A 4F50A 3N79A 2H4WB 2DNRA 1LEOA 1SI9A 2IVMA 1A9NB 4I4BA 1UMJA 4CLYA 3ET6B 1QVFR 2NYHA 2OPQA 3LPYA 5KOWA 1RHRB 5FJ4A 3MUVP 4LF2A 3UCGA 1NXIA 3HSDA 4NRTA 2R8HA 2MKJA 3X3UA 1FF2A 1JX4A 2WRMA 5KFHA 3CJ5A 1VRTA 4QIWD 4AQYF 4DV4J 5D6GA 3IR7B 5KFQA 1UFKA 2PI5A 5L1KA 2GHWA 1CBKA 2AX1A 3IG1A 4DCPB 2J7WA 4XPCA 3G6ES 3R1LA 2UUCJ 1X5TA 4QIEA 4B3TJ 4USIA 1RWOB 3BYRA 5T7LB 2ACYA 1KQSR 4FF1A 4Q2LA 3JAMY 1CS4A 2HWHA 2OPSA 2AEJA 1BQXA 2LFVA 2X3DA 4MT1A 3AY0A 4RBVA 5GVQA 3QT7A 3UFCX 2OTLS 8AT1B 3K8VA 4KHPF 4BWJA 5LRNA 1F9EB 1SQFA 1XBWA 4G1IA 1YJWS 4ED7A 3TZWA 2B9XA 4JI2F 2YH0A 4TVAB 1S99A 1RLCL 2J5AA 2XWYA 1Q78A 3FZ2A 4Y2IA 3TAMB 3KLEA 2EKYA 3KDNA 3F73A 2CQGA 3IGYB 5GADU 2Z57B 2AGQA 4LQ9A 3VQTA 1FTRA 3MMBA 1IM6A 3CD5A 1N5QA 1RAAB 2XSJA 4DV1F 4LVOP 4DR5F 1HDHA 3NKNA 4ILMA 1TFYA 2XRGA 5GMKa 2XC9A 3UCZP 2KT3A 4XDDA 4DV3F 2C2DA 1V3SA 1HARA 2C2MB 1IBLF 2V50A 3NY0A 1VQOS 1I94F 1B99A 1C0UA 4WU2A 5LL6d 3UDVA 3UE2A 4K2JA 3ZTRA 3T5KA 5DQIA 1VQLS 4FYDA 3W65A 3CJRA 1JLCA 3LP1B 5DQHA 3H5YA 3BV8A 5ITHA 2EKNA 1RT1A 3GR0A 1S1WA 3KLIB 2PEHA 1F2HA 3V6HA 2GX8A 1OYEA 2D41A 2DGWA 2IAJB 2ZZTA 3DDNA 1Q1KA 3ZZUA 4RUAA 2DGOA 3AODA 1YJRA 4LSLA 2JHEA 4V1Ak 2DH9A 2J76E 4YEAA 2W2QP 5BYRA 4C0HA 4C3KA 2H1YA 1RT4B 1H38A 2DH7A 2L41A 5HI7A 4ZVUB 2H54B 1IQZA 1GAOA 1M5KC 2W8SA 2AYEA 3MEDB 2LXIA 3M2UA 1IBMJ 2GVDA 4ZITA 2B8QA 3D1QA 3UR0A 3I55S 2OIHA 1N48A 1IR2A 2AYGA 2G9OA 1AJDA 4C6AA 3VAGA 4ECVA 1KHKA 4J9RA 1IKXA 2HHSA 4C11B 5LSRA 3M8PB 3QZ8A 2QT7A 4DV3J 4YR1A 4KIAA 5A8RB 3BEGB 1O51A 3KHLA 1ZAWA 1W7WA 4DSEA 2C2EA 1M90T 5BYQA 2R7UA 1SKRA 3SSSA 1OWXA 2CQ4A 1S48A 2WW8A 2EPIA 3G8QA 4KKOA 1NK4A 1GXLA 1V6HA 2CIMA 3BN7A 3DM2B 4O3OA 4AXIA 1G4CA 1VC0A 1S57A 2ZFHA 3TUPA 2CDRB 2UUAF 4MY4A 3I4HX 4LF4J 5BYSA 4NASA 3PJWA 4YP3A 4NL5A 4B9TA 4DPYA 4CCHA 4N76A 1JIHA 1R8HA 2B7BB 4R5PA 1WKLA 3CW2C 5J1EB 4M5LA 2LEAA 1WELA 3E01A 4Q8EA 3BBFA 2KXNB 2XG8A 3KJFB 1RWMB 2HHQA 2DD8S 2HS4A 3SCKE 1NH8A 1XWLA 3DLGA 4N77A 2HQFA 3W2VB 5GAHU 2ZH5A 3J7AN 5EN1A 4F02A 3EVOA 3CJ2A 3G8TA 2LQ5A 1H73A 2CJXB 1RWNB 2JLFA 3BZQA 2ZZMA 2DH8A 4ELUA 1YRUA 2W2PP 4OZ5A 4RW6A 1Q5YA 3NXZA 4HT7A 1WTBA 3NKRA 3D0HE 4CXKA 1TKTA 1RJJA 1NK0A 1X4EA 2XO7A 2HG4A 4TY9A 2W4CA 3ETMA 1RAFB 2P9GA 3E2DA 4ZVFA 1G2EA 2OFHX 3D7SB 3DU5A 3BGRA 2FHMA 3GWCA 1RCXB 3HZEA 1U47A 3IFEA 4M5KA 3UWTA 3KMQA 2PMWA 4DV2F 3PX0A 3B82A 1Q16B 1Y9OA 3THTA 3UVJA 4QBUA 4IUFA 1HQ2A 3NS7B 3LP2A 2RHQB 2NPIA 2Z56B 1Z4UA 2GGPB 4NMXA 5B09A 1NHVA 3SQGB 1O8BA 2OD6A 1FKAF 2RIJA 3F41A 1RWXB 1VCTA 2DXDA 3WBZA 1L3KA 2DNZA 4ZP9A 4U7CA 5L0EA 3H5UA 3HKZD 3D0GE 3DRRB 4HL9A 4I68A 5E0OA 1RCOB 5IC6B 2BJ7A 1WNEA 1NUEA 1AJAA 2OELA 4OIXA 1RAJA 3Q3QA 3CCVS 2PSZA 4F4ZA 3QRRA 3IWLA 4F2SA 2PN6A 3TX0A 1FTCA 1KS2A 2RNEA 4MIWA 4NLDA 4GMKA 3UR3C 1YX2A 2CZVC 4LF4F 2F8MA 4U7UK 2VG5A 1VS3A 3ENVA 2VICA 3BPSP 1AROP 3KUGA 3PKYA 3PY8A 1FKPA 3SFGA 2VKZG 3EZOA 3TZXA 3RU0A 1O98A 1HWLA 4MK7A 4ZVSB 1SCJB 2DGSA 3FBCA 5I3PA 3T1AA 3FRZA 2R9LA 4AL7A 3JQMA 1M5OC 4UPHA 2RQ4A 1CC8A 1MMDA 3R5BA 2NLWA 2ZD1B 3RR7A 3QGPA 1DQAA 4RW4A 3HHLA 2FLNA 2DNGA 2GMLA 3CD7A 3KUHA 3LO3A 1AFIA 4DZ6A 3R1HA 4TN2A 3KJVA 2YQ3A 1LW2B 2NXJA 4RNNA 1NHKL 1S1UA 2CPHA 1ZEDA 4E98A 2M8HA 2FHJD 3M8WA 2M7SA 4WIQA 1WF0A 1MROB 1EZZB 1GXUA 1U7LA 2B8PA 2CQIA 2HK3A 3CDWA 2RDJA 1UWBB 3AFGA 3BGLA 1YBTA 4L6V3 3VTIA 2MQPA 1Y3JA 1XJWB 1HBNA 2V4JA 4RJVA 5CA5A 4YOEA 4WFBQ 4I56A 4LJMA 5CZXA 3TUZC 4DF4A 3LAKA 1XMQF 2HVZA 1N34F 5D78A 2RJZA 3BKUA 2MY7A 5A6WA 2XCAA 5H9EK 4AL5A 2E5GA 3TVYA 1Z2LA 2FZCB 3IRWP 3FEYB 3R5AA 2H3EB 3BR8A 3QWUA 2YQ0A 4ZHRA 4LSZB 3W3SA 2NQPA 3RYLA 4MYTA 5KG7A 1U1MA 3KKFA 5IJQA 3VV2B 1MU2B 4NOHA 3PR5B 4F4XA 3M6WA 1ZS6A 2D9OA 1YJTA 3MR3A 3CEDA 2B5JB 1E6YB 2W9CB 5D0GA 3KLFA 1JJ2R 3KNGA 2EBGA 3IBWA 4M1KA 5B0AA 5THWA 4FKYA 4C11A 2ADCA 1VC5A 3HVRA 3LALA 4JI1F 1VC6A 1IBLJ 4KYZA 4PG5A 1S1TB 1FK9B 3GE9A 4BBYA 1UEVA 3OR2B 3T5JA 3DU6A 3E2EA 4B3RF 2HMIA 3CJ3A 4G65A 2EFQA 4AUKA 4UOPA 4OX9F 3DYCA 3CWJA 4I7FA 1UVIA 1ZEBA 2DNQA 1ZPVA 1RT6A 4ER8A 3UO0A 4UOFA 3IDDA 4NYOA 4CO5A 1N34J 3NKOA 2MEWA 4IO1A 2DB1A 2YX7A 3M7VA 1FNMA 1NMEB 1Q8KA 3EVWA 4NA3A 5IT9U 2W8KA 2QMWA 2U2FA 1QAYA 2YY3A 1N5VA 1QSLA 4CO4A 2MKKA 4WE1B 3K5OA 4A8KA 5KFRA 4EYHB 1TVRB 1TKDA 4ZVEA 2XY7A 3D66A 2ASYA 1U6FA 3BS9A 1CC7A 3EMTA 2H65B 3H5SA 1YLXA 4HTIA 5M2RA 3BR9A 4DPWA 1R0AA 5C42B 1EIYB 1IBMF 5CAAA 2NR0A 3R27A 2DHGA 4DV7F 5J2QB 2XY6A 2GAHC 2OFGX 5B0GA 3T02A 2YNHB 2G0CA 1M1KT 4EI2A 1CJUA 1H72C 5M2PA 2AYBA 2VF3A 1ALHA 4HACB 4UY8T 2EFGA 1LOUA 3W61A 3QZ7A 3A1YG 2XMVA 1ALIA 3M2VA 1GMUA 4HDGA 5IQQA 3ETOA 3PACA 3QIPA 2HKEA 5KFTA 3O5TB 3BDPA 1RTIB 1TL1B 5IOLA 4DDFA 4ED4A 2VU5A 4C97A 1FRHA 3POTA 1KVJA 2GC8A 3DOLB 4OI6A 1SHQA 2QYCA 5LQQA 3D54A 4M5GA 4LMZA 2R8GA 2ATCB 2QL5B 3T19A 1GX5A 3I32A 2EG2A 2V4RA 2W1BA 2XTJP 5LM7E 2UVUA 1GX6A 1DARA 5D4NA 1QUVA 2WSFC 2XYGB 2C2NA 4ZIWA 1AYEA 2ZITA 3ZTPA 2PEBA 4PG7A 4H54A 2DIUA 1NJXA 3PO5A 5IWAJ 3P3DA 1U2CA 2DXEA 1UVMA 1XR5A 1TV6A 4DPXA 4JB8B 1SJQA 2PD1A 1VQ5S 7AT1B 2O66A 3VAIA 5EX3A 1P1LA 1FNXH 5B0EA 2AJ2A 2PGCA 4KV8A 3ENAA 1P27B 1W2BR 3CO0P 4B17A 3OFGA 4QYRA 2DR5A 3ILOA 4NA2A 2B4PA 1MMLA 3EPGA 1Q8BA 3M30B 1RHKB 1YHQS 2R3VA 3T6BA 2JEIA 2CJQA 2M70A 1NZAA 1S9GA 4ZKAA 4QIFA 1A0OB 5DLGA 4TQRA 3OTOJ 3O1LA 4RLEA 2D3OR 2DCLA 3RB4A 2DGUA 5DLFA 2FVSA 1FA0A 4YB6A 2MQMA 3PW4A 2MKCA 1TKXB 1NSQA 3DLHA 4JI4J 2ZHBA 3JAMU 2MGZB 5HMWA 3ISZA 1KH5A 1FRLA 4WZMA 4C8OA 2EEYA 2HLTA 1YRXA 3EJMA 3NKYA 4LF1A 4Q0BB 1GXTA 1RHJB 2XHCA 4I64A 4DX6A 1LWCA 4NX9A 5CYJA 1JB0C 1JLEB 1NHUA 2BR0A 3KLGA 4FS2A 4X4TA 2FVCA 2VFVA 2Y1RI 4UTGA 3BSCA 2BE2B 4Y2MA 1LW0A 3FEXB 3HFVA 2OMLA 3MEGA 4Y2AA 3RW7A 2N82B 2JVOA 1IJFB 4DR1F 3PYDA 3TW0A 5JJBA 2AX0A 2D74B 2AZ3A 1X0PA 4XAKA 4GKJJ 1PC5A 4TY8A 2HFOA 4OYPA 2A2DA 5L9NA 4USHA 3FQLA 2Z2ZA 3MTKA 3NWGA 2OP5A 1R7IA 3BB5A 3I87A 3MM6B 3KDOA 3NP5A 4F04B 5JVHQ 3LXQA 4CLZA 2GCFA 1RLDA 3P5BP 3N6LA 3CJKA 3V6KA 1OY8A 1T03B 2UUBF 3SSRA 3H2VE 5F8MA 4LF8J 3RRGA 1HPZB 1QJHA 2NCKL 3DC2A 3I9ZA 2HMIB 3FFIB 3T9NA 3Q8SB 3KK1A 3BH6B 2LEPA 3MM7B 1N0VC 1RUSA 1IUJA 3PHTA 4I7FB 5J2MB 1T7PA 2GAGC 2ZOGA 3BH7B 4IOAQ 2Y1LB 1V5VA 4NLRA 1G3OA 4ZPVR 1U1KA 1M5PC 5HRTA 1WEZA 1S0VA 3GTYX 4QCLA 2RF2A 4KGZB 1RAEB 3BO3A 4ED8A 2FPHX 3BDHA 1ALJA 2YQ1A 1B70B 1RBOB 2BA9A 2CJ9A 2N4DA 3DOKB 4DSLA 3R2CJ 3HSJA 2DBBA 2UXCF 3C14B 3OFFA 3BQ0A 4J90A 3RAXA 1TK0A 1E6VB 5C5JA 2BJDA 2VFSA 3L3CA 2A6OA 2WONA 4WP8A 4ERDA 5AJ9A 1ZOTA 2I9SA 3OLAA 2PIIA 3DOMA 4PABA 1EX8A 1NZ8A 2YTCA 2HURA 2FDNA 3E51A 2XS2A 1Q8IA 2ZDPA 3MR7A 5DDQC 3HHLD 2PFFB 4WFZA 1HMVB 2QMUB 2HK2A 2L48A 3EYZA 4B9UA 2XQCA 3CNQP 1LWEA 4A8FA 2H9ZA 1CS4B 3SZZA 4ZPAA 5L39A 5LOQA 4UOOA 2E1RA 1KN6A 3NNHA 2ZOMA 4OZNA 4OMFG 4U6PA 2YWWA 1YSJA 1OMSA 3M2RA 3QWPA 2ZWPA 3KLHA 2APOA 3BJYA 3OW2R 2HZVA 1UVLA 2CADA 5A8WB 2DRAA 3VAKA 2DHHA 4CLUA 2IJNA 2UUTA 4K50A 4ZPDA 2GLQA 1NPPA 4EK2A 2XLIA 5D3GB 5HVGA 3D2WA 4J9NA 2LYVA 1VJWA 5CD4A 4ILRA 1KBRA 4QIGA 1Q7YT 5DS7A 3TX8A 2MQNA 3GG1A 4HI2A 5BXIA 1S7HA 4DV5J 1ZA1B 4IFYA 4OQJA 4DJBA 3HM9A 2H4YB 4ZLLA 3HXMA 4EBDA 2BDPA 1XR7A 3CCMS 1JXEA 1Q95G 4L72B 5DDOC 4N5SA 5IT9Y 2HNYB 1KC8T 1VBYA 2XZDB 1XNQF 1JNZB 4JV5F 4LT6A 5B7WA 4L73A 5GAGI 4JUZA 1UKUA 3TA1A 3D68A 3MEEB 3DLJA 2CXEA 3GIRA 4OFZA 3PIPQ 3CCQS 4F26A 3BGOP 3QJPA 2E7VA 5F8LA 2GS8A 1JLCB 3LP1A 3FBEA 1RT1B 4NLQA 5HMXA 3QGHA 3SIPB 2EI5A 1EB0A 3MMAB 4I2PB 4Z2XA 1TELA 2HQIA 2XMJA 5E2QA 1AZSA 2DXFA 2LXUA 2Z30B 3L9ZA 2E29A 4LF6J 4CO1A 2ALZA 4P74A 2X1AA 3VWSA 4OZ2A 1T3OA 4CLPA 4KHPJ 4KO0A 3ZNJ1 1H6KX 3MD1A 2HRTA 3SZYA 2ACMA 4I6WA 4ZJLA 5F9LA 2BQ3A 2XGPA 5D15A 5AXLA 2VASA 3GZ7A 4DV2J 3M4XA 1KVIA 4KKOB 3JYTB 2GVDB 3ISND 3DM2A 3JTNA 4H4OA 4WTYA 3MEDA 4ZPTR 5KFVA 4YB7A 3T1YF 4GTWA 3OLBA 2I2YA 4RW9A 1ZTTA 1QAXA 2RS8A 3CCRS 4NI2A 1RABB 4B9LA 3W66A 1HQUA 2Z0GA 1UL3A 2F7VA 4ZPCA 3TANA 4Q0BA 4WKYA 5D8HB 1E2SP 3HX9A 5L0BA 3ITHB 1LWCB 4JI7F 4OJ1A 1B7YB 1YJVA 1QVGR 2HWIA 2DHXA 1FWKA 3MAAB 4KM4A 5GOVA 4TNOA 4WFNQ 1HWJA 2NS1B 2A10A 1XNQJ 5G4DA 1BWEA 4LREA 1MN7A 3KD8A 2R42A 1JLAB 4FP9A 1WTFA 2XS5A 1FHTA 2RS2A 4U95A 1J5EJ 3OTBA 4OYWA 1T9YA 3H25A 3BSNA 4W4MA 1JNRB 1MN9A 1VHIA 2DEJA 3IRXB 4PXCA 4W98A 1UWBA 4WXOA 4TY8B 2FB0A 1NDPA 3B54A 5ETMA 3RRKA 6FD1A 2V34A 3MTJA 2OJ3A 4JI0F 1T9XA 3DRXA 4OV6A 3ULHA 4O3NA 5EWEA 3CC4S 1Z1ZA 1KEKA 4R5PB 4NCGB 1RT2A 1KDNA 1TL4A 2HS0A 2FJBB 5KT6A 4UZBA 2KG0A 3PYFA 2IM0A 3GJSB 5DLTA 2FJDB 5D4OA 4LFAJ 2J7KA 1N56A 5JXSA 4K4ZA 1EQMA 2DY1A 2AW0A 2DO4A 4G1QA 4HVZA 3RBDA 2GHPA 1D0EA 5KFDA 4M63A 2KT2A 5E3PA 2KM8C 2IJRA 3AT1B 4USVA 1Y11A 2CUYA 4DX7A 4A8OA 3TWZA 1K0TA 1EP4B 4KJDA 1FCAA 1Y5NB 3DLEB 1S1VA 2M8DB 4FXWA 2A3JA 3R7SB 4J5OA 3VF0B 1Y6VA 2ZOFA 4I6AA 1KFDA 4KAIA 3MOZA 4ID8A 4MFBA 3MWBA 3CXCR 1CSJA 2H5EA 3DOLA 4CTAB 4F25A 4JI1J 4Y0FA 1FK9A 5AT1B 3RB6A 5KFCA 4K4TA 3A4TA 1QM9A 1K9MT 1I5OB 2F9JA 3N5FA 4IH6A 5KFBA 3QBCA 1HJKA 2VQEJ 4DS5A 3GYXB 4OHZA 5FD1A 1RI7A 2FVQA 1Q0NA 4CNYA 1AT1B 3A8JA 4M94A 3T01A 3CVKA 3CGIA 2GGPA 1BD6A 2HQDA 4NZ6A 3NMRA 2RRAA 4WZQA 2D9PA 1R8AA 3THPA 4U9RA 3RR8A 2FY1A 2FHKA 3MAQA 2HFNA 1C1CA 1U1OA 4DSIA 1HNWF 4NWBA 5J1NA 3M8ZA 1WI6A 1RWUA 1U6BA 3GCWP 2P5VA 2ZM6F 1N33J 1I3OB 4A47A 5I3UB 4O0NA 4CH1A 2ASDA 2HIYA 2DR8A 3AOCA 3PX6A 1ED8A 3KLVA 1WOPA 1VLYA 3TEHB 2CJAA 2XLKA 3CT9A 1RISA 2V8VA 1RTZA 2DO0A 3IG1B 3T6JA 2AP6A 3V4MA 4QIVA 3KOAA 3HF5A 1LW2A 3KFWX 3IR5B 2G1DA 2UUAJ 2VFRA 4CH0S 4KGKA 2VH7A 3OHBA 1L3UA 4B3MJ 4ITSA 1LXJA 3KJNB 3SQOP 2J8AA 2DTJA 3MPVA 2QA4G 4KGMA 3CDUA 2HVDA 2QL9B 5EX0A 2IHR1 5KT5A 3NAHA 1PBUA 4OL8A 1CULB 3DLKA 3L7UA 2DR6A 3UD3P 1IKYA 1RADB 4DN9A 1ZBTA 3K2YA 1WEYA 3W2VA 5HMZA 2XYHB 4NLTA 2XGQA 4DV6F 4DFKA 1KD1T 4NXMJ 4UY85 1FWLA 2DNMA 4DV4F 1R43A 3IM9A 3MPWA 4NMLA 1JKHB 5A76A 2MJNA 2VPYB 4EZ9A 4CYSA 2Z4PA 3BM7A 2M4MA 3JSBA 1WHVA 4LR9A 3FGVA 3X1LB 1SPBP 4OI2A 2AGPA 2JLEA 4ALZA 5KT2A 3EZUA 5KFUA 3ELHA 4P72A 3KLFB 3BDFA 2LQ9A 5DG8A 4O44A 2HVEA 1VISA 4MK9A 4FNHA 1VI7A 5ETQA 2W7PA 1D3WA 2FD2A 1VBKA 3CCES 1DLOA 2GVZB 4FBUA 4P7VA 4IG3B 4IDKB 1FRKA 3FNNA 3W2WB 2VQEF 3M9OB 1PO6A 2CA9A 2QN6B 2ANHA 5L0KA 3UCUP 3HKWA 1NAQA 4ZHRB 3NKMA 3ILLA 3TR5A 4EGLA 4RBUA 2V94A 2CVEA 1TL3B 2BABA 1RXOB 2BZ2A 3LP2B 2JOQA 4PXEA 3C6TA 3FMWA 2QO3A 4M5HA 4A8XA 4DR5J 3D4JA 3OXGA 3WZ0A 3D9BA 4JI8J 1X4BA 1YRTA 3H98A 4ZVQB 4CP5A 4O23A 1RT4A 2P8IA 5LT5A 1N32J 5A8KB 2J0QD 1NDCA 2HS3A 2R7QA 4OLPA 5EHHA 5DRKA 1WG1A 3GYNA 1NKEA 1R8CA 2HHHF 4Q43A 4ID5A 1HW8A 2VB6A 3OVBA 1TKZB 2W5RA 5HQMA 4JI0J 1J5OA 3A3PB 2CQ3A 2E5HA 5DO2A 3UI3A 2LQ8A 4WYWA 3MCNA 4QJVA 1CJTB 3N0VA 3I5BA 5K8OA 3VAHA 2CQ2A 4PRFA 1DZ5A 1GQEA 5TJ3A 3VHQA 2EC0A 2KYXA 4F3OA 2ZH6A 3RB3A 4F8RA 5DDPC 1KH9A 4P2SA 2P6SA 1TUVA 4O4GB 4IOCQ 3HDSA 3QLHB 4IQMA 5KT3A 1IKVB 3JB9k 2E9ZA 3HULA 3OR1A 2Q3PA 4HLBA 4RPFA 4R0JA 1HQAA 3NBPA 5IFMA 3MMCB 4PWWA 3O44A 3M6XA 4N7TA 4XDCA 1U26A 2HQGA 3VGTA 5JVGQ 2QEXS 4JP8A 4B9MA 4JI4F 3G2XA 4GKJF 2IYGA 3H40A 1WDDA 1KHJA 5HSPA 4JYAF 4JV2A 1R27B 2H51B 3E01B 5CQGA 3DN9A 3HVTA 4AT1B 2ZUAA 4IG0B 2OHDA 1RA6A 3PRDA 3U7JA 1FXRA 2X1FA 1KTQA 2FGOA 1HPZA 2B0GA 1BUXA 2W5XA 4RX6A 2V67A 4DL6A 3GJRB 2DGVA 1RAHB 3C6UB 4NLWA 4X4RA 2ZH7A 4IR1A 2VG7A 4ED1A 1DY3A 2XULA 1NCLA 2I5JB 2YXLA 4MIVA 1HWKA 1Y00A 2M52A 4RW8A 3KHGA 1ZYQA 2FJEB 5EGYA 4ZG6A 3V81A 1REGX 3UQSA 4DUYJ 3D0IE 3LPEA 1URRA 1VRQC 3K58A 2R2RA 4P75A 2FC8A 2QZ8A 3NS6A 4KV8B 1C1CB 4WP3A 1IKWA 3TZZA 1GT8A 5KFGA 2E5LJ 2IFXA 2X98A 2HAIA 3AA9A 1R0AB 3HD2A 1PYSB 2O67A 3QGIA 3QIDA 1PAEX 1IR1A 1VK8A 2LCWA 5K8MA 2FGCA 1KOHA 2KT5A 2BVZA 3P4UB 4HR2A 1N36J 3TARA 2ERRA 4JV0A 3UD5A 5KG4A 2M2BA 3M1VB 3DMJA 1S1WB 1S59A 3KLIA 1FRMA 1OSCA 2F1FA 1UETA 1S12A 2QLJB 2V2KA 1PG5B 2L08A 3DDKA 3SZ2A 3N5BA 4KGXB 4RUCA 3OL6A 2IAJA 3CDAA 5KFZA 2IC3B 4TU7A 4E2FB 1U48A 4Z37A 2ZKTA 1CEZA 4HH0A 5AE1A 3J80Y 2DVIA 4P2FA 1N2LA 4DU8A 1KH7A 2JX2A 5L46A 2KFNA 4JBCA 4OLOA 4GC6A 2E7WA 3BYPA 1I1GA 1U8SA 4ZCLA 3T00A 2CNLB 4A4JA 4TYAA 4AXJA 3PKMA 2UU9F 4CLTA 4KQZA 3DRSA 4J9OA 2KTQA 4URSA 4OI4A 3FSYA 1IWAA 2CNKB 2IJFA 5L9XA 2LA6A 2KH9A 3JSMA 4ZVTB 4IR9A 3CD6S 5A6PA 4JYAJ 3QJJA 3WAYA 3MCSA 1IKXB 3HMJG 2DKOB 2MHEA 4LUBA 1HNWJ 5F8JA 3QSYB 4K0KJ 2WBRA 4X2BA 1BLUA 2BOAA 3M6VA 4RW4B 3DLGB 3V6JA 1SKUB 2HHPA 3PG9A 4LR8A 2BE2A 4BCAA 5HROA 1CJKA 2RT3A 4QU6A 3QAUA 2CPXA 5IWAF 2DT9A 1KH4A 3Q22A 2A6MA 2CJYB 3G4SS 3MMAA 5EWFA 4EUVA 1TTHB 5J2MA 1QD1A 1RYSA 1HWUA 4TN0A 3V2UC 2A1BA 3C16A 3A3OB 4H4KC 4LRCA 5C42A 4YHHJ 2XM3A 1HBMA 5C25A 3TO8A 3D6FB 3G6YA 1JXLA 4YR3A 2IVYA 1UJ4A 3G87A 2W7AA 3AB2B 4MFBB 1FESA 4PXDA 4BC7A 2G4BA 3DNCA 4CO2A 2J9DA 2ZE2A 5E3AA 5A8KA 1Y7PA 1N6QA 4MHXA 3JSRA 3TI0A 2IM2A 1SVDA 3CJKB 4MKYA 4NXNF 1GFWB 2R8IA 4QR1A 4ED6A 1YIJS 1IWGA 2VBYA 4RNOA 1WJ9A 3TUIC 3B78A 4M5MA 4DEZA 1AFJA 2DRDA 3AOAA 2RU9A 4LFCJ 2RDIA 3Q8VA 3CDBA 1SC3B 4USKA 3R8YA 4B08A 4QWDA 5K14B 3OHAA 4DFMA 1XN9A 4QPTA 3CPWR 1Y3KA 3NOCA 1QDUB 3K5LA 2F40A 3DCAA 4JOUA 2JZ5A 5GAEI 4LIRA 7FD1A 2XWXA 1S49A 4O0IA 5DM7Q 2B4OA 1XMQJ 4F67A 5IJSA 5GRRA 4QR0A 2KM8B 3IM8A 1S1XA 4NRUA 1H3DA 1RTHA 1U2RA 2DGXA 2ZWOA 1V9OA 3PTWA 4DQSA 2V5HG 3L4BC 4PWDB 1SIZA 1R6VA 2FJXA 5HATA 3ZC4A 2M5YA 2G2ZA 2UZAA 3DGVA 2MQQA 2F4FA 3CD0A 1FO1A 3GJTB 1T9TA 3MUTP 2GIQA 3JS9A 2MSSA 4CLSA 3KK2B 1T05A 1N4LA 2NXUA 3LANA 2XO6A 4C8LA 5K9FA 3KMSA 4W90B 2EXUA 4PQAA 1NB7A 1C0TA 1WKKA 6AT1B 3DRRA 3G86A 1RWKB 3KG1A 3CCSS 4C3MA 2HNZA 5HBMA 1QY7A 1T8EA 4J9PA 4UZCA 1EJJA 3CSKA 1SH2A 5CXTA 1J27A 1IR0A 2WAQD 3S8SA 2CWXA 4N47A 4AQYJ 4F3MA 2QFIA 3EWGA 2RSQA 3GP9A 3DYAB 4A8MP 4WFYA 3IGVA 3NKQA 2V0NA 2YNHA 3CIZA 4MIAA 4USJC 4CLKA 2LU2A 4B02A 4J9LA 1RTDB 4DSKA 1ZM2A 2MGZA 1VQSA 3MDFA 3EGZA 1R6YA 5E3CA 5F0UA 4C4WA 1GH8A 3LWLA 3UN3A 3MM6A 2GQQA 1NSPA 3GMGA 1F9FA 3LQVA 5D0HA 2X3GA 4J91A 1SL0A 1KHNA 2QTWA 2M9KA 5BR8J 5SUHA 4O44B 3ZXWA 4WJBA 1XNRJ 5HL7Q 5LJ5Y 2FQQB 5A2QU 2ZHOA 2QC3A 2JC0A 2CZ9A 1TL1A 2MMYA 4X65F 2W2OP 5C7PA 2W7OA 3HCXA 2YKMB 5KG6A 2E5JA 2IPOB 2K3IA 3CO9A 3DGPB 4ES1A 4ECTA 2CVIA 1WC4A 4M95A 1WC0A 1FDNA 3HD1A 3I9V9 2W9CA 4X4QA 2O01C 5CCLA 2E66A 3MR6A 5KG3A 4UOGA 3ONQA 3UN2A 5B0DA 1KVKA 3D6MB 3PEHA 1RKJA 2I6WA 3CCWA 2QLWA 9ATCB 4MKAA 4CH7A 1FSUA 4DV0F 2JEFA 3TOQA 1YJ7A 3K5MA 2NSBA 3IR6B 3PV8A 5FIIA 1VDHA 1F5AA 3GCXP 2K7KA 3HK2A 1VQ6S 2CNNB 3LGNA 4C8YA 3IRXA 2HFUA 1BGXT 4RBTA 4KSEB 2BW2A 2JFKA 3RBZA 2MLYA 4LR2A 3QT5A 4QQBA 2ZDOA 2E1AA 2K3KA 2MZJA 1LWEB 9RUBA 2VBWA 3BDGA 1RACB 3C8YA 4P9SA 5AE3A 2XI3A 1SJFA 2HBQB 3F44A 3OBIA 2VHGA 1U2FA 2R7VA 1NO8A 1WC5A 4PPZA 5HN0A 4J9KA 3IGZB 3PNIA 4RUBA 5LSLA 5DQGA 2L9NA 2A2CA 4WP9A 3Q23A 1B8JA 4FF4A 3S01A 3C15A 3KNAA 2I8EA 2DNLA 3NVLA 2L9WA 3IAS9 4OZ0A 1KSPA 5D3GA 1B0TA 1UZHA 2V2VA 2X1GA 3CJTA 4NCGA 5B08A 4JI5F 1FKPB 2QX0A 3KXDA 3PM9A 3G82B 5HAOA 5F8HA 1ELZA 5D0EA 1URAA 4ZS6A 3PXGa 3ENWA 1OPZA 4I69A 4NYZA 2ZE2B 4UUXA 3IWNC 2VOOA 4WPAA 5IV3A 2RQCA 5B0BA 3MM7A 1PJ7A 1MW7A 2LDIA 2PO4A 4DV0J 3PZPA 2KFYA 3KLHB 1RTIA 3HHLC 4DR4J 2JFDA 3W8PA 4UPLA 3LAMA 5DLVA 3BGUA 3B4DA 1WG4A 3DDIA 4YB5A 1L3TA 2LP4A 2I5JA 2XHWA 2J0SD 2VA2A 3KJQB 4X84A 5F8NA 1EETA 4HACA 1X5OA 2F4VF 1X8DA 1G1XA 1T94A 4DU7A 1MSWD 2Y0BB 2C1EB 3NGSA 3UDEA 1WOOA 3LA0A 3H59A 2D69A 2GV1A 3IO1A 3O6QA 3M2VB 5K8NA 3ISNC 5F3TA 3J81U 3EZ5A 2LA4A 4ED2A 1TFWA 2KL8A 4PKDB 5AE2A 2UU9J 4WXWA 4J9SA 1K1SA 3HJVA 3CCJS 1YJNS 3MXHP 3MK2A 3HHKA 4AYBD 4F4KA 5E5NA 2AT1B 2DNKA 2DIVA 1D8YA 1N5TA 4GVBB 2YBVA 2B9YA 4M5DA 2R2TA 3P8BB 4B56A 2JRSA 3IWXA 3RG6A 3K8WA 3CMRA 2GQ2A 3H2UB 3TVZA 4NWJA 2XNRA 3H4DA 1K44A 4EZ6A 2UUBJ 1T02A 3K17A 3S7RA 2V9KA 5H9FJ 1MMNA 4ICLA 2MKYA 2VL1A 5HBMB 4LF8F 1S9FA 3PO4A 1BMQB 2I0XA 1JMTA 1Q79A 1ROFA 2GZOA 5GAEU 3GIMA 3MZIA 2MHNA 1EQJA 2UVVA 2DHSA 1S76D 2ZNYA 1Y4ZB 2N7YA 2HIQA 3S1TA 2OUGA 5C24B 4H4OB 5A2QY 1VK3A 1U45A 1NJIT 3AD7C 5E3QA 1N2KA 2WVCA 2DNPA 4DL0C 2A18A 1S0NA 4YN3B 2B43A 1GNKA 4WYLA 1LFPA 3Q8YA 4C9DA
chains in the Genus database with same CATH topology
4CYSA 1N2LA 1KH7A 3MK0A 4LR9A 1AJDA 1KH5A 3MK1A 3SZYA 2VQRA 3WAWA 1KHKA 1KHLA 1ANIA 5C66A 4YR1A 3M8YA 3BDFA 4GTWA 4UORA 1E1ZP 5KXAA 1E3CP 4GTXA 3UN2A 2W5WA 3NKPA 5IJQA 4FDIA 3WAYA 5LIAA 5L0KA 2ANHA 1FSUA 1AJBA 3NKMA 1SHNA 1Y7AA 4MY4A 4CXUA 5GOVA 4KM4A 3WAVA 3T00A 1E33P 4LR8A 4LREA 1KH4A 2W5SA 4LR2A 1O99A 3LXQA 3DYCA 4CYRA 1ZEBA 2W8DA 4KAVA 3UO0A 3BDGA 4FDJA 3IDDA 1ZEFA 4TN0A 4CXSA 4LRCA 3NKOA 1P49A 5INHA 2W5QA 2QZUA 1ED9A 3M7VA 2W5RA 3IGZB 1B8JA 2W5VA 4UPIA 1ALKA 3NVLA 3NKRA 4LRBA 1K7HA 4CXKA 5HRTA 5TJ3A 5EGHA 3BDGB 1ALJA 3UNYA 3BDHA 4KAYA 4LR7A 1ELZA 4LRDA 3TWZA 1KH9A 3A52A 3E2DA 3ED4A 4KJDA 1EW9A 1Y6VA 3T02A 1HQAA 5LRMA 4N7TA 5AJ9A 3OT9A 2IFYA 4UPLA 1KHJA 1HJKA 5DLVA 5DLTA 5IJSA 2W5TA 5GRRA 1ALIA 1URAA 3SZZA 2W5XA 5K4PA 4UOOA 1ELYA 1EW8A 3T01A 5L0EA 3IGYB 1AJAA 4UOPA 3NKNA 1ALHA 1HDHA 1SHQA 5DLWA 3Q3QA 1EI6A 5LQQA 2GSOA 1EW2A 2D1GA 2XRGA 4GTZA 4ZG9A 3M8ZA 2XR9A 3TX0A 3DPCA 3MK2A 2G9YA 1ELXA 2GSNA 2GLQA 2GA3A 4MIVA 3UN5A 4ZG6A 3TG0A 1ED8A 1EJJA 2IUCA 1AUKA 1O98A 4B56A 3WBHA 5L0BA 4GTYA 3CMRA 4UPHA 2X98A 4QAXA 3NKQA 4NWJA 4ZG7A 4KJGA 5EGEA 4ZGAA 3KD8A 4UPKA 1E2SP 4LRFA 2RH6A 2GSUA 1ANJA 1EQJA 1AJCA 3UN3A 1ZEDA 5LRNA 1KHNA 2IUCB 4LQYA 3WAXA 3M8WA 4MHXA 1URBA 3B5QA 1N2KA 2W8SA 4LRAA 4NWXA 2ZKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYS A;  1N2L A;  1KH7 A;  3MK0 A;  4LR9 A;  1AJD A;  1KH5 A;  3MK1 A;  3SZY A;  2VQR A;  3WAW A;  1KHK A;  1KHL A;  1ANI A;  5C66 A;  4YR1 A;  3M8Y A;  3BDF A;  4GTW A;  4UOR A;  1E1Z P;  5KXA A;  1E3C P;  4GTX A;  3UN2 A;  2W5W A;  3NKP A;  5IJQ A;  4FDI A;  3WAY A;  5LIA A;  5L0K A;  2ANH A;  1FSU A;  1AJB A;  3NKM A;  1SHN A;  1Y7A A;  4MY4 A;  4CXU A;  5GOV A;  4KM4 A;  3WAV A;  3T00 A;  1E33 P;  4LR8 A;  4LRE A;  1KH4 A;  2W5S A;  4LR2 A;  1O99 A;  3LXQ A;  3DYC A;  4CYR A;  1ZEB A;  2W8D A;  4KAV A;  3UO0 A;  3BDG A;  4FDJ A;  3IDD A;  1ZEF A;  4TN0 A;  4CXS A;  4LRC A;  3NKO A;  1P49 A;  5INH A;  2W5Q A;  2QZU A;  1ED9 A;  3M7V A;  2W5R A;  3IGZ B;  1B8J A;  2W5V A;  4UPI A;  1ALK A;  3NVL A;  3NKR A;  4LRB A;  1K7H A;  4CXK A;  5HRT A;  5TJ3 A;  5EGH A;  3BDG B;  1ALJ A;  3UNY A;  3BDH A;  4KAY A;  4LR7 A;  1ELZ A;  4LRD A;  3TWZ A;  1KH9 A;  3A52 A;  3E2D A;  3ED4 A;  4KJD A;  1EW9 A;  1Y6V A;  3T02 A;  1HQA A;  5LRM A;  4N7T A;  5AJ9 A;  3OT9 A;  2IFY A;  4UPL A;  1KHJ A;  1HJK A;  5DLV A;  5DLT A;  5IJS A;  2W5T A;  5GRR A;  1ALI A;  1URA A;  3SZZ A;  2W5X A;  5K4P A;  4UOO A;  1ELY A;  1EW8 A;  3T01 A;  5L0E A;  3IGY B;  1AJA A;  4UOP A;  3NKN A;  1ALH A;  1HDH A;  1SHQ A;  5DLW A;  3Q3Q A;  1EI6 A;  5LQQ A;  2GSO A;  1EW2 A;  2D1G A;  2XRG A;  4GTZ A;  4ZG9 A;  3M8Z A;  2XR9 A;  3TX0 A;  3DPC A;  3MK2 A;  2G9Y A;  1ELX A;  2GSN A;  2GLQ A;  2GA3 A;  4MIV A;  3UN5 A;  4ZG6 A;  3TG0 A;  1ED8 A;  1EJJ A;  2IUC A;  1AUK A;  1O98 A;  4B56 A;  3WBH A;  5L0B A;  4GTY A;  3CMR A;  4UPH A;  2X98 A;  4QAX A;  3NKQ A;  4NWJ A;  4ZG7 A;  4KJG A;  5EGE A;  4ZGA A;  3KD8 A;  4UPK A;  1E2S P;  4LRF A;  2RH6 A;  2GSU A;  1ANJ A;  1EQJ A;  1AJC A;  3UN3 A;  1ZED A;  5LRN A;  1KHN A;  2IUC B;  4LQY A;  3WAX A;  3M8W A;  4MHX A;  1URB A;  3B5Q A;  1N2K A;  2W8S A;  4LRA A;  4NWX A;  2ZKT A; 
#chains in the Genus database with same CATH topology
 4Q45 A;  3CCL S;  1FDB A;  3AJD A;  2RU3 A;  1D9A A;  4ATN A;  1ELO A;  3MEG B;  2XSF A;  3TZY A;  1VQY A;  2CPY A;  2DNO A;  4C48 A;  2W5V A;  1OSD A;  3MHY A;  4DQR A;  2HBR B;  3UD4 P;  5C66 A;  2BM0 A;  2JH3 A;  3MF5 A;  4TYB A;  4D3H A;  1R31 A;  2GFF A;  1JLA A;  1SC4 B;  3VCD A;  2W8L A;  1HR0 J;  2FTR A;  3FCV A;  5KFN A;  3DGP A;  3ZNU A;  3CJ4 A;  3ILJ A;  5I42 A;  2UUC F;  4OYM A;  2AD9 A;  4XPE A;  1TUW A;  2KI2 A;  5BJR A;  1TMM A;  4GO7 X;  3EX7 B;  4DFP A;  4P2X A;  2OKQ A;  4FZV A;  3RTV A;  1PKU A;  5KFY A;  1HNV B;  1FNO A;  5ETN A;  4ZN1 A;  3PR4 A;  3SYZ A;  2F3J A;  2OAU A;  1Y7A A;  3GYG A;  4DL7 A;  1T03 A;  4K5R A;  2VOP A;  2IDE A;  2EWH A;  1X4H A;  2UVR A;  2ADB A;  4LF5 F;  2GNK A;  1N6Q B;  1RKI A;  3M1V A;  3VAJ A;  1RP5 A;  4RW9 B;  4EBE A;  1FKO A;  1IXK A;  1XMO J;  1NPK A;  3GV5 B;  4HKQ A;  3PHE A;  4QOT A;  3W5Y A;  2H5I B;  2XEX A;  2R2U A;  1FDA A;  3SSQ A;  3FKB A;  2E5I A;  4N8O A;  2UVW A;  1FE0 A;  2HVH A;  1FFW B;  2VPZ B;  2Z2M A;  2RVJ A;  4H4M B;  4KB7 A;  2IVF B;  3VVT A;  1HNZ J;  4FVM A;  5J2N B;  3HSG A;  2BE9 B;  1NJY A;  2LQJ A;  2E1P A;  1KP6 A;  1KQK A;  3AQO A;  3EXC X;  3ZO7 A;  4DOZ A;  2YVS A;  1S7I A;  4RW7 B;  5LJ3 Y;  3Q2T C;  3DRS B;  5EGH A;  2QA2 A;  2ZBR A;  3R5D A;  1B7F A;  1P8G A;  3SCI E;  3SV4 A;  2J7U A;  1FRJ A;  1OIA A;  3ED4 A;  1SH3 A;  2DY9 A;  1HD0 A;  2JWN A;  1HQU B;  2L3M A;  1EW9 A;  3Q8P B;  4ECY A;  2OSQ A;  5I4M A;  2CQ0 A;  4U7U D;  1U0H B;  4K4X A;  2VC1 A;  5RUB A;  3JXO A;  2GQC A;  4DR2 F;  2IFY A;  1TL7 A;  4ECS A;  1WG5 A;  1RT5 B;  3LP0 B;  1WC3 A;  1GMW D;  2DGT A;  2WSE C;  4Q7A A;  1N54 B;  1NB2 A;  7FDR A;  1AW0 A;  3M30 A;  4WU3 A;  5HQL A;  1VR6 A;  2OEJ A;  1SC6 A;  1X31 C;  1WSR A;  2WON B;  3AHP A;  1LK7 A;  1KWM A;  2Y0S D;  4WFX A;  4CWB A;  1GEH A;  3NBP B;  1TK5 A;  4TKT A;  3DOM B;  4DPU A;  2XNQ A;  2QLX A;  1SKS A;  4ZVH A;  4K0K F;  2ZH9 A;  1CJU B;  3AXK A;  4FYY B;  3A13 A;  5DZ6 A;  3CE8 A;  4CTA A;  1YG0 A;  4DPT A;  2ZH1 A;  2N3L A;  3FBF A;  2PI4 A;  2QA1 A;  5H1S V;  3V4I B;  3W9I A;  1MWZ A;  2AF6 A;  5M2U A;  2IBK A;  3H90 A;  3NNA A;  4X4N A;  1HHQ A;  3HFZ B;  4ZCK A;  1RBA A;  4A8W A;  2YKA A;  1DTT B;  3UN5 A;  2YWE A;  2C2R A;  2MKI A;  5GAD I;  2EBE A;  4KPC A;  4CRJ A;  1JK9 B;  5AXM A;  4AL6 A;  1SV5 B;  2K8G A;  1FVQ A;  2BRL A;  3MEE A;  2KG1 A;  2ILZ A;  3CCU S;  1S1V B;  4GTY A;  1FX2 A;  2Y9H A;  1HI1 A;  1NK5 A;  1LNQ A;  1HIY A;  2I38 A;  1HQE A;  1YQH A;  3S6E A;  1P6T A;  3D67 A;  4NLX A;  1APS A;  4NLY A;  5HJY A;  2OLW A;  1TUG B;  3FJ2 A;  5F9N A;  5KT4 A;  2D3Z A;  2MDA A;  3V81 B;  2XLJ A;  2D3O 1;  4HDH A;  4GVB A;  2CQH A;  3GLJ A;  1TR0 A;  1KRP A;  2IRX A;  4JI8 F;  3C6T B;  2HHU A;  3BGF A;  3IA0 A;  2D1C A;  1F60 B;  4LF7 F;  4EFA C;  3QFW A;  3GFH A;  5G0R A;  5A0Y B;  2AYM A;  1OYD A;  1TV6 B;  2M3D A;  3ILI A;  1BC6 A;  2EG1 A;  1AXQ A;  2XMW A;  2MQ8 A;  3A3N B;  4NWX A;  4IDK A;  4OV1 A;  4GO5 X;  3OTD A;  5AXK A;  4P71 A;  4KHM A;  4R8U A;  3VGS A;  2BJE A;  1X7V A;  3PX4 A;  2FUG 9;  1F6T A;  3FFI A;  3FSI A;  4EBC A;  4DBQ A;  2V6A A;  3DHW C;  3OJS A;  1KLN A;  3GIK A;  4DWI A;  5HLF B;  4B9S A;  1M1G A;  4ECQ A;  1P9Q C;  5D4L A;  3MAA A;  1NJZ A;  2BUN A;  1HI8 A;  1XER A;  3LOU A;  4GTX A;  2KRR A;  4NA1 A;  1YGY A;  2MKH A;  3EE3 A;  3KUE A;  4P10 A;  5LXR A;  3NKP A;  3CMA S;  1RHM B;  1S79 A;  1ZM3 A;  2HBZ B;  4IRC A;  2HQ3 A;  1CJK B;  1RHQ B;  2B56 A;  1IKV A;  3GSD A;  4ZA1 A;  5K20 B;  3H0P A;  2H48 B;  3I96 A;  4NEY A;  1AUD A;  1WAC A;  1TMJ A;  4F4W A;  3G8S A;  4N41 A;  3THV A;  1HYS B;  1ZM4 A;  1S0M A;  1IQT A;  1UFW A;  3W63 A;  1T95 A;  2C2O B;  3N6N A;  4I2Q A;  4L76 A;  3W5Z A;  3VAF A;  1WWH A;  3BN4 A;  4RL1 A;  2EFN A;  1WUU A;  2BM1 A;  3P96 A;  1PIL A;  2AEF A;  3KLG B;  4ZJQ A;  1CJT A;  3BDE A;  1PGZ A;  3WX4 A;  1FEE A;  4WK3 A;  1CUL A;  1RT2 B;  3DLK B;  4ANE A;  4DUT A;  4U67 Q;  3OV7 A;  3V5R A;  2VQF J;  5FDL A;  2WTF A;  1Q86 T;  3WC2 A;  1M1H A;  2KJW A;  2MJU A;  5KFS A;  2IA0 A;  2MZQ A;  2QIF A;  4DL4 A;  1FVS A;  2QLF B;  1ITP A;  1P49 A;  1UPP A;  4J37 A;  4O4G A;  1TAU A;  4YME A;  4NXM F;  4IRK A;  2G0J A;  1H2T Z;  3TP2 A;  5AJ3 J;  3FZB A;  4E0D A;  1FKO B;  4FBT A;  1S9E A;  2ABY A;  4Q2M A;  3TEG A;  1Q53 A;  2Q1L A;  3J80 U;  1K73 T;  2DIS A;  2O3D A;  3KG4 A;  3K57 A;  4ED5 A;  2KVI A;  3FK4 A;  3JTO A;  3ZTO A;  3Q8R B;  2DR7 A;  2OPP A;  2ZJP Q;  4KAY A;  2FZG B;  3GFX A;  4LRD A;  1X4C A;  2QMX A;  5ETK A;  1EAY C;  3TJA A;  1Q5V A;  3N01 A;  3RAM A;  4WBF A;  2BMB A;  3W2W A;  3CC2 S;  3QFH A;  4IG0 A;  5DG7 A;  3NL0 A;  4JV5 J;  2UUW A;  2UXB F;  4OYO A;  4DCJ B;  4NPO A;  3FDS A;  3AA8 A;  1RTH B;  4DV6 J;  3N6M A;  3CB4 A;  1P9Y A;  2CQD A;  2MY8 A;  2VPX B;  4UST A;  1F0X A;  1VHF A;  3DXS X;  3R3T A;  4NLV A;  3ZZO A;  3DRP A;  1QTM A;  4FKX A;  4YDD B;  2RF2 B;  2CKW A;  1HLW A;  2CG4 A;  3NMA A;  1LXN A;  5J2P B;  3LGH A;  3G96 A;  2GMJ A;  3LUY A;  2Y8Y A;  1JLQ A;  2YKN A;  3K5P A;  5KAK A;  4PUO B;  1RTD A;  1MG7 A;  3R97 A;  4NYP A;  3SFU A;  3CUN A;  1S97 A;  5T14 A;  1U1R A;  3Q8Q B;  2QGF B;  2RKI B;  4F0M A;  2NRE A;  2N3O A;  1T9V A;  1U02 A;  1OY6 A;  1VQ8 S;  4PWD A;  1F3F A;  4WE1 A;  1EI6 A;  2F63 A;  5KG5 A;  2YPZ A;  4WTO B;  2WB4 A;  1P1T A;  2D3U A;  2XR9 A;  3QT8 A;  4G6V B;  2AHO B;  5LMN F;  2G9Y A;  3W9J A;  1SJ1 A;  4GVL A;  4OYB A;  2HHV A;  2PE8 A;  2VBX A;  3MM5 A;  4Y2K A;  1ZM9 A;  4M8L A;  3T1Y J;  3HVW A;  2GA3 A;  4KPY A;  3TG0 A;  2RB7 A;  2K1R B;  1EHW A;  2AMC B;  1HBU A;  1SXL A;  2QRR A;  3OVS A;  2IUC A;  5HO4 A;  3OFE A;  2J9C A;  1LWF B;  1L3S A;  1NSK L;  3H5X A;  2QJ3 A;  3QO9 B;  4DSJ A;  2C3U A;  2QSW A;  2W2M P;  4K4S A;  2UXC J;  4ZG7 A;  2X51 A;  2HHW A;  2FHJ A;  1H74 A;  4E8U A;  1HNX F;  4R25 A;  1IKY B;  1RGV A;  4LRF A;  4PR6 A;  1XIQ A;  2P9C A;  5AJ3 F;  3MCO A;  1AJC A;  2LDY A;  4V19 X;  1W2I A;  2FYX A;  1GTE A;  3T5H A;  3ZZT A;  1HQE B;  1F3V A;  1CJV B;  2W4P A;  5ETR A;  4EO6 A;  3N28 A;  3OUY B;  5I3U A;  1URB A;  2AJ1 A;  1A6L A;  3C16 B;  1U1P A;  4JI5 J;  3LW5 C;  2HNY A;  1SH0 A;  1WC1 A;  4GKK J;  1XTZ A;  5C25 B;  2MZT A;  2DHA A;  3BBC A;  3W62 A;  1UVN A;  1WSV A;  3BQ1 A;  3HT0 A;  3IS9 B;  4YDX A;  2RML A;  4IG3 A;  4ETX A;  1DUR A;  5F41 A;  2HGM A;  4XIU A;  1HW9 A;  4L74 A;  4K5S A;  1UAW A;  2EFP A;  2MST A;  2DRB A;  2WSC C;  2HQC A;  2DPI A;  4JI2 J;  2DEI A;  1AA1 B;  3TQ1 A;  5CHC B;  4G1Q B;  4ZOS A;  4ZP8 A;  1VYA A;  1S6P B;  3N9U C;  2EFV A;  2QE5 A;  3OL9 A;  4KHR A;  4J9V A;  4LVN P;  4DR7 J;  1RK8 A;  4J9M A;  4I6Y A;  3MUR P;  1ZH5 A;  3PJX A;  1VOM A;  3RAQ A;  2R8K A;  1RZM A;  3DLE A;  2DNH A;  1NK6 A;  3IXQ A;  2ZJQ Q;  2CQC A;  1FJ7 A;  3FEZ A;  1EJ7 L;  1X4D A;  5I3Q A;  4DF8 A;  1VFJ A;  4IFV A;  2J0X A;  3CJ0 A;  3CMQ A;  4QW8 A;  4NZ0 A;  3D3B J;  5IV4 A;  3KYL A;  2W9B A;  4FDJ A;  4WK1 A;  1EAR A;  2VPW B;  3BSO A;  4UF4 A;  4C8M A;  5CYM A;  4MH8 A;  4X64 J;  4K4W A;  1UEU A;  3TAP A;  4AD6 A;  3Q24 A;  3T5L A;  4WKR A;  4YFU A;  5ETV A;  2KJV A;  2QLB B;  3VGU A;  2F8H A;  3W1Y C;  5HVH A;  4FF3 A;  1O5J A;  3ITH A;  3NGU A;  3MAH A;  1KFS A;  2AJ4 A;  4C8K A;  2EC2 A;  4M5I A;  3NGD A;  2IBO A;  1K0V A;  5KXA A;  2FC9 A;  4CI0 B;  4LF7 J;  2G0I A;  1W25 A;  1MLA A;  4X66 F;  2J9D E;  3I56 S;  3FBB A;  3P5T L;  4OX8 A;  4UPI A;  4UOC A;  4PQU A;  1I6J A;  3VZH A;  5CYQ B;  3M8Q A;  1S6Q B;  2VG6 A;  2CFX A;  1I94 J;  3HSZ A;  4A8S A;  4X65 J;  1S10 A;  4LQ3 A;  4LR7 A;  2ROE A;  2CDQ A;  2YNI B;  1T11 A;  2DGQ A;  5CAB A;  2BYC A;  5DGA A;  2DR9 A;  2R7T A;  2CPZ A;  4Q5V A;  4QWA A;  2GO8 A;  4CQ1 A;  1YI2 S;  4B3M F;  1KON A;  2BE7 D;  2KU7 A;  5HQ8 A;  3OSP A;  1UW9 A;  2NSC A;  1YWX A;  2ZBP A;  2RQM A;  3EGN A;  5E3R A;  2BEF A;  4C0O C;  1N8R T;  2V8D A;  3MMB B;  4FNI A;  1T0T V;  2V63 A;  3MEC A;  3R6G B;  5CCM A;  5LXY A;  5DG9 A;  3QAT A;  2Y8W A;  2B51 A;  2OD4 A;  1PJ6 A;  2NXN A;  1K1Q A;  3NWR A;  2W25 A;  4B3R J;  1HBO A;  1JJH A;  2VG7 B;  4DR3 F;  3F56 A;  5L1L A;  2KVQ E;  2MYF A;  1VMB A;  1XK8 A;  3CCZ A;  3UVJ B;  3ZTS A;  2BJ8 A;  4DG1 A;  4DMZ A;  4XO0 A;  4BS2 A;  3OL8 A;  4YHH F;  1HD1 A;  4C98 A;  1IBK J;  1UJ5 A;  3TA2 A;  3TAQ A;  4DR6 F;  2OPR B;  2ZVS A;  2GSO A;  3HVT B;  4ILL A;  3KTQ A;  5ETS A;  2GHV C;  3W8G A;  3HPO A;  2QL7 B;  3C2P A;  1ELX A;  1OY9 A;  2IA6 A;  1U49 A;  2RD5 C;  5C2C A;  1AB8 A;  1YZ6 A;  2R7X A;  4PPD A;  4ICL B;  4Y28 C;  1KLM A;  2DNY A;  3U1N A;  1B3T A;  3WBH A;  3ZZZ A;  4KFB B;  1OJ4 A;  1BQN B;  4CYU B;  1REV A;  4PYA A;  1F5B A;  3R6L B;  1JLB A;  4NEZ A;  5ETL A;  3M32 A;  4ZK7 M;  5KFK A;  1JJ4 A;  1WDT A;  3EGV A;  4BDP A;  5EGE A;  1ZPW X;  4ZGA A;  3B4M A;  2QSF A;  3IP0 A;  2XMK A;  1VQM S;  3GR1 A;  1WEX A;  4OYZ A;  1E3C P;  2HNZ B;  1S4E A;  4CLL A;  3UPF A;  4TU8 A;  5IC4 B;  3GV7 B;  2AU0 A;  5HAN A;  3U1L A;  4L75 A;  1PYO B;  2HWT A;  2JSX A;  2Z2L A;  2GA7 A;  2BBE A;  2YNG B;  5FLX U;  3C3L A;  2MPU A;  2G2Y A;  4RNM A;  1H7X A;  4ZLP A;  1Y5L B;  3HZG A;  2PA8 D;  1JLF B;  2MLZ A;  2FLO A;  3L95 X;  4O3S A;  1NRK A;  1ZA2 B;  1G6B A;  4PG6 A;  3IBF B;  5ADZ A;  5KFA A;  2CQB A;  3MCM A;  5I42 B;  1DTQ A;  5C2G A;  4PG8 A;  3V4I A;  2QYG A;  1B0P A;  1FI4 A;  2JEG A;  3NGK A;  3WAW A;  1MRO A;  2GO9 A;  2HGL A;  3D1H A;  2A0F B;  3E8O A;  4BC9 A;  1HI0 P;  2OO4 A;  2VUG A;  3KK3 A;  4DR2 J;  2V9W A;  1N33 F;  1HNV A;  1E1Z P;  5HVF A;  4Y00 A;  1VIX A;  2JL9 A;  3DRY A;  5GME A;  1S6O A;  4PZV A;  3T9Z A;  5KFL A;  1VQ4 S;  4QW9 A;  3DKD A;  3QLH A;  1NK7 A;  2MLX A;  4HEA 9;  3IGN A;  3OR1 B;  4C8N A;  4PYD A;  4B3S F;  4CLF A;  1C4A A;  1VIO A;  1U09 A;  4KBI A;  4USW A;  1BY9 A;  2FVP A;  4OI0 A;  4A8Y A;  1VGY A;  2H5J B;  4X62 F;  3CTR A;  4Y34 A;  3NCQ A;  3OL7 A;  1QE1 B;  3R2D J;  3HHE A;  4K4V A;  4YB1 P;  5L1I A;  1WF2 A;  2FZK B;  4V19 J;  4MIB A;  4Y6I A;  2ZH8 A;  4FF2 A;  3L7P A;  1CVJ A;  2MQO A;  5U47 A;  5HMY A;  3M2U B;  2KN4 A;  4KTQ A;  2HSE B;  1NND A;  3CUL A;  2WHO A;  3WDO A;  2AEM A;  2R7R A;  3GFZ A;  2LEB A;  4IOB A;  3ICL A;  1ALK A;  3FC9 A;  3TUJ C;  2ZJR Q;  4O3P A;  3MGJ A;  4CM0 A;  2RIL A;  2HLU A;  4RKU C;  1DRZ A;  3ZTQ A;  1C1B A;  4IKA A;  1MWQ A;  4GKK F;  1JLQ B;  2YKN B;  3HI9 A;  3DXB A;  3MM9 B;  4URG A;  3D3C J;  3EDR B;  2PMH A;  2X1B A;  1OQ6 A;  3ZZY A;  2R2S A;  1X9S A;  4F36 A;  5BR8 F;  3TQE A;  2Z8Q A;  3BKT A;  4HYK A;  3V6D B;  3DHX A;  1BQM A;  1AUS L;  2HYI B;  1ZTW A;  1IJE B;  3OT9 A;  5L8R C;  1UEK A;  2ZEJ A;  4I2Q B;  2Z58 B;  2ZVI A;  4DQQ A;  3NRB A;  1UCN A;  2C42 A;  2HFS A;  3GG0 A;  3KK2 A;  1T05 B;  1TK8 A;  5KT7 A;  4DZD A;  3QSI A;  1U0H A;  4A8Q A;  3DLL Q;  5B0F A;  5K14 A;  4ZN3 A;  2V2Z A;  5C24 A;  5T7L A;  3CJQ A;  4OX6 A;  3MUM P;  3KHH A;  2B4V A;  1PBA A;  2J0W A;  3VR1 A;  2COL A;  2QV6 A;  4KC5 A;  5DM6 Q;  2MKS A;  3PW7 A;  3PFO A;  4F0K A;  1KNZ A;  4QYZ J;  2KHD A;  4DLG A;  2IC3 A;  2KZZ A;  2OEM A;  3SDE A;  2HBY B;  2ZKU A;  1S1X B;  3UNG C;  3I4P A;  3TRG A;  3FSX A;  4LF5 J;  4DR1 J;  2WVF A;  3T41 A;  1S9E B;  5GMD A;  2ALY B;  1J5E F;  3C15 B;  2YNF A;  3ZFV A;  3AD9 C;  3TAM A;  1K47 A;  3QAE A;  5GAG U;  3T1H F;  1YKW A;  5L38 A;  3I0S B;  4X4S A;  1S6U A;  4R0E A;  4ZLJ A;  3OPK A;  1F5C A;  4G3I A;  3FCW A;  5K5M A;  1TQL A;  4MYU A;  1DAX A;  4X62 J;  2CAJ A;  5GAH I;  1T9W A;  1Y10 A;  4NZ7 A;  3I5C A;  2E1C A;  2HRU A;  4KJG A;  4MKV A;  2R7W A;  4DL3 A;  2CRL A;  3E3X A;  5MLC V;  4EO8 A;  2N4C A;  4FDF A;  2EK1 A;  4Y3C A;  4HTJ A;  3J81 Y;  3PW0 A;  4LF9 F;  1UJ6 A;  1Y0H A;  3OQ2 A;  4P6Q A;  1SBR A;  1CQN A;  4RW8 B;  2JC1 A;  1QSS A;  5AXN A;  2CJK A;  3R5C A;  2RH6 A;  2XBP A;  1ANJ A;  1S72 S;  4NCA A;  1JLB B;  2KYZ A;  2NUH A;  2YKQ A;  1RA7 A;  5HP1 A;  2IRY A;  1H0H B;  1WI8 A;  1KQF B;  3C46 A;  1LKZ A;  4DHV A;  3GB0 A;  4URQ U;  2QFJ A;  5KG0 A;  4K8R A;  1MU2 A;  4NLS A;  3H7H B;  3OXF A;  1WKJ A;  4OHV A;  4UQT A;  4O3Q A;  2B5J A;  4ZP6 A;  4MKB A;  1B64 A;  1VRU B;  3PRB A;  1RT7 A;  3CJ8 A;  3H4B A;  3NCR A;  2UXB J;  4KJI A;  3LF0 A;  4NXN J;  1FRX A;  1WD6 A;  3PIO Q;  3OVA A;  5IM0 B;  2XI2 A;  2LLZ A;  4KRW A;  4IH7 A;  1Q8L A;  1VBZ A;  4FPR A;  3W5X A;  2R8J A;  4OI1 A;  4OZ3 A;  1S0O A;  3PYG A;  3PVX A;  5LIA A;  5IZH A;  1VJQ A;  4KY3 A;  1EKS A;  1WOR A;  2E5L F;  2RHS B;  2VFT A;  2PC6 A;  1R89 A;  4H4K A;  2PA3 A;  3KK3 B;  5KFF A;  4RZR A;  4KH1 B;  2W4D A;  5EDW A;  3EUN A;  3IMQ J;  1GMV A;  2CPE A;  4LSN B;  2W9A A;  2QA4 S;  2KFZ A;  3WAV A;  4QZV B;  2VIH A;  3NGR A;  2LQB A;  4C2M A;  1N36 F;  3CDE A;  2RUG A;  3K59 A;  2MZS A;  3DI6 A;  1TVR A;  1RU2 A;  1S1U B;  4UW2 A;  2LKZ A;  4ZMM A;  1J5O B;  4CYR A;  2AJF E;  2KO1 A;  5K8P A;  5MAO A;  1IVZ A;  2X7I A;  2CQ1 A;  2J6T A;  1VQN S;  4RW6 B;  4EEY A;  3JQK A;  1FWP A;  1SB6 A;  2UXD F;  2DK2 A;  1ZEF A;  2YNI A;  2ZC4 A;  4JI3 J;  3C19 A;  1UA1 A;  4C7Q A;  4ZVG A;  5F0W A;  4LF6 F;  3FQK A;  1F1B B;  3QNW B;  3IBC B;  2EK6 A;  3NG8 A;  1FXD A;  2GW8 A;  2WCX A;  1NH7 A;  3SBM A;  5J1E A;  3MPD A;  4Z7Y A;  5KFI A;  5HRO B;  5DDR C;  2C28 A;  1YJU A;  2G1H A;  1RDR A;  2F8E X;  3RRH A;  3OXL A;  3O2I A;  3PYE A;  4LRB A;  3RB0 A;  2J6S A;  2O1P A;  2AKW B;  2GMH A;  3SCJ E;  1JWW A;  1FD8 A;  3Q83 A;  2MXY A;  2NZ4 A;  2F5G A;  2NXE A;  1C0U B;  1XMB A;  2KKH A;  2Y3Y A;  2WVB A;  2BAC A;  4DR7 F;  1ZZF A;  1XQI A;  4CZC A;  2CPD A;  3G6X A;  3A8E A;  4AND A;  1QSY A;  2FJW A;  3ADA C;  3EXY A;  4IH5 A;  4PXB A;  3WIU A;  3MR2 A;  2HND B;  1EET B;  2ASJ A;  1SQG A;  2XSJ B;  3GIJ A;  4CNZ A;  2W9B B;  2KDO A;  2FHO B;  4UUW A;  1SJ3 P;  2XMA A;  4FPI A;  4RUH A;  1VRT B;  4QWB A;  1IBC B;  4O4R A;  2BJ1 A;  4ZDN A;  1B0V A;  5KFM A;  1E6V A;  1FE4 A;  5DJB A;  4PEO A;  2M88 A;  1YTY A;  1SKW A;  3ENQ A;  1EW8 A;  3SEO A;  3W64 A;  1OPI A;  4Y2C A;  5ETO A;  3SQG A;  3DRP B;  2MZR A;  1O6X A;  2XCP A;  1REV B;  2OPS B;  5D77 A;  1C2P A;  1BXN A;  3NNC A;  1U1N A;  1HHT P;  1HMV A;  1LFW A;  1FXL A;  1RAG B;  4ZG9 A;  2VJU A;  3MOJ B;  3AQP A;  3D5M A;  1CQM A;  4ZP7 A;  2Q6B A;  2AV5 A;  4OZJ A;  5CYQ A;  1DBD A;  3TNV A;  5KOX A;  1LQ9 A;  2C3O A;  4JI6 F;  4ELV A;  1SC1 B;  1KTV A;  1RWW B;  3A8I A;  3J7Y U;  2YWK A;  1FD2 A;  3HHL B;  3OTC A;  1S9G B;  4X64 F;  3I0R A;  3A12 A;  4IYQ A;  3DMJ B;  3CIM A;  4C0B A;  2HZC A;  4QAX A;  1F9H A;  1KHW A;  2C2K B;  3FUY A;  4F7V A;  1GMW A;  5LMU F;  3MM8 B;  2VG5 B;  2ZH2 A;  1RE1 B;  2B6A A;  3M8R A;  4DL5 A;  1H2V Z;  2PFD A;  2HVI A;  1JLG A;  1NDL A;  4O3R A;  1TU0 B;  2HZA A;  4OJ3 A;  4WCE Q;  2BAN B;  2IMO A;  3W7B A;  1IBK F;  2GSU A;  1U25 A;  2ZD1 A;  3WAX A;  3AOB A;  4DUZ F;  2YH1 A;  3HT3 A;  2XMU A;  1URN A;  3D6H B;  3IN5 A;  4DR3 J;  4HH1 A;  4P73 A;  1QLN A;  1SL2 A;  3POT B;  2DIT A;  3BRE A;  4G1P A;  4YY3 J;  3J7Y I;  3JSM B;  3MK0 A;  1X4G A;  2VDI A;  1FFG B;  1Q81 T;  1HYS A;  4P2M A;  1J2V A;  2HFV A;  3MFH A;  5HP1 B;  1KHL A;  2UV8 A;  4ZCI A;  5KFJ A;  2V4Q A;  2C3P A;  2NZC A;  1UTA A;  1WHY A;  5D0R A;  2ZM6 J;  1DHM A;  2GIF A;  3M8Y A;  4NLO A;  4ELT A;  2I1R A;  1I51 B;  3HHN B;  1ZZN A;  2V69 A;  2GJI A;  2FLL A;  1VQK S;  1BWV A;  4L3K A;  2C2Z B;  3U1M A;  5IQ6 A;  5ETT A;  2YKM A;  1DQ9 A;  2IYI A;  3OR2 A;  2AJQ A;  2DYA A;  1WHX A;  3BSA A;  2FVR A;  5E41 A;  5LMN J;  4IQX A;  3QYY A;  1KOO A;  1NBE B;  1RTJ A;  5L1J A;  3NGT A;  4B3O B;  1RU1 A;  4LFB J;  4FN5 A;  2ZH4 A;  3WIV A;  1WC6 A;  2HAF A;  1HBM B;  4D3G A;  3BO4 A;  4RU2 A;  1NJW A;  4H4M A;  4EYI B;  3O8W A;  5E7O B;  4LSL B;  2OPQ B;  1U24 A;  2WB1 D;  3EGW B;  4UQG A;  4ECU A;  1CLF A;  5J2N A;  3ET6 A;  3PCO B;  3OTE A;  3VZI A;  1ZAV A;  1LWX A;  3NS5 A;  4JI3 F;  2R7S A;  4YQW A;  1GK8 A;  4JI6 J;  3R7B B;  2HGN A;  3GON A;  4RW7 A;  4CXS A;  2CNO B;  3H42 A;  3M6U A;  4OYI A;  2BV3 A;  3UW1 A;  3QRQ A;  4LF9 J;  2HFZ A;  4OHW A;  3SCL E;  1U1L A;  2KXF A;  1ED9 A;  2QZU A;  4YR0 A;  3DI6 B;  1VQP S;  2YWF A;  3QGG A;  2LEC A;  1X9W A;  4DX8 H;  2KB2 A;  4ZIV A;  1PCA A;  2YPY A;  3M8P A;  2XMT A;  3VAM A;  2ZBQ A;  3M8S A;  3BDG B;  1Q7L B;  2GJ2 A;  2AZ1 A;  3LP0 A;  4ZVO B;  2VON A;  2BJ9 A;  3A52 A;  2BRK A;  4KT0 C;  1SUQ A;  4Z7C A;  3BF4 A;  3Q89 A;  2PT0 A;  4L3N A;  4CT9 A;  3OTO F;  1XNR F;  2RKI A;  1NSA A;  3K89 A;  2HPU A;  2VKR A;  4FYX B;  4W92 B;  1XR6 A;  3LTO A;  1RAI B;  3EPI A;  4ANC A;  3KLE B;  1PC4 A;  1K8A T;  1NU4 A;  1UP1 A;  2YWH A;  4OJH A;  1T3N A;  1TL5 A;  2BXJ A;  3G82 A;  3MI7 X;  5D4P A;  5J1P A;  5EWG A;  1YJ9 S;  4LQY A;  5HJX A;  3AD8 C;  3BBB A;  5KFO A;  1U6Z A;  2R7O A;  2VQF F;  4IRD A;  2IMW P;  1R8P A;  4UT4 A;  4CLW A;  1X60 A;  3BKF A;  4P7T A;  3R9L A;  1ZAX A;  3QO9 A;  3UDL A;  3RBX A;  3GII A;  1NM2 A;  4GC7 A;  1EQ0 A;  3KWM A;  1D9F A;  2B9E A;  1OS5 A;  5B0C A;  2ROP A;  4RR5 A;  1EW2 A;  5KFX A;  1UVJ A;  3ZZP A;  3QIP B;  4CO0 A;  1S5Z A;  3NCP A;  4AE5 A;  4OX9 J;  3PJ9 A;  1RWP B;  1FJC A;  2GSN A;  2CZ4 A;  1TKT B;  2CYY A;  3I82 A;  4PAA A;  5KFE A;  2B9W A;  1U1Q A;  1MWY A;  3AJ2 A;  4Y65 A;  2OPP B;  1HFE L;  3J7Z 5;  3VVU A;  4CXU A;  2AIR B;  2DJW A;  1AUK A;  4B3O A;  3I5A A;  1CJV A;  3OUY A;  1X5P A;  3C14 A;  3HLU A;  3RUB L;  5G0R B;  4DL2 A;  1VQ7 S;  1N32 F;  2ZBI A;  4NCB A;  1KR4 A;  5A0Y A;  2J8S A;  2W01 A;  3B8H A;  4UPK A;  1XC9 A;  4FYV B;  3SXL A;  1W26 A;  1RT3 B;  2OGU A;  4ZVR B;  1BQN A;  3GQC A;  4LFC F;  3IAM 9;  2BKP A;  2JJ4 D;  1RWV B;  3M32 B;  8ATC B;  3HP6 A;  5J2P A;  4M5D B;  5IM0 A;  2VV5 A;  2IUC B;  2JNJ A;  2LXF A;  4DFJ A;  2CPJ A;  2LMI A;  2IIH A;  2C3Y A;  3D6T B;  1LWF A;  2QG9 B;  2ZUG A;  3F0N A;  3PFE A;  2RE1 A;  4OJG A;  3DFE A;  5HK4 A;  3G71 S;  4HT5 A;  4RNH A;  2M0G B;  1RAO A;  2FLP A;  4MK8 A;  3NEK A;  3SDE B;  4F2R A;  5A8R A;  4BWM A;  4NLG A;  2NUU G;  2WOM A;  2ZBC A;  2WBM A;  3TJ8 A;  2HHX A;  4LFA F;  5KTQ A;  2OTJ S;  4LSN A;  3Q86 A;  1FX4 A;  1N5S A;  1UZD A;  1ANI A;  3BQ2 A;  1S1T A;  2AJ0 A;  4MAK A;  4K4Y A;  4F4Y A;  1FJG F;  1UPM B;  2JEJ A;  1TKX A;  4UOH A;  3QPI A;  4F0H A;  1JKH A;  1YK9 A;  4TXS A;  1H2U X;  4ECX A;  4QU7 A;  2W5W A;  1M0S A;  3EIC A;  2DNN A;  3QMQ A;  4FDI A;  3JTP A;  1X0F A;  3WHI A;  5J2Q A;  1H98 A;  1FDD A;  4ETZ A;  4DV5 F;  4CDI A;  1R3N A;  4DR6 J;  5IT0 A;  1YBA A;  3H20 A;  1N0U A;  4DCO B;  2MB0 B;  1N5Y A;  1M5V C;  1TL7 B;  2C3M A;  2P6T A;  3FMB A;  4I1T A;  4KE5 A;  3VGV A;  1RT5 A;  3GIL A;  3SV3 A;  4LBI A;  3R7N B;  2GIR A;  2RAQ A;  2ZNZ A;  4A48 A;  3OSN A;  3KJV B;  4ZJO A;  4A46 A;  4TQS A;  2AQ4 A;  4MMO A;  1O99 A;  1S6Q A;  2VG6 B;  3TYT A;  3K0J A;  3A8K A;  3TA0 A;  2YX4 A;  3KK1 B;  1RSC A;  3LH2 S;  4KH0 B;  5HLF A;  3L7O A;  1AZS B;  5CH7 B;  5LMU J;  3I31 A;  5H9F K;  2K2P A;  1EP4 A;  4YS2 A;  1UW4 A;  2SXL A;  3KG0 A;  4MTP A;  2W5Q A;  2FJV A;  8RUC A;  3IS9 A;  1HA1 A;  1Q4R A;  2UP1 A;  4X4V A;  3DOK A;  1NK8 A;  2AWZ A;  1GTH A;  2GJF A;  1BE4 A;  2OMO A;  3M05 A;  4C3L A;  4DUZ J;  1QAJ A;  2VOD A;  4M5J A;  2P9E A;  1K7H A;  3U02 A;  4DV1 J;  1DTT A;  1HL6 A;  2XMM A;  3CC7 S;  2D7S A;  4ID5 B;  2Q43 A;  4U8Y A;  2DPJ A;  4C8Z A;  4FS1 A;  4WWS A;  1SV5 A;  4NI2 B;  3R5G A;  4YR2 A;  1HR0 F;  4CO3 A;  4X4U A;  2LU1 A;  1O0P A;  5E33 A;  4DS4 A;  4PUO A;  1QTN B;  1YVF A;  3D28 A;  2AGO A;  3C66 A;  3PDN A;  4NLP A;  3RBE A;  4K4U A;  1B4S A;  1CG2 A;  4X4P A;  4MJK A;  5JUM A;  1L5U A;  4CM2 A;  2ATL A;  4WF9 Q;  3CME S;  2VDH A;  3PRV A;  1NKC A;  3EM1 A;  2MZ1 A;  3MR5 A;  3PW5 A;  2W5T A;  4QWE A;  4UOR A;  1C4C A;  3M2R B;  2HW3 A;  1OQ3 A;  4EWT A;  3M9M B;  1PIE A;  2OSR A;  2P2C B;  3GPA A;  2K7J A;  2VBZ A;  3H8Y A;  3MMC A;  5K4P A;  1JJC B;  4USM A;  5DGB A;  2E7X A;  3MM5 B;  2ASL A;  4LFB F;  4YY3 F;  3GSI A;  4PWU A;  5H9E J;  5T41 A;  1VQ9 S;  3MEC B;  1FRI A;  3VAL A;  4DI6 A;  2N7C A;  3KHR A;  3VQS A;  1PAU B;  1HNZ F;  4GTZ A;  1UFL A;  3OFH A;  1X4A A;  3CF5 Q;  3G9C A;  3MFI A;  2VC0 A;  5EUH A;  2WVE A;  3DPC A;  4JI7 J;  1TAQ A;  4FVC A;  4KR0 B;  1JLE A;  1KQG B;  2B7C B;  1QAI A;  2BAN A;  2UV8 G;  4ECR A;  1KHV A;  5CZV A;  2HHH J;  2PMZ D;  2XYP B;  1QUP A;  3MMJ A;  1NKB A;  1DFD A;  1XMO F;  2Y1J A;  3H2L A;  1OO0 B;  2HEK A;  3HJF A;  3P45 B;  1V3Z A;  1FER A;  1HNI B;  1M5S A;  4RO0 A;  4ES2 A;  2UXD J;  4ZCM A;  4QWC A;  1S4F A;  4ECW A;  3UDC A;  3P49 B;  2BW7 A;  4B9N A;  5DZ7 A;  4X4O A;  4DSF A;  2POK A;  3Q8U A;  2ZH3 A;  1IKW B;  1VBX A;  1FEH A;  2BKO A;  2OEK A;  4TLQ A;  5JMN A;  1Y5I B;  1QE1 A;  3P6Y C;  3B5Q A;  2RUS A;  4ZPB A;  2V8G A;  1YBU A;  4K7Q A;  1DLO B;  2CPI A;  2GVZ A;  4LRA A;  3GJQ B;  4S0M A;  4N56 A;  4DQI A;  1FT8 A;  2L9D A;  1Z2Z A;  2OPR A;  4AFF A;  4IO9 Q;  1RQ0 A;  4DPO A;  4CIO A;  4GRS A;  2J9E A;  4NLU A;  3EDQ B;  5KFP A;  1ACM B;  1V3R A;  4PG4 A;  3TVK A;  1E6Y A;  2JLG A;  1WHW A;  4YUD A;  3ZZ0 A;  4OX7 A;  1C1B B;  1HWI A;  2YX1 A;  1T9U A;  3PEJ A;  2CPF A;  3NOG A;  1MNE A;  3HVA A;  3NAI A;  4IFV B;  4KO0 B;  1RB0 A;  1VRU A;  4DX5 A;  1RT7 B;  3BGR B;  2IM3 A;  4R8U B;  3JQJ A;  4XK8 C;  4CT8 A;  3JYT A;  1S6P A;  1DTQ B;  2BX6 A;  1DQ8 A;  3MPY A;  3I6P A;  5IXU A;  2B4U A;  3M9N B;  1N5Y B;  3DLB A;  4DR4 F;  2YKO A;  3JSY A;  5KG2 A;  5F8I A;  1LK5 A;  1ICE B;  1D8Z A;  3WQP A;  1JLG B;  3MEK A;  4U96 A;  1YDL A;  4OYX A;  3QQC D;  4DN0 A;  4DLE A;  4DQP A;  1WF1 A;  2WW4 A;  4TLR A;  2W5S A;  2CG8 A;  4XTT A;  2KXH A;  2F4V J;  4M5N A;  2YNG A;  3QJL A;  4RU9 A;  2W8D A;  4KAV A;  1N52 B;  3K5N A;  2KZM A;  3O3L A;  3M8Q B;  1U8W A;  3MM9 A;  4OHX A;  1NDK A;  3WX8 A;  2G13 A;  5ETP A;  4PQU B;  1RBL A;  4I0W A;  3RGI A;  2BOP A;  4K2X A;  5INH A;  2CQP A;  4ES3 A;  2VFU A;  1X9M A;  3SMZ A;  1F2G A;  1D09 B;  1RT6 B;  2V68 A;  3EVM A;  1BHN A;  1BQM B;  1TZ0 A;  2G2O A;  2RQK A;  2V2Q A;  4J9U E;  3HFK A;  4LBH A;  4OI3 A;  4U8V A;  3G6V A;  3BO2 A;  3T3F A;  3T1H J;  5DET A;  1JXV A;  2FY8 A;  3RW6 A;  2R4F A;  3CJS A;  1A7G E;  2CWK A;  4ED3 A;  2BQR A;  4P52 A;  2BQU A;  5FDL B;  2E9R X;  3UNY A;  1UA0 A;  1D9D A;  1NK9 A;  2K1R A;  4RWX A;  2MQL A;  3QT6 A;  2F65 A;  3Q2S C;  1Q82 T;  1SJR A;  2B3T B;  2IM1 A;  3RJM B;  3ZZR A;  2VA3 A;  1RYR A;  2WVD A;  1NPR A;  4LBP A;  3CCT A;  2YWG A;  2C22 A;  2LVW A;  4ECZ A;  2BJ3 A;  4ENO A;  2VZ9 A;  4OZ1 A;  3US5 A;  4USU A;  3PW2 A;  1TL3 A;  1PJ5 A;  2ILY A;  2NYI A;  2W24 A;  3WC0 A;  3C6U A;  4DG1 B;  4HHU A;  4WII A;  2XZT B;  2OI2 A;  3R5J B;  6FDR A;  1G7C B;  2U1A A;  4OYA A;  2HND A;  3U27 A;  4I2P A;  1H7W A;  2ZC3 A;  4QR2 A;  1YZ7 A;  2ZHA A;  5F3Z A;  4J9Q A;  1ULR A;  1D1U A;  4B3S J;  2NPF A;  4BHQ A;  2XY5 A;  4QYZ K;  1ELY A;  3OJU A;  1NEE A;  2EVZ A;  4EU0 A;  1HBN B;  2WK4 A;  3V6D A;  4DXL A;  2K06 A;  1KKH A;  2RH3 A;  4F4A A;  2E9T A;  2W2N P;  5DLW A;  3OD2 A;  2IY5 B;  1RHU B;  2RDD A;  2CJB A;  2D1G A;  2V8P A;  1KLM B;  1FJG J;  4OHY A;  4K59 A;  1HKA A;  4PCQ A;  2YKP A;  4KFB A;  4CYU A;  5F8G A;  1RT3 A;  4NE9 C;  1UVK A;  3AB4 B;  2E44 A;  4ED0 A;  1U4B A;  2HHT A;  4Q44 A;  3MM8 A;  4FXV A;  4ZLN A;  3GV8 B;  2B6A B;  5IT4 A;  3J7A 1;  1SUQ B;  3HO1 A;  4J7C A;  4X66 J;  1C0T B;  2J6U A;  1EKR A;  1R8B A;  2IRU A;  3MPU B;  1M5H A;  4ZVP B;  4BLG A;  5A8W A;  5FLX Y;  2RRB A;  3W9H A;  5SZT A;  2PDA A;  4I67 A;  2WOM B;  1WOS A;  2NXC A;  3FCH A;  4HHJ A;  1S77 D;  1V5I B;  2XS7 A;  4HHH A;  4QPX A;  1JLF A;  2KRB A;  4ZPW R;  1R0B G;  3I0R B;  3I0S A;  1YIT S;  1SJ4 P;  3IC1 A;  5CYM B;  3DYA A;  4RNF A;  1HBU B;  4TU9 A;  4DV7 J;  1XEZ A;  2VJV A;  1IM4 A;  4HI1 A;  2DCU B;  1HNI A;  4EMD A;  4IFY B;  3BPD A;  1SQE A;  3GU0 A;  2F9D A;  1DJ0 A;  3D1O A;  3HHD A;  2FIU A;  4WFA Q;  2OH2 A;  5KFW A;  4B3T F;  3NLC A;  5CD4 H;  2JVR A;  3B6B A;  1LW0 B;  1PYT A;  3LGM A;  3K7R A;  1R0C B;  1U0S A;  1L3V A;  3MK1 A;  5LSO A;  5IS2 A;  2VQR A;  2VD3 A;  1TP7 A;  3J81 j;  3W60 A;  1UWA A;  2YNF B;  3Q0A A;  4FYW B;  1NLK L;  2O5D A;  2IDL A;  1IN0 A;  2Q66 A;  1N88 A;  4Q8F A;  1PSD A;  1RTJ B;  1SIW B;  2V8H A;  1FJE B;  4JV1 A;  2Y1I A;  3AH6 A;  3RZA A;  3TJ9 A;  3GFY A;  4OZL A;  2XZW A;  3AXM A;  2ZZN A;  3N4W A;  2V4J B;  4DUY F;  3QRP A;  2EFO A;  3AAW B;  2Q6C A;  4LIW A;  3LWM A;  1SL1 A;  1AJB A;  1SHN A;  3SI8 A;  2JDJ A;  4B9V A;  3J7Z T;  1HNX J;  1CPZ A;  1E33 P;  2KHC A;  2HRY A;  4N8N A;  3FRY A;  2XB2 D;  1X4F A;  1HHS A;  1VLO A;  3MD3 A;  1JQG A;  4FXD A;  2RRN A;  1LV5 A;  1X5S A;  4KGV B;  2BKN A;  5KG1 A;  1TKZ A;  4F3Q A;  5LRM A;  1FFS B;  2WZ1 A;  3L09 A;  2MTL A;  1HBO B;  3FVY A;  1ZET A;  2Z2Y B;  2Q79 A;  2ROG A;  2FJA B;  2EW9 A;  4RWW A;  2E1M C;  3AJ1 A;  4F50 A;  3N79 A;  2H4W B;  2DNR A;  1LEO A;  1SI9 A;  2IVM A;  1A9N B;  4I4B A;  1UMJ A;  4CLY A;  3ET6 B;  1QVF R;  2NYH A;  2OPQ A;  3LPY A;  5KOW A;  1RHR B;  5FJ4 A;  3MUV P;  4LF2 A;  3UCG A;  1NXI A;  3HSD A;  4NRT A;  2R8H A;  2MKJ A;  3X3U A;  1FF2 A;  1JX4 A;  2WRM A;  5KFH A;  3CJ5 A;  1VRT A;  4QIW D;  4AQY F;  4DV4 J;  5D6G A;  3IR7 B;  5KFQ A;  1UFK A;  2PI5 A;  5L1K A;  2GHW A;  1CBK A;  2AX1 A;  3IG1 A;  4DCP B;  2J7W A;  4XPC A;  3G6E S;  3R1L A;  2UUC J;  1X5T A;  4QIE A;  4B3T J;  4USI A;  1RWO B;  3BYR A;  5T7L B;  2ACY A;  1KQS R;  4FF1 A;  4Q2L A;  3JAM Y;  1CS4 A;  2HWH A;  2OPS A;  2AEJ A;  1BQX A;  2LFV A;  2X3D A;  4MT1 A;  3AY0 A;  4RBV A;  5GVQ A;  3QT7 A;  3UFC X;  2OTL S;  8AT1 B;  3K8V A;  4KHP F;  4BWJ A;  5LRN A;  1F9E B;  1SQF A;  1XBW A;  4G1I A;  1YJW S;  4ED7 A;  3TZW A;  2B9X A;  4JI2 F;  2YH0 A;  4TVA B;  1S99 A;  1RLC L;  2J5A A;  2XWY A;  1Q78 A;  3FZ2 A;  4Y2I A;  3TAM B;  3KLE A;  2EKY A;  3KDN A;  3F73 A;  2CQG A;  3IGY B;  5GAD U;  2Z57 B;  2AGQ A;  4LQ9 A;  3VQT A;  1FTR A;  3MMB A;  1IM6 A;  3CD5 A;  1N5Q A;  1RAA B;  2XSJ A;  4DV1 F;  4LVO P;  4DR5 F;  1HDH A;  3NKN A;  4ILM A;  1TFY A;  2XRG A;  5GMK a;  2XC9 A;  3UCZ P;  2KT3 A;  4XDD A;  4DV3 F;  2C2D A;  1V3S A;  1HAR A;  2C2M B;  1IBL F;  2V50 A;  3NY0 A;  1VQO S;  1I94 F;  1B99 A;  1C0U A;  4WU2 A;  5LL6 d;  3UDV A;  3UE2 A;  4K2J A;  3ZTR A;  3T5K A;  5DQI A;  1VQL S;  4FYD A;  3W65 A;  3CJR A;  1JLC A;  3LP1 B;  5DQH A;  3H5Y A;  3BV8 A;  5ITH A;  2EKN A;  1RT1 A;  3GR0 A;  1S1W A;  3KLI B;  2PEH A;  1F2H A;  3V6H A;  2GX8 A;  1OYE A;  2D41 A;  2DGW A;  2IAJ B;  2ZZT A;  3DDN A;  1Q1K A;  3ZZU A;  4RUA A;  2DGO A;  3AOD A;  1YJR A;  4LSL A;  2JHE A;  4V1A k;  2DH9 A;  2J76 E;  4YEA A;  2W2Q P;  5BYR A;  4C0H A;  4C3K A;  2H1Y A;  1RT4 B;  1H38 A;  2DH7 A;  2L41 A;  5HI7 A;  4ZVU B;  2H54 B;  1IQZ A;  1GAO A;  1M5K C;  2W8S A;  2AYE A;  3MED B;  2LXI A;  3M2U A;  1IBM J;  2GVD A;  4ZIT A;  2B8Q A;  3D1Q A;  3UR0 A;  3I55 S;  2OIH A;  1N48 A;  1IR2 A;  2AYG A;  2G9O A;  1AJD A;  4C6A A;  3VAG A;  4ECV A;  1KHK A;  4J9R A;  1IKX A;  2HHS A;  4C11 B;  5LSR A;  3M8P B;  3QZ8 A;  2QT7 A;  4DV3 J;  4YR1 A;  4KIA A;  5A8R B;  3BEG B;  1O51 A;  3KHL A;  1ZAW A;  1W7W A;  4DSE A;  2C2E A;  1M90 T;  5BYQ A;  2R7U A;  1SKR A;  3SSS A;  1OWX A;  2CQ4 A;  1S48 A;  2WW8 A;  2EPI A;  3G8Q A;  4KKO A;  1NK4 A;  1GXL A;  1V6H A;  2CIM A;  3BN7 A;  3DM2 B;  4O3O A;  4AXI A;  1G4C A;  1VC0 A;  1S57 A;  2ZFH A;  3TUP A;  2CDR B;  2UUA F;  4MY4 A;  3I4H X;  4LF4 J;  5BYS A;  4NAS A;  3PJW A;  4YP3 A;  4NL5 A;  4B9T A;  4DPY A;  4CCH A;  4N76 A;  1JIH A;  1R8H A;  2B7B B;  4R5P A;  1WKL A;  3CW2 C;  5J1E B;  4M5L A;  2LEA A;  1WEL A;  3E01 A;  4Q8E A;  3BBF A;  2KXN B;  2XG8 A;  3KJF B;  1RWM B;  2HHQ A;  2DD8 S;  2HS4 A;  3SCK E;  1NH8 A;  1XWL A;  3DLG A;  4N77 A;  2HQF A;  3W2V B;  5GAH U;  2ZH5 A;  3J7A N;  5EN1 A;  4F02 A;  3EVO A;  3CJ2 A;  3G8T A;  2LQ5 A;  1H73 A;  2CJX B;  1RWN B;  2JLF A;  3BZQ A;  2ZZM A;  2DH8 A;  4ELU A;  1YRU A;  2W2P P;  4OZ5 A;  4RW6 A;  1Q5Y A;  3NXZ A;  4HT7 A;  1WTB A;  3NKR A;  3D0H E;  4CXK A;  1TKT A;  1RJJ A;  1NK0 A;  1X4E A;  2XO7 A;  2HG4 A;  4TY9 A;  2W4C A;  3ETM A;  1RAF B;  2P9G A;  3E2D A;  4ZVF A;  1G2E A;  2OFH X;  3D7S B;  3DU5 A;  3BGR A;  2FHM A;  3GWC A;  1RCX B;  3HZE A;  1U47 A;  3IFE A;  4M5K A;  3UWT A;  3KMQ A;  2PMW A;  4DV2 F;  3PX0 A;  3B82 A;  1Q16 B;  1Y9O A;  3THT A;  3UVJ A;  4QBU A;  4IUF A;  1HQ2 A;  3NS7 B;  3LP2 A;  2RHQ B;  2NPI A;  2Z56 B;  1Z4U A;  2GGP B;  4NMX A;  5B09 A;  1NHV A;  3SQG B;  1O8B A;  2OD6 A;  1FKA F;  2RIJ A;  3F41 A;  1RWX B;  1VCT A;  2DXD A;  3WBZ A;  1L3K A;  2DNZ A;  4ZP9 A;  4U7C A;  5L0E A;  3H5U A;  3HKZ D;  3D0G E;  3DRR B;  4HL9 A;  4I68 A;  5E0O A;  1RCO B;  5IC6 B;  2BJ7 A;  1WNE A;  1NUE A;  1AJA A;  2OEL A;  4OIX A;  1RAJ A;  3Q3Q A;  3CCV S;  2PSZ A;  4F4Z A;  3QRR A;  3IWL A;  4F2S A;  2PN6 A;  3TX0 A;  1FTC A;  1KS2 A;  2RNE A;  4MIW A;  4NLD A;  4GMK A;  3UR3 C;  1YX2 A;  2CZV C;  4LF4 F;  2F8M A;  4U7U K;  2VG5 A;  1VS3 A;  3ENV A;  2VIC A;  3BPS P;  1ARO P;  3KUG A;  3PKY A;  3PY8 A;  1FKP A;  3SFG A;  2VKZ G;  3EZO A;  3TZX A;  3RU0 A;  1O98 A;  1HWL A;  4MK7 A;  4ZVS B;  1SCJ B;  2DGS A;  3FBC A;  5I3P A;  3T1A A;  3FRZ A;  2R9L A;  4AL7 A;  3JQM A;  1M5O C;  4UPH A;  2RQ4 A;  1CC8 A;  1MMD A;  3R5B A;  2NLW A;  2ZD1 B;  3RR7 A;  3QGP A;  1DQA A;  4RW4 A;  3HHL A;  2FLN A;  2DNG A;  2GML A;  3CD7 A;  3KUH A;  3LO3 A;  1AFI A;  4DZ6 A;  3R1H A;  4TN2 A;  3KJV A;  2YQ3 A;  1LW2 B;  2NXJ A;  4RNN A;  1NHK L;  1S1U A;  2CPH A;  1ZED A;  4E98 A;  2M8H A;  2FHJ D;  3M8W A;  2M7S A;  4WIQ A;  1WF0 A;  1MRO B;  1EZZ B;  1GXU A;  1U7L A;  2B8P A;  2CQI A;  2HK3 A;  3CDW A;  2RDJ A;  1UWB B;  3AFG A;  3BGL A;  1YBT A;  4L6V 3;  3VTI A;  2MQP A;  1Y3J A;  1XJW B;  1HBN A;  2V4J A;  4RJV A;  5CA5 A;  4YOE A;  4WFB Q;  4I56 A;  4LJM A;  5CZX A;  3TUZ C;  4DF4 A;  3LAK A;  1XMQ F;  2HVZ A;  1N34 F;  5D78 A;  2RJZ A;  3BKU A;  2MY7 A;  5A6W A;  2XCA A;  5H9E K;  4AL5 A;  2E5G A;  3TVY A;  1Z2L A;  2FZC B;  3IRW P;  3FEY B;  3R5A A;  2H3E B;  3BR8 A;  3QWU A;  2YQ0 A;  4ZHR A;  4LSZ B;  3W3S A;  2NQP A;  3RYL A;  4MYT A;  5KG7 A;  1U1M A;  3KKF A;  5IJQ A;  3VV2 B;  1MU2 B;  4NOH A;  3PR5 B;  4F4X A;  3M6W A;  1ZS6 A;  2D9O A;  1YJT A;  3MR3 A;  3CED A;  2B5J B;  1E6Y B;  2W9C B;  5D0G A;  3KLF A;  1JJ2 R;  3KNG A;  2EBG A;  3IBW A;  4M1K A;  5B0A A;  5THW A;  4FKY A;  4C11 A;  2ADC A;  1VC5 A;  3HVR A;  3LAL A;  4JI1 F;  1VC6 A;  1IBL J;  4KYZ A;  4PG5 A;  1S1T B;  1FK9 B;  3GE9 A;  4BBY A;  1UEV A;  3OR2 B;  3T5J A;  3DU6 A;  3E2E A;  4B3R F;  2HMI A;  3CJ3 A;  4G65 A;  2EFQ A;  4AUK A;  4UOP A;  4OX9 F;  3DYC A;  3CWJ A;  4I7F A;  1UVI A;  1ZEB A;  2DNQ A;  1ZPV A;  1RT6 A;  4ER8 A;  3UO0 A;  4UOF A;  3IDD A;  4NYO A;  4CO5 A;  1N34 J;  3NKO A;  2MEW A;  4IO1 A;  2DB1 A;  2YX7 A;  3M7V A;  1FNM A;  1NME B;  1Q8K A;  3EVW A;  4NA3 A;  5IT9 U;  2W8K A;  2QMW A;  2U2F A;  1QAY A;  2YY3 A;  1N5V A;  1QSL A;  4CO4 A;  2MKK A;  4WE1 B;  3K5O A;  4A8K A;  5KFR A;  4EYH B;  1TVR B;  1TKD A;  4ZVE A;  2XY7 A;  3D66 A;  2ASY A;  1U6F A;  3BS9 A;  1CC7 A;  3EMT A;  2H65 B;  3H5S A;  1YLX A;  4HTI A;  5M2R A;  3BR9 A;  4DPW A;  1R0A A;  5C42 B;  1EIY B;  1IBM F;  5CAA A;  2NR0 A;  3R27 A;  2DHG A;  4DV7 F;  5J2Q B;  2XY6 A;  2GAH C;  2OFG X;  5B0G A;  3T02 A;  2YNH B;  2G0C A;  1M1K T;  4EI2 A;  1CJU A;  1H72 C;  5M2P A;  2AYB A;  2VF3 A;  1ALH A;  4HAC B;  4UY8 T;  2EFG A;  1LOU A;  3W61 A;  3QZ7 A;  3A1Y G;  2XMV A;  1ALI A;  3M2V A;  1GMU A;  4HDG A;  5IQQ A;  3ETO A;  3PAC A;  3QIP A;  2HKE A;  5KFT A;  3O5T B;  3BDP A;  1RTI B;  1TL1 B;  5IOL A;  4DDF A;  4ED4 A;  2VU5 A;  4C97 A;  1FRH A;  3POT A;  1KVJ A;  2GC8 A;  3DOL B;  4OI6 A;  1SHQ A;  2QYC A;  5LQQ A;  3D54 A;  4M5G A;  4LMZ A;  2R8G A;  2ATC B;  2QL5 B;  3T19 A;  1GX5 A;  3I32 A;  2EG2 A;  2V4R A;  2W1B A;  2XTJ P;  5LM7 E;  2UVU A;  1GX6 A;  1DAR A;  5D4N A;  1QUV A;  2WSF C;  2XYG B;  2C2N A;  4ZIW A;  1AYE A;  2ZIT A;  3ZTP A;  2PEB A;  4PG7 A;  4H54 A;  2DIU A;  1NJX A;  3PO5 A;  5IWA J;  3P3D A;  1U2C A;  2DXE A;  1UVM A;  1XR5 A;  1TV6 A;  4DPX A;  4JB8 B;  1SJQ A;  2PD1 A;  1VQ5 S;  7AT1 B;  2O66 A;  3VAI A;  5EX3 A;  1P1L A;  1FNX H;  5B0E A;  2AJ2 A;  2PGC A;  4KV8 A;  3ENA A;  1P27 B;  1W2B R;  3CO0 P;  4B17 A;  3OFG A;  4QYR A;  2DR5 A;  3ILO A;  4NA2 A;  2B4P A;  1MML A;  3EPG A;  1Q8B A;  3M30 B;  1RHK B;  1YHQ S;  2R3V A;  3T6B A;  2JEI A;  2CJQ A;  2M70 A;  1NZA A;  1S9G A;  4ZKA A;  4QIF A;  1A0O B;  5DLG A;  4TQR A;  3OTO J;  3O1L A;  4RLE A;  2D3O R;  2DCL A;  3RB4 A;  2DGU A;  5DLF A;  2FVS A;  1FA0 A;  4YB6 A;  2MQM A;  3PW4 A;  2MKC A;  1TKX B;  1NSQ A;  3DLH A;  4JI4 J;  2ZHB A;  3JAM U;  2MGZ B;  5HMW A;  3ISZ A;  1KH5 A;  1FRL A;  4WZM A;  4C8O A;  2EEY A;  2HLT A;  1YRX A;  3EJM A;  3NKY A;  4LF1 A;  4Q0B B;  1GXT A;  1RHJ B;  2XHC A;  4I64 A;  4DX6 A;  1LWC A;  4NX9 A;  5CYJ A;  1JB0 C;  1JLE B;  1NHU A;  2BR0 A;  3KLG A;  4FS2 A;  4X4T A;  2FVC A;  2VFV A;  2Y1R I;  4UTG A;  3BSC A;  2BE2 B;  4Y2M A;  1LW0 A;  3FEX B;  3HFV A;  2OML A;  3MEG A;  4Y2A A;  3RW7 A;  2N82 B;  2JVO A;  1IJF B;  4DR1 F;  3PYD A;  3TW0 A;  5JJB A;  2AX0 A;  2D74 B;  2AZ3 A;  1X0P A;  4XAK A;  4GKJ J;  1PC5 A;  4TY8 A;  2HFO A;  4OYP A;  2A2D A;  5L9N A;  4USH A;  3FQL A;  2Z2Z A;  3MTK A;  3NWG A;  2OP5 A;  1R7I A;  3BB5 A;  3I87 A;  3MM6 B;  3KDO A;  3NP5 A;  4F04 B;  5JVH Q;  3LXQ A;  4CLZ A;  2GCF A;  1RLD A;  3P5B P;  3N6L A;  3CJK A;  3V6K A;  1OY8 A;  1T03 B;  2UUB F;  3SSR A;  3H2V E;  5F8M A;  4LF8 J;  3RRG A;  1HPZ B;  1QJH A;  2NCK L;  3DC2 A;  3I9Z A;  2HMI B;  3FFI B;  3T9N A;  3Q8S B;  3KK1 A;  3BH6 B;  2LEP A;  3MM7 B;  1N0V C;  1RUS A;  1IUJ A;  3PHT A;  4I7F B;  5J2M B;  1T7P A;  2GAG C;  2ZOG A;  3BH7 B;  4IOA Q;  2Y1L B;  1V5V A;  4NLR A;  1G3O A;  4ZPV R;  1U1K A;  1M5P C;  5HRT A;  1WEZ A;  1S0V A;  3GTY X;  4QCL A;  2RF2 A;  4KGZ B;  1RAE B;  3BO3 A;  4ED8 A;  2FPH X;  3BDH A;  1ALJ A;  2YQ1 A;  1B70 B;  1RBO B;  2BA9 A;  2CJ9 A;  2N4D A;  3DOK B;  4DSL A;  3R2C J;  3HSJ A;  2DBB A;  2UXC F;  3C14 B;  3OFF A;  3BQ0 A;  4J90 A;  3RAX A;  1TK0 A;  1E6V B;  5C5J A;  2BJD A;  2VFS A;  3L3C A;  2A6O A;  2WON A;  4WP8 A;  4ERD A;  5AJ9 A;  1ZOT A;  2I9S A;  3OLA A;  2PII A;  3DOM A;  4PAB A;  1EX8 A;  1NZ8 A;  2YTC A;  2HUR A;  2FDN A;  3E51 A;  2XS2 A;  1Q8I A;  2ZDP A;  3MR7 A;  5DDQ C;  3HHL D;  2PFF B;  4WFZ A;  1HMV B;  2QMU B;  2HK2 A;  2L48 A;  3EYZ A;  4B9U A;  2XQC A;  3CNQ P;  1LWE A;  4A8F A;  2H9Z A;  1CS4 B;  3SZZ A;  4ZPA A;  5L39 A;  5LOQ A;  4UOO A;  2E1R A;  1KN6 A;  3NNH A;  2ZOM A;  4OZN A;  4OMF G;  4U6P A;  2YWW A;  1YSJ A;  1OMS A;  3M2R A;  3QWP A;  2ZWP A;  3KLH A;  2APO A;  3BJY A;  3OW2 R;  2HZV A;  1UVL A;  2CAD A;  5A8W B;  2DRA A;  3VAK A;  2DHH A;  4CLU A;  2IJN A;  2UUT A;  4K50 A;  4ZPD A;  2GLQ A;  1NPP A;  4EK2 A;  2XLI A;  5D3G B;  5HVG A;  3D2W A;  4J9N A;  2LYV A;  1VJW A;  5CD4 A;  4ILR A;  1KBR A;  4QIG A;  1Q7Y T;  5DS7 A;  3TX8 A;  2MQN A;  3GG1 A;  4HI2 A;  5BXI A;  1S7H A;  4DV5 J;  1ZA1 B;  4IFY A;  4OQJ A;  4DJB A;  3HM9 A;  2H4Y B;  4ZLL A;  3HXM A;  4EBD A;  2BDP A;  1XR7 A;  3CCM S;  1JXE A;  1Q95 G;  4L72 B;  5DDO C;  4N5S A;  5IT9 Y;  2HNY B;  1KC8 T;  1VBY A;  2XZD B;  1XNQ F;  1JNZ B;  4JV5 F;  4LT6 A;  5B7W A;  4L73 A;  5GAG I;  4JUZ A;  1UKU A;  3TA1 A;  3D68 A;  3MEE B;  3DLJ A;  2CXE A;  3GIR A;  4OFZ A;  3PIP Q;  3CCQ S;  4F26 A;  3BGO P;  3QJP A;  2E7V A;  5F8L A;  2GS8 A;  1JLC B;  3LP1 A;  3FBE A;  1RT1 B;  4NLQ A;  5HMX A;  3QGH A;  3SIP B;  2EI5 A;  1EB0 A;  3MMA B;  4I2P B;  4Z2X A;  1TEL A;  2HQI A;  2XMJ A;  5E2Q A;  1AZS A;  2DXF A;  2LXU A;  2Z30 B;  3L9Z A;  2E29 A;  4LF6 J;  4CO1 A;  2ALZ A;  4P74 A;  2X1A A;  3VWS A;  4OZ2 A;  1T3O A;  4CLP A;  4KHP J;  4KO0 A;  3ZNJ 1;  1H6K X;  3MD1 A;  2HRT A;  3SZY A;  2ACM A;  4I6W A;  4ZJL A;  5F9L A;  2BQ3 A;  2XGP A;  5D15 A;  5AXL A;  2VAS A;  3GZ7 A;  4DV2 J;  3M4X A;  1KVI A;  4KKO B;  3JYT B;  2GVD B;  3ISN D;  3DM2 A;  3JTN A;  4H4O A;  4WTY A;  3MED A;  4ZPT R;  5KFV A;  4YB7 A;  3T1Y F;  4GTW A;  3OLB A;  2I2Y A;  4RW9 A;  1ZTT A;  1QAX A;  2RS8 A;  3CCR S;  4NI2 A;  1RAB B;  4B9L A;  3W66 A;  1HQU A;  2Z0G A;  1UL3 A;  2F7V A;  4ZPC A;  3TAN A;  4Q0B A;  4WKY A;  5D8H B;  1E2S P;  3HX9 A;  5L0B A;  3ITH B;  1LWC B;  4JI7 F;  4OJ1 A;  1B7Y B;  1YJV A;  1QVG R;  2HWI A;  2DHX A;  1FWK A;  3MAA B;  4KM4 A;  5GOV A;  4TNO A;  4WFN Q;  1HWJ A;  2NS1 B;  2A10 A;  1XNQ J;  5G4D A;  1BWE A;  4LRE A;  1MN7 A;  3KD8 A;  2R42 A;  1JLA B;  4FP9 A;  1WTF A;  2XS5 A;  1FHT A;  2RS2 A;  4U95 A;  1J5E J;  3OTB A;  4OYW A;  1T9Y A;  3H25 A;  3BSN A;  4W4M A;  1JNR B;  1MN9 A;  1VHI A;  2DEJ A;  3IRX B;  4PXC A;  4W98 A;  1UWB A;  4WXO A;  4TY8 B;  2FB0 A;  1NDP A;  3B54 A;  5ETM A;  3RRK A;  6FD1 A;  2V34 A;  3MTJ A;  2OJ3 A;  4JI0 F;  1T9X A;  3DRX A;  4OV6 A;  3ULH A;  4O3N A;  5EWE A;  3CC4 S;  1Z1Z A;  1KEK A;  4R5P B;  4NCG B;  1RT2 A;  1KDN A;  1TL4 A;  2HS0 A;  2FJB B;  5KT6 A;  4UZB A;  2KG0 A;  3PYF A;  2IM0 A;  3GJS B;  5DLT A;  2FJD B;  5D4O A;  4LFA J;  2J7K A;  1N56 A;  5JXS A;  4K4Z A;  1EQM A;  2DY1 A;  2AW0 A;  2DO4 A;  4G1Q A;  4HVZ A;  3RBD A;  2GHP A;  1D0E A;  5KFD A;  4M63 A;  2KT2 A;  5E3P A;  2KM8 C;  2IJR A;  3AT1 B;  4USV A;  1Y11 A;  2CUY A;  4DX7 A;  4A8O A;  3TWZ A;  1K0T A;  1EP4 B;  4KJD A;  1FCA A;  1Y5N B;  3DLE B;  1S1V A;  2M8D B;  4FXW A;  2A3J A;  3R7S B;  4J5O A;  3VF0 B;  1Y6V A;  2ZOF A;  4I6A A;  1KFD A;  4KAI A;  3MOZ A;  4ID8 A;  4MFB A;  3MWB A;  3CXC R;  1CSJ A;  2H5E A;  3DOL A;  4CTA B;  4F25 A;  4JI1 J;  4Y0F A;  1FK9 A;  5AT1 B;  3RB6 A;  5KFC A;  4K4T A;  3A4T A;  1QM9 A;  1K9M T;  1I5O B;  2F9J A;  3N5F A;  4IH6 A;  5KFB A;  3QBC A;  1HJK A;  2VQE J;  4DS5 A;  3GYX B;  4OHZ A;  5FD1 A;  1RI7 A;  2FVQ A;  1Q0N A;  4CNY A;  1AT1 B;  3A8J A;  4M94 A;  3T01 A;  3CVK A;  3CGI A;  2GGP A;  1BD6 A;  2HQD A;  4NZ6 A;  3NMR A;  2RRA A;  4WZQ A;  2D9P A;  1R8A A;  3THP A;  4U9R A;  3RR8 A;  2FY1 A;  2FHK A;  3MAQ A;  2HFN A;  1C1C A;  1U1O A;  4DSI A;  1HNW F;  4NWB A;  5J1N A;  3M8Z A;  1WI6 A;  1RWU A;  1U6B A;  3GCW P;  2P5V A;  2ZM6 F;  1N33 J;  1I3O B;  4A47 A;  5I3U B;  4O0N A;  4CH1 A;  2ASD A;  2HIY A;  2DR8 A;  3AOC A;  3PX6 A;  1ED8 A;  3KLV A;  1WOP A;  1VLY A;  3TEH B;  2CJA A;  2XLK A;  3CT9 A;  1RIS A;  2V8V A;  1RTZ A;  2DO0 A;  3IG1 B;  3T6J A;  2AP6 A;  3V4M A;  4QIV A;  3KOA A;  3HF5 A;  1LW2 A;  3KFW X;  3IR5 B;  2G1D A;  2UUA J;  2VFR A;  4CH0 S;  4KGK A;  2VH7 A;  3OHB A;  1L3U A;  4B3M J;  4ITS A;  1LXJ A;  3KJN B;  3SQO P;  2J8A A;  2DTJ A;  3MPV A;  2QA4 G;  4KGM A;  3CDU A;  2HVD A;  2QL9 B;  5EX0 A;  2IHR 1;  5KT5 A;  3NAH A;  1PBU A;  4OL8 A;  1CUL B;  3DLK A;  3L7U A;  2DR6 A;  3UD3 P;  1IKY A;  1RAD B;  4DN9 A;  1ZBT A;  3K2Y A;  1WEY A;  3W2V A;  5HMZ A;  2XYH B;  4NLT A;  2XGQ A;  4DV6 F;  4DFK A;  1KD1 T;  4NXM J;  4UY8 5;  1FWL A;  2DNM A;  4DV4 F;  1R43 A;  3IM9 A;  3MPW A;  4NML A;  1JKH B;  5A76 A;  2MJN A;  2VPY B;  4EZ9 A;  4CYS A;  2Z4P A;  3BM7 A;  2M4M A;  3JSB A;  1WHV A;  4LR9 A;  3FGV A;  3X1L B;  1SPB P;  4OI2 A;  2AGP A;  2JLE A;  4ALZ A;  5KT2 A;  3EZU A;  5KFU A;  3ELH A;  4P72 A;  3KLF B;  3BDF A;  2LQ9 A;  5DG8 A;  4O44 A;  2HVE A;  1VIS A;  4MK9 A;  4FNH A;  1VI7 A;  5ETQ A;  2W7P A;  1D3W A;  2FD2 A;  1VBK A;  3CCE S;  1DLO A;  2GVZ B;  4FBU A;  4P7V A;  4IG3 B;  4IDK B;  1FRK A;  3FNN A;  3W2W B;  2VQE F;  3M9O B;  1PO6 A;  2CA9 A;  2QN6 B;  2ANH A;  5L0K A;  3UCU P;  3HKW A;  1NAQ A;  4ZHR B;  3NKM A;  3ILL A;  3TR5 A;  4EGL A;  4RBU A;  2V94 A;  2CVE A;  1TL3 B;  2BAB A;  1RXO B;  2BZ2 A;  3LP2 B;  2JOQ A;  4PXE A;  3C6T A;  3FMW A;  2QO3 A;  4M5H A;  4A8X A;  4DR5 J;  3D4J A;  3OXG A;  3WZ0 A;  3D9B A;  4JI8 J;  1X4B A;  1YRT A;  3H98 A;  4ZVQ B;  4CP5 A;  4O23 A;  1RT4 A;  2P8I A;  5LT5 A;  1N32 J;  5A8K B;  2J0Q D;  1NDC A;  2HS3 A;  2R7Q A;  4OLP A;  5EHH A;  5DRK A;  1WG1 A;  3GYN A;  1NKE A;  1R8C A;  2HHH F;  4Q43 A;  4ID5 A;  1HW8 A;  2VB6 A;  3OVB A;  1TKZ B;  2W5R A;  5HQM A;  4JI0 J;  1J5O A;  3A3P B;  2CQ3 A;  2E5H A;  5DO2 A;  3UI3 A;  2LQ8 A;  4WYW A;  3MCN A;  4QJV A;  1CJT B;  3N0V A;  3I5B A;  5K8O A;  3VAH A;  2CQ2 A;  4PRF A;  1DZ5 A;  1GQE A;  5TJ3 A;  3VHQ A;  2EC0 A;  2KYX A;  4F3O A;  2ZH6 A;  3RB3 A;  4F8R A;  5DDP C;  1KH9 A;  4P2S A;  2P6S A;  1TUV A;  4O4G B;  4IOC Q;  3HDS A;  3QLH B;  4IQM A;  5KT3 A;  1IKV B;  3JB9 k;  2E9Z A;  3HUL A;  3OR1 A;  2Q3P A;  4HLB A;  4RPF A;  4R0J A;  1HQA A;  3NBP A;  5IFM A;  3MMC B;  4PWW A;  3O44 A;  3M6X A;  4N7T A;  4XDC A;  1U26 A;  2HQG A;  3VGT A;  5JVG Q;  2QEX S;  4JP8 A;  4B9M A;  4JI4 F;  3G2X A;  4GKJ F;  2IYG A;  3H40 A;  1WDD A;  1KHJ A;  5HSP A;  4JYA F;  4JV2 A;  1R27 B;  2H51 B;  3E01 B;  5CQG A;  3DN9 A;  3HVT A;  4AT1 B;  2ZUA A;  4IG0 B;  2OHD A;  1RA6 A;  3PRD A;  3U7J A;  1FXR A;  2X1F A;  1KTQ A;  2FGO A;  1HPZ A;  2B0G A;  1BUX A;  2W5X A;  4RX6 A;  2V67 A;  4DL6 A;  3GJR B;  2DGV A;  1RAH B;  3C6U B;  4NLW A;  4X4R A;  2ZH7 A;  4IR1 A;  2VG7 A;  4ED1 A;  1DY3 A;  2XUL A;  1NCL A;  2I5J B;  2YXL A;  4MIV A;  1HWK A;  1Y00 A;  2M52 A;  4RW8 A;  3KHG A;  1ZYQ A;  2FJE B;  5EGY A;  4ZG6 A;  3V81 A;  1REG X;  3UQS A;  4DUY J;  3D0I E;  3LPE A;  1URR A;  1VRQ C;  3K58 A;  2R2R A;  4P75 A;  2FC8 A;  2QZ8 A;  3NS6 A;  4KV8 B;  1C1C B;  4WP3 A;  1IKW A;  3TZZ A;  1GT8 A;  5KFG A;  2E5L J;  2IFX A;  2X98 A;  2HAI A;  3AA9 A;  1R0A B;  3HD2 A;  1PYS B;  2O67 A;  3QGI A;  3QID A;  1PAE X;  1IR1 A;  1VK8 A;  2LCW A;  5K8M A;  2FGC A;  1KOH A;  2KT5 A;  2BVZ A;  3P4U B;  4HR2 A;  1N36 J;  3TAR A;  2ERR A;  4JV0 A;  3UD5 A;  5KG4 A;  2M2B A;  3M1V B;  3DMJ A;  1S1W B;  1S59 A;  3KLI A;  1FRM A;  1OSC A;  2F1F A;  1UET A;  1S12 A;  2QLJ B;  2V2K A;  1PG5 B;  2L08 A;  3DDK A;  3SZ2 A;  3N5B A;  4KGX B;  4RUC A;  3OL6 A;  2IAJ A;  3CDA A;  5KFZ A;  2IC3 B;  4TU7 A;  4E2F B;  1U48 A;  4Z37 A;  2ZKT A;  1CEZ A;  4HH0 A;  5AE1 A;  3J80 Y;  2DVI A;  4P2F A;  1N2L A;  4DU8 A;  1KH7 A;  2JX2 A;  5L46 A;  2KFN A;  4JBC A;  4OLO A;  4GC6 A;  2E7W A;  3BYP A;  1I1G A;  1U8S A;  4ZCL A;  3T00 A;  2CNL B;  4A4J A;  4TYA A;  4AXJ A;  3PKM A;  2UU9 F;  4CLT A;  4KQZ A;  3DRS A;  4J9O A;  2KTQ A;  4URS A;  4OI4 A;  3FSY A;  1IWA A;  2CNK B;  2IJF A;  5L9X A;  2LA6 A;  2KH9 A;  3JSM A;  4ZVT B;  4IR9 A;  3CD6 S;  5A6P A;  4JYA J;  3QJJ A;  3WAY A;  3MCS A;  1IKX B;  3HMJ G;  2DKO B;  2MHE A;  4LUB A;  1HNW J;  5F8J A;  3QSY B;  4K0K J;  2WBR A;  4X2B A;  1BLU A;  2BOA A;  3M6V A;  4RW4 B;  3DLG B;  3V6J A;  1SKU B;  2HHP A;  3PG9 A;  4LR8 A;  2BE2 A;  4BCA A;  5HRO A;  1CJK A;  2RT3 A;  4QU6 A;  3QAU A;  2CPX A;  5IWA F;  2DT9 A;  1KH4 A;  3Q22 A;  2A6M A;  2CJY B;  3G4S S;  3MMA A;  5EWF A;  4EUV A;  1TTH B;  5J2M A;  1QD1 A;  1RYS A;  1HWU A;  4TN0 A;  3V2U C;  2A1B A;  3C16 A;  3A3O B;  4H4K C;  4LRC A;  5C42 A;  4YHH J;  2XM3 A;  1HBM A;  5C25 A;  3TO8 A;  3D6F B;  3G6Y A;  1JXL A;  4YR3 A;  2IVY A;  1UJ4 A;  3G87 A;  2W7A A;  3AB2 B;  4MFB B;  1FES A;  4PXD A;  4BC7 A;  2G4B A;  3DNC A;  4CO2 A;  2J9D A;  2ZE2 A;  5E3A A;  5A8K A;  1Y7P A;  1N6Q A;  4MHX A;  3JSR A;  3TI0 A;  2IM2 A;  1SVD A;  3CJK B;  4MKY A;  4NXN F;  1GFW B;  2R8I A;  4QR1 A;  4ED6 A;  1YIJ S;  1IWG A;  2VBY A;  4RNO A;  1WJ9 A;  3TUI C;  3B78 A;  4M5M A;  4DEZ A;  1AFJ A;  2DRD A;  3AOA A;  2RU9 A;  4LFC J;  2RDI A;  3Q8V A;  3CDB A;  1SC3 B;  4USK A;  3R8Y A;  4B08 A;  4QWD A;  5K14 B;  3OHA A;  4DFM A;  1XN9 A;  4QPT A;  3CPW R;  1Y3K A;  3NOC A;  1QDU B;  3K5L A;  2F40 A;  3DCA A;  4JOU A;  2JZ5 A;  5GAE I;  4LIR A;  7FD1 A;  2XWX A;  1S49 A;  4O0I A;  5DM7 Q;  2B4O A;  1XMQ J;  4F67 A;  5IJS A;  5GRR A;  4QR0 A;  2KM8 B;  3IM8 A;  1S1X A;  4NRU A;  1H3D A;  1RTH A;  1U2R A;  2DGX A;  2ZWO A;  1V9O A;  3PTW A;  4DQS A;  2V5H G;  3L4B C;  4PWD B;  1SIZ A;  1R6V A;  2FJX A;  5HAT A;  3ZC4 A;  2M5Y A;  2G2Z A;  2UZA A;  3DGV A;  2MQQ A;  2F4F A;  3CD0 A;  1FO1 A;  3GJT B;  1T9T A;  3MUT P;  2GIQ A;  3JS9 A;  2MSS A;  4CLS A;  3KK2 B;  1T05 A;  1N4L A;  2NXU A;  3LAN A;  2XO6 A;  4C8L A;  5K9F A;  3KMS A;  4W90 B;  2EXU A;  4PQA A;  1NB7 A;  1C0T A;  1WKK A;  6AT1 B;  3DRR A;  3G86 A;  1RWK B;  3KG1 A;  3CCS S;  4C3M A;  2HNZ A;  5HBM A;  1QY7 A;  1T8E A;  4J9P A;  4UZC A;  1EJJ A;  3CSK A;  1SH2 A;  5CXT A;  1J27 A;  1IR0 A;  2WAQ D;  3S8S A;  2CWX A;  4N47 A;  4AQY J;  4F3M A;  2QFI A;  3EWG A;  2RSQ A;  3GP9 A;  3DYA B;  4A8M P;  4WFY A;  3IGV A;  3NKQ A;  2V0N A;  2YNH A;  3CIZ A;  4MIA A;  4USJ C;  4CLK A;  2LU2 A;  4B02 A;  4J9L A;  1RTD B;  4DSK A;  1ZM2 A;  2MGZ A;  1VQS A;  3MDF A;  3EGZ A;  1R6Y A;  5E3C A;  5F0U A;  4C4W A;  1GH8 A;  3LWL A;  3UN3 A;  3MM6 A;  2GQQ A;  1NSP A;  3GMG A;  1F9F A;  3LQV A;  5D0H A;  2X3G A;  4J91 A;  1SL0 A;  1KHN A;  2QTW A;  2M9K A;  5BR8 J;  5SUH A;  4O44 B;  3ZXW A;  4WJB A;  1XNR J;  5HL7 Q;  5LJ5 Y;  2FQQ B;  5A2Q U;  2ZHO A;  2QC3 A;  2JC0 A;  2CZ9 A;  1TL1 A;  2MMY A;  4X65 F;  2W2O P;  5C7P A;  2W7O A;  3HCX A;  2YKM B;  5KG6 A;  2E5J A;  2IPO B;  2K3I A;  3CO9 A;  3DGP B;  4ES1 A;  4ECT A;  2CVI A;  1WC4 A;  4M95 A;  1WC0 A;  1FDN A;  3HD1 A;  3I9V 9;  2W9C A;  4X4Q A;  2O01 C;  5CCL A;  2E66 A;  3MR6 A;  5KG3 A;  4UOG A;  3ONQ A;  3UN2 A;  5B0D A;  1KVK A;  3D6M B;  3PEH A;  1RKJ A;  2I6W A;  3CCW A;  2QLW A;  9ATC B;  4MKA A;  4CH7 A;  1FSU A;  4DV0 F;  2JEF A;  3TOQ A;  1YJ7 A;  3K5M A;  2NSB A;  3IR6 B;  3PV8 A;  5FII A;  1VDH A;  1F5A A;  3GCX P;  2K7K A;  3HK2 A;  1VQ6 S;  2CNN B;  3LGN A;  4C8Y A;  3IRX A;  2HFU A;  1BGX T;  4RBT A;  4KSE B;  2BW2 A;  2JFK A;  3RBZ A;  2MLY A;  4LR2 A;  3QT5 A;  4QQB A;  2ZDO A;  2E1A A;  2K3K A;  2MZJ A;  1LWE B;  9RUB A;  2VBW A;  3BDG A;  1RAC B;  3C8Y A;  4P9S A;  5AE3 A;  2XI3 A;  1SJF A;  2HBQ B;  3F44 A;  3OBI A;  2VHG A;  1U2F A;  2R7V A;  1NO8 A;  1WC5 A;  4PPZ A;  5HN0 A;  4J9K A;  3IGZ B;  3PNI A;  4RUB A;  5LSL A;  5DQG A;  2L9N A;  2A2C A;  4WP9 A;  3Q23 A;  1B8J A;  4FF4 A;  3S01 A;  3C15 A;  3KNA A;  2I8E A;  2DNL A;  3NVL A;  2L9W A;  3IAS 9;  4OZ0 A;  1KSP A;  5D3G A;  1B0T A;  1UZH A;  2V2V A;  2X1G A;  3CJT A;  4NCG A;  5B08 A;  4JI5 F;  1FKP B;  2QX0 A;  3KXD A;  3PM9 A;  3G82 B;  5HAO A;  5F8H A;  1ELZ A;  5D0E A;  1URA A;  4ZS6 A;  3PXG a;  3ENW A;  1OPZ A;  4I69 A;  4NYZ A;  2ZE2 B;  4UUX A;  3IWN C;  2VOO A;  4WPA A;  5IV3 A;  2RQC A;  5B0B A;  3MM7 A;  1PJ7 A;  1MW7 A;  2LDI A;  2PO4 A;  4DV0 J;  3PZP A;  2KFY A;  3KLH B;  1RTI A;  3HHL C;  4DR4 J;  2JFD A;  3W8P A;  4UPL A;  3LAM A;  5DLV A;  3BGU A;  3B4D A;  1WG4 A;  3DDI A;  4YB5 A;  1L3T A;  2LP4 A;  2I5J A;  2XHW A;  2J0S D;  2VA2 A;  3KJQ B;  4X84 A;  5F8N A;  1EET A;  4HAC A;  1X5O A;  2F4V F;  1X8D A;  1G1X A;  1T94 A;  4DU7 A;  1MSW D;  2Y0B B;  2C1E B;  3NGS A;  3UDE A;  1WOO A;  3LA0 A;  3H59 A;  2D69 A;  2GV1 A;  3IO1 A;  3O6Q A;  3M2V B;  5K8N A;  3ISN C;  5F3T A;  3J81 U;  3EZ5 A;  2LA4 A;  4ED2 A;  1TFW A;  2KL8 A;  4PKD B;  5AE2 A;  2UU9 J;  4WXW A;  4J9S A;  1K1S A;  3HJV A;  3CCJ S;  1YJN S;  3MXH P;  3MK2 A;  3HHK A;  4AYB D;  4F4K A;  5E5N A;  2AT1 B;  2DNK A;  2DIV A;  1D8Y A;  1N5T A;  4GVB B;  2YBV A;  2B9Y A;  4M5D A;  2R2T A;  3P8B B;  4B56 A;  2JRS A;  3IWX A;  3RG6 A;  3K8W A;  3CMR A;  2GQ2 A;  3H2U B;  3TVZ A;  4NWJ A;  2XNR A;  3H4D A;  1K44 A;  4EZ6 A;  2UUB J;  1T02 A;  3K17 A;  3S7R A;  2V9K A;  5H9F J;  1MMN A;  4ICL A;  2MKY A;  2VL1 A;  5HBM B;  4LF8 F;  1S9F A;  3PO4 A;  1BMQ B;  2I0X A;  1JMT A;  1Q79 A;  1ROF A;  2GZO A;  5GAE U;  3GIM A;  3MZI A;  2MHN A;  1EQJ A;  2UVV A;  2DHS A;  1S76 D;  2ZNY A;  1Y4Z B;  2N7Y A;  2HIQ A;  3S1T A;  2OUG A;  5C24 B;  4H4O B;  5A2Q Y;  1VK3 A;  1U45 A;  1NJI T;  3AD7 C;  5E3Q A;  1N2K A;  2WVC A;  2DNP A;  4DL0 C;  2A18 A;  1S0N A;  4YN3 B;  2B43 A;  1GNK A;  4WYL A;  1LFP A;  3Q8Y A;  4C9D A; 
#chains in the Genus database with same CATH homology
 4CYS A;  1N2L A;  1KH7 A;  3MK0 A;  4LR9 A;  1AJD A;  1KH5 A;  3MK1 A;  3SZY A;  2VQR A;  3WAW A;  1KHK A;  1KHL A;  1ANI A;  5C66 A;  4YR1 A;  3M8Y A;  3BDF A;  4GTW A;  4UOR A;  1E1Z P;  5KXA A;  1E3C P;  4GTX A;  3UN2 A;  2W5W A;  3NKP A;  5IJQ A;  4FDI A;  3WAY A;  5LIA A;  5L0K A;  2ANH A;  1FSU A;  1AJB A;  3NKM A;  1SHN A;  1Y7A A;  4MY4 A;  4CXU A;  5GOV A;  4KM4 A;  3WAV A;  3T00 A;  1E33 P;  4LR8 A;  4LRE A;  1KH4 A;  2W5S A;  4LR2 A;  1O99 A;  3LXQ A;  3DYC A;  4CYR A;  1ZEB A;  2W8D A;  4KAV A;  3UO0 A;  3BDG A;  4FDJ A;  3IDD A;  1ZEF A;  4TN0 A;  4CXS A;  4LRC A;  3NKO A;  1P49 A;  5INH A;  2W5Q A;  2QZU A;  1ED9 A;  3M7V A;  2W5R A;  3IGZ B;  1B8J A;  2W5V A;  4UPI A;  1ALK A;  3NVL A;  3NKR A;  4LRB A;  1K7H A;  4CXK A;  5HRT A;  5TJ3 A;  5EGH A;  3BDG B;  1ALJ A;  3UNY A;  3BDH A;  4KAY A;  4LR7 A;  1ELZ A;  4LRD A;  3TWZ A;  1KH9 A;  3A52 A;  3E2D A;  3ED4 A;  4KJD A;  1EW9 A;  1Y6V A;  3T02 A;  1HQA A;  5LRM A;  4N7T A;  5AJ9 A;  3OT9 A;  2IFY A;  4UPL A;  1KHJ A;  1HJK A;  5DLV A;  5DLT A;  5IJS A;  2W5T A;  5GRR A;  1ALI A;  1URA A;  3SZZ A;  2W5X A;  5K4P A;  4UOO A;  1ELY A;  1EW8 A;  3T01 A;  5L0E A;  3IGY B;  1AJA A;  4UOP A;  3NKN A;  1ALH A;  1HDH A;  1SHQ A;  5DLW A;  3Q3Q A;  1EI6 A;  5LQQ A;  2GSO A;  1EW2 A;  2D1G A;  2XRG A;  4GTZ A;  4ZG9 A;  3M8Z A;  2XR9 A;  3TX0 A;  3DPC A;  3MK2 A;  2G9Y A;  1ELX A;  2GSN A;  2GLQ A;  2GA3 A;  4MIV A;  3UN5 A;  4ZG6 A;  3TG0 A;  1ED8 A;  1EJJ A;  2IUC A;  1AUK A;  1O98 A;  4B56 A;  3WBH A;  5L0B A;  4GTY A;  3CMR A;  4UPH A;  2X98 A;  4QAX A;  3NKQ A;  4NWJ A;  4ZG7 A;  4KJG A;  5EGE A;  4ZGA A;  3KD8 A;  4UPK A;  1E2S P;  4LRF A;  2RH6 A;  2GSU A;  1ANJ A;  1EQJ A;  1AJC A;  3UN3 A;  1ZED A;  5LRN A;  1KHN A;  2IUC B;  4LQY A;  3WAX A;  3M8W A;  4MHX A;  1URB A;  3B5Q A;  1N2K A;  2W8S A;  4LRA A;  4NWX A;  2ZKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...