3M8ZA

Phosphopentomutase from bacillus cereus bound with ribose-5-phosphate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus (strain atcc 14579 / dsm 31 / jcm 2152 / nbrc 15305 / ncimb 9373
molecule tags Isomerase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8zA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8zA01
4UPKA 4UPHA 4MY4A 4UOPA 4KAYA 1P49A 1ZEBA 5HRTA 1KH9A 2RH6A 4CXKA 4N7TA 5KXAA 3IDDA 2GSNA 2GSOA 1EQJA 4MIVA 1SHNA 2W8DA 4UOOA 5L0EA 2XRGA 3BDGB 2G9YA 3NKNA 1KH7A 1K7HA 2W5SA 1KH4A 3MK2A 4MHXA 1HJKA 1EI6A 2IUCA 1HQAA 1ELYA 3CMRA 1EW8A 5C66A 4B56A 2ANHA 1KHLA 4NWXA 2IUCB 1EW9A 2X98A 3NKRA 5DLTA 3IGZB 3M8YA 5TJ3A 5EGEA 4UPLA 4CXSA 3ED4A 5LRMA 4TN0A 3TG0A 1AUKA 4GTZA 4KM4A 3B5QA 3WAYA 3A52A 4ZG6A 2VQRA 1N2LA 1AJCA 1ANIA 4LRCA 4KJDA 3UN5A 1ELXA 1KHJA 1B8JA 4CXUA 4FDJA 1Y6VA 1KH5A 3TWZA 3IGYB 1ANJA 5LQQA 4NWJA 5LRNA 2XR9A 2W5WA 3NKPA 3SZZA 2GLQA 1ZEDA 5INHA 3WAXA 3E2DA 3BDFA 5K4PA 4ZG9A 1EJJA 4LREA 4LRAA 1HDHA 3UN2A 2D1GA 3DPCA 3SZYA 4UORA 3MK1A 1E2SP 3WAWA 1Y7AA 3MK0A 4LRDA 3KD8A 4FDIA 5EGHA 3UN3A 3NKQA 2W5XA 3Q3QA 5IJSA 1KHKA 4ZGAA 1ELZA 4GTYA 3T00A 1O99A 4CYRA 2W5VA 1URAA 3T02A 2W8SA 1E33P 1ED9A 1N2KA 1AJDA 5LIAA 1O98A 3UNYA 1ALJA 4GTXA 3T01A 1EW2A 4QAXA 1FSUA 4KJGA 4ZG7A 1ALKA 4LR8A 5DLVA 3M8WA 1AJBA 1E3CP 1SHQA 3NKMA 4KAVA 4LR9A 4LR2A 1E1ZP 1ED8A 3WBHA 4GTWA 3WAVA 5L0KA 5AJ9A 3BDGA 5GRRA 3LXQA 3M8ZA 3DYCA 2W5QA 4LQYA 1ALHA 5GOVA 1ZEFA 4UPIA 3OT9A 5L0BA 2ZKTA 1ALIA 4LRBA 3BDHA 2IFYA 2GA3A 4LRFA 5IJQA 3NVLA 3NKOA 3TX0A 2GSUA 3M7VA 4YR1A 3UO0A 1AJAA 2QZUA 4CYSA 1URBA 2W5RA 5DLWA 4LR7A 2W5TA 1KHNA
chains in the Genus database with same CATH superfamily
2ZVIA 2ROGA 2HRUA 1N52B 1GX5A 3CDBA 3H2LA 1Q53A 4UOOA 1T03B 3MK2A 1PG5B 1WG4A 1BQXA 5BYRA 1QE1A 3HVTA 3MUVP 5TJ3A 1TKXA 4IFYA 4MIAA 3X1LB 2RSQA 3KMSA 2POKA 1N2LA 2WBRA 3MFHA 5G0RA 4IOAQ 4YHHJ 1NRKA 1HBOB 4Y2IA 2BBEA 2AJ0A 5AJ3J 5J2PB 3JAMU 2V9KA 1U45A 4RW9B 5F9LA 2DB1A 5INHA 3MXHP 4ZVRB 4IH7A 1RADB 1KR4A 3W8GA 4ELUA 2HQGA 1TFWA 2R7XA 3NCQA 5GMEA 2O5DA 2KT5A 4EZ9A 1TAUA 2Z58B 1QAYA 1B3TA 4AYBD 2QYCA 2JFDA 3IG1B 5IV4A 2YNHA 4NWBA 2MQ8A 3M8PA 4CLFA 4JI8F 5GADI 3KMQA 1JLQB 5HBMB 1HFEL 1VQSA 1OYEA 2V94A 4DX6A 4ER8A 2DGXA 2M5YA 5D77A 1HNVA 1HQ2A 1P27B 3LP2A 4N7TA 2MY7A 4LF6J 1YJ9S 2Q66A 4X4PA 2RKIB 4IOBA 3H98A 4ED3A 2KKHA 1BQMA 4Z37A 2J7WA 1Y10A 1KQSR 1XNRJ 3C6UB 3RB6A 3D1QA 2DNNA 2HNYA 3D3CJ 2M3DA 5CYQB 4RWXA 2MQPA 4CXUA 3M1VA 3K59A 1TAQA 1TUWA 3CJKA 4UTGA 5CA5A 2VPXB 2PI4A 1SUQA 4OI3A 1R0CB 3KD8A 3ZTRA 1RAIB 4PUOB 3F44A 3US5A 3WC2A 4TKTA 3UDEA 2QLWA 4GKKJ 1NSPA 2MYFA 2W4CA 2KM8B 2MMYA 1F2GA 3ET6A 2RU3A 3G6XA 1C2PA 2ILZA 1D1UA 1ITPA 1HWUA 4RNMA 4H4OA 1RB0A 3OJUA 2PFDA 4DV1F 3NBPB 4DLGA 3HP6A 4DOZA 5KFCA 2E7WA 4WFNQ 4OYWA 2EEYA 3HI9A 1AFIA 2GMHA 4M5HA 4TQSA 2RUGA 2G4BA 3MM7B 1NCLA 2V2ZA 3KDOA 2Q43A 2R7OA 1JXVA 1WKJA 1REGX 2V9WA 5HMZA 1U24A 1U0SA 2CJYB 1M5VC 2QGFB 3I82A 1WF1A 5EX3A 2MJNA 4WFBQ 5F8LA 3A8JA 4JV2A 1VQKS 2WVFA 2E7VA 3DYAB 2ACMA 1V3RA 2R3VA 4G1QA 3L7UA 2PA3A 4HI2A 3SFUA 3C46A 2QE5A 5DDRC 4RUHA 2UVWA 1EKSA 1LW0A 3H2VE 4USTA 4F26A 5K5MA 1AJDA 2OD6A 3CB4A 1JK9B 4DPOA 2ZUAA 3QBCA 1VQ6S 3G2XA 3PX4A 1JX4A 3DOKB 3Q8RB 4ERDA 3R5DA 1T02A 1P1LA 3NWGA 2H5IB 1EQ0A 4OZ3A 2VZ9A 3MPWA 1TL1A 3AJDA 5F3ZA 3VQSA 1N0VC 3UR0A 4IFVA 1Y7PA 2ZJRQ 3PM9A 1QVGR 1ZAWA 4QCLA 2HIYA 1ZOTA 2J0WA 3R6LB 1FD2A 4LF8J 1YJWS 3G87A 2CPFA 1S97A 4ZG6A 2XI2A 1KHJA 4OZLA 2J8AA 3CMES 9RUBA 4J9KA 2MJUA 2CPIA 4DQPA 1FJGF 1O6XA 1EJJA 2WK4A 1HDHA 2GIFA 3CD7A 2YQ0A 3WAWA 2E5IA 3R5GA 4B3MJ 4ZPAA 2B3TB 2OEKA 1MU2B 2E7XA 1ALJA 1EW2A 2DXDA 4A46A 2AYBA 4LR2A 2K7KA 3D6MB 1D09B 1M1GA 2BYCA 3V6JA 1P9QC 4NEYA 2LA4A 1NK6A 4CM0A 2CZVC 1X4GA 5KT6A 4KO0A 5KFOA 2BJ7A 4MKAA 1MWYA 2JZ5A 2D3O1 3KLEB 4J9VA 2CADA 1MW7A 1T03A 5F8HA 1S0VA 2W5SA 4LSNB 5HL7Q 4A47A 4EGLA 2VU5A 2R8KA 2X1BA 4I67A 4X4RA 3GFHA 2FHJD 1WTBA 1BC6A 1P1TA 3B6BA 2C2EA 5J2PA 5AXLA 4RW9A 4K4UA 4EO8A 4R0EA 1FWLA 3MMBA 2RF2B 1EAYC 2EKNA 2RB7A 3M2RB 3NNCA 1UFWA 1TKZB 4CH1A 4O4GB 2V2QA 3RR7A 1JQGA 2UU9F 1K0TA 5KOXA 3J7ZT 2CQIA 3IG1A 1FFGB 2BANB 4FXDA 4NYPA 4ECSA 2D3UA 2HVEA 1E1ZP 1F5AA 1D8YA 2W5QA 2YNIB 4WPAA 5HBMA 1AZSB 2RQCA 1MSWD 4WE1B 1U4BA 2DNRA 2JDJA 4UY85 3DHWC 1U1QA 3W65A 1WWHA 5F9NA 1RJJA 2HEKA 2RKIA 5CD4H 3HJVA 2XQCA 3NNHA 3LH2S 2NQPA 4ALZA 2OPRB 4AT1B 3D66A 4MIWA 1FDDA 1NHKL 3KK1B 3C6UA 3AOBA 4DUTA 7FD1A 5KFBA 5F0UA 2MXYA 1GFWB 1RAOA 5CYQA 1Q7YT 1PO6A 4C3MA 1FJEB 1FESA 1KONA 2KXHA 5JMNA 2FZCB 3FGVA 2ZJQQ 2VBXA 1FF2A 5I42B 3R7NB 5KFGA 3C66A 2WSCC 3D0GE 4PUOA 4DEZA 4HHJA 2ZNYA 2MKKA 3CF5Q 4DV3F 2YY3A 2VKZG 4UOGA 1YRTA 2F3JA 2VICA 1RU1A 4UOCA 3JS9A 1UA1A 1DZ5A 3UDCA 2N4DA 3LANA 4IQXA 2ZH4A 2B4OA 3UE2A 2ZZNA 3OLAA 1DQ8A 2GZOA 2RHSB 2Y0BB 3NBPA 3HHLD 1N5TA 4Y2CA 4O3OA 2XY6A 3DNCA 1FCAA 4EBCA 4Z2XA 3PCOB 3CCLS 3QFHA 5KFRA 4NPOA 4MT1A 2CPDA 4MIVA 2IJNA 4YHHF 3DLGA 2HBRB 2I1RA 1GK8A 4MMOA 2YPZA 3AT1B 8RUCA 1PKUA 1PJ7A 3DGPB 1DY3A 1FFWB 3MAHA 1HYSB 1SCJB 3CDWA 2NSBA 1FXLA 5AE2A 3B5QA 4OHXA 1RT7B 3DYAA 2J5AA 2DHAA 3IC1A 4JP8A 3TI0A 2IRYA 4MKBA 2GV1A 1FNMA 4A8KA 5HN0A 1XIQA 3IR5B 2OEMA 4DI6A 4F4YA 3UD5A 3J7YI 4ES1A 2QSWA 3S1TA 1SJFA 5DM7Q 3DU5A 1LNQA 2DGWA 5B7WA 3MEKA 5IQ6A 2WSEC 3DOKA 3M9MB 1S1TA 4LF6F 4O0IA 2DISA 1HNXJ 1X31C 1V9OA 1FFSB 1XNRF 1AJAA 4NOHA 3QGIA 2G13A 4ZVPB 3T9NA 3P8BB 5CCLA 4L6V3 2VQEJ 2EC2A 5I4MA 4AL7A 1W7WA 3L7OA 4ZPCA 3ENAA 2AHOB 1ELYA 5KFMA 2DR5A 3PY8A 5GAHI 1Q81T 2M7SA 3W5YA 4UOFA 4EBDA 2W7OA 5C5JA 1AXQA 1F6TA 1UWBB 2IM0A 4WF9Q 5IT9Y 4M5IA 3RB0A 5I3UA 2BQUA 4GKKF 3KUGA 2GQQA 4R25A 2V2VA 3BR8A 3LP1A 2XSFA 1S6QB 3PO4A 3BZQA 2GMJA 2XWXA 3O1LA 2PA8D 1OY8A 1NJYA 1MU2A 3MECA 1Q95G 2C2DA 1KC8T 5D0EA 1U2RA 3W64A 2XBPA 2WVCA 2EKYA 5KFYA 3BH6B 4KJGA 4ZG7A 4LR8A 5DLVA 4DV7J 5KG7A 2EK1A 5ETLA 1F9FA 1U02A 4QW9A 2NPFA 4BS2A 5GOVA 1KTVA 2C22A 1HI0P 3J81U 3PACA 2H51B 2HHPA 3OHBA 2E5LJ 4F04B 3HDSA 3DOLB 5HI7A 1RTIB 2Z30B 2DR8A 2YKOA 3TQ1A 2KJVA 2PSZA 2V8HA 4LSNA 2DO4A 4LIWA 5BYQA 2VJUA 4AQYJ 2JEJA 4FKXA 4FKYA 4PQUB 1JLAB 1R8HA 4CQ1A 2BKNA 1YJUA 3O8WA 3AOAA 5LRMA 4C0HA 4XPCA 2AGPA 3DLBA 3FBFA 2ALYB 4PG6A 1OY6A 3GFXA 4QR1A 1ZH5A 2RF2A 1S99A 1T9YA 4DWIA 4A8QA 3M2RA 1B0PA 2QJ3A 3WAXA 1TKZA 4ZG9A 1VQYA 4I2QB 4LRDA 2W5XA 1QSYA 3A8KA 2XCPA 2FYXA 2BANA 4NXMJ 2YNIA 4MH8A 1U1PA 2IVFB 3KKFA 1HARA 1D0EA 3IP0A 4WYWA 1AZSA 3ILOA 4WE1A 3TW0A 2LXIA 4F3MA 4ECYA 3A8IA 5E33A 4LF8F 4O44B 1JIHA 1CULB 3OXLA 2VUGA 2DNQA 3DXSX 4ZCIA 2DNMA 4CLUA 1IBKJ 1K44A 2FHKA 3HZGA 2OELA 4QIWD 4NZ7A 1SI9A 1RWKB 2A3JA 4HACB 5LJ3Y 2R7UA 2N7CA 3B54A 2QRRA 4B3MF 1X0PA 4DSLA 1S5ZA 3OTOJ 3EGNA 1RT4B 2ASYA 1T94A 1XK8A 4DPYA 2HPUA 1QUPA 2BR0A 2MQQA 5K4PA 1KS2A 2HK2A 1WORA 4OZNA 4ANEA 3RU0A 4DUYJ 1YBUA 3VALA 4YB1P 3Q8UA 3UNYA 1TVRA 2CQ4A 2K8GA 2HFVA 1ZTTA 1TMJA 4FVMA 2XS5A 1ZAVA 2BVZA 3HF5A 5C24A 4B3OB 3E51A 2YWKA 4YOEA 2RU9A 1IM4A 1C1BB 4DR5J 5IJQA 2BABA 1R8CA 4DF4A 2KHDA 2W9BA 1WEYA 5AE3A 3GYGA 3EUNA 4L76A 5T7LB 4TY9A 3EYZA 3DGPA 1HYSA 2DITA 3OFFA 3QRPA 1X5OA 2V2KA 1FDNA 3K57A 2HYIB 3FEZA 1XERA 5A2QY 4DDFA 1HPZA 2M2BA 1URNA 2E9RX 3IWLA 1RT5A 3PJ9A 4PYDA 2AJ4A 2XNRA 2C3YA 4EZ6A 2CQ1A 4OYMA 1S76D 2BQRA 4KAIA 4I4BA 1XWLA 2LA6A 1K73T 1ELZA 2OD4A 3JXOA 2IM2A 5CABA 1GH8A 1O98A 2HHTA 4G65A 1O0PA 2AYGA 4ZPBA 1UEKA 5L0KA 2CRLA 1BQNA 5D0HA 2EBEA 4LF4J 1ZEFA 5A8KB 4PCQA 4DQSA 2DBBA 4ZP6A 3J81j 3FNNA 2J7KA 3OSNA 1QDUB 2F63A 2NLWA 3VGSA 5JXSA 4QPXA 4GC6A 3AB4B 1FERA 4FNIA 4U67Q 3T19A 2KFYA 1EI6A 4UF4A 5DQGA 2V8PA 4O3QA 1UWBA 4CXSA 1RBOB 4N47A 3F0NA 2Z2ZA 2A2CA 1TL3A 2LQBA 3N6MA 5IT4A 2P9CA 2F9DA 3QLHB 1WC3A 4DUZJ 5D3GB 1S6QA 5HP1A 3AXMA 3DRXA 3NAIA 3BO4A 4KC5A 1S1XB 4Y65A 4JI7J 3BDPA 1SKSA 1NH8A 4URGA 2P6SA 4CT8A 1S7HA 1HNIB 2VPWB 1RTJB 3TAQA 1K9MT 4OJGA 3MWBA 3WQPA 3N5BA 3QSYB 4O4RA 4PPZA 4LR9A 3D6TB 4OZ1A 5K8OA 3VWSA 4EEYA 3AODA 4ED0A 3BQ2A 1H2UX 5EDWA 2HFOA 2UXBJ 2ACYA 1WUUA 1KRPA 1NUEA 3TRGA 3U02A 4ZMMA 1MMLA 2V0NA 5CCMA 5DGBA 1X5PA 3Q86A 1MG7A 4G6VB 4PWDB 4PQUA 4KY3A 2W8DA 2OI2A 1WOSA 4X4SA 2AZ1A 3BSAA 4B56A 2BACA 2AQ4A 1Y11A 2Z0GA 2DHGA 4DPTA 5E3QA 4L74A 1UVIA 3D9BA 1WC0A 2CJ9A 3CD0A 5F41A 1CBKA 2FHMA 3KLGA 1VQ8S 1NNDA 1PGZA 2FJAB 2FJXA 1VRTA 4R5PB 4I2QA 3QGHA 4MJKA 4E0DA 3CMAS 1HNXF 4ZN1A 3J80U 2CDQA 1CS4A 2JC1A 2HAIA 1DRZA 1T0TV 1V3ZA 2QL5B 5KTQA 2KDOA 5BYSA 3I5CA 3CJQA 3IBFB 2VQEF 1SV5B 4B9UA 1U2FA 4USWA 1I6JA 4U7CA 2K06A 4C11B 3F73A 4USMA 3DLLQ 4O44A 5HJXA 4K7QA 2DRBA 3ISNC 1CULA 3W8PA 2HQFA 4UPKA 3R8YA 5KXAA 3DDIA 1PC4A 2BE7D 3N9UC 2I6WA 1RQ0A 4HACA 1UJ5A 2MZTA 4Y28C 2C1EB 2JEIA 1HW8A 4ZKAA 4KGZB 4DSKA 3GV5B 2CG8A 5DG7A 1WG5A 1NU4A 1RT4A 1JJ2R 1GNKA 1NPPA 1QAJA 3HSJA 1FEHA 4FDJA 1KH5A 4NLRA 4DV7F 4X4OA 1HR0J 2XR9A 3NKPA 4MK7A 3PVXA 3CO9A 2SXLA 3C2PA 2IM1A 1LWXA 4YB6A 4WJBA 4EYIB 2R8HA 2E5LF 1U1RA 2ATCB 2EG1A 3Q2SC 2ZE2A 4ILRA 3M8WA 5ETPA 2ZH5A 1SC4B 4B3OA 4DG1A 3MEEB 4AQYF 3OTDA 2E5HA 4QR2A 2KXFA 4KIAA 3BGRB 1P6TA 4MYUA 4C97A 4CO1A 4B17A 3P96A 4C6AA 2VASA 2BW7A 1NZAA 5T7LA 2B8PA 3CVKA 2BUNA 5KG1A 4DR7F 3KHHA 3KJVB 4O3NA 2HWTA 5EWFA 1T8EA 3A13A 3MM6B 3CJ3A 2KYXA 2PE8A 5KG6A 1QVFR 1H3DA 1VK8A 1IM6A 4NXMF 2F4FA 4C8OA 4GVLA 3QT7A 5A6WA 2PFFB 2LXUA 4WKRA 4P7VA 1HI8A 2KM8C 3VCDA 4ZJOA 5J2NB 2KJWA 2MSTA 2CWKA 3H42A 2YQ1A 2K1RA 1U8WA 3BEGB 3MPDA 3QT6A 3G6YA 1TKDA 3PRVA 1HI1A 2CPXA 1VBZA 1CC7A 2YX4A 4QZVB 1IBKF 1YK9A 1U1MA 3FRYA 3OQ2A 5E3CA 3ETOA 3FVYA 3U1MA 3OTOF 3AD9C 4QQBA 4ZDNA 3Q0AA 2QMXA 1EW9A 4P2SA 3CE8A 1AYEA 1S0OA 1M1KT 2LFVA 3CIMA 4DUYF 3QLHA 4L3NA 3MR7A 5D3GA 3TJAA 1TKTA 2W1BA 2HVHA 5KFFA 2AJQA 3G82B 2W5WA 4QWEA 4FNHA 4PG4A 5KG2A 2UUWA 4ZPWR 4DR5F 3LAKA 4NLUA 4GTYA 1S49A 3T6BA 1CG2A 4U8YA 2ZVSA 1JWWA 2PEHA 2XEXA 2JWNA 5I3PA 1RCOB 4N77A 3MFIA 1SXLA 2HVIA 1FK9A 1SC6A 1YX2A 3RW7A 3LO3A 2BE9B 2ZBRA 1FI4A 1ZZNA 1X8DA 3W62A 5KT4A 1ZYQA 1YHQS 3MTJA 4M1KA 4Z7CA 4CLTA 4CH7A 3Q23A 4PWDA 4QYZJ 1M5KC 4DL6A 4B3SJ 5F8JA 3FSIA 4OJHA 5L8RC 4ECVA 3NNAA 3MGJA 5KFDA 3VF0B 3RBEA 3SDEB 1FXDA 3IWNC 4KSEB 4W92B 1NK7A 1JLBB 1UFLA 4WZQA 1R89A 4ECRA 2LKZA 3OR1B 2CQBA 1FE0A 1SIWB 4KRWA 2FVQA 4R5PA 6FDRA 1IR2A 1X9MA 4LF4F 2DRDA 3T1AA 2GVZB 1OQ3A 1FT8A 1RTDB 1VQ9S 1OSCA 2EBGA 2W8SA 1WTFA 1H98A 3NKMA 2WSFC 3P5TL 4PXDA 4DFKA 4C11A 2JRSA 3BGFA 3RG6A 4QIEA 5IM0B 1FA0A 3LQVA 1RT3B 2IA0A 5GAEI 2AF6A 1VBXA 1ZEBA 1N33J 1CJKB 4K0KJ 2CIMA 1PJ5A 3W66A 3IDDA 2IY5B 1VISA 1GQEA 3KK2B 4OI4A 1RKIA 4DUZF 2A6MA 1KH7A 4C7QA 1PIEA 1RABB 1NM2A 2BXJA 2IVYA 1T9VA 2FJDB 1QSLA 3GFZA 2XI3A 1Z2LA 3IN5A 2W9CA 2ZWOA 4JI7F 2J0XA 1Q8KA 5K8NA 5LOQA 3I87A 1BE4A 3MCSA 3S8SA 3DM2A 3ZZRA 3DN9A 1UAWA 2DKOB 1S1WB 3OD2A 2ZDPA 3SZZA 4URSA 4M94A 4KE5A 4UORA 2J0QD 4NCGA 3PXGa 3L09A 2UXBF 4NMLA 1WDDA 2DHHA 4DF8A 1S79A 3H59A 5KFSA 2HLTA 5LL6d 3MF5A 5IV3A 3MD3A 4JV1A 1FX4A 3MEEA 4ED7A 3GILA 1J5OB 1AA1B 1YIJS 3KLIA 5KFVA 3RYLA 3RBDA 5E3AA 2OGUA 1RT6B 4ECWA 1TK8A 3Q83A 5DG8A 4QU7A 2Y1RI 2W01A 4FF4A 1AT1B 1NPKA 4M5GA 3ONQA 3D3BJ 2IIHA 3PW0A 5J2QB 1MWQA 3D4JA 1KHLA 4OLPA 2W25A 5DLTA 1NDCA 3KJFB 3PRDA 3OFEA 2WHOA 3OTCA 1TL5A 1B0TA 5D15A 3AXKA 3E3XA 1IJEB 1IBMF 2MKHA 2R8IA 1NLKL 2D41A 3KJQB 3TO8A 5D4OA 2LQ5A 3W9HA 3UDLA 2J7UA 4H4KA 3RB3A 5J2NA 3LOUA 2XB2D 1SC3B 2RNEA 3HHEA 4OX8A 2CVIA 3S01A 2IBOA 2QIFA 4YS2A 3MZIA 1ALKA 2W9AA 3NAHA 2DEJA 1VRUB 3FCVA 5KT3A 1WACA 3QJLA 2MKYA 1EJ7L 2UV8G 2RH3A 3Q8VA 4W4MA 1OO0B 2Z2LA 3UO0A 5F0WA 1R8BA 1I5OB 3EDRB 2RDJA 3K58A 3MUTP 1VQMS 3OPKA 2HRTA 1VIOA 2ASJA 4DSIA 4C4WA 1HR0F 2N3OA 5FLXU 3KK3B 3HHNB 3GYXB 3H4DA 4LRCA 2OPQB 4IRCA 2FHOB 3CCZA 5LXRA 4RUCA 4B9MA 2D69A 5K20B 4DXLA 4Y2KA 1WI8A 3GSIA 5B0FA 2FGCA 1HNZJ 3QIDA 1GMWD 2X51A 2RJZA 2YKNB 4JOUA 2QFIA 3VVUA 3Q8SB 4F0KA 1FRIA 3J7AN 1U1LA 3T9ZA 2G2OA 3J7A1 2A10A 3M2VB 1YRXA 4GO5X 1VYAA 1PILA 3WIVA 4XAKA 5JUMA 1HKAA 4USVA 2VHGA 4OYBA 1EQJA 5DDPC 2E9TA 1DQ9A 2AJFE 1EETA 1K7HA 2KVQE 1HQEB 3CJ0A 4B3TJ 2H54B 4ZA1A 4UPLA 4Q5VA 3PR5B 5DZ6A 2ZOFA 2VD3A 4LF2A 1U6FA 2XYPB 4OFZA 3OR1A 1ANIA 4DPWA 1GMUA 3BSCA 3O3LA 3GPAA 3IS9B 5B0EA 2GVZA 3T5HA 1U25A 5A0YB 4LSZB 1VHIA 1FD8A 1ZA1B 2D1GA 1RTDA 4DX7A 1Y7AA 3MK0A 2KO1A 4Q43A 2RS2A 4CLLA 3KNGA 4PABA 3B4DA 2DNPA 1JXLA 3B82A 5K8MA 1D9AA 1B99A 1RT3A 1UMJA 2IFYA 4QWAA 1T9XA 3QFWA 5DLWA 3VV2B 1C1CB 4TY8B 2DIUA 2KXNB 1A7GE 2YTCA 4JUZA 1Q16B 4OZ2A 1ROFA 5AT1B 1SJ4P 3OL6A 1R0AB 3PR4A 3VTIA 1M90T 4LF1A 2H9ZA 5DJBA 4KFBB 2XZWA 2IUCB 2YBVA 3LP0B 5DQIA 2HK3A 2OTJS 2ZH7A 2RQ4A 2LCWA 2YKPA 3TVZA 4XPEA 3IBWA 4AL6A 4HTIA 1ELXA 5DDOC 1T11A 3CCES 2WAQD 3ZTQA 1S1WA 2E5JA 4DV0J 2BJ8A 5KT7A 4Q8EA 1S9FA 2UUBF 4DR4J 1WJ9A 4ZIVA 1FKOA 4CLPA 1PYOB 1RSCA 2CQHA 3VAGA 1SIZA 1WC6A 4PAAA 2CJQA 5KFKA 3UD3P 5ETQA 4YDDB 1J5OA 4P2FA 2AGQA 4B3SF 4NL5A 4RUBA 2IAJB 2WOMB 3H5SA 4J9RA 3OT9A 4F25A 2XY7A 1U8SA 4KGVB 1ZZFA 4Q0BB 1H7XA 2FUG9 4ZVFA 1H0HB 1RYSA 2DCLA 4RLEA 4CZCA 4N56A 1FWKA 2IRXA 5J2QA 3HVAA 5DLFA 3Q22A 4C8YA 4EBEA 4MFBB 3I96A 1S57A 3ICLA 4AUKA 3KUHA 4RL1A 3GCWP 1V3SA 4BLGA 3CJ5A 4UOHA 4R0JA 2BKOA 2OSQA 3PFEA 3HLUA 2NREA 3KUEA 1TQLA 3FZ2A 4IO1A 1IXKA 1WF2A 2GW8A 1SH2A 2ZITA 2AJ1A 1UTAA 4ECXA 4NCBA 4Y6IA 4AD6A 3WZ0A 1VC6A 1RKJA 4QYZK 1UWAA 4WU2A 2CNOB 1WNEA 3IM9A 1YDLA 5LMNF 3KHLA 4J37A 4NYZA 1ZPVA 3UI3A 3LWLA 1N33F 3CCMS 4K0KF 1VRUA 1KVJA 1FKPB 4ZLPA 2H3EB 1U47A 5KT5A 3I0RB 4DL2A 2GO9A 1E6VA 3SFGA 2CVEA 1UJ4A 1UETA 2V4JB 1RHRB 3CC4S 1V6HA 1YJTA 4OI2A 2LU1A 2AEMA 2Y8WA 2RQKA 4JB8B 4UOPA 1S6PB 4KYZA 4HEA9 3R6GB 5KG3A 4UW2A 1DJ0A 4PPDA 5M2RA 2CPZA 2RT3A 3KNAA 3NKNA 1N56A 3HVWA 2OJ3A 2QZ8A 2IMWP 3UWTA 1FRXA 3I55S 3ED4A 4ITSA 5CH7B 3CCVS 2HG4A 4NLXA 3RJMB 2OPQA 2FTRA 2FY1A 1M0SA 1CQMA 1JJCB 5KFQA 3D28A 2YKQA 3QT5A 4NLOA 5LJ5Y 2W2QP 5HJYA 2DGUA 4ZP8A 5DLGA 3TA1A 2C2NA 4DPUA 4N41A 1LW2A 3RBZA 2W8LA 3FEXB 1TUGB 1HNWJ 4CT9A 3GFYA 4WP3A 3GIKA 2N4CA 3DU6A 5B0DA 2YKNA 2E1AA 2OPPB 2OFGX 4LT6A 4TU8A 3LXQA 3AB2B 1A6LA 2E44A 2FJVA 5L0BA 1NB2A 1UPPA 3M2VA 5HROB 4ZLNA 1XR7A 3PYEA 4G1PA 2QG9B 2UVRA 4DSJA 1PC5A 2W2MP 1DBDA 3BBFA 5IXUA 1HLWA 2XNQA 2ZEJA 2DIVA 3JYTA 1HQEA 2R7RA 3VGTA 3EE3A 3RZAA 1OWXA 4DR3J 3NG8A 1UW4A 1UW9A 2YPYA 1FVQA 4WFYA 8ATCB 5ITHA 2ADBA 3CCUS 1NBEB 1F3FA 3IS9A 6FD1A 4I2PB 3HFKA 2Y9HA 2MQNA 3EJMA 1SKUB 3VAKA 3BKUA 2CPJA 3A8EA 2D9OA 2WB1D 3OVBA 3NS6A 4B9NA 3FUYA 2RS8A 3WX8A 2JHEA 2B7BB 2FGOA 2XMMA 3O6QA 1VCTA 2MPUA 3IA0A 2X1FA 1FX2A 3GJRB 2ZJPQ 1NKEA 3CW2C 4B9TA 3KLHB 3DCAA 4YY3J 5D6GA 1C1CA 4TY8A 1LWCB 3JTNA 2QZUA 2C42A 3TOQA 2VDIA 5L9NA 4B9LA 4DHVA 4X4VA 2ASDA 3R27A 2R2TA 3V4IA 2F40A 1MMNA 3PW5A 3BH7B 4KFBA 2IUCA 1NK0A 3LP0A 3PHEA 4RW7B 4F2RA 1TUVA 1SC1B 3SZ2A 3QQCD 1G4CA 2LQ8A 2AEFA 3T1HJ 3UDVA 1HNZF 1RWVB 3CDAA 2W4DA 2WRMA 5A8RB 2J6TA 3GU0A 1U48A 2Q6BA 1ZEDA 2MLZA 4KQZA 5KG4A 3F41A 4F4XA 1NKBA 3MHYA 2JC0A 4JV0A 1DFDA 1H2TZ 1YBAA 2ZUGA 4CWBA 3Q8PB 1LXNA 3QZ8A 2DEIA 4NASA 4R8UB 3T01A 3J7Z5 3HHLC 3JSRA 3LPEA 2RRBA 1JKHA 2WOMA 4DS5A 3WAVA 2HZVA 2QMUB 1OPZA 3THVA 2I5JB 4OYZA 3EX7B 2DT9A 1NDKA 4Q0BA 4B9VA 5JVGQ 3ZTOA 4B3TF 4CRJA 3NVLA 2FVCA 4GO7X 3MR2A 1CSJA 4YB5A 4Y0FA 1J2VA 1F0XA 4Z7YA 3VZHA 3DRPB 1WOOA 2IDLA 1S1VA 2RD5C 2KHCA 3CEDA 4MFBA 3I5AA 4DQIA 2LMIA 2DH9A 1UVNA 3HT3A 2MLYA 1UKUA 1LWFB 4IOCQ 3DDNA 3RUBL 2QN6B 3HVRA 3G6ES 4K2JA 3M8YA 2DNKA 1VBKA 3H8YA 2XSJA 3C15B 4ZPVR 1FRHA 2B43A 2MDAA 1P8GA 1F9HA 3V81B 1EP4B 1F5CA 2HW3A 1RWOB 3RGIA 2VFSA 1KLMB 5ETRA 1NK5A 3UFCX 2YH1A 3TUPA 3DMJB 2P9GA 2P9EA 3HFZB 4I6YA 1S12A 3GJSB 2KH9A 1SL2A 3K2YA 3I0RA 4LQ9A 2YWHA 5EX0A 3HHDA 1SL1A 3M32B 2LP4A 3BQ1A 2FVRA 5D0GA 4DR6F 2V4JA 5ETNA 4LRBA 1FTCA 4PWWA 5KFPA 3NMAA 4H4MB 4HTJA 2R8GA 1S6PA 3GQCA 2DO0A 3LGNA 2AKWB 3K5NA 1Y3JA 3BDGB 2QA4G 4DV0F 4J91A 3WDOA 2KFNA 2V5HG 5DDQC 2NXUA 3GZ7A 4DR4F 2AZ3A 1BWVA 2E1CA 4OIXA 5J2MB 1UJ6A 3S6EA 3RB4A 1IBLF 5L1LA 2NS1B 4KJDA 2IC3A 4H4KC 1RU2A 4JI4J 2OHDA 4A8SA 5HK4A 3SCLE 4RW4B 3E2DA 3KXDA 2GJIA 2XS2A 2ZH6A 1X0FA 3CT9A 3NKQA 1QY7A 3SSSA 2FZGB 3HKWA 2LU2A 3LGHA 1QLNA 2V8GA 2OPPA 3UVJA 4CO0A 2P2CB 3M8RA 3H90A 4KAVA 3W1YC 1SVDA 1KHVA 1M5SA 1JB0C 5G4DA 3I5BA 5HMWA 1HWKA 2GA3A 4PYAA 1BLUA 4OLOA 3GB0A 3DI6A 3M7VA 2EFOA 2UXDJ 2MHEA 3OL8A 3BPDA 3FJ2A 5L46A 5IQQA 1WELA 3PG9A 3POTB 3P6YC 3ETMA 4A48A 2YWFA 1S9GB 4ZOSA 2RVJA 2EK6A 4E2FB 1DHMA 3W7BA 1KFDA 4A8MP 4ILLA 4YR3A 4ECUA 5C42A 2BZ2A 1ZAXA 4I2PA 4TU9A 1FNXH 3O2IA 3CTRA 2V4QA 2RE1A 1WKLA 3Q8QB 2XHWA 2G2YA 2HQ3A 4GMKA 3V6DB 3SZYA 1UZHA 3CMQA 2VG6A 4RKUC 4DS4A 4FVCA 2OSRA 3MEGA 3W2VA 4CO5A 2MGZB 3KG0A 4IG0A 3D7SB 4PKDB 5HQLA 3NEKA 5ETTA 2HHUA 3ISZA 1Q8IA 5CD4A 3KLHA 2JH3A 3PFOA 3NP5A 2Q3PA 5C25A 2PO4A 3ZZTA 1ALIA 2KYZA 2B5JB 3M4XA 4CCHA 1W25A 1SJ1A 4DN9A 5HRTA 3JQKA 3E2EA 1N32F 1I1GA 2O67A 4CLZA 1ZPWX 1QSSA 3G8TA 5B0CA 5LSOA 2B9WA 4FPRA 3MR3A 1QAIA 4F0MA 4JI6J 3GIJA 1RAJA 2RILA 4J9NA 4OI0A 5F8GA 3DDKA 4A8FA 2LEBA 4FYVB 5L9XA 3CULA 4M5NA 3WAYA 3PKYA 1HNWF 2OUGA 2N3LA 1AROP 1EZZB 3KG1A 1W2BR 4TLQA 1JNRB 1N36J 3QMQA 3MM5B 2ZD1B 2NYHA 2EFGA 3W9JA 3SSQA 4WXOA 4I6AA 4NRTA 4KGXB 4R8UA 2JVOA 1RHUB 3CUNA 2B4PA 1RAFB 4C8KA 3TP2A 2ZH3A 1U49A 5CXTA 2I5JA 3T6JA 2AD9A 4ID5A 2MY8A 1QUVA 4DX5A 2Z57B 4FN5A 1TFYA 2HMIB 2QLBB 2CQPA 1VQ7S 3TAPA 3PW2A 4DR3F 2E66A 4FXVA 3DRPA 3QPIA 4KAYA 2DNYA 5DO2A 3NGDA 2E9ZA 5E5NA 2G9YA 1RP5A 5GAGU 2XM3A 1F9EB 1LWFA 2ILYA 2KU7A 4X62J 2LQJA 5IFMA 3N4WA 2WONA 1YBTA 3TG0A 4C3LA 3C15A 2ZKUA 2B6AA 5FIIA 4X4UA 1X4BA 3A52A 3T5KA 4TXSA 2U1AA 3RRKA 2V67A 1Q79A 1EP4A 2MLXA 2R8JA 3ISND 2M8DB 4HVZA 1RDRA 1KLMA 4TYAA 1FWPA 4WK3A 3DMJA 2BJEA 2FZKB 2XG8A 4YY3F 3JQJA 1HHTP 2OAUA 3N6LA 1YJNS 1RT1B 1IKYB 3BKFA 3ENWA 3SCIE 2FLNA 4NE9C 2YX7A 1FRMA 1DLOB 4H4MA 3UPFA 2XMUA 2CQCA 2W5RA 1RWPB 4U96A 1X7VA 2R2SA 3BR9A 5ADZA 3T1HF 1RAAB 1FRJA 1U7LA 1HBOA 4ETZA 3KTQA 2L9DA 2Q1LA 4P2MA 3MMCB 3OTBA 2RIJA 4ZN3A 1WOPA 1R43A 1OPIA 1IQZA 3R5CA 1GXUA 1T7PA 1FEEA 3AOCA 3B4MA 1NPRA 4KV8B 5A76A 4RW4A 4DR1J 2R4FA 2QV6A 3TUJC 4Q44A 2MB0B 4LRAA 1JLQA 3D54A 4M5LA 4ZGAA 4TNOA 1I51B 2CYYA 1TZ0A 2XZDB 2CQ3A 3I4HX 2NXEA 3DKDA 3D0HE 3HD1A 1TV6B 2IPOB 4RW8B 3M05A 2P8IA 1ZETA 5L1JA 4JI3J 1KN6A 1RTZA 3A3NB 4I56A 1XC9A 2GSOA 3GYNA 2YWGA 1S9GA 3DRYA 4AL5A 4ZVGA 3PO5A 1NJWA 1QM9A 3VAFA 5I3QA 1YJRA 1HQUB 1O51A 3KDNA 3QRRA 3EM1A 4OV6A 3W2WB 2QEXS 2XO7A 3GONA 2A18A 4HL9A 3BO2A 3TWZA 2X3DA 1K1QA 5L39A 4K5SA 4RU9A 4O3PA 2CAJA 2VFUA 2R9LA 5KFWA 3KHRA 1ZM2A 4K2XA 4LJMA 4C2MA 2MGZA 1OYDA 3H25A 5HAOA 1ICEB 4EI2A 2YKMB 1L3KA 2B5JA 5AJ3F 3MM7A 4C98A 2MSSA 2AWZA 1JLFB 1JNZB 5SUHA 3OJSA 1URBA 2ZBPA 3JSYA 2O01C 2BJ9A 3C6TB 4EFAC 3ZC4A 1C4CA 3E01B 4ZHRB 4RU2A 5D8HB 4JI4F 4K4XA 5LMUJ 3R97A 1MROB 4P75A 3H5YA 4PQAA 4K4SA 3VGVA 4WWSA 4J7CA 5IZHA 1N34J 5E3RA 2P6TA 5L38A 5ETKA 4V19X 3QWPA 2ZD1A 2NR0A 2AIRB 1VJQA 3HVTB 2DVIA 1TKXB 5CQGA 2VFTA 1I94J 2BE2B 4MK9A 2HHVA 3HZEA 4DCPB 2ZH2A 2VJVA 2ZOGA 5SZTA 2M88A 2XO6A 2DH7A 1OMSA 1RWWB 1ED8A 4V19J 4WU3A 1YG0A 1NH7A 2DR7A 2OPSB 4LF7J 2WW4A 2GCFA 1SH3A 4QWCA 2FJWA 1KD1T 4HI1A 1YSJA 3U1NA 4U8VA 2HVZA 2BRLA 1CVJA 2RQMA 1XTZA 2H4WB 3MAAB 2WCXA 3JAMY 2YNHB 2NXJA 3M8PB 5C66A 1F2HA 4LF5J 5DM6Q 1WHVA 4F4KA 3PTWA 2A2DA 3BJYA 2KFZA 4QIFA 3VZIA 3W9IA 1RHKB 3LP2B 1Y6VA 2CA9A 3GCXP 3Q89A 3TUZC 2L3MA 4YN3B 2JL9A 4FYDA 4JI0J 5A6PA 1RT1A 1VBYA 1VI7A 4LF9J 4DL3A 1FTRA 3WBZA 3EMTA 5GVQA 3ILIA 2B0GA 1EB0A 2C2OB 3KLEA 2VDHA 2KN4A 3BKTA 3CJKB 3V2UC 5AJ9A 5GRRA 3FSXA 1WKKA 2PDAA 3GJQB 3MR5A 3I32A 4JI6F 2AEJA 4J9OA 1U2CA 1U1NA 3MTKA 4AFFA 2K3IA 3BN4A 3OV7A 1RYRA 1Q86T 3D6FB 3ET6B 4RX6A 1X60A 4USJC 2HGNA 3CD5A 2M9KA 3P4UB 4NRUA 4IRKA 1N36F 2AMCB 5DZ7A 3IGZB 2V4RA 5EGEA 1S72S 1FJ7A 4O4GA 2EPIA 3ITHB 4KV8A 1PBUA 4P9SA 2PD1A 4KH0B 2BM0A 1ANJA 1N5SA 1DURA 4ELVA 2G0CA 5J1EB 1G6BA 1UL3A 4BWJA 1UVLA 4IRDA 2YKAA 3M6VA 4MK8A 2Z8QA 2C2MB 5RUBA 4TLRA 3HO1A 1HBUB 4O3RA 5AXKA 4ZLJA 2Z56B 4P10A 3TARA 1R31A 3D5MA 1Q8LA 3OXGA 3IR7B 4OJ3A 2W24A 2MQMA 3T1YJ 4C9DA 3WBHA 3NWRA 3BBCA 5HSPA 2OPRA 4EU0A 1KBRA 4CLWA 2NUHA 4X62F 2CQGA 3KK1A 3BDEA 3QIPB 3D0IE 2PT0A 4RW8A 3NKOA 1LW0B 2XZTB 3VAMA 4F3QA 3ADAC 4U6PA 3QATA 2GSNA 2F65A 1FO1A 4ED1A 3LALA 5I42A 4E8UA 1L3VA 5H9EJ 2VA3A 4Q7AA 4WP9A 4CIOA 4Y00A 3W2WA 4HDGA 1V5VA 4LFAJ 1X4EA 4UUWA 4OL8A 1LEOA 3IMQJ 1CJUB 3I9V9 1G1XA 2QTWA 2VFVA 3Q2TC 3B8HA 4C8MA 3I9ZA 4LREA 4S0MA 1RLCL 5JVHQ 5HVFA 3R9LA 2O1PA 4WK1A 4F0HA 3HX9A 3DGVA 2PIIA 4B08A 4B3RJ 3UNGC 4JI5J 4QAXA 2F9JA 4UUXA 2YKMA 2EFNA 3MOJB 2VB6A 4HH0A 2AJ2A 3GG1A 1JLFA 2CNKB 1X4FA 3RR8A 5HANA 3OFHA 4MIBA 3ELHA 1X5TA 3FEYB 4KGKA 3R2CJ 3OSPA 4OZ5A 3C6TA 1RT7A 2EWHA 3E01A 2B4VA 4ZHRA 4RW6B 1A9NB 2NXNA 1REVB 3AJ2A 3EWGA 4HKQA 4DR1F 1JJHA 4IH6A 1RWUA 4KO0B 3GR1A 4LUBA 4YR0A 2HWHA 1FRKA 2XMKA 2XLJA 3QNWB 4ED6A 4FXWA 2FJBB 4J9SA 3AA9A 3CJSA 3CCSS 2DGSA 3IM8A 4DU7A 4OYXA 4IDKB 2ZBQA 1JLGB 2F1FA 2BE2A 3K0JA 2ZBCA 4P2XA 1B70B 1AUDA 4WKYA 5IT9U 5IOLA 3MR6A 3ENVA 2W8KA 4JI3F 3EICA 3LUYA 3MMBB 1Q5VA 5THWA 2OPSA 1OIAA 2M8HA 3IAM9 2WW8A 3KYLA 1S6UA 3NGUA 3TNVA 4EK2A 3TA0A 2MHNA 5KFUA 4WTYA 2VOOA 3MAAA 4YB7A 2U2FA 2RH6A 3CD6S 2MQLA 2ZM6J 4XTTA 1VJWA 1B0VA 3CSKA 2JSXA 1U0HB 3UD4P 3I31A 3NKRA 1TU0B 1JLEB 4B02A 4MKVA 1SH0A 1WEZA 2C3UA 2FLPA 1R8AA 4NWJA 3THTA 4ECQA 2ZDOA 4F7VA 2I38A 4QPTA 4FYXB 1KWMA 5IC6B 3FMWA 1I3OB 1RI7A 3KWMA 2J9CA 3IGNA 2EI5A 3TJ9A 2BJ1A 4LFCJ 2Y8YA 4EMDA 1HWIA 2JNJA 1H7WA 3KJNB 4I0WA 3FQLA 1BXNA 2NZ4A 4YDXA 5M2UA 2BA9A 3LGMA 3S7RA 3DOLA 4FZVA 2G0IA 1RTIA 4ZPTR 2PMHA 3HK2A 2GAHC 1UCNA 1GXTA 1CPZA 3C14B 3CJ2A 1QJHA 5LMUF 1APSA 2YNGB 2P5VA 1XBWA 2KB2A 2HSEB 1JLAA 4DU8A 3NGTA 3HXMA 4CLSA 3P5BP 3CCRS 3TYTA 4YR1A 4PZVA 3M6UA 4OZ0A 4NA1A 5DG9A 1RZMA 1OSDA 4IR9A 3DRRB 2KI2A 1D3WA 1VIXA 3PW4A 1N34F 2D3ZA 2V8DA 1KFSA 2HURA 4K4YA 4V1Ak 4CTAB 1VFJA 3DOMB 4PR6A 4DL7A 3TX8A 2CPHA 3QZ7A 1F1BB 1KKHA 3ITHA 2JOQA 5CZVA 1I94F 2GIQA 4USUA 3TZWA 1GTHA 2VQFJ 2IDEA 1B8JA 5C2GA 5J1EA 2Y1JA 3DLGB 3MD1A 5MLCV 5LT5A 2F8MA 2Q79A 1IJFB 2DCUB 4LF7F 1HBUA 3NL0A 4ZP7A 2KG0A 2IVMA 3HHLB 1VQLS 4DL5A 2K7JA 4QBUA 4KGMA 1KP6A 4ED8A 2GAGC 4NCAA 5DRKA 2HNZB 3PYDA 5FDLB 5K14B 5KFNA 1GT8A 3QIPA 4CO4A 1LFPA 1VHFA 2QT7A 3GIMA 4LF5F 3OLBA 1C0UB 1RHQB 1NK4A 3I4PA 4NA3A 2J76E 4ZVUB 1CJTB 3PJWA 2XLKA 3MPUB 1S1TB 4RBUA 4EO6A 5F8MA 3G6VA 1B4SA 2NZCA 1MLAA 2H1YA 3K8WA 2AT1B 2B9YA 3IWXA 3W63A 2X98A 4IQMA 4JI0F 1FRLA 3CC2S 5K8PA 4CI0B 4LF9F 2XMJA 1VQNS 1TR0A 1CJUA 5KG0A 1DAXA 3GJTB 3DHXA 1RT2B 2WTFA 1MWZA 3V6KA 4OX6A 2CZ9A 3ZNUA 4CLKA 2M4MA 1C1BA 4OYIA 5A2QU 1LV5A 2D74B 3QRQA 1HA1A 1O99A 3SQOP 1BD6A 5I3UB 1NKCA 2Y0SD 1LFWA 1H72C 2B4UA 4M5KA 3LP1B 4HDHA 1RBLA 3HSGA 1KQKA 4A8YA 4QJVA 2C3PA 4DMZA 2YVSA 3MECB 2J9EA 3BYRA 1NHVA 2Q6CA 4RW6A 1REVA 1RLDA 4I6WA 1XR6A 1IUJA 2ZC3A 2AV5A 3BSOA 4KJIA 3CPWR 4O0NA 1G7CB 2DPIA 4RZRA 2CQDA 5GADU 4DV4J 3IFEA 4BHQA 1DARA 3D68A 2DY1A 3VGUA 3VR1A 4K4ZA 5CYMB 4LFBJ 3EZUA 1NDPA 2GS8A 4NLDA 3P45B 3FKBA 1TL4A 2DGQA 2HQCA 3RRHA 1IR0A 1WC1A 3T1YF 5F8IA 3D6HB 4MTPA 2ZHAA 2GLQA 4IDKA 5M2PA 1JLGA 1VR6A 4JBCA 3BGLA 3G96A 5A8KA 1CLFA 4L72B 4HR2A 5EGHA 2H4YB 3M8SA 3GWCA 1IVZA 3J81Y 2JFKA 3PW7A 1FE4A 2UUAJ 3FFIB 3BGOP 2R2UA 3TZYA 1ED9A 3NOGA 4KR0B 2HFNA 4FP9A 3AAWB 1UVKA 1FNOA 2I8EA 2DPJA 1AJBA 2ZNZA 4F67A 4GTWA 4PG7A 2A6OA 4KHMA 1IKVB 4H54A 4LQYA 3ZTPA 2W2OP 1XMBA 3N5FA 1HIYA 2O3DA 4LBHA 5J1PA 4FBUA 3DLEB 5AXMA 4ILMA 2FHJA 4LFAF 1H6KX 4QIGA 5HMYA 2ABYA 3SBMA 1K8AT 2YX1A 2WVBA 2NXCA 4KPCA 3Q8YA 2RDIA 3CCWA 1ULRA 1U0HA 1YZ7A 3FCHA 1X5SA 1UEVA 1JLEA 4GC7A 3VAIA 3L4BC 1S1XA 1RA6A 2VV5A 3DFEA 5EWEA 2PGCA 1N4LA 2FPHX 3GP9A 3IRXB 2ZWPA 2J8SA 2HWIA 4B3RF 4F4ZA 1HNIA 1RTJA 2XMVA 3E8OA 4JI5F 3OTEA 2E1MC 3SIPB 3CGIA 2FB0A 4USHA 1N6QB 1UEUA 3W60A 1UPMB 2DNOA 2HS4A 1VGYA 2COLA 1E6YB 2W2NP 1NSQA 1RACB 5L1IA 1YZ6A 2HGLA 1T3OA 1YTYA 3C14A 1WD6A 2DNLA 2YNGA 5H9EK 2Z2YB 2FD2A 3SI8A 2ATLA 2B9XA 3R1HA 4PG5A 3FQKA 3TX0A 3OVAA 1QD1A 3NGSA 4I69A 3DRRA 4UPHA 1TVRB 4CXKA 4DSFA 2CQ2A 3G4SS 3I0SB 3G71S 1YQHA 2ZH1A 3FRZA 4K4WA 4CTAA 4FYWB 4OZJA 2DGTA 3DOMA 2QMWA 5C24B 5CYJA 4M5DB 4NWXA 2IA6A 4WFAQ 2CZ4A 2BV3A 3A3PB 5C2CA 1KLNA 1AUSL 4C0OC 2W9BB 1Q82T 4OX9J 4J90A 2HHHJ 1F5BA 2LEAA 5KG5A 4W90B 4DV2J 1SV5A 1PYSB 2CJKA 3VHQA 4WP8A 3T5LA 3ZZUA 3HHLA 4BDPA 3PJXA 1HPZB 1Y3KA 1PAEX 2BOAA 4QYRA 2HNZA 1RT5B 5FDLA 5K14A 1EIYB 4OQJA 4DQQA 3NCRA 2ZM6F 3VQTA 2GHWA 4I68A 3MM9B 1C0UA 3FZBA 3EVMA 2GSUA 4IYQA 4FS1A 4RO0A 4QR0A 1L3TA 1CJTA 3U1LA 3T3FA 1U6BA 2GO8A 4DR2J 2V6AA 2KT2A 1L3UA 1R3NA 1BQNB 3SEOA 4CLYA 3WC0A 1NAQA 1VLOA 3TJ8A 2QYGA 2F5GA 2HQDA 3QGGA 3MMJA 1SJ3P 2JEFA 2MKCA 4LFCF 3QO9B 4GRSA 3M9OB 2PMZD 4URQU 2YQ3A 1RT2A 1VK3A 3M2UB 4ZK7M 3ZTSA 1Q78A 4FS2A 3TA2A 1BUXA 1B7FA 1N0UA 2E1RA 3BGRA 4NLGA 4X4NA 3C3LA 1TL3B 2QX0A 1XEZA 1H74A 4G3IA 4Y2AA 3GIIA 5L1KA 4RNFA 1Z2ZA 3MCMA 1T3NA 3H40A 3W5XA 5HP1B 4DFPA 1S9EB 3KJVA 2F4VJ 3NGRA 5LXYA 1N48A 2W4PA 3JB9k 1C4AA 3MM6A 4PEOA 1TELA 4LBIA 3KHGA 1ZTWA 2VQFF 2DHXA 3ILLA 4YP3A 5KFZA 4UT4A 2ANHA 4RWWA 1SB6A 2E5GA 3RAXA 3MEDB 1H2VZ 4U95A 5CYMA 2HBYB 3UQSA 2VPZB 4ZVTB 3P3DA 2OFHX 2M70A 2D7SA 3LWMA 1Y00A 1FJCA 2H5EA 4D3GA 2RRNA 4C8NA 3PX0A 3FFIA 1SJQA 2UUTA 4HYKA 1R27B 5AXNA 4DR7J 2V63A 3KLGB 1IKVA 4DV5J 1SBRA 1J5EJ 4LBPA 1VRTB 3GLJA 3RBXA 1RA7A 3DLEA 2CXEA 2V8VA 3MCNA 1CS4B 1ZBTA 2DR6A 4WFXA 5ETVA 3WHIA 3FMBA 3HKZD 1LWEB 1EKRA 3GR0A 1CEZA 1R8PA 1TK5A 4F3OA 5DS7A 4RNOA 2CJXB 1KEKA 1CJVB 2QA4S 2ZBIA 2CUYA 3G82A 1VRQC 3R7SB 1ZM4A 3J80Y 3IRXA 4C8ZA 1UZDA 2ZFHA 3CWJA 1RK8A 2HHQA 1RTHB 1AJCA 1VDHA 4Y34A 1IKWB 2K2PA 1N6QA 1RWNB 3ILJA 5LRNA 4ZVSB 3HPOA 1E6YA 3R5BA 5ETOA 1KQFB 5IJSA 4ZVHA 2NUUG 3ZZZA 2EVZA 3PDNA 1RUSA 1E33P 2VL1A 4N5SA 2ROEA 2L9WA 2OP5A 2A1BA 2HIQA 4NXNJ 2XYGB 2CQ0A 3FK4A 3BF4A 2H65B 2B51A 4DV4F 2N7YA 3J7YU 2HRYA 3SDEA 3KLVA 1Q5YA 1S1UB 4LFBF 5ETMA 1JLBA 4JI1J 2ZE2B 3I0SA 3K8VA 3TZXA 5HVHA 2VPYB 4DG1B 4RNHA 4M5DA 1SKWA 4UZBA 1TMMA 2CPYA 4ZIWA 2MZ1A 4TN0A 4ID8A 2AU0A 2ADCA 2DNHA 1BWEA 4IG3B 4ZPDA 4I1TA 2UUAF 3IAS9 1KHWA 3VVTA 4UQGA 3SV3A 3VAJA 3NKYA 3BREA 1ZS6A 3K17A 3ZZ0A 4KBIA 1VQ5S 1VOMA 4WXWA 5GAHU 4X65J 5LSLA 2KZMA 2GVDB 3UN2A 4ATNA 5IM0A 2HLUA 2DR9A 1GAOA 2BMBA 4KPYA 1PSDA 5KFJA 4NLPA 2QFJA 3ZZYA 2Z4PA 5LIAA 1RAHB 1CJKA 4OHWA 3R3TA 3BN7A 4I7FB 1EQMA 4ECZA 3MI7X 4DZDA 4P52A 3KK2A 3MM9A 3MPYA 3FSYA 2E29A 4WFZA 1YKWA 1A0OB 4K8RA 4NLSA 2VH7A 1XNQJ 2K1RB 2W7PA 4UY8T 2Y1LB 3SSRA 2DRAA 4N8NA 3QYYA 4CP5A 1KH9A 1TK0A 5EN1A 4F2SA 4RNNA 3D1OA 1PAUB 1LOUA 4JV5J 3V4MA 1X9WA 1TL7B 5KFLA 2C2ZB 1GMVA 3LW5C 1UFKA 3QO9A 1Q0NA 1S0NA 4OHZA 4BC9A 2AW0A 4N8OA 3M2UA 5T41A 3HM9A 4DSEA 2NSCA 4I64A 3QJPA 3M6XA 1WC4A 2XTJP 5F3TA 4FBTA 4X4QA 4OYOA 4AXIA 4DX8H 2HAFA 1U1KA 4YFUA 2VC1A 2G0JA 1RT6A 4DN0A 1R6VA 2UXCJ 2DH8A 5HATA 2R7VA 1N5YB 4PG8A 3G8SA 5E3PA 3SCJE 5H9FJ 1WHYA 2RDDA 1TKTB 4ED4A 1S9EA 4YEAA 3TZZA 3EPIA 3M9NB 4DFMA 2A0FB 1Q7LB 2HHSA 2F8EX 1QAXA 4NEZA 2QLFB 4GKJJ 1KHNA 2DYAA 5KAKA 2IJFA 3K5LA 3H0PA 1PYTA 2NYIA 3H5XA 2V68A 3GV7B 2DY9A 1FK9B 4W98A 4OX9F 2HHHF 4YQWA 4DV2F 3QSIA 3CMRA 2CJAA 1M5PC 2M0GB 1NEEA 3MEDA 1BHNA 5DETA 3AQPA 4GTZA 1U6ZA 4CO3A 1NHUA 3PV8A 2DD8S 5IC4B 1NSKL 4LQ3A 2D3OR 3NMRA 2VOPA 5AE1A 3AH6A 1RBAA 3H5UA 3PIOQ 2ZHBA 3DPCA 3CC7S 4ZVOB 4A4JA 2J6UA 3U27A 1RWXB 2GQ2A 2RHQB 1YJ7A 2HGMA 2NPIA 4G1IA 2XULA 1DTQB 4DR2F 2IYIA 2AX0A 5MAOA 4IR1A 3DRSB 1GEHA 5D0RA 9ATCB 2GQCA 2VKRA 3KK3A 1K1SA 1LWEA 2GMLA 1H38A 2C28A 1IBMJ 4LR7A 2X3GA 1LK5A 3HD2A 1RXOB 1CJVA 3BPSP 4J9UE 1Y5IB 3CJRA 5D78A 1DQAA 1YJVA 1KH4A 4FYYB 4TN2A 4X4TA 2XMAA 1H73A 2OMLA 4CH0S 1JXEA 3PNIA 2MZSA 1RTHA 2JLGA 3CNQP 1PBAA 4ANCA 1JLCB 1Y0HA 4ZLLA 1IKWA 3EXCX 1BY9A 2KVIA 2OKQA 1F3VA 3RRGA 3T41A 5LQQA 4F02A 3ZO7A 2HQIA 3QWUA 2Y1IA 3BDFA 3N28A 2F4VF 2W9CB 1GTEA 3DXBA 4LVNP 4NZ6A 4PXBA 1Y4ZB 2IRUA 2J6SA 1UVJA 4AXJA 4QU6A 3IXQA 2Y3YA 3RTVA 1HBNB 3DM2B 2FC9A 4FF2A 2GJ2A 4X84A 3M8ZA 2OIHA 2YH0A 1LK7A 4USIA 4OHVA 4NCGB 3OVSA 3HMJG 2R7TA 2D1CA 2F8HA 1S1UA 4IO9Q 1XMOJ 4HT7A 1MN7A 4DJBA 2BX6A 3SQGB 3Q24A 4M5MA 1M5HA 3KLIB 2VA2A 5KFTA 2VBWA 5A0YA 2R7QA 3MMAB 1FKAF 2QC3A 3CJ8A 2XHCA 2MKIA 1NZ8A 2XGPA 4IG3A 3RAMA 5KFEA 3KG4A 3TANA 2CWXA 5BXIA 1HHQA 2DHSA 1ZM3A 4OI1A 3FDSA 4YUDA 1X9SA 3IGYB 1O5JA 3UCUP 5C7PA 2L08A 2CJBA 4DV5F 4TVAB 2GVDA 1N54B 1J5EF 2JLFA 4ENOA 1RISA 5A8WB 4A8OA 1NXIA 4FDIA 3NCPA 1KHKA 2OLWA 2CNLB 2C2RA 4EWTA 1URAA 1RHJB 4I7FA 3W5ZA 2VC0A 4L75A 1R0AA 4GVBB 2KT3A 4DV6J 2DGOA 2EXUA 2VBYA 2ZKTA 4RPFA 4N76A 4KHPJ 4DL4A 2HS0A 3PYGA 4L73A 1KSPA 7AT1B 4KB7A 2GFFA 1YRUA 1RAGB 4CM2A 1X4HA 4ZJLA 3MM8B 3HFVA 4XDDA 3NGKA 4P72A 3UW1A 4WIIA 3ZZOA 2FVSA 1TL7A 5DQHA 2KL8A 3AHPA 2R42A 3TQEA 4O3SA 1X4DA 5E41A 1V5IB 1S4FA 2AX1A 1WHXA 2DGVA 4ZVEA 3BQ0A 3R7BB 2RAQA 2B56A 4LIRA 2HHWA 3H4BA 1S4EA 4J9PA 4ELTA 4F8RA 1UVMA 3L9ZA 2IAJA 2XC9A 4NXNF 2DXFA 3G9CA 2OMOA 2MZQA 5B09A 3KOAA 1Y5LB 4KKOB 4DLEA 1N5YA 1NK9A 4HLBA 1NJXA 3AQOA 8AT1B 3AY0A 4JI1F 2FY8A 1SHQA 1WSVA 4PWUA 3SV4A 1FDAA 2RRAA 1EX8A 1T05B 4UZCA 2OH2A 4K4VA 4P6QA 2XYHB 2I0XA 3K89A 5FLXY 2FIUA 4J9QA 1U1OA 3NOCA 2CNNB 3BB5A 1KVKA 1M1HA 3LTOA 4M8LA 3OR2B 3R5JB 2WB4A 2LXFA 4KHRA 1WF0A 2MQOA 1NK8A 1T9WA 1Q1KA 3SCKE 2UUBJ 4TU7A 4DCOB 4O23A 1ZA2B 4X65F 3DLHA 2KRBA 3CO0P 2PN6A 1MNEA 3BV8A 3MPVA 3LPYA 5B0BA 1NO8A 3C16B 2XMWA 2HFSA 1KNZA 1VQPS 1EETB 1S59A 1FKPA 2LLZA 3BYPA 4BC7A 4CNZA 4C3KA 4ZVQB 2MZRA 1G2EA 4XK8C 3CJ4A 3O44A 3CDEA 1R6YA 4PXCA 1XNQF 1SL0A 1YVFA 1DTQA 3HJFA 3DRSA 1HBMB 2B7CB 5EUHA 4NLVA 3NY0A 2PMWA 2AGOA 4WCEQ 5GAGI 4JV5F 3BO3A 4UPIA 2WBMA 4OJ1A 3R2DJ 2W5TA 2DXEA 1PCAA 1LKZA 2APOA 5B08A 2XY5A 2YWWA 1HQAA 2VFRA 2LDYA 2WZ1A 5LMNJ 1JLCA 2BJ3A 2UXCF 4DBQA 3A3OB 4XDCA 5CHCB 1Q8BA 4LMZA 1WDTA 3JQMA 1VC5A 2GNKA 3QGPA 1S48A 3PHTA 3THPA 5HROA 2XWYA 4JYAJ 3Q3QA 4ZP9A 5HQMA 4RUAA 3X3UA 1XQIA 1HBNA 3T02A 4GKJF 2UVVA 2N82B 2DNZA 4DFJA 1RE1B 2BJDA 2VG5B 3EVWA 1FXRA 2BM1A 2PC6A 2ZOMA 1SQGA 1FKOB 3TVYA 1LXJA 1XMQJ 1F60B 5D4LA 2EFQA 2BRKA 3K5MA 4ANDA 3BSNA 4CYUB 1Z4UA 2IM3A 2O66A 3SQGA 2IFXA 2H5JB 5H1SV 3V6HA 4J9MA 2GC8A 1VC0A 1IBCB 2EG2A 3IBCB 2AP6A 1S6OA 3MMAA 3N01A 1HD0A 1VS3A 2FVPA 3HSZA 4ZITA 1RHMB 2YNFB 3PZPA 1WEXA 4BWMA 1WHWA 3HSDA 4FPIA 3UCZP 1ACMB 5H9FK 3L95X 3CDUA 1LQ9A 3WIUA 3OBIA 1SQEA 5A8WA 1K47A 1WI6A 3PX6A 3KLFB 2JVRA 4Q2LA 2HFZA 1P9YA 1LWCA 5KOWA 5HO4A 5T14A 3NRBA 4F4WA 3UCGA 1EHWA 1FSUA 3GSDA 3PYFA 2HBQB 3HCXA 4GVBA 2LQ9A 4CO2A 1T9TA 5GMKa 1KOHA 2R7SA 3A12A 1CC8A 4RW7A 4ICLB 1YLXA 4P7TA 5IT0A 1N8RT 1PJ6A 1OY9A 1NMEB 5IS2A 3W61A 3MM8A 1HMVB 4MAKA 1EARA 4LSLB 3DLKB 3ULHA 4XIUA 5A8RA 1IWAA 3M6WA 4FF3A 1E6VB 3AFGA 4QOTA 2NCKL 2ERRA 2ZC4A 4J9LA 3QT8A 5U47A 3ZXWA 4NMXA 5IWAJ 4AE5A 3NS5A 2W2PP 2KTQA 3ZZPA 2HBZB 1WSRA 3R1LA 4RR5A 2G9OA 1AW0A 4KKOA 2LECA 3ZNJ1 5BR8J 3NS7B 2XGQA 1DTTB 5HQ8A 2UV8A 4CYRA 2ASLA 3GV8B 1YGYA 1J27A 2CFXA 4C48A 1XMOF 2MTLA 3EGVA 1T05A 3AJ1A 3DYCA 2VODA 1CQNA 1KVIA 3F56A 5F8NA 1WG1A 2CKWA 2XS7A 1LW2B 1VLYA 1VQOS 2M52A 4WZMA 2GJFA 3OR2A 2ALZA 3HT0A 5E2QA 4X64J 4X2BA 4MY4A 4NYOA 4IUFA 2G2ZA 3TAMB 1S77D 1NJIT 1VMBA 3TR5A 3V5RA 3V81A 2GGPB 2VG7B 1EW8A 1KTQA 3VAHA 4KH1B 1NB7A 4KTQA 3NLCA 5GAEU 4D3HA 3MOZA 1T9UA 4ECTA 4RBTA 3C16A 2RMLA 1KOOA 3LA0A 1GMWA 2UUCJ 1N5QA 5HLFB 1B7YB 2CG4A 3JYTB 1HL6A 4J5OA 1L5UA 2FC8A 4U7UD 5BJRA 3M32A 2BDPA 4DV6F 2EC0A 4ED5A 5JJBA 4KHPF 4EYHB 4NZ0A 2V34A 3GIRA 1NSAA 3FBEA 4YMEA 5KFHA 3L3CA 5HMXA 1HBMA 3H20A 4JI2J 3BDGA 1KQGB 3O5TB 4Q45A 3JSBA 2JEGA 2XLIA 5GMDA 2GA7A 2HNDB 4F4AA 3TEHB 3HHKA 1M5OC 1K0VA 2F7VA 2DJWA 4E98A 3K5OA 2PI5A 4ZS6A 5J2MA 4X66J 2ZH8A 3MDFA 1P49A 1ELOA 4HT5A 3CJTA 1IKXB 4FDFA 2MKSA 2L48A 1HHSA 3N79A 1RCXB 1N88A 3RW6A 4TYBA 1AUKA 5B0AA 1X4CA 3G8QA 4Y3CA 2B9EA 2RUSA 3GMGA 1ZM9A 3V4IB 2VBZA 2EFVA 5LSRA 3RAQA 2VF3A 4DR6J 4DL0C 4BBYA 3SYZA 1X4AA 5EGYA 3AA8A 1JMTA 1SQFA 4WTOB 3EGZA 1YITS 1QTMA 4RJVA 3PKMA 3M8QB 1FVSA 3IR6B 4K5RA 4DQRA 1N2KA 1T95A 3QJJA 2UP1A 3B78A 5D4NA 2VG5A 4K59A 3EZOA 1E3CP 3QAUA 3MUMP 3POTA 5KFXA 2GX8A 1OJ4A 2I9SA 3N0VA 4ES3A 1FHTA 2PEBA 4ETXA 3OW2R 2C3MA 4U9RA 2Z2MA 4NI2B 2E1PA 1XN9A 1IBLJ 1NDLA 2L9NA 1S7IA 4HH1A 4CYUA 5LM7E 4QWDA 3OUYB 4P73A 2BQ3A 3K5PA 5E0OA 1JKHB 4M95A 2ZH9A 4JI8J 2YNFA 2BEFA 3D1HA 3V6DA 4USKA 2LYVA 3LF0A 4KM4A 2LVWA 3EGWB 2R7WA 4ZCMA 4RBVA 3R5AA 3UN5A 1KDNA 1S1VB 4WIQA 1TTHB 3G86A 1JJ4A 4KT0C 4ZJQA 4DPXA 3PEJA 3D2WA 1S0MA 3KLFA 7FDRA 2WVDA 3U7JA 2LEPA 2V69A 4EUVA 3M30B 2XSJB 5KT2A 1NJZA 4Y2MA 5DGAA 2GHVC 1HW9A 2IYGA 3PRBA 2MEWA 4NA2A 3JSMB 3ENQA 3EXYA 1MMDA 1N5VA 3OL9A 4ICLA 1C0TB 3D67A 4LRFA 1HMVA 3H7HB 4Q8FA 2XCAA 2HHXA 3OL7A 4LSLA 1SPBP 2QLJB 3DLKA 4K4TA 1D9FA 3BBBA 4HHUA 2JLEA 5KFIA 3CCJS 1AFJA 3FBBA 4MHXA 5D4PA 4M63A 1S10A 4A8WA 1UA0A 2BOPA 3MM5A 3C8YA 3TVKA 4OX7A 4DV1J 1QE1B 4JYAF 2VONA 4CNYA 2B8QA 2BW2A 4IFYB 1L3SA 1IWGA 2GIRA 2UVUA 4MKYA 2AYMA 2J0SD 5G0RB 2UXDF 2X1AA 2EW9A 3W3SA 2QO3A 2HMIA 3FBCA 1IQTA 2G1DA 1DTTA 3AD7C 1SKRA 3GG0A 2QL7B 1N32J 4A8XA 1XMQF 5E7OB 1B64A 2OTLS 5FD1A 2IC3B 2IBKA 3IRWP 4FF1A 2QA2A 1QTNB 4QIVA 5FJ4A 3FCWA 4OV1A 3CXCR 2CDRB 4MYTA 3NXZA 4WBFA 4K50A 2EFPA 2MZJA 2FJEB 4LVOP 4OYPA 3CCQS 2UZAA 4L3KA 1AB8A 3N6NA 4F36A 1HD1A 3TAMA 3UVJB 2GGPA 2KZZA 3JTPA 1SHNA 5CAAA 1HNVB 2VG7A 2IHR1 4WYLA 3LAMA 2YXLA 4QW8A 3ZFVA 1U26A 3DC2A 3C19A 4IKAA 1BQMB 3L7PA 3GE9A 3DI6B 2JX2A 2C3OA 1MN9A 2HNYB 1IKYA 5HLFA 2ZZMA 1XJWB 3IO1A 3CIZA 2WVEA 1UP1A 3M1VB 1FDBA 2K3KA 3MAQA 1DLOA 3TUIC 1Z1ZA 2IMOA 1SUQB 2FLLA 6AT1B 2HKEA 1Y5NB 3DLJA 4NX9A 2OEJA 2ROPA 3EVOA 5C42B 1URRA 3EDQB 1D9DA 4ZCLA 4BCAA 3PIPQ 1FJGJ 2HNDA 1YI2S 2LDIA 4H4OB 3BS9A 3MMCA 2KG1A 2VG6B 3MCOA 3EZ5A 4PRFA 4CYSA 3OHAA 1W2IA 2DTJA 1OS5A 1RGVA 2X1GA 1HWJA 3K7RA 3MEGB 1IKXA 3W2VB 1IN0A 5IWAF 4IG0B 4F50A 2XRGA 5B0GA 1HJKA 3A1YG 1O8BA 5C25B 3QAEA 4CDIA 5EHHA 3UR3C 3TEGA 3I56S 2HZAA 5BR8F 1Y9OA 3FC9A 4OMFG 1GX6A 1Q4RA 2MKJA 3IGVA 2BKPA 2VQRA 4ES2A 4OHYA 1RAEB 1GXLA 3CCTA 1VQ4S 5ETSA 2C2KB 2H48B 4Q2MA 2AYEA 2QL9B 4C8LA 1BMQB 3AD8C 4G1QB 3MK1A 5CZXA 4U7UK 1SJRA 1TV6A 3M8QA 3UN3A 3OFGA 5HVGA 2QLXA 2CPEA 1RWMB 4XO0A 2W5VA 4UQTA 4X64F 4GTXA 4B9SA 4NLWA 1IR1A 2D9PA 4PXEA 4TQRA 4OYAA 3EPGA 1OQ6A 1ALHA 2HVDA 4NI2A 4DCJB 1HWLA 2ZHOA 2ZZTA 4NLTA 1HQUA 1WC5A 4M5JA 5K9FA 3OUYA 4HHHA 4ED2A 2UU9J 2HS3A 4NLYA 2W7AA 3BGUA 2DK2A 2FDNA 2FLOA 2QA1A 5KFAA 2DNGA 1G3OA 3WX4A 5L0EA 1TL1B 2UUCF 4ID5B 2X7IA 2IJRA 4DZ6A 4IFVB 2VIHA 5EWGA 2HZCA 2V50A 2J9DA 3SXLA 2HFUA 4YR2A 2YWEA 3OXFA 2GHPA 4OI6A 2G1HA 3A4TA 5J1NA 1YWXA 4JI2F 3JTOA 1XR5A 3KFWX 1U09A 2R2RA 3M30A 2I2YA 2QSFA 3HULA 2WONB 1E2SP 3T5JA 2OO4A 2B6AB 4QWBA 1R7IA 3I6PA 3T00A 4P71A 3P49B 3SMZA 3GTYX 4ZCKA 4IH5A 1W26A 4P74A 4X66F 1TP7A 2KRRA 3JSMA 3H2UB 1C0TA 2J9DE 3MURP 3BDHA 4NLQA 2L41A 3BM7A 1MROA 4C0BA 4DV3J 2XMTA 1BGXT 3PEHA 2FQQB 1R0BG 1D8ZA 2JJ4D
chains in the Genus database with same CATH topology
4UPKA 4UPHA 4MY4A 4UOPA 4KAYA 1P49A 1ZEBA 5HRTA 1KH9A 2RH6A 4CXKA 4N7TA 5KXAA 3IDDA 2GSNA 2GSOA 1EQJA 4MIVA 1SHNA 2W8DA 4UOOA 5L0EA 2XRGA 3BDGB 2G9YA 3NKNA 1KH7A 1K7HA 2W5SA 1KH4A 3MK2A 4MHXA 1HJKA 1EI6A 2IUCA 1HQAA 1ELYA 3CMRA 1EW8A 5C66A 4B56A 2ANHA 1KHLA 4NWXA 2IUCB 1EW9A 2X98A 3NKRA 5DLTA 3IGZB 3M8YA 5TJ3A 5EGEA 4UPLA 4CXSA 3ED4A 5LRMA 4TN0A 3TG0A 1AUKA 4GTZA 4KM4A 3B5QA 3WAYA 3A52A 4ZG6A 2VQRA 1N2LA 1AJCA 1ANIA 4LRCA 4KJDA 3UN5A 1ELXA 1KHJA 1B8JA 4CXUA 4FDJA 1Y6VA 1KH5A 3TWZA 3IGYB 1ANJA 5LQQA 4NWJA 5LRNA 2XR9A 2W5WA 3NKPA 3SZZA 2GLQA 1ZEDA 5INHA 3WAXA 3E2DA 3BDFA 5K4PA 4ZG9A 1EJJA 4LREA 4LRAA 1HDHA 3UN2A 2D1GA 3DPCA 3SZYA 4UORA 3MK1A 1E2SP 3WAWA 1Y7AA 3MK0A 4LRDA 3KD8A 4FDIA 5EGHA 3UN3A 3NKQA 2W5XA 3Q3QA 5IJSA 1KHKA 4ZGAA 1ELZA 4GTYA 3T00A 1O99A 4CYRA 2W5VA 1URAA 3T02A 2W8SA 1E33P 1ED9A 1N2KA 1AJDA 5LIAA 1O98A 3UNYA 1ALJA 4GTXA 3T01A 1EW2A 4QAXA 1FSUA 4KJGA 4ZG7A 1ALKA 4LR8A 5DLVA 3M8WA 1AJBA 1E3CP 1SHQA 3NKMA 4KAVA 4LR9A 4LR2A 1E1ZP 1ED8A 3WBHA 4GTWA 3WAVA 5L0KA 5AJ9A 3BDGA 5GRRA 3LXQA 3M8ZA 3DYCA 2W5QA 4LQYA 1ALHA 5GOVA 1ZEFA 4UPIA 3OT9A 5L0BA 2ZKTA 1ALIA 4LRBA 3BDHA 2IFYA 2GA3A 4LRFA 5IJQA 3NVLA 3NKOA 3TX0A 2GSUA 3M7VA 4YR1A 3UO0A 1AJAA 2QZUA 4CYSA 1URBA 2W5RA 5DLWA 4LR7A 2W5TA 1KHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPK A;  4UPH A;  4MY4 A;  4UOP A;  4KAY A;  1P49 A;  1ZEB A;  5HRT A;  1KH9 A;  2RH6 A;  4CXK A;  4N7T A;  5KXA A;  3IDD A;  2GSN A;  2GSO A;  1EQJ A;  4MIV A;  1SHN A;  2W8D A;  4UOO A;  5L0E A;  2XRG A;  3BDG B;  2G9Y A;  3NKN A;  1KH7 A;  1K7H A;  2W5S A;  1KH4 A;  3MK2 A;  4MHX A;  1HJK A;  1EI6 A;  2IUC A;  1HQA A;  1ELY A;  3CMR A;  1EW8 A;  5C66 A;  4B56 A;  2ANH A;  1KHL A;  4NWX A;  2IUC B;  1EW9 A;  2X98 A;  3NKR A;  5DLT A;  3IGZ B;  3M8Y A;  5TJ3 A;  5EGE A;  4UPL A;  4CXS A;  3ED4 A;  5LRM A;  4TN0 A;  3TG0 A;  1AUK A;  4GTZ A;  4KM4 A;  3B5Q A;  3WAY A;  3A52 A;  4ZG6 A;  2VQR A;  1N2L A;  1AJC A;  1ANI A;  4LRC A;  4KJD A;  3UN5 A;  1ELX A;  1KHJ A;  1B8J A;  4CXU A;  4FDJ A;  1Y6V A;  1KH5 A;  3TWZ A;  3IGY B;  1ANJ A;  5LQQ A;  4NWJ A;  5LRN A;  2XR9 A;  2W5W A;  3NKP A;  3SZZ A;  2GLQ A;  1ZED A;  5INH A;  3WAX A;  3E2D A;  3BDF A;  5K4P A;  4ZG9 A;  1EJJ A;  4LRE A;  4LRA A;  1HDH A;  3UN2 A;  2D1G A;  3DPC A;  3SZY A;  4UOR A;  3MK1 A;  1E2S P;  3WAW A;  1Y7A A;  3MK0 A;  4LRD A;  3KD8 A;  4FDI A;  5EGH A;  3UN3 A;  3NKQ A;  2W5X A;  3Q3Q A;  5IJS A;  1KHK A;  4ZGA A;  1ELZ A;  4GTY A;  3T00 A;  1O99 A;  4CYR A;  2W5V A;  1URA A;  3T02 A;  2W8S A;  1E33 P;  1ED9 A;  1N2K A;  1AJD A;  5LIA A;  1O98 A;  3UNY A;  1ALJ A;  4GTX A;  3T01 A;  1EW2 A;  4QAX A;  1FSU A;  4KJG A;  4ZG7 A;  1ALK A;  4LR8 A;  5DLV A;  3M8W A;  1AJB A;  1E3C P;  1SHQ A;  3NKM A;  4KAV A;  4LR9 A;  4LR2 A;  1E1Z P;  1ED8 A;  3WBH A;  4GTW A;  3WAV A;  5L0K A;  5AJ9 A;  3BDG A;  5GRR A;  3LXQ A;  3M8Z A;  3DYC A;  2W5Q A;  4LQY A;  1ALH A;  5GOV A;  1ZEF A;  4UPI A;  3OT9 A;  5L0B A;  2ZKT A;  1ALI A;  4LRB A;  3BDH A;  2IFY A;  2GA3 A;  4LRF A;  5IJQ A;  3NVL A;  3NKO A;  3TX0 A;  2GSU A;  3M7V A;  4YR1 A;  3UO0 A;  1AJA A;  2QZU A;  4CYS A;  1URB A;  2W5R A;  5DLW A;  4LR7 A;  2W5T A;  1KHN A; 
#chains in the Genus database with same CATH topology
 2ZVI A;  2ROG A;  2HRU A;  1N52 B;  1GX5 A;  3CDB A;  3H2L A;  1Q53 A;  4UOO A;  1T03 B;  3MK2 A;  1PG5 B;  1WG4 A;  1BQX A;  5BYR A;  1QE1 A;  3HVT A;  3MUV P;  5TJ3 A;  1TKX A;  4IFY A;  4MIA A;  3X1L B;  2RSQ A;  3KMS A;  2POK A;  1N2L A;  2WBR A;  3MFH A;  5G0R A;  4IOA Q;  4YHH J;  1NRK A;  1HBO B;  4Y2I A;  2BBE A;  2AJ0 A;  5AJ3 J;  5J2P B;  3JAM U;  2V9K A;  1U45 A;  4RW9 B;  5F9L A;  2DB1 A;  5INH A;  3MXH P;  4ZVR B;  4IH7 A;  1RAD B;  1KR4 A;  3W8G A;  4ELU A;  2HQG A;  1TFW A;  2R7X A;  3NCQ A;  5GME A;  2O5D A;  2KT5 A;  4EZ9 A;  1TAU A;  2Z58 B;  1QAY A;  1B3T A;  4AYB D;  2QYC A;  2JFD A;  3IG1 B;  5IV4 A;  2YNH A;  4NWB A;  2MQ8 A;  3M8P A;  4CLF A;  4JI8 F;  5GAD I;  3KMQ A;  1JLQ B;  5HBM B;  1HFE L;  1VQS A;  1OYE A;  2V94 A;  4DX6 A;  4ER8 A;  2DGX A;  2M5Y A;  5D77 A;  1HNV A;  1HQ2 A;  1P27 B;  3LP2 A;  4N7T A;  2MY7 A;  4LF6 J;  1YJ9 S;  2Q66 A;  4X4P A;  2RKI B;  4IOB A;  3H98 A;  4ED3 A;  2KKH A;  1BQM A;  4Z37 A;  2J7W A;  1Y10 A;  1KQS R;  1XNR J;  3C6U B;  3RB6 A;  3D1Q A;  2DNN A;  2HNY A;  3D3C J;  2M3D A;  5CYQ B;  4RWX A;  2MQP A;  4CXU A;  3M1V A;  3K59 A;  1TAQ A;  1TUW A;  3CJK A;  4UTG A;  5CA5 A;  2VPX B;  2PI4 A;  1SUQ A;  4OI3 A;  1R0C B;  3KD8 A;  3ZTR A;  1RAI B;  4PUO B;  3F44 A;  3US5 A;  3WC2 A;  4TKT A;  3UDE A;  2QLW A;  4GKK J;  1NSP A;  2MYF A;  2W4C A;  2KM8 B;  2MMY A;  1F2G A;  3ET6 A;  2RU3 A;  3G6X A;  1C2P A;  2ILZ A;  1D1U A;  1ITP A;  1HWU A;  4RNM A;  4H4O A;  1RB0 A;  3OJU A;  2PFD A;  4DV1 F;  3NBP B;  4DLG A;  3HP6 A;  4DOZ A;  5KFC A;  2E7W A;  4WFN Q;  4OYW A;  2EEY A;  3HI9 A;  1AFI A;  2GMH A;  4M5H A;  4TQS A;  2RUG A;  2G4B A;  3MM7 B;  1NCL A;  2V2Z A;  3KDO A;  2Q43 A;  2R7O A;  1JXV A;  1WKJ A;  1REG X;  2V9W A;  5HMZ A;  1U24 A;  1U0S A;  2CJY B;  1M5V C;  2QGF B;  3I82 A;  1WF1 A;  5EX3 A;  2MJN A;  4WFB Q;  5F8L A;  3A8J A;  4JV2 A;  1VQK S;  2WVF A;  2E7V A;  3DYA B;  2ACM A;  1V3R A;  2R3V A;  4G1Q A;  3L7U A;  2PA3 A;  4HI2 A;  3SFU A;  3C46 A;  2QE5 A;  5DDR C;  4RUH A;  2UVW A;  1EKS A;  1LW0 A;  3H2V E;  4UST A;  4F26 A;  5K5M A;  1AJD A;  2OD6 A;  3CB4 A;  1JK9 B;  4DPO A;  2ZUA A;  3QBC A;  1VQ6 S;  3G2X A;  3PX4 A;  1JX4 A;  3DOK B;  3Q8R B;  4ERD A;  3R5D A;  1T02 A;  1P1L A;  3NWG A;  2H5I B;  1EQ0 A;  4OZ3 A;  2VZ9 A;  3MPW A;  1TL1 A;  3AJD A;  5F3Z A;  3VQS A;  1N0V C;  3UR0 A;  4IFV A;  1Y7P A;  2ZJR Q;  3PM9 A;  1QVG R;  1ZAW A;  4QCL A;  2HIY A;  1ZOT A;  2J0W A;  3R6L B;  1FD2 A;  4LF8 J;  1YJW S;  3G87 A;  2CPF A;  1S97 A;  4ZG6 A;  2XI2 A;  1KHJ A;  4OZL A;  2J8A A;  3CME S;  9RUB A;  4J9K A;  2MJU A;  2CPI A;  4DQP A;  1FJG F;  1O6X A;  1EJJ A;  2WK4 A;  1HDH A;  2GIF A;  3CD7 A;  2YQ0 A;  3WAW A;  2E5I A;  3R5G A;  4B3M J;  4ZPA A;  2B3T B;  2OEK A;  1MU2 B;  2E7X A;  1ALJ A;  1EW2 A;  2DXD A;  4A46 A;  2AYB A;  4LR2 A;  2K7K A;  3D6M B;  1D09 B;  1M1G A;  2BYC A;  3V6J A;  1P9Q C;  4NEY A;  2LA4 A;  1NK6 A;  4CM0 A;  2CZV C;  1X4G A;  5KT6 A;  4KO0 A;  5KFO A;  2BJ7 A;  4MKA A;  1MWY A;  2JZ5 A;  2D3O 1;  3KLE B;  4J9V A;  2CAD A;  1MW7 A;  1T03 A;  5F8H A;  1S0V A;  2W5S A;  4LSN B;  5HL7 Q;  4A47 A;  4EGL A;  2VU5 A;  2R8K A;  2X1B A;  4I67 A;  4X4R A;  3GFH A;  2FHJ D;  1WTB A;  1BC6 A;  1P1T A;  3B6B A;  2C2E A;  5J2P A;  5AXL A;  4RW9 A;  4K4U A;  4EO8 A;  4R0E A;  1FWL A;  3MMB A;  2RF2 B;  1EAY C;  2EKN A;  2RB7 A;  3M2R B;  3NNC A;  1UFW A;  1TKZ B;  4CH1 A;  4O4G B;  2V2Q A;  3RR7 A;  1JQG A;  2UU9 F;  1K0T A;  5KOX A;  3J7Z T;  2CQI A;  3IG1 A;  1FFG B;  2BAN B;  4FXD A;  4NYP A;  4ECS A;  2D3U A;  2HVE A;  1E1Z P;  1F5A A;  1D8Y A;  2W5Q A;  2YNI B;  4WPA A;  5HBM A;  1AZS B;  2RQC A;  1MSW D;  4WE1 B;  1U4B A;  2DNR A;  2JDJ A;  4UY8 5;  3DHW C;  1U1Q A;  3W65 A;  1WWH A;  5F9N A;  1RJJ A;  2HEK A;  2RKI A;  5CD4 H;  3HJV A;  2XQC A;  3NNH A;  3LH2 S;  2NQP A;  4ALZ A;  2OPR B;  4AT1 B;  3D66 A;  4MIW A;  1FDD A;  1NHK L;  3KK1 B;  3C6U A;  3AOB A;  4DUT A;  7FD1 A;  5KFB A;  5F0U A;  2MXY A;  1GFW B;  1RAO A;  5CYQ A;  1Q7Y T;  1PO6 A;  4C3M A;  1FJE B;  1FES A;  1KON A;  2KXH A;  5JMN A;  2FZC B;  3FGV A;  2ZJQ Q;  2VBX A;  1FF2 A;  5I42 B;  3R7N B;  5KFG A;  3C66 A;  2WSC C;  3D0G E;  4PUO A;  4DEZ A;  4HHJ A;  2ZNY A;  2MKK A;  3CF5 Q;  4DV3 F;  2YY3 A;  2VKZ G;  4UOG A;  1YRT A;  2F3J A;  2VIC A;  1RU1 A;  4UOC A;  3JS9 A;  1UA1 A;  1DZ5 A;  3UDC A;  2N4D A;  3LAN A;  4IQX A;  2ZH4 A;  2B4O A;  3UE2 A;  2ZZN A;  3OLA A;  1DQ8 A;  2GZO A;  2RHS B;  2Y0B B;  3NBP A;  3HHL D;  1N5T A;  4Y2C A;  4O3O A;  2XY6 A;  3DNC A;  1FCA A;  4EBC A;  4Z2X A;  3PCO B;  3CCL S;  3QFH A;  5KFR A;  4NPO A;  4MT1 A;  2CPD A;  4MIV A;  2IJN A;  4YHH F;  3DLG A;  2HBR B;  2I1R A;  1GK8 A;  4MMO A;  2YPZ A;  3AT1 B;  8RUC A;  1PKU A;  1PJ7 A;  3DGP B;  1DY3 A;  1FFW B;  3MAH A;  1HYS B;  1SCJ B;  3CDW A;  2NSB A;  1FXL A;  5AE2 A;  3B5Q A;  4OHX A;  1RT7 B;  3DYA A;  2J5A A;  2DHA A;  3IC1 A;  4JP8 A;  3TI0 A;  2IRY A;  4MKB A;  2GV1 A;  1FNM A;  4A8K A;  5HN0 A;  1XIQ A;  3IR5 B;  2OEM A;  4DI6 A;  4F4Y A;  3UD5 A;  3J7Y I;  4ES1 A;  2QSW A;  3S1T A;  1SJF A;  5DM7 Q;  3DU5 A;  1LNQ A;  2DGW A;  5B7W A;  3MEK A;  5IQ6 A;  2WSE C;  3DOK A;  3M9M B;  1S1T A;  4LF6 F;  4O0I A;  2DIS A;  1HNX J;  1X31 C;  1V9O A;  1FFS B;  1XNR F;  1AJA A;  4NOH A;  3QGI A;  2G13 A;  4ZVP B;  3T9N A;  3P8B B;  5CCL A;  4L6V 3;  2VQE J;  2EC2 A;  5I4M A;  4AL7 A;  1W7W A;  3L7O A;  4ZPC A;  3ENA A;  2AHO B;  1ELY A;  5KFM A;  2DR5 A;  3PY8 A;  5GAH I;  1Q81 T;  2M7S A;  3W5Y A;  4UOF A;  4EBD A;  2W7O A;  5C5J A;  1AXQ A;  1F6T A;  1UWB B;  2IM0 A;  4WF9 Q;  5IT9 Y;  4M5I A;  3RB0 A;  5I3U A;  2BQU A;  4GKK F;  3KUG A;  2GQQ A;  4R25 A;  2V2V A;  3BR8 A;  3LP1 A;  2XSF A;  1S6Q B;  3PO4 A;  3BZQ A;  2GMJ A;  2XWX A;  3O1L A;  2PA8 D;  1OY8 A;  1NJY A;  1MU2 A;  3MEC A;  1Q95 G;  2C2D A;  1KC8 T;  5D0E A;  1U2R A;  3W64 A;  2XBP A;  2WVC A;  2EKY A;  5KFY A;  3BH6 B;  4KJG A;  4ZG7 A;  4LR8 A;  5DLV A;  4DV7 J;  5KG7 A;  2EK1 A;  5ETL A;  1F9F A;  1U02 A;  4QW9 A;  2NPF A;  4BS2 A;  5GOV A;  1KTV A;  2C22 A;  1HI0 P;  3J81 U;  3PAC A;  2H51 B;  2HHP A;  3OHB A;  2E5L J;  4F04 B;  3HDS A;  3DOL B;  5HI7 A;  1RTI B;  2Z30 B;  2DR8 A;  2YKO A;  3TQ1 A;  2KJV A;  2PSZ A;  2V8H A;  4LSN A;  2DO4 A;  4LIW A;  5BYQ A;  2VJU A;  4AQY J;  2JEJ A;  4FKX A;  4FKY A;  4PQU B;  1JLA B;  1R8H A;  4CQ1 A;  2BKN A;  1YJU A;  3O8W A;  3AOA A;  5LRM A;  4C0H A;  4XPC A;  2AGP A;  3DLB A;  3FBF A;  2ALY B;  4PG6 A;  1OY6 A;  3GFX A;  4QR1 A;  1ZH5 A;  2RF2 A;  1S99 A;  1T9Y A;  4DWI A;  4A8Q A;  3M2R A;  1B0P A;  2QJ3 A;  3WAX A;  1TKZ A;  4ZG9 A;  1VQY A;  4I2Q B;  4LRD A;  2W5X A;  1QSY A;  3A8K A;  2XCP A;  2FYX A;  2BAN A;  4NXM J;  2YNI A;  4MH8 A;  1U1P A;  2IVF B;  3KKF A;  1HAR A;  1D0E A;  3IP0 A;  4WYW A;  1AZS A;  3ILO A;  4WE1 A;  3TW0 A;  2LXI A;  4F3M A;  4ECY A;  3A8I A;  5E33 A;  4LF8 F;  4O44 B;  1JIH A;  1CUL B;  3OXL A;  2VUG A;  2DNQ A;  3DXS X;  4ZCI A;  2DNM A;  4CLU A;  1IBK J;  1K44 A;  2FHK A;  3HZG A;  2OEL A;  4QIW D;  4NZ7 A;  1SI9 A;  1RWK B;  2A3J A;  4HAC B;  5LJ3 Y;  2R7U A;  2N7C A;  3B54 A;  2QRR A;  4B3M F;  1X0P A;  4DSL A;  1S5Z A;  3OTO J;  3EGN A;  1RT4 B;  2ASY A;  1T94 A;  1XK8 A;  4DPY A;  2HPU A;  1QUP A;  2BR0 A;  2MQQ A;  5K4P A;  1KS2 A;  2HK2 A;  1WOR A;  4OZN A;  4ANE A;  3RU0 A;  4DUY J;  1YBU A;  3VAL A;  4YB1 P;  3Q8U A;  3UNY A;  1TVR A;  2CQ4 A;  2K8G A;  2HFV A;  1ZTT A;  1TMJ A;  4FVM A;  2XS5 A;  1ZAV A;  2BVZ A;  3HF5 A;  5C24 A;  4B3O B;  3E51 A;  2YWK A;  4YOE A;  2RU9 A;  1IM4 A;  1C1B B;  4DR5 J;  5IJQ A;  2BAB A;  1R8C A;  4DF4 A;  2KHD A;  2W9B A;  1WEY A;  5AE3 A;  3GYG A;  3EUN A;  4L76 A;  5T7L B;  4TY9 A;  3EYZ A;  3DGP A;  1HYS A;  2DIT A;  3OFF A;  3QRP A;  1X5O A;  2V2K A;  1FDN A;  3K57 A;  2HYI B;  3FEZ A;  1XER A;  5A2Q Y;  4DDF A;  1HPZ A;  2M2B A;  1URN A;  2E9R X;  3IWL A;  1RT5 A;  3PJ9 A;  4PYD A;  2AJ4 A;  2XNR A;  2C3Y A;  4EZ6 A;  2CQ1 A;  4OYM A;  1S76 D;  2BQR A;  4KAI A;  4I4B A;  1XWL A;  2LA6 A;  1K73 T;  1ELZ A;  2OD4 A;  3JXO A;  2IM2 A;  5CAB A;  1GH8 A;  1O98 A;  2HHT A;  4G65 A;  1O0P A;  2AYG A;  4ZPB A;  1UEK A;  5L0K A;  2CRL A;  1BQN A;  5D0H A;  2EBE A;  4LF4 J;  1ZEF A;  5A8K B;  4PCQ A;  4DQS A;  2DBB A;  4ZP6 A;  3J81 j;  3FNN A;  2J7K A;  3OSN A;  1QDU B;  2F63 A;  2NLW A;  3VGS A;  5JXS A;  4QPX A;  4GC6 A;  3AB4 B;  1FER A;  4FNI A;  4U67 Q;  3T19 A;  2KFY A;  1EI6 A;  4UF4 A;  5DQG A;  2V8P A;  4O3Q A;  1UWB A;  4CXS A;  1RBO B;  4N47 A;  3F0N A;  2Z2Z A;  2A2C A;  1TL3 A;  2LQB A;  3N6M A;  5IT4 A;  2P9C A;  2F9D A;  3QLH B;  1WC3 A;  4DUZ J;  5D3G B;  1S6Q A;  5HP1 A;  3AXM A;  3DRX A;  3NAI A;  3BO4 A;  4KC5 A;  1S1X B;  4Y65 A;  4JI7 J;  3BDP A;  1SKS A;  1NH8 A;  4URG A;  2P6S A;  4CT8 A;  1S7H A;  1HNI B;  2VPW B;  1RTJ B;  3TAQ A;  1K9M T;  4OJG A;  3MWB A;  3WQP A;  3N5B A;  3QSY B;  4O4R A;  4PPZ A;  4LR9 A;  3D6T B;  4OZ1 A;  5K8O A;  3VWS A;  4EEY A;  3AOD A;  4ED0 A;  3BQ2 A;  1H2U X;  5EDW A;  2HFO A;  2UXB J;  2ACY A;  1WUU A;  1KRP A;  1NUE A;  3TRG A;  3U02 A;  4ZMM A;  1MML A;  2V0N A;  5CCM A;  5DGB A;  1X5P A;  3Q86 A;  1MG7 A;  4G6V B;  4PWD B;  4PQU A;  4KY3 A;  2W8D A;  2OI2 A;  1WOS A;  4X4S A;  2AZ1 A;  3BSA A;  4B56 A;  2BAC A;  2AQ4 A;  1Y11 A;  2Z0G A;  2DHG A;  4DPT A;  5E3Q A;  4L74 A;  1UVI A;  3D9B A;  1WC0 A;  2CJ9 A;  3CD0 A;  5F41 A;  1CBK A;  2FHM A;  3KLG A;  1VQ8 S;  1NND A;  1PGZ A;  2FJA B;  2FJX A;  1VRT A;  4R5P B;  4I2Q A;  3QGH A;  4MJK A;  4E0D A;  3CMA S;  1HNX F;  4ZN1 A;  3J80 U;  2CDQ A;  1CS4 A;  2JC1 A;  2HAI A;  1DRZ A;  1T0T V;  1V3Z A;  2QL5 B;  5KTQ A;  2KDO A;  5BYS A;  3I5C A;  3CJQ A;  3IBF B;  2VQE F;  1SV5 B;  4B9U A;  1U2F A;  4USW A;  1I6J A;  4U7C A;  2K06 A;  4C11 B;  3F73 A;  4USM A;  3DLL Q;  4O44 A;  5HJX A;  4K7Q A;  2DRB A;  3ISN C;  1CUL A;  3W8P A;  2HQF A;  4UPK A;  3R8Y A;  5KXA A;  3DDI A;  1PC4 A;  2BE7 D;  3N9U C;  2I6W A;  1RQ0 A;  4HAC A;  1UJ5 A;  2MZT A;  4Y28 C;  2C1E B;  2JEI A;  1HW8 A;  4ZKA A;  4KGZ B;  4DSK A;  3GV5 B;  2CG8 A;  5DG7 A;  1WG5 A;  1NU4 A;  1RT4 A;  1JJ2 R;  1GNK A;  1NPP A;  1QAJ A;  3HSJ A;  1FEH A;  4FDJ A;  1KH5 A;  4NLR A;  4DV7 F;  4X4O A;  1HR0 J;  2XR9 A;  3NKP A;  4MK7 A;  3PVX A;  3CO9 A;  2SXL A;  3C2P A;  2IM1 A;  1LWX A;  4YB6 A;  4WJB A;  4EYI B;  2R8H A;  2E5L F;  1U1R A;  2ATC B;  2EG1 A;  3Q2S C;  2ZE2 A;  4ILR A;  3M8W A;  5ETP A;  2ZH5 A;  1SC4 B;  4B3O A;  4DG1 A;  3MEE B;  4AQY F;  3OTD A;  2E5H A;  4QR2 A;  2KXF A;  4KIA A;  3BGR B;  1P6T A;  4MYU A;  4C97 A;  4CO1 A;  4B17 A;  3P96 A;  4C6A A;  2VAS A;  2BW7 A;  1NZA A;  5T7L A;  2B8P A;  3CVK A;  2BUN A;  5KG1 A;  4DR7 F;  3KHH A;  3KJV B;  4O3N A;  2HWT A;  5EWF A;  1T8E A;  3A13 A;  3MM6 B;  3CJ3 A;  2KYX A;  2PE8 A;  5KG6 A;  1QVF R;  1H3D A;  1VK8 A;  1IM6 A;  4NXM F;  2F4F A;  4C8O A;  4GVL A;  3QT7 A;  5A6W A;  2PFF B;  2LXU A;  4WKR A;  4P7V A;  1HI8 A;  2KM8 C;  3VCD A;  4ZJO A;  5J2N B;  2KJW A;  2MST A;  2CWK A;  3H42 A;  2YQ1 A;  2K1R A;  1U8W A;  3BEG B;  3MPD A;  3QT6 A;  3G6Y A;  1TKD A;  3PRV A;  1HI1 A;  2CPX A;  1VBZ A;  1CC7 A;  2YX4 A;  4QZV B;  1IBK F;  1YK9 A;  1U1M A;  3FRY A;  3OQ2 A;  5E3C A;  3ETO A;  3FVY A;  3U1M A;  3OTO F;  3AD9 C;  4QQB A;  4ZDN A;  3Q0A A;  2QMX A;  1EW9 A;  4P2S A;  3CE8 A;  1AYE A;  1S0O A;  1M1K T;  2LFV A;  3CIM A;  4DUY F;  3QLH A;  4L3N A;  3MR7 A;  5D3G A;  3TJA A;  1TKT A;  2W1B A;  2HVH A;  5KFF A;  2AJQ A;  3G82 B;  2W5W A;  4QWE A;  4FNH A;  4PG4 A;  5KG2 A;  2UUW A;  4ZPW R;  4DR5 F;  3LAK A;  4NLU A;  4GTY A;  1S49 A;  3T6B A;  1CG2 A;  4U8Y A;  2ZVS A;  1JWW A;  2PEH A;  2XEX A;  2JWN A;  5I3P A;  1RCO B;  4N77 A;  3MFI A;  1SXL A;  2HVI A;  1FK9 A;  1SC6 A;  1YX2 A;  3RW7 A;  3LO3 A;  2BE9 B;  2ZBR A;  1FI4 A;  1ZZN A;  1X8D A;  3W62 A;  5KT4 A;  1ZYQ A;  1YHQ S;  3MTJ A;  4M1K A;  4Z7C A;  4CLT A;  4CH7 A;  3Q23 A;  4PWD A;  4QYZ J;  1M5K C;  4DL6 A;  4B3S J;  5F8J A;  3FSI A;  4OJH A;  5L8R C;  4ECV A;  3NNA A;  3MGJ A;  5KFD A;  3VF0 B;  3RBE A;  3SDE B;  1FXD A;  3IWN C;  4KSE B;  4W92 B;  1NK7 A;  1JLB B;  1UFL A;  4WZQ A;  1R89 A;  4ECR A;  2LKZ A;  3OR1 B;  2CQB A;  1FE0 A;  1SIW B;  4KRW A;  2FVQ A;  4R5P A;  6FDR A;  1IR2 A;  1X9M A;  4LF4 F;  2DRD A;  3T1A A;  2GVZ B;  1OQ3 A;  1FT8 A;  1RTD B;  1VQ9 S;  1OSC A;  2EBG A;  2W8S A;  1WTF A;  1H98 A;  3NKM A;  2WSF C;  3P5T L;  4PXD A;  4DFK A;  4C11 A;  2JRS A;  3BGF A;  3RG6 A;  4QIE A;  5IM0 B;  1FA0 A;  3LQV A;  1RT3 B;  2IA0 A;  5GAE I;  2AF6 A;  1VBX A;  1ZEB A;  1N33 J;  1CJK B;  4K0K J;  2CIM A;  1PJ5 A;  3W66 A;  3IDD A;  2IY5 B;  1VIS A;  1GQE A;  3KK2 B;  4OI4 A;  1RKI A;  4DUZ F;  2A6M A;  1KH7 A;  4C7Q A;  1PIE A;  1RAB B;  1NM2 A;  2BXJ A;  2IVY A;  1T9V A;  2FJD B;  1QSL A;  3GFZ A;  2XI3 A;  1Z2L A;  3IN5 A;  2W9C A;  2ZWO A;  4JI7 F;  2J0X A;  1Q8K A;  5K8N A;  5LOQ A;  3I87 A;  1BE4 A;  3MCS A;  3S8S A;  3DM2 A;  3ZZR A;  3DN9 A;  1UAW A;  2DKO B;  1S1W B;  3OD2 A;  2ZDP A;  3SZZ A;  4URS A;  4M94 A;  4KE5 A;  4UOR A;  2J0Q D;  4NCG A;  3PXG a;  3L09 A;  2UXB F;  4NML A;  1WDD A;  2DHH A;  4DF8 A;  1S79 A;  3H59 A;  5KFS A;  2HLT A;  5LL6 d;  3MF5 A;  5IV3 A;  3MD3 A;  4JV1 A;  1FX4 A;  3MEE A;  4ED7 A;  3GIL A;  1J5O B;  1AA1 B;  1YIJ S;  3KLI A;  5KFV A;  3RYL A;  3RBD A;  5E3A A;  2OGU A;  1RT6 B;  4ECW A;  1TK8 A;  3Q83 A;  5DG8 A;  4QU7 A;  2Y1R I;  2W01 A;  4FF4 A;  1AT1 B;  1NPK A;  4M5G A;  3ONQ A;  3D3B J;  2IIH A;  3PW0 A;  5J2Q B;  1MWQ A;  3D4J A;  1KHL A;  4OLP A;  2W25 A;  5DLT A;  1NDC A;  3KJF B;  3PRD A;  3OFE A;  2WHO A;  3OTC A;  1TL5 A;  1B0T A;  5D15 A;  3AXK A;  3E3X A;  1IJE B;  1IBM F;  2MKH A;  2R8I A;  1NLK L;  2D41 A;  3KJQ B;  3TO8 A;  5D4O A;  2LQ5 A;  3W9H A;  3UDL A;  2J7U A;  4H4K A;  3RB3 A;  5J2N A;  3LOU A;  2XB2 D;  1SC3 B;  2RNE A;  3HHE A;  4OX8 A;  2CVI A;  3S01 A;  2IBO A;  2QIF A;  4YS2 A;  3MZI A;  1ALK A;  2W9A A;  3NAH A;  2DEJ A;  1VRU B;  3FCV A;  5KT3 A;  1WAC A;  3QJL A;  2MKY A;  1EJ7 L;  2UV8 G;  2RH3 A;  3Q8V A;  4W4M A;  1OO0 B;  2Z2L A;  3UO0 A;  5F0W A;  1R8B A;  1I5O B;  3EDR B;  2RDJ A;  3K58 A;  3MUT P;  1VQM S;  3OPK A;  2HRT A;  1VIO A;  2ASJ A;  4DSI A;  4C4W A;  1HR0 F;  2N3O A;  5FLX U;  3KK3 B;  3HHN B;  3GYX B;  3H4D A;  4LRC A;  2OPQ B;  4IRC A;  2FHO B;  3CCZ A;  5LXR A;  4RUC A;  4B9M A;  2D69 A;  5K20 B;  4DXL A;  4Y2K A;  1WI8 A;  3GSI A;  5B0F A;  2FGC A;  1HNZ J;  3QID A;  1GMW D;  2X51 A;  2RJZ A;  2YKN B;  4JOU A;  2QFI A;  3VVU A;  3Q8S B;  4F0K A;  1FRI A;  3J7A N;  1U1L A;  3T9Z A;  2G2O A;  3J7A 1;  2A10 A;  3M2V B;  1YRX A;  4GO5 X;  1VYA A;  1PIL A;  3WIV A;  4XAK A;  5JUM A;  1HKA A;  4USV A;  2VHG A;  4OYB A;  1EQJ A;  5DDP C;  2E9T A;  1DQ9 A;  2AJF E;  1EET A;  1K7H A;  2KVQ E;  1HQE B;  3CJ0 A;  4B3T J;  2H54 B;  4ZA1 A;  4UPL A;  4Q5V A;  3PR5 B;  5DZ6 A;  2ZOF A;  2VD3 A;  4LF2 A;  1U6F A;  2XYP B;  4OFZ A;  3OR1 A;  1ANI A;  4DPW A;  1GMU A;  3BSC A;  3O3L A;  3GPA A;  3IS9 B;  5B0E A;  2GVZ A;  3T5H A;  1U25 A;  5A0Y B;  4LSZ B;  1VHI A;  1FD8 A;  1ZA1 B;  2D1G A;  1RTD A;  4DX7 A;  1Y7A A;  3MK0 A;  2KO1 A;  4Q43 A;  2RS2 A;  4CLL A;  3KNG A;  4PAB A;  3B4D A;  2DNP A;  1JXL A;  3B82 A;  5K8M A;  1D9A A;  1B99 A;  1RT3 A;  1UMJ A;  2IFY A;  4QWA A;  1T9X A;  3QFW A;  5DLW A;  3VV2 B;  1C1C B;  4TY8 B;  2DIU A;  2KXN B;  1A7G E;  2YTC A;  4JUZ A;  1Q16 B;  4OZ2 A;  1ROF A;  5AT1 B;  1SJ4 P;  3OL6 A;  1R0A B;  3PR4 A;  3VTI A;  1M90 T;  4LF1 A;  2H9Z A;  5DJB A;  4KFB B;  2XZW A;  2IUC B;  2YBV A;  3LP0 B;  5DQI A;  2HK3 A;  2OTJ S;  2ZH7 A;  2RQ4 A;  2LCW A;  2YKP A;  3TVZ A;  4XPE A;  3IBW A;  4AL6 A;  4HTI A;  1ELX A;  5DDO C;  1T11 A;  3CCE S;  2WAQ D;  3ZTQ A;  1S1W A;  2E5J A;  4DV0 J;  2BJ8 A;  5KT7 A;  4Q8E A;  1S9F A;  2UUB F;  4DR4 J;  1WJ9 A;  4ZIV A;  1FKO A;  4CLP A;  1PYO B;  1RSC A;  2CQH A;  3VAG A;  1SIZ A;  1WC6 A;  4PAA A;  2CJQ A;  5KFK A;  3UD3 P;  5ETQ A;  4YDD B;  1J5O A;  4P2F A;  2AGQ A;  4B3S F;  4NL5 A;  4RUB A;  2IAJ B;  2WOM B;  3H5S A;  4J9R A;  3OT9 A;  4F25 A;  2XY7 A;  1U8S A;  4KGV B;  1ZZF A;  4Q0B B;  1H7X A;  2FUG 9;  4ZVF A;  1H0H B;  1RYS A;  2DCL A;  4RLE A;  4CZC A;  4N56 A;  1FWK A;  2IRX A;  5J2Q A;  3HVA A;  5DLF A;  3Q22 A;  4C8Y A;  4EBE A;  4MFB B;  3I96 A;  1S57 A;  3ICL A;  4AUK A;  3KUH A;  4RL1 A;  3GCW P;  1V3S A;  4BLG A;  3CJ5 A;  4UOH A;  4R0J A;  2BKO A;  2OSQ A;  3PFE A;  3HLU A;  2NRE A;  3KUE A;  1TQL A;  3FZ2 A;  4IO1 A;  1IXK A;  1WF2 A;  2GW8 A;  1SH2 A;  2ZIT A;  2AJ1 A;  1UTA A;  4ECX A;  4NCB A;  4Y6I A;  4AD6 A;  3WZ0 A;  1VC6 A;  1RKJ A;  4QYZ K;  1UWA A;  4WU2 A;  2CNO B;  1WNE A;  3IM9 A;  1YDL A;  5LMN F;  3KHL A;  4J37 A;  4NYZ A;  1ZPV A;  3UI3 A;  3LWL A;  1N33 F;  3CCM S;  4K0K F;  1VRU A;  1KVJ A;  1FKP B;  4ZLP A;  2H3E B;  1U47 A;  5KT5 A;  3I0R B;  4DL2 A;  2GO9 A;  1E6V A;  3SFG A;  2CVE A;  1UJ4 A;  1UET A;  2V4J B;  1RHR B;  3CC4 S;  1V6H A;  1YJT A;  4OI2 A;  2LU1 A;  2AEM A;  2Y8W A;  2RQK A;  4JB8 B;  4UOP A;  1S6P B;  4KYZ A;  4HEA 9;  3R6G B;  5KG3 A;  4UW2 A;  1DJ0 A;  4PPD A;  5M2R A;  2CPZ A;  2RT3 A;  3KNA A;  3NKN A;  1N56 A;  3HVW A;  2OJ3 A;  2QZ8 A;  2IMW P;  3UWT A;  1FRX A;  3I55 S;  3ED4 A;  4ITS A;  5CH7 B;  3CCV S;  2HG4 A;  4NLX A;  3RJM B;  2OPQ A;  2FTR A;  2FY1 A;  1M0S A;  1CQM A;  1JJC B;  5KFQ A;  3D28 A;  2YKQ A;  3QT5 A;  4NLO A;  5LJ5 Y;  2W2Q P;  5HJY A;  2DGU A;  4ZP8 A;  5DLG A;  3TA1 A;  2C2N A;  4DPU A;  4N41 A;  1LW2 A;  3RBZ A;  2W8L A;  3FEX B;  1TUG B;  1HNW J;  4CT9 A;  3GFY A;  4WP3 A;  3GIK A;  2N4C A;  3DU6 A;  5B0D A;  2YKN A;  2E1A A;  2OPP B;  2OFG X;  4LT6 A;  4TU8 A;  3LXQ A;  3AB2 B;  1A6L A;  2E44 A;  2FJV A;  5L0B A;  1NB2 A;  1UPP A;  3M2V A;  5HRO B;  4ZLN A;  1XR7 A;  3PYE A;  4G1P A;  2QG9 B;  2UVR A;  4DSJ A;  1PC5 A;  2W2M P;  1DBD A;  3BBF A;  5IXU A;  1HLW A;  2XNQ A;  2ZEJ A;  2DIV A;  3JYT A;  1HQE A;  2R7R A;  3VGT A;  3EE3 A;  3RZA A;  1OWX A;  4DR3 J;  3NG8 A;  1UW4 A;  1UW9 A;  2YPY A;  1FVQ A;  4WFY A;  8ATC B;  5ITH A;  2ADB A;  3CCU S;  1NBE B;  1F3F A;  3IS9 A;  6FD1 A;  4I2P B;  3HFK A;  2Y9H A;  2MQN A;  3EJM A;  1SKU B;  3VAK A;  3BKU A;  2CPJ A;  3A8E A;  2D9O A;  2WB1 D;  3OVB A;  3NS6 A;  4B9N A;  3FUY A;  2RS8 A;  3WX8 A;  2JHE A;  2B7B B;  2FGO A;  2XMM A;  3O6Q A;  1VCT A;  2MPU A;  3IA0 A;  2X1F A;  1FX2 A;  3GJR B;  2ZJP Q;  1NKE A;  3CW2 C;  4B9T A;  3KLH B;  3DCA A;  4YY3 J;  5D6G A;  1C1C A;  4TY8 A;  1LWC B;  3JTN A;  2QZU A;  2C42 A;  3TOQ A;  2VDI A;  5L9N A;  4B9L A;  4DHV A;  4X4V A;  2ASD A;  3R27 A;  2R2T A;  3V4I A;  2F40 A;  1MMN A;  3PW5 A;  3BH7 B;  4KFB A;  2IUC A;  1NK0 A;  3LP0 A;  3PHE A;  4RW7 B;  4F2R A;  1TUV A;  1SC1 B;  3SZ2 A;  3QQC D;  1G4C A;  2LQ8 A;  2AEF A;  3T1H J;  3UDV A;  1HNZ F;  1RWV B;  3CDA A;  2W4D A;  2WRM A;  5A8R B;  2J6T A;  3GU0 A;  1U48 A;  2Q6B A;  1ZED A;  2MLZ A;  4KQZ A;  5KG4 A;  3F41 A;  4F4X A;  1NKB A;  3MHY A;  2JC0 A;  4JV0 A;  1DFD A;  1H2T Z;  1YBA A;  2ZUG A;  4CWB A;  3Q8P B;  1LXN A;  3QZ8 A;  2DEI A;  4NAS A;  4R8U B;  3T01 A;  3J7Z 5;  3HHL C;  3JSR A;  3LPE A;  2RRB A;  1JKH A;  2WOM A;  4DS5 A;  3WAV A;  2HZV A;  2QMU B;  1OPZ A;  3THV A;  2I5J B;  4OYZ A;  3EX7 B;  2DT9 A;  1NDK A;  4Q0B A;  4B9V A;  5JVG Q;  3ZTO A;  4B3T F;  4CRJ A;  3NVL A;  2FVC A;  4GO7 X;  3MR2 A;  1CSJ A;  4YB5 A;  4Y0F A;  1J2V A;  1F0X A;  4Z7Y A;  3VZH A;  3DRP B;  1WOO A;  2IDL A;  1S1V A;  2RD5 C;  2KHC A;  3CED A;  4MFB A;  3I5A A;  4DQI A;  2LMI A;  2DH9 A;  1UVN A;  3HT3 A;  2MLY A;  1UKU A;  1LWF B;  4IOC Q;  3DDN A;  3RUB L;  2QN6 B;  3HVR A;  3G6E S;  4K2J A;  3M8Y A;  2DNK A;  1VBK A;  3H8Y A;  2XSJ A;  3C15 B;  4ZPV R;  1FRH A;  2B43 A;  2MDA A;  1P8G A;  1F9H A;  3V81 B;  1EP4 B;  1F5C A;  2HW3 A;  1RWO B;  3RGI A;  2VFS A;  1KLM B;  5ETR A;  1NK5 A;  3UFC X;  2YH1 A;  3TUP A;  3DMJ B;  2P9G A;  2P9E A;  3HFZ B;  4I6Y A;  1S12 A;  3GJS B;  2KH9 A;  1SL2 A;  3K2Y A;  3I0R A;  4LQ9 A;  2YWH A;  5EX0 A;  3HHD A;  1SL1 A;  3M32 B;  2LP4 A;  3BQ1 A;  2FVR A;  5D0G A;  4DR6 F;  2V4J A;  5ETN A;  4LRB A;  1FTC A;  4PWW A;  5KFP A;  3NMA A;  4H4M B;  4HTJ A;  2R8G A;  1S6P A;  3GQC A;  2DO0 A;  3LGN A;  2AKW B;  3K5N A;  1Y3J A;  3BDG B;  2QA4 G;  4DV0 F;  4J91 A;  3WDO A;  2KFN A;  2V5H G;  5DDQ C;  2NXU A;  3GZ7 A;  4DR4 F;  2AZ3 A;  1BWV A;  2E1C A;  4OIX A;  5J2M B;  1UJ6 A;  3S6E A;  3RB4 A;  1IBL F;  5L1L A;  2NS1 B;  4KJD A;  2IC3 A;  4H4K C;  1RU2 A;  4JI4 J;  2OHD A;  4A8S A;  5HK4 A;  3SCL E;  4RW4 B;  3E2D A;  3KXD A;  2GJI A;  2XS2 A;  2ZH6 A;  1X0F A;  3CT9 A;  3NKQ A;  1QY7 A;  3SSS A;  2FZG B;  3HKW A;  2LU2 A;  3LGH A;  1QLN A;  2V8G A;  2OPP A;  3UVJ A;  4CO0 A;  2P2C B;  3M8R A;  3H90 A;  4KAV A;  3W1Y C;  1SVD A;  1KHV A;  1M5S A;  1JB0 C;  5G4D A;  3I5B A;  5HMW A;  1HWK A;  2GA3 A;  4PYA A;  1BLU A;  4OLO A;  3GB0 A;  3DI6 A;  3M7V A;  2EFO A;  2UXD J;  2MHE A;  3OL8 A;  3BPD A;  3FJ2 A;  5L46 A;  5IQQ A;  1WEL A;  3PG9 A;  3POT B;  3P6Y C;  3ETM A;  4A48 A;  2YWF A;  1S9G B;  4ZOS A;  2RVJ A;  2EK6 A;  4E2F B;  1DHM A;  3W7B A;  1KFD A;  4A8M P;  4ILL A;  4YR3 A;  4ECU A;  5C42 A;  2BZ2 A;  1ZAX A;  4I2P A;  4TU9 A;  1FNX H;  3O2I A;  3CTR A;  2V4Q A;  2RE1 A;  1WKL A;  3Q8Q B;  2XHW A;  2G2Y A;  2HQ3 A;  4GMK A;  3V6D B;  3SZY A;  1UZH A;  3CMQ A;  2VG6 A;  4RKU C;  4DS4 A;  4FVC A;  2OSR A;  3MEG A;  3W2V A;  4CO5 A;  2MGZ B;  3KG0 A;  4IG0 A;  3D7S B;  4PKD B;  5HQL A;  3NEK A;  5ETT A;  2HHU A;  3ISZ A;  1Q8I A;  5CD4 A;  3KLH A;  2JH3 A;  3PFO A;  3NP5 A;  2Q3P A;  5C25 A;  2PO4 A;  3ZZT A;  1ALI A;  2KYZ A;  2B5J B;  3M4X A;  4CCH A;  1W25 A;  1SJ1 A;  4DN9 A;  5HRT A;  3JQK A;  3E2E A;  1N32 F;  1I1G A;  2O67 A;  4CLZ A;  1ZPW X;  1QSS A;  3G8T A;  5B0C A;  5LSO A;  2B9W A;  4FPR A;  3MR3 A;  1QAI A;  4F0M A;  4JI6 J;  3GIJ A;  1RAJ A;  2RIL A;  4J9N A;  4OI0 A;  5F8G A;  3DDK A;  4A8F A;  2LEB A;  4FYV B;  5L9X A;  3CUL A;  4M5N A;  3WAY A;  3PKY A;  1HNW F;  2OUG A;  2N3L A;  1ARO P;  1EZZ B;  3KG1 A;  1W2B R;  4TLQ A;  1JNR B;  1N36 J;  3QMQ A;  3MM5 B;  2ZD1 B;  2NYH A;  2EFG A;  3W9J A;  3SSQ A;  4WXO A;  4I6A A;  4NRT A;  4KGX B;  4R8U A;  2JVO A;  1RHU B;  3CUN A;  2B4P A;  1RAF B;  4C8K A;  3TP2 A;  2ZH3 A;  1U49 A;  5CXT A;  2I5J A;  3T6J A;  2AD9 A;  4ID5 A;  2MY8 A;  1QUV A;  4DX5 A;  2Z57 B;  4FN5 A;  1TFY A;  2HMI B;  2QLB B;  2CQP A;  1VQ7 S;  3TAP A;  3PW2 A;  4DR3 F;  2E66 A;  4FXV A;  3DRP A;  3QPI A;  4KAY A;  2DNY A;  5DO2 A;  3NGD A;  2E9Z A;  5E5N A;  2G9Y A;  1RP5 A;  5GAG U;  2XM3 A;  1F9E B;  1LWF A;  2ILY A;  2KU7 A;  4X62 J;  2LQJ A;  5IFM A;  3N4W A;  2WON A;  1YBT A;  3TG0 A;  4C3L A;  3C15 A;  2ZKU A;  2B6A A;  5FII A;  4X4U A;  1X4B A;  3A52 A;  3T5K A;  4TXS A;  2U1A A;  3RRK A;  2V67 A;  1Q79 A;  1EP4 A;  2MLX A;  2R8J A;  3ISN D;  2M8D B;  4HVZ A;  1RDR A;  1KLM A;  4TYA A;  1FWP A;  4WK3 A;  3DMJ A;  2BJE A;  2FZK B;  2XG8 A;  4YY3 F;  3JQJ A;  1HHT P;  2OAU A;  3N6L A;  1YJN S;  1RT1 B;  1IKY B;  3BKF A;  3ENW A;  3SCI E;  2FLN A;  4NE9 C;  2YX7 A;  1FRM A;  1DLO B;  4H4M A;  3UPF A;  2XMU A;  2CQC A;  2W5R A;  1RWP B;  4U96 A;  1X7V A;  2R2S A;  3BR9 A;  5ADZ A;  3T1H F;  1RAA B;  1FRJ A;  1U7L A;  1HBO A;  4ETZ A;  3KTQ A;  2L9D A;  2Q1L A;  4P2M A;  3MMC B;  3OTB A;  2RIJ A;  4ZN3 A;  1WOP A;  1R43 A;  1OPI A;  1IQZ A;  3R5C A;  1GXU A;  1T7P A;  1FEE A;  3AOC A;  3B4M A;  1NPR A;  4KV8 B;  5A76 A;  4RW4 A;  4DR1 J;  2R4F A;  2QV6 A;  3TUJ C;  4Q44 A;  2MB0 B;  4LRA A;  1JLQ A;  3D54 A;  4M5L A;  4ZGA A;  4TNO A;  1I51 B;  2CYY A;  1TZ0 A;  2XZD B;  2CQ3 A;  3I4H X;  2NXE A;  3DKD A;  3D0H E;  3HD1 A;  1TV6 B;  2IPO B;  4RW8 B;  3M05 A;  2P8I A;  1ZET A;  5L1J A;  4JI3 J;  1KN6 A;  1RTZ A;  3A3N B;  4I56 A;  1XC9 A;  2GSO A;  3GYN A;  2YWG A;  1S9G A;  3DRY A;  4AL5 A;  4ZVG A;  3PO5 A;  1NJW A;  1QM9 A;  3VAF A;  5I3Q A;  1YJR A;  1HQU B;  1O51 A;  3KDN A;  3QRR A;  3EM1 A;  4OV6 A;  3W2W B;  2QEX S;  2XO7 A;  3GON A;  2A18 A;  4HL9 A;  3BO2 A;  3TWZ A;  2X3D A;  1K1Q A;  5L39 A;  4K5S A;  4RU9 A;  4O3P A;  2CAJ A;  2VFU A;  2R9L A;  5KFW A;  3KHR A;  1ZM2 A;  4K2X A;  4LJM A;  4C2M A;  2MGZ A;  1OYD A;  3H25 A;  5HAO A;  1ICE B;  4EI2 A;  2YKM B;  1L3K A;  2B5J A;  5AJ3 F;  3MM7 A;  4C98 A;  2MSS A;  2AWZ A;  1JLF B;  1JNZ B;  5SUH A;  3OJS A;  1URB A;  2ZBP A;  3JSY A;  2O01 C;  2BJ9 A;  3C6T B;  4EFA C;  3ZC4 A;  1C4C A;  3E01 B;  4ZHR B;  4RU2 A;  5D8H B;  4JI4 F;  4K4X A;  5LMU J;  3R97 A;  1MRO B;  4P75 A;  3H5Y A;  4PQA A;  4K4S A;  3VGV A;  4WWS A;  4J7C A;  5IZH A;  1N34 J;  5E3R A;  2P6T A;  5L38 A;  5ETK A;  4V19 X;  3QWP A;  2ZD1 A;  2NR0 A;  2AIR B;  1VJQ A;  3HVT B;  2DVI A;  1TKX B;  5CQG A;  2VFT A;  1I94 J;  2BE2 B;  4MK9 A;  2HHV A;  3HZE A;  4DCP B;  2ZH2 A;  2VJV A;  2ZOG A;  5SZT A;  2M88 A;  2XO6 A;  2DH7 A;  1OMS A;  1RWW B;  1ED8 A;  4V19 J;  4WU3 A;  1YG0 A;  1NH7 A;  2DR7 A;  2OPS B;  4LF7 J;  2WW4 A;  2GCF A;  1SH3 A;  4QWC A;  2FJW A;  1KD1 T;  4HI1 A;  1YSJ A;  3U1N A;  4U8V A;  2HVZ A;  2BRL A;  1CVJ A;  2RQM A;  1XTZ A;  2H4W B;  3MAA B;  2WCX A;  3JAM Y;  2YNH B;  2NXJ A;  3M8P B;  5C66 A;  1F2H A;  4LF5 J;  5DM6 Q;  1WHV A;  4F4K A;  3PTW A;  2A2D A;  3BJY A;  2KFZ A;  4QIF A;  3VZI A;  3W9I A;  1RHK B;  3LP2 B;  1Y6V A;  2CA9 A;  3GCX P;  3Q89 A;  3TUZ C;  2L3M A;  4YN3 B;  2JL9 A;  4FYD A;  4JI0 J;  5A6P A;  1RT1 A;  1VBY A;  1VI7 A;  4LF9 J;  4DL3 A;  1FTR A;  3WBZ A;  3EMT A;  5GVQ A;  3ILI A;  2B0G A;  1EB0 A;  2C2O B;  3KLE A;  2VDH A;  2KN4 A;  3BKT A;  3CJK B;  3V2U C;  5AJ9 A;  5GRR A;  3FSX A;  1WKK A;  2PDA A;  3GJQ B;  3MR5 A;  3I32 A;  4JI6 F;  2AEJ A;  4J9O A;  1U2C A;  1U1N A;  3MTK A;  4AFF A;  2K3I A;  3BN4 A;  3OV7 A;  1RYR A;  1Q86 T;  3D6F B;  3ET6 B;  4RX6 A;  1X60 A;  4USJ C;  2HGN A;  3CD5 A;  2M9K A;  3P4U B;  4NRU A;  4IRK A;  1N36 F;  2AMC B;  5DZ7 A;  3IGZ B;  2V4R A;  5EGE A;  1S72 S;  1FJ7 A;  4O4G A;  2EPI A;  3ITH B;  4KV8 A;  1PBU A;  4P9S A;  2PD1 A;  4KH0 B;  2BM0 A;  1ANJ A;  1N5S A;  1DUR A;  4ELV A;  2G0C A;  5J1E B;  1G6B A;  1UL3 A;  4BWJ A;  1UVL A;  4IRD A;  2YKA A;  3M6V A;  4MK8 A;  2Z8Q A;  2C2M B;  5RUB A;  4TLR A;  3HO1 A;  1HBU B;  4O3R A;  5AXK A;  4ZLJ A;  2Z56 B;  4P10 A;  3TAR A;  1R31 A;  3D5M A;  1Q8L A;  3OXG A;  3IR7 B;  4OJ3 A;  2W24 A;  2MQM A;  3T1Y J;  4C9D A;  3WBH A;  3NWR A;  3BBC A;  5HSP A;  2OPR A;  4EU0 A;  1KBR A;  4CLW A;  2NUH A;  4X62 F;  2CQG A;  3KK1 A;  3BDE A;  3QIP B;  3D0I E;  2PT0 A;  4RW8 A;  3NKO A;  1LW0 B;  2XZT B;  3VAM A;  4F3Q A;  3ADA C;  4U6P A;  3QAT A;  2GSN A;  2F65 A;  1FO1 A;  4ED1 A;  3LAL A;  5I42 A;  4E8U A;  1L3V A;  5H9E J;  2VA3 A;  4Q7A A;  4WP9 A;  4CIO A;  4Y00 A;  3W2W A;  4HDG A;  1V5V A;  4LFA J;  1X4E A;  4UUW A;  4OL8 A;  1LEO A;  3IMQ J;  1CJU B;  3I9V 9;  1G1X A;  2QTW A;  2VFV A;  3Q2T C;  3B8H A;  4C8M A;  3I9Z A;  4LRE A;  4S0M A;  1RLC L;  5JVH Q;  5HVF A;  3R9L A;  2O1P A;  4WK1 A;  4F0H A;  3HX9 A;  3DGV A;  2PII A;  4B08 A;  4B3R J;  3UNG C;  4JI5 J;  4QAX A;  2F9J A;  4UUX A;  2YKM A;  2EFN A;  3MOJ B;  2VB6 A;  4HH0 A;  2AJ2 A;  3GG1 A;  1JLF A;  2CNK B;  1X4F A;  3RR8 A;  5HAN A;  3OFH A;  4MIB A;  3ELH A;  1X5T A;  3FEY B;  4KGK A;  3R2C J;  3OSP A;  4OZ5 A;  3C6T A;  1RT7 A;  2EWH A;  3E01 A;  2B4V A;  4ZHR A;  4RW6 B;  1A9N B;  2NXN A;  1REV B;  3AJ2 A;  3EWG A;  4HKQ A;  4DR1 F;  1JJH A;  4IH6 A;  1RWU A;  4KO0 B;  3GR1 A;  4LUB A;  4YR0 A;  2HWH A;  1FRK A;  2XMK A;  2XLJ A;  3QNW B;  4ED6 A;  4FXW A;  2FJB B;  4J9S A;  3AA9 A;  3CJS A;  3CCS S;  2DGS A;  3IM8 A;  4DU7 A;  4OYX A;  4IDK B;  2ZBQ A;  1JLG B;  2F1F A;  2BE2 A;  3K0J A;  2ZBC A;  4P2X A;  1B70 B;  1AUD A;  4WKY A;  5IT9 U;  5IOL A;  3MR6 A;  3ENV A;  2W8K A;  4JI3 F;  3EIC A;  3LUY A;  3MMB B;  1Q5V A;  5THW A;  2OPS A;  1OIA A;  2M8H A;  3IAM 9;  2WW8 A;  3KYL A;  1S6U A;  3NGU A;  3TNV A;  4EK2 A;  3TA0 A;  2MHN A;  5KFU A;  4WTY A;  2VOO A;  3MAA A;  4YB7 A;  2U2F A;  2RH6 A;  3CD6 S;  2MQL A;  2ZM6 J;  4XTT A;  1VJW A;  1B0V A;  3CSK A;  2JSX A;  1U0H B;  3UD4 P;  3I31 A;  3NKR A;  1TU0 B;  1JLE B;  4B02 A;  4MKV A;  1SH0 A;  1WEZ A;  2C3U A;  2FLP A;  1R8A A;  4NWJ A;  3THT A;  4ECQ A;  2ZDO A;  4F7V A;  2I38 A;  4QPT A;  4FYX B;  1KWM A;  5IC6 B;  3FMW A;  1I3O B;  1RI7 A;  3KWM A;  2J9C A;  3IGN A;  2EI5 A;  3TJ9 A;  2BJ1 A;  4LFC J;  2Y8Y A;  4EMD A;  1HWI A;  2JNJ A;  1H7W A;  3KJN B;  4I0W A;  3FQL A;  1BXN A;  2NZ4 A;  4YDX A;  5M2U A;  2BA9 A;  3LGM A;  3S7R A;  3DOL A;  4FZV A;  2G0I A;  1RTI A;  4ZPT R;  2PMH A;  3HK2 A;  2GAH C;  1UCN A;  1GXT A;  1CPZ A;  3C14 B;  3CJ2 A;  1QJH A;  5LMU F;  1APS A;  2YNG B;  2P5V A;  1XBW A;  2KB2 A;  2HSE B;  1JLA A;  4DU8 A;  3NGT A;  3HXM A;  4CLS A;  3P5B P;  3CCR S;  3TYT A;  4YR1 A;  4PZV A;  3M6U A;  4OZ0 A;  4NA1 A;  5DG9 A;  1RZM A;  1OSD A;  4IR9 A;  3DRR B;  2KI2 A;  1D3W A;  1VIX A;  3PW4 A;  1N34 F;  2D3Z A;  2V8D A;  1KFS A;  2HUR A;  4K4Y A;  4V1A k;  4CTA B;  1VFJ A;  3DOM B;  4PR6 A;  4DL7 A;  3TX8 A;  2CPH A;  3QZ7 A;  1F1B B;  1KKH A;  3ITH A;  2JOQ A;  5CZV A;  1I94 F;  2GIQ A;  4USU A;  3TZW A;  1GTH A;  2VQF J;  2IDE A;  1B8J A;  5C2G A;  5J1E A;  2Y1J A;  3DLG B;  3MD1 A;  5MLC V;  5LT5 A;  2F8M A;  2Q79 A;  1IJF B;  2DCU B;  4LF7 F;  1HBU A;  3NL0 A;  4ZP7 A;  2KG0 A;  2IVM A;  3HHL B;  1VQL S;  4DL5 A;  2K7J A;  4QBU A;  4KGM A;  1KP6 A;  4ED8 A;  2GAG C;  4NCA A;  5DRK A;  2HNZ B;  3PYD A;  5FDL B;  5K14 B;  5KFN A;  1GT8 A;  3QIP A;  4CO4 A;  1LFP A;  1VHF A;  2QT7 A;  3GIM A;  4LF5 F;  3OLB A;  1C0U B;  1RHQ B;  1NK4 A;  3I4P A;  4NA3 A;  2J76 E;  4ZVU B;  1CJT B;  3PJW A;  2XLK A;  3MPU B;  1S1T B;  4RBU A;  4EO6 A;  5F8M A;  3G6V A;  1B4S A;  2NZC A;  1MLA A;  2H1Y A;  3K8W A;  2AT1 B;  2B9Y A;  3IWX A;  3W63 A;  2X98 A;  4IQM A;  4JI0 F;  1FRL A;  3CC2 S;  5K8P A;  4CI0 B;  4LF9 F;  2XMJ A;  1VQN S;  1TR0 A;  1CJU A;  5KG0 A;  1DAX A;  3GJT B;  3DHX A;  1RT2 B;  2WTF A;  1MWZ A;  3V6K A;  4OX6 A;  2CZ9 A;  3ZNU A;  4CLK A;  2M4M A;  1C1B A;  4OYI A;  5A2Q U;  1LV5 A;  2D74 B;  3QRQ A;  1HA1 A;  1O99 A;  3SQO P;  1BD6 A;  5I3U B;  1NKC A;  2Y0S D;  1LFW A;  1H72 C;  2B4U A;  4M5K A;  3LP1 B;  4HDH A;  1RBL A;  3HSG A;  1KQK A;  4A8Y A;  4QJV A;  2C3P A;  4DMZ A;  2YVS A;  3MEC B;  2J9E A;  3BYR A;  1NHV A;  2Q6C A;  4RW6 A;  1REV A;  1RLD A;  4I6W A;  1XR6 A;  1IUJ A;  2ZC3 A;  2AV5 A;  3BSO A;  4KJI A;  3CPW R;  4O0N A;  1G7C B;  2DPI A;  4RZR A;  2CQD A;  5GAD U;  4DV4 J;  3IFE A;  4BHQ A;  1DAR A;  3D68 A;  2DY1 A;  3VGU A;  3VR1 A;  4K4Z A;  5CYM B;  4LFB J;  3EZU A;  1NDP A;  2GS8 A;  4NLD A;  3P45 B;  3FKB A;  1TL4 A;  2DGQ A;  2HQC A;  3RRH A;  1IR0 A;  1WC1 A;  3T1Y F;  5F8I A;  3D6H B;  4MTP A;  2ZHA A;  2GLQ A;  4IDK A;  5M2P A;  1JLG A;  1VR6 A;  4JBC A;  3BGL A;  3G96 A;  5A8K A;  1CLF A;  4L72 B;  4HR2 A;  5EGH A;  2H4Y B;  3M8S A;  3GWC A;  1IVZ A;  3J81 Y;  2JFK A;  3PW7 A;  1FE4 A;  2UUA J;  3FFI B;  3BGO P;  2R2U A;  3TZY A;  1ED9 A;  3NOG A;  4KR0 B;  2HFN A;  4FP9 A;  3AAW B;  1UVK A;  1FNO A;  2I8E A;  2DPJ A;  1AJB A;  2ZNZ A;  4F67 A;  4GTW A;  4PG7 A;  2A6O A;  4KHM A;  1IKV B;  4H54 A;  4LQY A;  3ZTP A;  2W2O P;  1XMB A;  3N5F A;  1HIY A;  2O3D A;  4LBH A;  5J1P A;  4FBU A;  3DLE B;  5AXM A;  4ILM A;  2FHJ A;  4LFA F;  1H6K X;  4QIG A;  5HMY A;  2ABY A;  3SBM A;  1K8A T;  2YX1 A;  2WVB A;  2NXC A;  4KPC A;  3Q8Y A;  2RDI A;  3CCW A;  1ULR A;  1U0H A;  1YZ7 A;  3FCH A;  1X5S A;  1UEV A;  1JLE A;  4GC7 A;  3VAI A;  3L4B C;  1S1X A;  1RA6 A;  2VV5 A;  3DFE A;  5EWE A;  2PGC A;  1N4L A;  2FPH X;  3GP9 A;  3IRX B;  2ZWP A;  2J8S A;  2HWI A;  4B3R F;  4F4Z A;  1HNI A;  1RTJ A;  2XMV A;  3E8O A;  4JI5 F;  3OTE A;  2E1M C;  3SIP B;  3CGI A;  2FB0 A;  4USH A;  1N6Q B;  1UEU A;  3W60 A;  1UPM B;  2DNO A;  2HS4 A;  1VGY A;  2COL A;  1E6Y B;  2W2N P;  1NSQ A;  1RAC B;  5L1I A;  1YZ6 A;  2HGL A;  1T3O A;  1YTY A;  3C14 A;  1WD6 A;  2DNL A;  2YNG A;  5H9E K;  2Z2Y B;  2FD2 A;  3SI8 A;  2ATL A;  2B9X A;  3R1H A;  4PG5 A;  3FQK A;  3TX0 A;  3OVA A;  1QD1 A;  3NGS A;  4I69 A;  3DRR A;  4UPH A;  1TVR B;  4CXK A;  4DSF A;  2CQ2 A;  3G4S S;  3I0S B;  3G71 S;  1YQH A;  2ZH1 A;  3FRZ A;  4K4W A;  4CTA A;  4FYW B;  4OZJ A;  2DGT A;  3DOM A;  2QMW A;  5C24 B;  5CYJ A;  4M5D B;  4NWX A;  2IA6 A;  4WFA Q;  2CZ4 A;  2BV3 A;  3A3P B;  5C2C A;  1KLN A;  1AUS L;  4C0O C;  2W9B B;  1Q82 T;  4OX9 J;  4J90 A;  2HHH J;  1F5B A;  2LEA A;  5KG5 A;  4W90 B;  4DV2 J;  1SV5 A;  1PYS B;  2CJK A;  3VHQ A;  4WP8 A;  3T5L A;  3ZZU A;  3HHL A;  4BDP A;  3PJX A;  1HPZ B;  1Y3K A;  1PAE X;  2BOA A;  4QYR A;  2HNZ A;  1RT5 B;  5FDL A;  5K14 A;  1EIY B;  4OQJ A;  4DQQ A;  3NCR A;  2ZM6 F;  3VQT A;  2GHW A;  4I68 A;  3MM9 B;  1C0U A;  3FZB A;  3EVM A;  2GSU A;  4IYQ A;  4FS1 A;  4RO0 A;  4QR0 A;  1L3T A;  1CJT A;  3U1L A;  3T3F A;  1U6B A;  2GO8 A;  4DR2 J;  2V6A A;  2KT2 A;  1L3U A;  1R3N A;  1BQN B;  3SEO A;  4CLY A;  3WC0 A;  1NAQ A;  1VLO A;  3TJ8 A;  2QYG A;  2F5G A;  2HQD A;  3QGG A;  3MMJ A;  1SJ3 P;  2JEF A;  2MKC A;  4LFC F;  3QO9 B;  4GRS A;  3M9O B;  2PMZ D;  4URQ U;  2YQ3 A;  1RT2 A;  1VK3 A;  3M2U B;  4ZK7 M;  3ZTS A;  1Q78 A;  4FS2 A;  3TA2 A;  1BUX A;  1B7F A;  1N0U A;  2E1R A;  3BGR A;  4NLG A;  4X4N A;  3C3L A;  1TL3 B;  2QX0 A;  1XEZ A;  1H74 A;  4G3I A;  4Y2A A;  3GII A;  5L1K A;  4RNF A;  1Z2Z A;  3MCM A;  1T3N A;  3H40 A;  3W5X A;  5HP1 B;  4DFP A;  1S9E B;  3KJV A;  2F4V J;  3NGR A;  5LXY A;  1N48 A;  2W4P A;  3JB9 k;  1C4A A;  3MM6 A;  4PEO A;  1TEL A;  4LBI A;  3KHG A;  1ZTW A;  2VQF F;  2DHX A;  3ILL A;  4YP3 A;  5KFZ A;  4UT4 A;  2ANH A;  4RWW A;  1SB6 A;  2E5G A;  3RAX A;  3MED B;  1H2V Z;  4U95 A;  5CYM A;  2HBY B;  3UQS A;  2VPZ B;  4ZVT B;  3P3D A;  2OFH X;  2M70 A;  2D7S A;  3LWM A;  1Y00 A;  1FJC A;  2H5E A;  4D3G A;  2RRN A;  4C8N A;  3PX0 A;  3FFI A;  1SJQ A;  2UUT A;  4HYK A;  1R27 B;  5AXN A;  4DR7 J;  2V63 A;  3KLG B;  1IKV A;  4DV5 J;  1SBR A;  1J5E J;  4LBP A;  1VRT B;  3GLJ A;  3RBX A;  1RA7 A;  3DLE A;  2CXE A;  2V8V A;  3MCN A;  1CS4 B;  1ZBT A;  2DR6 A;  4WFX A;  5ETV A;  3WHI A;  3FMB A;  3HKZ D;  1LWE B;  1EKR A;  3GR0 A;  1CEZ A;  1R8P A;  1TK5 A;  4F3O A;  5DS7 A;  4RNO A;  2CJX B;  1KEK A;  1CJV B;  2QA4 S;  2ZBI A;  2CUY A;  3G82 A;  1VRQ C;  3R7S B;  1ZM4 A;  3J80 Y;  3IRX A;  4C8Z A;  1UZD A;  2ZFH A;  3CWJ A;  1RK8 A;  2HHQ A;  1RTH B;  1AJC A;  1VDH A;  4Y34 A;  1IKW B;  2K2P A;  1N6Q A;  1RWN B;  3ILJ A;  5LRN A;  4ZVS B;  3HPO A;  1E6Y A;  3R5B A;  5ETO A;  1KQF B;  5IJS A;  4ZVH A;  2NUU G;  3ZZZ A;  2EVZ A;  3PDN A;  1RUS A;  1E33 P;  2VL1 A;  4N5S A;  2ROE A;  2L9W A;  2OP5 A;  2A1B A;  2HIQ A;  4NXN J;  2XYG B;  2CQ0 A;  3FK4 A;  3BF4 A;  2H65 B;  2B51 A;  4DV4 F;  2N7Y A;  3J7Y U;  2HRY A;  3SDE A;  3KLV A;  1Q5Y A;  1S1U B;  4LFB F;  5ETM A;  1JLB A;  4JI1 J;  2ZE2 B;  3I0S A;  3K8V A;  3TZX A;  5HVH A;  2VPY B;  4DG1 B;  4RNH A;  4M5D A;  1SKW A;  4UZB A;  1TMM A;  2CPY A;  4ZIW A;  2MZ1 A;  4TN0 A;  4ID8 A;  2AU0 A;  2ADC A;  2DNH A;  1BWE A;  4IG3 B;  4ZPD A;  4I1T A;  2UUA F;  3IAS 9;  1KHW A;  3VVT A;  4UQG A;  3SV3 A;  3VAJ A;  3NKY A;  3BRE A;  1ZS6 A;  3K17 A;  3ZZ0 A;  4KBI A;  1VQ5 S;  1VOM A;  4WXW A;  5GAH U;  4X65 J;  5LSL A;  2KZM A;  2GVD B;  3UN2 A;  4ATN A;  5IM0 A;  2HLU A;  2DR9 A;  1GAO A;  2BMB A;  4KPY A;  1PSD A;  5KFJ A;  4NLP A;  2QFJ A;  3ZZY A;  2Z4P A;  5LIA A;  1RAH B;  1CJK A;  4OHW A;  3R3T A;  3BN7 A;  4I7F B;  1EQM A;  4ECZ A;  3MI7 X;  4DZD A;  4P52 A;  3KK2 A;  3MM9 A;  3MPY A;  3FSY A;  2E29 A;  4WFZ A;  1YKW A;  1A0O B;  4K8R A;  4NLS A;  2VH7 A;  1XNQ J;  2K1R B;  2W7P A;  4UY8 T;  2Y1L B;  3SSR A;  2DRA A;  4N8N A;  3QYY A;  4CP5 A;  1KH9 A;  1TK0 A;  5EN1 A;  4F2S A;  4RNN A;  3D1O A;  1PAU B;  1LOU A;  4JV5 J;  3V4M A;  1X9W A;  1TL7 B;  5KFL A;  2C2Z B;  1GMV A;  3LW5 C;  1UFK A;  3QO9 A;  1Q0N A;  1S0N A;  4OHZ A;  4BC9 A;  2AW0 A;  4N8O A;  3M2U A;  5T41 A;  3HM9 A;  4DSE A;  2NSC A;  4I64 A;  3QJP A;  3M6X A;  1WC4 A;  2XTJ P;  5F3T A;  4FBT A;  4X4Q A;  4OYO A;  4AXI A;  4DX8 H;  2HAF A;  1U1K A;  4YFU A;  2VC1 A;  2G0J A;  1RT6 A;  4DN0 A;  1R6V A;  2UXC J;  2DH8 A;  5HAT A;  2R7V A;  1N5Y B;  4PG8 A;  3G8S A;  5E3P A;  3SCJ E;  5H9F J;  1WHY A;  2RDD A;  1TKT B;  4ED4 A;  1S9E A;  4YEA A;  3TZZ A;  3EPI A;  3M9N B;  4DFM A;  2A0F B;  1Q7L B;  2HHS A;  2F8E X;  1QAX A;  4NEZ A;  2QLF B;  4GKJ J;  1KHN A;  2DYA A;  5KAK A;  2IJF A;  3K5L A;  3H0P A;  1PYT A;  2NYI A;  3H5X A;  2V68 A;  3GV7 B;  2DY9 A;  1FK9 B;  4W98 A;  4OX9 F;  2HHH F;  4YQW A;  4DV2 F;  3QSI A;  3CMR A;  2CJA A;  1M5P C;  2M0G B;  1NEE A;  3MED A;  1BHN A;  5DET A;  3AQP A;  4GTZ A;  1U6Z A;  4CO3 A;  1NHU A;  3PV8 A;  2DD8 S;  5IC4 B;  1NSK L;  4LQ3 A;  2D3O R;  3NMR A;  2VOP A;  5AE1 A;  3AH6 A;  1RBA A;  3H5U A;  3PIO Q;  2ZHB A;  3DPC A;  3CC7 S;  4ZVO B;  4A4J A;  2J6U A;  3U27 A;  1RWX B;  2GQ2 A;  2RHQ B;  1YJ7 A;  2HGM A;  2NPI A;  4G1I A;  2XUL A;  1DTQ B;  4DR2 F;  2IYI A;  2AX0 A;  5MAO A;  4IR1 A;  3DRS B;  1GEH A;  5D0R A;  9ATC B;  2GQC A;  2VKR A;  3KK3 A;  1K1S A;  1LWE A;  2GML A;  1H38 A;  2C28 A;  1IBM J;  4LR7 A;  2X3G A;  1LK5 A;  3HD2 A;  1RXO B;  1CJV A;  3BPS P;  4J9U E;  1Y5I B;  3CJR A;  5D78 A;  1DQA A;  1YJV A;  1KH4 A;  4FYY B;  4TN2 A;  4X4T A;  2XMA A;  1H73 A;  2OML A;  4CH0 S;  1JXE A;  3PNI A;  2MZS A;  1RTH A;  2JLG A;  3CNQ P;  1PBA A;  4ANC A;  1JLC B;  1Y0H A;  4ZLL A;  1IKW A;  3EXC X;  1BY9 A;  2KVI A;  2OKQ A;  1F3V A;  3RRG A;  3T41 A;  5LQQ A;  4F02 A;  3ZO7 A;  2HQI A;  3QWU A;  2Y1I A;  3BDF A;  3N28 A;  2F4V F;  2W9C B;  1GTE A;  3DXB A;  4LVN P;  4NZ6 A;  4PXB A;  1Y4Z B;  2IRU A;  2J6S A;  1UVJ A;  4AXJ A;  4QU6 A;  3IXQ A;  2Y3Y A;  3RTV A;  1HBN B;  3DM2 B;  2FC9 A;  4FF2 A;  2GJ2 A;  4X84 A;  3M8Z A;  2OIH A;  2YH0 A;  1LK7 A;  4USI A;  4OHV A;  4NCG B;  3OVS A;  3HMJ G;  2R7T A;  2D1C A;  2F8H A;  1S1U A;  4IO9 Q;  1XMO J;  4HT7 A;  1MN7 A;  4DJB A;  2BX6 A;  3SQG B;  3Q24 A;  4M5M A;  1M5H A;  3KLI B;  2VA2 A;  5KFT A;  2VBW A;  5A0Y A;  2R7Q A;  3MMA B;  1FKA F;  2QC3 A;  3CJ8 A;  2XHC A;  2MKI A;  1NZ8 A;  2XGP A;  4IG3 A;  3RAM A;  5KFE A;  3KG4 A;  3TAN A;  2CWX A;  5BXI A;  1HHQ A;  2DHS A;  1ZM3 A;  4OI1 A;  3FDS A;  4YUD A;  1X9S A;  3IGY B;  1O5J A;  3UCU P;  5C7P A;  2L08 A;  2CJB A;  4DV5 F;  4TVA B;  2GVD A;  1N54 B;  1J5E F;  2JLF A;  4ENO A;  1RIS A;  5A8W B;  4A8O A;  1NXI A;  4FDI A;  3NCP A;  1KHK A;  2OLW A;  2CNL B;  2C2R A;  4EWT A;  1URA A;  1RHJ B;  4I7F A;  3W5Z A;  2VC0 A;  4L75 A;  1R0A A;  4GVB B;  2KT3 A;  4DV6 J;  2DGO A;  2EXU A;  2VBY A;  2ZKT A;  4RPF A;  4N76 A;  4KHP J;  4DL4 A;  2HS0 A;  3PYG A;  4L73 A;  1KSP A;  7AT1 B;  4KB7 A;  2GFF A;  1YRU A;  1RAG B;  4CM2 A;  1X4H A;  4ZJL A;  3MM8 B;  3HFV A;  4XDD A;  3NGK A;  4P72 A;  3UW1 A;  4WII A;  3ZZO A;  2FVS A;  1TL7 A;  5DQH A;  2KL8 A;  3AHP A;  2R42 A;  3TQE A;  4O3S A;  1X4D A;  5E41 A;  1V5I B;  1S4F A;  2AX1 A;  1WHX A;  2DGV A;  4ZVE A;  3BQ0 A;  3R7B B;  2RAQ A;  2B56 A;  4LIR A;  2HHW A;  3H4B A;  1S4E A;  4J9P A;  4ELT A;  4F8R A;  1UVM A;  3L9Z A;  2IAJ A;  2XC9 A;  4NXN F;  2DXF A;  3G9C A;  2OMO A;  2MZQ A;  5B09 A;  3KOA A;  1Y5L B;  4KKO B;  4DLE A;  1N5Y A;  1NK9 A;  4HLB A;  1NJX A;  3AQO A;  8AT1 B;  3AY0 A;  4JI1 F;  2FY8 A;  1SHQ A;  1WSV A;  4PWU A;  3SV4 A;  1FDA A;  2RRA A;  1EX8 A;  1T05 B;  4UZC A;  2OH2 A;  4K4V A;  4P6Q A;  2XYH B;  2I0X A;  3K89 A;  5FLX Y;  2FIU A;  4J9Q A;  1U1O A;  3NOC A;  2CNN B;  3BB5 A;  1KVK A;  1M1H A;  3LTO A;  4M8L A;  3OR2 B;  3R5J B;  2WB4 A;  2LXF A;  4KHR A;  1WF0 A;  2MQO A;  1NK8 A;  1T9W A;  1Q1K A;  3SCK E;  2UUB J;  4TU7 A;  4DCO B;  4O23 A;  1ZA2 B;  4X65 F;  3DLH A;  2KRB A;  3CO0 P;  2PN6 A;  1MNE A;  3BV8 A;  3MPV A;  3LPY A;  5B0B A;  1NO8 A;  3C16 B;  2XMW A;  2HFS A;  1KNZ A;  1VQP S;  1EET B;  1S59 A;  1FKP A;  2LLZ A;  3BYP A;  4BC7 A;  4CNZ A;  4C3K A;  4ZVQ B;  2MZR A;  1G2E A;  4XK8 C;  3CJ4 A;  3O44 A;  3CDE A;  1R6Y A;  4PXC A;  1XNQ F;  1SL0 A;  1YVF A;  1DTQ A;  3HJF A;  3DRS A;  1HBM B;  2B7C B;  5EUH A;  4NLV A;  3NY0 A;  2PMW A;  2AGO A;  4WCE Q;  5GAG I;  4JV5 F;  3BO3 A;  4UPI A;  2WBM A;  4OJ1 A;  3R2D J;  2W5T A;  2DXE A;  1PCA A;  1LKZ A;  2APO A;  5B08 A;  2XY5 A;  2YWW A;  1HQA A;  2VFR A;  2LDY A;  2WZ1 A;  5LMN J;  1JLC A;  2BJ3 A;  2UXC F;  4DBQ A;  3A3O B;  4XDC A;  5CHC B;  1Q8B A;  4LMZ A;  1WDT A;  3JQM A;  1VC5 A;  2GNK A;  3QGP A;  1S48 A;  3PHT A;  3THP A;  5HRO A;  2XWY A;  4JYA J;  3Q3Q A;  4ZP9 A;  5HQM A;  4RUA A;  3X3U A;  1XQI A;  1HBN A;  3T02 A;  4GKJ F;  2UVV A;  2N82 B;  2DNZ A;  4DFJ A;  1RE1 B;  2BJD A;  2VG5 B;  3EVW A;  1FXR A;  2BM1 A;  2PC6 A;  2ZOM A;  1SQG A;  1FKO B;  3TVY A;  1LXJ A;  1XMQ J;  1F60 B;  5D4L A;  2EFQ A;  2BRK A;  3K5M A;  4AND A;  3BSN A;  4CYU B;  1Z4U A;  2IM3 A;  2O66 A;  3SQG A;  2IFX A;  2H5J B;  5H1S V;  3V6H A;  4J9M A;  2GC8 A;  1VC0 A;  1IBC B;  2EG2 A;  3IBC B;  2AP6 A;  1S6O A;  3MMA A;  3N01 A;  1HD0 A;  1VS3 A;  2FVP A;  3HSZ A;  4ZIT A;  1RHM B;  2YNF B;  3PZP A;  1WEX A;  4BWM A;  1WHW A;  3HSD A;  4FPI A;  3UCZ P;  1ACM B;  5H9F K;  3L95 X;  3CDU A;  1LQ9 A;  3WIU A;  3OBI A;  1SQE A;  5A8W A;  1K47 A;  1WI6 A;  3PX6 A;  3KLF B;  2JVR A;  4Q2L A;  2HFZ A;  1P9Y A;  1LWC A;  5KOW A;  5HO4 A;  5T14 A;  3NRB A;  4F4W A;  3UCG A;  1EHW A;  1FSU A;  3GSD A;  3PYF A;  2HBQ B;  3HCX A;  4GVB A;  2LQ9 A;  4CO2 A;  1T9T A;  5GMK a;  1KOH A;  2R7S A;  3A12 A;  1CC8 A;  4RW7 A;  4ICL B;  1YLX A;  4P7T A;  5IT0 A;  1N8R T;  1PJ6 A;  1OY9 A;  1NME B;  5IS2 A;  3W61 A;  3MM8 A;  1HMV B;  4MAK A;  1EAR A;  4LSL B;  3DLK B;  3ULH A;  4XIU A;  5A8R A;  1IWA A;  3M6W A;  4FF3 A;  1E6V B;  3AFG A;  4QOT A;  2NCK L;  2ERR A;  2ZC4 A;  4J9L A;  3QT8 A;  5U47 A;  3ZXW A;  4NMX A;  5IWA J;  4AE5 A;  3NS5 A;  2W2P P;  2KTQ A;  3ZZP A;  2HBZ B;  1WSR A;  3R1L A;  4RR5 A;  2G9O A;  1AW0 A;  4KKO A;  2LEC A;  3ZNJ 1;  5BR8 J;  3NS7 B;  2XGQ A;  1DTT B;  5HQ8 A;  2UV8 A;  4CYR A;  2ASL A;  3GV8 B;  1YGY A;  1J27 A;  2CFX A;  4C48 A;  1XMO F;  2MTL A;  3EGV A;  1T05 A;  3AJ1 A;  3DYC A;  2VOD A;  1CQN A;  1KVI A;  3F56 A;  5F8N A;  1WG1 A;  2CKW A;  2XS7 A;  1LW2 B;  1VLY A;  1VQO S;  2M52 A;  4WZM A;  2GJF A;  3OR2 A;  2ALZ A;  3HT0 A;  5E2Q A;  4X64 J;  4X2B A;  4MY4 A;  4NYO A;  4IUF A;  2G2Z A;  3TAM B;  1S77 D;  1NJI T;  1VMB A;  3TR5 A;  3V5R A;  3V81 A;  2GGP B;  2VG7 B;  1EW8 A;  1KTQ A;  3VAH A;  4KH1 B;  1NB7 A;  4KTQ A;  3NLC A;  5GAE U;  4D3H A;  3MOZ A;  1T9U A;  4ECT A;  4RBT A;  3C16 A;  2RML A;  1KOO A;  3LA0 A;  1GMW A;  2UUC J;  1N5Q A;  5HLF B;  1B7Y B;  2CG4 A;  3JYT B;  1HL6 A;  4J5O A;  1L5U A;  2FC8 A;  4U7U D;  5BJR A;  3M32 A;  2BDP A;  4DV6 F;  2EC0 A;  4ED5 A;  5JJB A;  4KHP F;  4EYH B;  4NZ0 A;  2V34 A;  3GIR A;  1NSA A;  3FBE A;  4YME A;  5KFH A;  3L3C A;  5HMX A;  1HBM A;  3H20 A;  4JI2 J;  3BDG A;  1KQG B;  3O5T B;  4Q45 A;  3JSB A;  2JEG A;  2XLI A;  5GMD A;  2GA7 A;  2HND B;  4F4A A;  3TEH B;  3HHK A;  1M5O C;  1K0V A;  2F7V A;  2DJW A;  4E98 A;  3K5O A;  2PI5 A;  4ZS6 A;  5J2M A;  4X66 J;  2ZH8 A;  3MDF A;  1P49 A;  1ELO A;  4HT5 A;  3CJT A;  1IKX B;  4FDF A;  2MKS A;  2L48 A;  1HHS A;  3N79 A;  1RCX B;  1N88 A;  3RW6 A;  4TYB A;  1AUK A;  5B0A A;  1X4C A;  3G8Q A;  4Y3C A;  2B9E A;  2RUS A;  3GMG A;  1ZM9 A;  3V4I B;  2VBZ A;  2EFV A;  5LSR A;  3RAQ A;  2VF3 A;  4DR6 J;  4DL0 C;  4BBY A;  3SYZ A;  1X4A A;  5EGY A;  3AA8 A;  1JMT A;  1SQF A;  4WTO B;  3EGZ A;  1YIT S;  1QTM A;  4RJV A;  3PKM A;  3M8Q B;  1FVS A;  3IR6 B;  4K5R A;  4DQR A;  1N2K A;  1T95 A;  3QJJ A;  2UP1 A;  3B78 A;  5D4N A;  2VG5 A;  4K59 A;  3EZO A;  1E3C P;  3QAU A;  3MUM P;  3POT A;  5KFX A;  2GX8 A;  1OJ4 A;  2I9S A;  3N0V A;  4ES3 A;  1FHT A;  2PEB A;  4ETX A;  3OW2 R;  2C3M A;  4U9R A;  2Z2M A;  4NI2 B;  2E1P A;  1XN9 A;  1IBL J;  1NDL A;  2L9N A;  1S7I A;  4HH1 A;  4CYU A;  5LM7 E;  4QWD A;  3OUY B;  4P73 A;  2BQ3 A;  3K5P A;  5E0O A;  1JKH B;  4M95 A;  2ZH9 A;  4JI8 J;  2YNF A;  2BEF A;  3D1H A;  3V6D A;  4USK A;  2LYV A;  3LF0 A;  4KM4 A;  2LVW A;  3EGW B;  2R7W A;  4ZCM A;  4RBV A;  3R5A A;  3UN5 A;  1KDN A;  1S1V B;  4WIQ A;  1TTH B;  3G86 A;  1JJ4 A;  4KT0 C;  4ZJQ A;  4DPX A;  3PEJ A;  3D2W A;  1S0M A;  3KLF A;  7FDR A;  2WVD A;  3U7J A;  2LEP A;  2V69 A;  4EUV A;  3M30 B;  2XSJ B;  5KT2 A;  1NJZ A;  4Y2M A;  5DGA A;  2GHV C;  1HW9 A;  2IYG A;  3PRB A;  2MEW A;  4NA2 A;  3JSM B;  3ENQ A;  3EXY A;  1MMD A;  1N5V A;  3OL9 A;  4ICL A;  1C0T B;  3D67 A;  4LRF A;  1HMV A;  3H7H B;  4Q8F A;  2XCA A;  2HHX A;  3OL7 A;  4LSL A;  1SPB P;  2QLJ B;  3DLK A;  4K4T A;  1D9F A;  3BBB A;  4HHU A;  2JLE A;  5KFI A;  3CCJ S;  1AFJ A;  3FBB A;  4MHX A;  5D4P A;  4M63 A;  1S10 A;  4A8W A;  1UA0 A;  2BOP A;  3MM5 A;  3C8Y A;  3TVK A;  4OX7 A;  4DV1 J;  1QE1 B;  4JYA F;  2VON A;  4CNY A;  2B8Q A;  2BW2 A;  4IFY B;  1L3S A;  1IWG A;  2GIR A;  2UVU A;  4MKY A;  2AYM A;  2J0S D;  5G0R B;  2UXD F;  2X1A A;  2EW9 A;  3W3S A;  2QO3 A;  2HMI A;  3FBC A;  1IQT A;  2G1D A;  1DTT A;  3AD7 C;  1SKR A;  3GG0 A;  2QL7 B;  1N32 J;  4A8X A;  1XMQ F;  5E7O B;  1B64 A;  2OTL S;  5FD1 A;  2IC3 B;  2IBK A;  3IRW P;  4FF1 A;  2QA2 A;  1QTN B;  4QIV A;  5FJ4 A;  3FCW A;  4OV1 A;  3CXC R;  2CDR B;  4MYT A;  3NXZ A;  4WBF A;  4K50 A;  2EFP A;  2MZJ A;  2FJE B;  4LVO P;  4OYP A;  3CCQ S;  2UZA A;  4L3K A;  1AB8 A;  3N6N A;  4F36 A;  1HD1 A;  3TAM A;  3UVJ B;  2GGP A;  2KZZ A;  3JTP A;  1SHN A;  5CAA A;  1HNV B;  2VG7 A;  2IHR 1;  4WYL A;  3LAM A;  2YXL A;  4QW8 A;  3ZFV A;  1U26 A;  3DC2 A;  3C19 A;  4IKA A;  1BQM B;  3L7P A;  3GE9 A;  3DI6 B;  2JX2 A;  2C3O A;  1MN9 A;  2HNY B;  1IKY A;  5HLF A;  2ZZM A;  1XJW B;  3IO1 A;  3CIZ A;  2WVE A;  1UP1 A;  3M1V B;  1FDB A;  2K3K A;  3MAQ A;  1DLO A;  3TUI C;  1Z1Z A;  2IMO A;  1SUQ B;  2FLL A;  6AT1 B;  2HKE A;  1Y5N B;  3DLJ A;  4NX9 A;  2OEJ A;  2ROP A;  3EVO A;  5C42 B;  1URR A;  3EDQ B;  1D9D A;  4ZCL A;  4BCA A;  3PIP Q;  1FJG J;  2HND A;  1YI2 S;  2LDI A;  4H4O B;  3BS9 A;  3MMC A;  2KG1 A;  2VG6 B;  3MCO A;  3EZ5 A;  4PRF A;  4CYS A;  3OHA A;  1W2I A;  2DTJ A;  1OS5 A;  1RGV A;  2X1G A;  1HWJ A;  3K7R A;  3MEG B;  1IKX A;  3W2V B;  1IN0 A;  5IWA F;  4IG0 B;  4F50 A;  2XRG A;  5B0G A;  1HJK A;  3A1Y G;  1O8B A;  5C25 B;  3QAE A;  4CDI A;  5EHH A;  3UR3 C;  3TEG A;  3I56 S;  2HZA A;  5BR8 F;  1Y9O A;  3FC9 A;  4OMF G;  1GX6 A;  1Q4R A;  2MKJ A;  3IGV A;  2BKP A;  2VQR A;  4ES2 A;  4OHY A;  1RAE B;  1GXL A;  3CCT A;  1VQ4 S;  5ETS A;  2C2K B;  2H48 B;  4Q2M A;  2AYE A;  2QL9 B;  4C8L A;  1BMQ B;  3AD8 C;  4G1Q B;  3MK1 A;  5CZX A;  4U7U K;  1SJR A;  1TV6 A;  3M8Q A;  3UN3 A;  3OFG A;  5HVG A;  2QLX A;  2CPE A;  1RWM B;  4XO0 A;  2W5V A;  4UQT A;  4X64 F;  4GTX A;  4B9S A;  4NLW A;  1IR1 A;  2D9P A;  4PXE A;  4TQR A;  4OYA A;  3EPG A;  1OQ6 A;  1ALH A;  2HVD A;  4NI2 A;  4DCJ B;  1HWL A;  2ZHO A;  2ZZT A;  4NLT A;  1HQU A;  1WC5 A;  4M5J A;  5K9F A;  3OUY A;  4HHH A;  4ED2 A;  2UU9 J;  2HS3 A;  4NLY A;  2W7A A;  3BGU A;  2DK2 A;  2FDN A;  2FLO A;  2QA1 A;  5KFA A;  2DNG A;  1G3O A;  3WX4 A;  5L0E A;  1TL1 B;  2UUC F;  4ID5 B;  2X7I A;  2IJR A;  4DZ6 A;  4IFV B;  2VIH A;  5EWG A;  2HZC A;  2V50 A;  2J9D A;  3SXL A;  2HFU A;  4YR2 A;  2YWE A;  3OXF A;  2GHP A;  4OI6 A;  2G1H A;  3A4T A;  5J1N A;  1YWX A;  4JI2 F;  3JTO A;  1XR5 A;  3KFW X;  1U09 A;  2R2R A;  3M30 A;  2I2Y A;  2QSF A;  3HUL A;  2WON B;  1E2S P;  3T5J A;  2OO4 A;  2B6A B;  4QWB A;  1R7I A;  3I6P A;  3T00 A;  4P71 A;  3P49 B;  3SMZ A;  3GTY X;  4ZCK A;  4IH5 A;  1W26 A;  4P74 A;  4X66 F;  1TP7 A;  2KRR A;  3JSM A;  3H2U B;  1C0T A;  2J9D E;  3MUR P;  3BDH A;  4NLQ A;  2L41 A;  3BM7 A;  1MRO A;  4C0B A;  4DV3 J;  2XMT A;  1BGX T;  3PEH A;  2FQQ B;  1R0B G;  1D8Z A;  2JJ4 D; 
#chains in the Genus database with same CATH homology
 4UPK A;  4UPH A;  4MY4 A;  4UOP A;  4KAY A;  1P49 A;  1ZEB A;  5HRT A;  1KH9 A;  2RH6 A;  4CXK A;  4N7T A;  5KXA A;  3IDD A;  2GSN A;  2GSO A;  1EQJ A;  4MIV A;  1SHN A;  2W8D A;  4UOO A;  5L0E A;  2XRG A;  3BDG B;  2G9Y A;  3NKN A;  1KH7 A;  1K7H A;  2W5S A;  1KH4 A;  3MK2 A;  4MHX A;  1HJK A;  1EI6 A;  2IUC A;  1HQA A;  1ELY A;  3CMR A;  1EW8 A;  5C66 A;  4B56 A;  2ANH A;  1KHL A;  4NWX A;  2IUC B;  1EW9 A;  2X98 A;  3NKR A;  5DLT A;  3IGZ B;  3M8Y A;  5TJ3 A;  5EGE A;  4UPL A;  4CXS A;  3ED4 A;  5LRM A;  4TN0 A;  3TG0 A;  1AUK A;  4GTZ A;  4KM4 A;  3B5Q A;  3WAY A;  3A52 A;  4ZG6 A;  2VQR A;  1N2L A;  1AJC A;  1ANI A;  4LRC A;  4KJD A;  3UN5 A;  1ELX A;  1KHJ A;  1B8J A;  4CXU A;  4FDJ A;  1Y6V A;  1KH5 A;  3TWZ A;  3IGY B;  1ANJ A;  5LQQ A;  4NWJ A;  5LRN A;  2XR9 A;  2W5W A;  3NKP A;  3SZZ A;  2GLQ A;  1ZED A;  5INH A;  3WAX A;  3E2D A;  3BDF A;  5K4P A;  4ZG9 A;  1EJJ A;  4LRE A;  4LRA A;  1HDH A;  3UN2 A;  2D1G A;  3DPC A;  3SZY A;  4UOR A;  3MK1 A;  1E2S P;  3WAW A;  1Y7A A;  3MK0 A;  4LRD A;  3KD8 A;  4FDI A;  5EGH A;  3UN3 A;  3NKQ A;  2W5X A;  3Q3Q A;  5IJS A;  1KHK A;  4ZGA A;  1ELZ A;  4GTY A;  3T00 A;  1O99 A;  4CYR A;  2W5V A;  1URA A;  3T02 A;  2W8S A;  1E33 P;  1ED9 A;  1N2K A;  1AJD A;  5LIA A;  1O98 A;  3UNY A;  1ALJ A;  4GTX A;  3T01 A;  1EW2 A;  4QAX A;  1FSU A;  4KJG A;  4ZG7 A;  1ALK A;  4LR8 A;  5DLV A;  3M8W A;  1AJB A;  1E3C P;  1SHQ A;  3NKM A;  4KAV A;  4LR9 A;  4LR2 A;  1E1Z P;  1ED8 A;  3WBH A;  4GTW A;  3WAV A;  5L0K A;  5AJ9 A;  3BDG A;  5GRR A;  3LXQ A;  3M8Z A;  3DYC A;  2W5Q A;  4LQY A;  1ALH A;  5GOV A;  1ZEF A;  4UPI A;  3OT9 A;  5L0B A;  2ZKT A;  1ALI A;  4LRB A;  3BDH A;  2IFY A;  2GA3 A;  4LRF A;  5IJQ A;  3NVL A;  3NKO A;  3TX0 A;  2GSU A;  3M7V A;  4YR1 A;  3UO0 A;  1AJA A;  2QZU A;  4CYS A;  1URB A;  2W5R A;  5DLW A;  4LR7 A;  2W5T A;  1KHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...